1M1GA

Crystal structure of aquifex aeolicus n-utilization substance g (nusg), space group p2(1)
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
240
structure length
240
Chain Sequence
b'LEKKWYALQVEPGKENEAKENLLKVLELEGLKDLVDEVIVPAEEKVVIRAQGKEKYRLSLKGNARDISVLGKKGVTTFRIENGEVKVVESVEGDTCVNAPPISKPGQKITCKENKTEAKIVLDNKIFPGYILIKAHMNDKLLMAIEKTPHVFRPVMVGGKPVPLKEEEVQNILNQIKRGVKPSKVEFEKGDQVRVIEGPFMNFTGTVEEVHPEKRKLTVMISIFGRMTPVELDFDQVEKI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcription antitermination protein nusG
publication title Crystal structures of transcription factor NusG in light of its nucleic acid- and protein-binding activities
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Transcription
total genus 46
structure length 240
sequence length 240
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2002-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00467 KOW KOW motif
A PF02357 NusG Transcription termination factor nusG
A PF07009 NusG_II NusG domain II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1m1gA03
2.60.320.10 Mainly Beta Sandwich mini-chromosome maintenance (MCM) complex, domain 2 N-utilization substance G protein NusG, insert domain 1m1gA02
3.30.70.940 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits NusG, N-terminal domain 1m1gA01
1N8RC 3CCUA 1VQMA 5IT9E 3DB4A 1Q81U 3J80E 1YHQT 3CMET 2L3RA 4CRIA 3H7HB 3CCST 1M1KU 4ZN3A 2EXUA 1VQOA 3TREA 3CCMT 3CD6A 3CPFA 3CCET 3I56T 3CMAA 1YITA 1JJ2S 3CC7T 1Q81C 1YI2T 1YJWA 1YJ9A 3CC4A 3J7AF 3I55A 1VQ8A 1M1KC 3OW2S 5IAYA 2OTLA 1VQPA 3CCLA 2OUGA 1VQKT 1VQLA 2JOYA 3CPWA 2LQ8A 1VQ4T 1KC8U 1VQ7T 2LVMA 1NJIU 2JVVA 1YHQA 2DO3A 2EIFA 2KVQG 1JJ2A 3G6ET 3G71A 1KD1U 3CCJA 3JAME 3OW2A 3CC2T 3CPWS 1KC8C 1VQ5T 1VQ9A 2QEXA 1NPPA 1NJIC 4RG2A 2JUFA 1VQNA 1Q7YU 1YIJT 1K73U 1YBYA 1UEBA 1S72A 1KD1C 1VQ6A 3CCQT 1Q86U 1YJNT 1K9MU 5J26A 3J81E 3G4SA 3OYYA 1VQKA 2K06A 2QA4A 3CCVT 3HKSA 1Q7YC 1QVFS 5DLQE 4ZN1A 3DLLA 1K73C 3EWGA 1Q82U 3CCUT 1Q86C 2MWPA 3KBGA 3CMEA 1K9MC 1QVGS 3CCSA 5FLXE 1BKBA 3CC2A 3DB3A 2G3RA 1X6OA 3CCMA 3CXCS 4OBIA 2IG0A 3CCEA 1YIJA 3LGFA 3I56A 1M90U 1NPRA 1RL2A 2E70A 2MI6A 3CC7A 3CCRT 1YI2A 1YITT 1W2BS 3A5ZB 3CMAT 2MWOA 1QVFA 1YJWT 3QQCD 3CC4T 1YJ9T 3I55T 1VQ8T 4ESNA 3P8BB 2OTJT 2XHCA 3CCVA 1QVGA 1VQPT 3CCLT 1XTDA 1VQLT 1NZ8A 1M90C 2LCLA 1VQ4A 1KQSS 1VQ7A 3PIOA 3CXCA 5J3BA 1SSFA 1W2BA 3G6EA 1NZ9A 3LH0A 2JNGA 1VQMT 3G71T 5DM7R 3CCJT 2CKKA 1IZ6A 3LGLA 4QQDA 1XNIA 1K8AU 1VQ5A 1M1HA 1VQ9T 3CCRA 1VQOT 2QEXT 1VQNT 3CD6T 5HY6A 3LPEA 3LD7A 2E6ZA 1KHIA 1Q82C 1KQSA 1N8RU 5LL6S 3ER0A 4X34A 1S72T 2OTJA 3CCQA 1YJNA 1M1GA 2KPPA 1VQ6T 1K8AC 3G4ST 4YTLA 2KDSA 5A2QE 4TVRA 2OTLT 1EIFA 2QA4T 3PIPA
chains in the Genus database with same CATH superfamily
3ETOA 2HQGA 4MH8A 4NEZA 4MYUA 1U6FA 3SSSA 2XMFA 4JZ3A 2EKOA 3GJSB 4DR7F 1YBTA 2NUHA 3TVKA 3C0CA 3EGUA 5D6XA 3UA7A 1WG5A 3EJMA 4DV0J 2EQIA 2ZH8A 4LDXA 4RU9A 2WONB 4IH5A 4ES3A 4PUOB 2ASDA 3TVZA 4AQYF 5HK3A 2IJNA 1QTMA 1JJ2A 3MAQA 4OZ5A 3HCXA 2C3OA 4F14A 3C6TA 4DUYF 2LQKA 1RI0A 2NPFA 2CKWA 2WONA 2PFFB 4RW7B 4YB7A 3FLGA 4H4OA 4ECUA 4RW4B 3KWMA 2M5YA 1X9SA 2VBYA 4O6JA 4DPTA 2F40A 3X1LB 1YJUA 3TYTA 4CM2A 1BYMA 2GFFA 3LGNA 3CCVQ 1I3OB 3DRPB 3PEHA 3A3NB 3DGPB 2CWKA 1VQ7S 1F5CA 3EG2A 2CH4A 4PQUA 2G1DA 1FJEB 1XC9A 2C2ZB 4WKRA 4XPCA 3ZZPA 2R58A 2WRMA 4AE5A 2NUZA 5ETTA 2P8IA 4EGLA 3PW5A 2RSQA 2RO0A 5KG2A 1VBZA 1T9XA 3R6OA 1JQQA 1XK8A 3E8OA 2VFSA 3NY0A 1BHNA 4ZP7A 2XNRA 3UWNA 4EMKC 1NKCA 1RAHB 1MMAA 2KDSA 3K5MA 3BGRB 2Z4PA 1RWOB 1SKSA 2L3RA 1B99A 2DYAA 3MPDA 1WTBA 2X4YA 4WFYA 1XNQJ 2NYHA 3BGRA 3EXYA 1OYDA 3CC7T 2ZJQQ 5CQXA 1VQ8A 1WSVA 1SKWA 1H98A 3FMBA 3TJAA 3NMAA 2ZWOA 2QQAA 2LLZA 1KC8U 3W1YC 1WI8A 3OS5A 1AROP 3BB5A 4C92G 4CQ1A 3BR8A 3QYYA 3F56A 5F8LA 6AT1B 1NSPA 1CC7A 2D9PA 3C3LA 2E12A 2IYGA 1VQSA 3MAAA 4U95A 2G13A 3CBMA 3OYYA 3ZZZA 3MP8A 1S1XA 2Z0GA 2I5JB 1WTFA 3AHPA 3EX7B 4JI7F 2FZCB 4ZVSB 1EZZB 1J5OB 1UFKA 4M5DB 4Y2KA 3HL8A 1TL7B 4WF2A 3W61A 3A3PB 2L9WA 1SJ3P 2DERA 3CC2S 1J5OA 2KYXA 1ZPWX 1XERA 1TL7A 1MMGA 1IWAA 1U1MA 3EG0A 1YRUA 1G3OA 4ED6A 3L2ZA 4FL6A 3K5PA 3RG6A 3HVWA 1R8AA 4CH0S 3PKYA 1VIFA 3Q1JA 2A36A 1WORA 1ZOTA 1VQYA 5HKCA 1WHVA 1HHSA 5FLXU 4IR1A 1JWWA 4ELYC 4DUTA 5IHIA 2MIOA 3BPDA 2H5IB 2GVZB 2DXEA 3EUNA 2FJBB 3I4PA 3W2WA 3AJ2A 1OS5A 1OYEA 2G0IA 1QVPA 1ZBTA 2OTLA 2C22A 1NEGA 1VQLA 3PO4A 5HANA 3H0FA 4OMFG 1IQTA 2C3YA 3FDRA 1DFDA 3PXGa 4GO5X 4OYWA 3ZZYA 5T41A 2AEFA 4QIEA 4CLZA 2Q3PA 2VFVA 3NGUA 3L7UA 4KFBB 1ZM2A 1T95A 4TQRA 5CKDA 4DL7A 5F9LA 4GBQA 1Q86U 1U8WA 3RB6A 1FTCA 3DLKA 3N0VA 5I42B 4JLIA 4ELVA 2V5HG 4TU8A 3OW2P 1H38A 3M32B 3QT5A 2GIQA 1RLDA 1X5TA 2ASYA 5I42A 1KR4A 1U2RA 2PIIA 3BGLA 4C92D 3M32A 1K9AA 2D1XA 3R97A 4WBFA 2DNUA 1GXIE 2V68A 1W2BA 1KP6A 1T9YA 2MTLA 2V67A 4IFVB 3QWPA 5GMKi 4F3QA 1XNIA 5CKHA 1GMUA 4ID5B 3KFVA 4YR0A 2XKOC 2OTJA 1HNVB 4IFVA 1EARA 2IMOA 4AXJA 2ZH7A 3GIRA 4Y91A 3H9NA 4ID5A 2OTJQ 2GF7A 4A48A 1VQPQ 1GMWD 5GAMd 1S76D 2A28A 1XMBA 3C12A 1EETB 4OX9J 2FHKA 4NCGB 2GW8A 1UFWA 2QC3A 4R8UA 2FVPA 2XSFA 2RNAA 1YZ6A 4X66J 3KUGA 3HHEA 1KHVA 2F5GA 3MM7B 1H2TZ 5EGYA 5A0YB 1B0TA 3R7NB 2ECZA 4HDHA 4OZJA 1WNLA 2YWFA 1HR0F 2DNPA 3HHLB 1Y3JA 5DY9A 4M8LA 1Q7YU 2EFGA 4R0JA 5F3ZA 1C2PA 2BKNA 5A0YA 4EI2A 4I2PB 3I56Q 3ASKA 3PW2A 4B3RF 1QQJA 3HHLA 4ZPAA 3CC7S 2E5HA 3OFFA 1WHKA 3DRRB 4FT2A 4KRTA 3JB9I 4CTAA 2KXCA 1FJCA 5GAOp 3UW1A 2F9DA 1O51A 2GGPA 4ZITA 4NL2A 2CPEA 3DRRA 3TARA 5FU6B 2VYTA 4HHHA 3T5LA 2IDLA 5B0AA 4CNZA 3QPIA 3UF4A 4KY3A 3PT9A 2MZTA 5CHCB 4HVVA 4RWWA 4RG8A 2DXCA 3EMTA 2MZQA 3UCGA 2C2RA 4JP8A 5H9EJ 2KT3A 3M6XA 3J81U 2L9NA 3KG4A 3V6KA 1M5VC 2F63A 2FHOB 1QVGP 2LXIA 2HQEA 2ZAEA 1B0VA 3OTEA 2K3BA 2ZC3A 3RNJA 3VKIA 2E44A 1M3BA 2EWHA 3H7HB 1M8VA 1LXNA 3LW5E 4KIAA 1JEGA 5C42B 1ZA1B 1L3KA 3Q23A 1DAXA 4YN3B 1XTZA 3CXCR 4QPXA 4C0GA 1KKHA 2AQ4A 3OQ2A 1NEEA 5C42A 4OMOA 3DFEA 3JQJA 2KZZA 1LOUA 1OX9A 2XQCA 3S1TA 1G3SA 4C0ZA 1RKIA 2HVDA 3KLVA 3OYNA 3CEYA 3HSJA 4ZVTB 2OEKA 3OHBA 4C0DB 1S1WA 4DU7A 3TJ8A 3H8YA 3NMZC 1JJ4A 4Q0BB 2OD4A 5IS2A 4JOUA 3CMEA 1M2VB 2PI5A 3M55A 1KBRA 4I64A 4W4MA 3BQ2A 5GAMj 2RE1A 2V8PA 3LGFA 3ILJA 1SH0A 3R1HA 3JXOA 2PUOB 4LF9F 2UVUA 1M2VA 4X4TA 2HD0A 3BH6B 3SDZA 1FD2A 4J9QA 1MMNA 1S7IA 1WGSA 4CLPA 4B3OB 5J2NB 4RLEA 3MD3A 1C1AA 5DZ6A 4ZP8A 4JI0F 4PG7A 5LMNJ 3ER0A 5KAKA 4CDIA 3JB9k 4C8QB 3CJ8A 4B3OA 2RHIA 1FNXH 2OTLT 1NB7A 4GKJF 1TUGB 2DEQA 1IXDA 2AYBA 1RB0A 2YKNA 1ZA2B 1RK8A 2HS3A 1XMOF 2BOPA 2RJZA 4JI6F 2AYGA 5DDPC 2CNLB 2B7BB 4ZGDB 3DOKB 3VS4A 1UFLA 2ERRA 3HSGA 3K59A 3T41A 4FW1A 3DOKA 4NLQA 4E98A 1BIAA 3HKZD 2YWEA 1N32F 3QBCA 4HT9A 1X27A 4YS2A 4F02A 2V26A 1LPLA 1JLQB 4OV1A 2E9TA 2W9CB 1T0TV 3CCVS 2Y0BB 4Z7CA 2HHUA 2G3RA 4QCLA 2CPHA 1FRXA 2X1FA 3J80Y 3ISND 2SEMA 3HSBA 2GX8A 1VK8A 2OTJT 1HBUB 2HSPA 1VQPT 4CLLA 4WZMA 2VQFF 2YX7A 4YY3F 3OYHA 1IBLF 1HBUA 1VBKA 3R5JB 4DR4J 4M77E 1N8RR 4BS2A 1OPKA 2R7SA 3PTAA 1J5EF 4MMKA 2ZBCA 5M2PA 5HP1B 3NPFA 1WLPB 2HFSA 4BLGA 2B5JB 2VUGA 5FWCA 4JV2A 4WU2A 4M75B 3PYDA 2BTTA 4P73A 2IPOB 4D8KA 2CS7A 2P0PA 1N88A 4ANJA 4M7DC 2WSEC 4CRIA 3WQPA 4XTXA 3G2XA 5LT5A 3WC2A 2UXDJ 2RU9A 3D5MA 3I56T 3OVBA 4ZHRA 4FXWA 4LREA 4J9UE 2IVYA 2PEHA 3TVTA 3ULHA 1P1LA 2QQ9A 3GV7B 1AXQA 4ED1A 3LWIA 1RAFB 3EH2A 4ZA1A 2XLIA 3MCOA 4DMZA 2RJEA 4EMDA 2CJAA 1N5SA 1PO6A 3FDSA 4OX6A 5LJ5f 2J9DE 2ABLA 4XTTA 1S6QB 3G8SA 3T1HJ 1NK9A 1U3OA 4JI1F 5A8WB 1VLOA 4ZJLA 1MG7A 4MMLA 2XULA 1QCOA 1OYXA 3NCRA 3UN3A 2J05A 3OLBA 1R8HA 4F7UF 1WACA 3H4DA 5KFCA 3EM1A 3U1NA 1RTHB 3CJ5A 5A8WA 4XTVA 2MZ1A 5ETVA 2BANB 3ZNUA 2F2VA 1IBCB 5T7LA 5HSPA 2BJ9A 2Z8QA 3PEJA 5SUHA 3J7AN 4ITSA 5KTQA 3RERA 1I51B 4WFAQ 1KQSA 2B3TB 3MP6A 2KGTA 3CCQA 1TK0A 3J7YI 1ZAVA 1HW8A 3Q8QB 4ZS6A 2J6OA 3CCUA 4LD6A 4XU1A 3VHQA 1A6LA 4YB1P 4DBHA 3EYZA 3DI6B 1JLFB 1YJWA 5ETKA 2KFZA 2IJRA 1FJ7A 3EDRB 4K0KJ 1HI8A 1AW0A 3OTDA 2QDLA 3PY8A 1MWZA 1VQKQ 1LW0A 2JLEA 4JYAF 5HVGA 3C6UB 1APSA 3PM9A 3L09A 4ZNXA 1L5UA 5IT9Y 2V8KA 2EFNA 1X7VA 3C6UA 4M78E 2E41A 5HL7Q 3MHXA 4TKTA 2F4VF 2H8HA 2N7YA 3UQSA 1KJWA 2HAIA 1K44A 2XZWA 4RTYA 5KFUA 4WF9Q 3MUVP 4RUHA 1YZ7A 1VBXA 2W01A 3TUIC 2AEMA 1TAUA 2OO4A 5ETMA 2Q6CA 4M77D 4UOHA 4KRWA 3DNCA 5HJXA 3MUMP 4DL3A 3OMCA 5HCKA 1SKRA 3OL6A 3LLRA 2QIFA 2DNOA 5J3BA 4MKYA 2CSQA 3Q8SB 2JNGA 1HQ2A 3NOCA 2DTOA 2DMOA 4UOCA 4C8MA 2E5IA 3EH1A 4P9SA 1YBAA 1VRUA 1M1GA 4UY8T 3OS2A 3IA0A 2F2WA 2G2ZA 1FYNA 2MKCA 2L3QA 1JK9B 2C2OB 2OTJS 4Y0FA 2XM3A 1VQPS 1OPIA 2ZM6J 3LWHA 1LWXA 4QIWD 4DHVA 2XGPA 2D8HA 3Q8PB 3BN7A 1Z9QA 2XBPA 4K2XA 3R7SB 1VQ9Q 4PXDA 5D3GA 4DQ2A 1KHWA 4C3KA 3IGNA 3OW2S 1W26A 4U9RA 3U02A 2MPXC 2GNKA 1QD1A 2NLWA 2O88A 2I0XA 5FDLA 1KQGB 4OZ0A 4P6QA 3DLLQ 2HKEA 2XZDB 4F7UG 2B4OA 1QAXA 3VV2B 1K73U 1N0UA 1K9MU 2WSFC 5CZVA 4CT9A 3I56S 5JJBA 4JJCA 1GTHA 4C5IA 2RI3A 2MYSA 3REAB 2D74B 1M27C 2K7AA 4MIWA 4ILLA 1IREB 2BE9B 2Z58B 3UE2A 2KYZA 5CYJA 3OY9A 2EKYA 2CQHA 3D2WA 4C5GA 2M0GB 3OXFA 3FSIA 3QO9A 1E6HA 2ZE2A 2F3JA 3SQGB 4RKUE 2W24A 2D41A 2YLBA 1H2UX 4NZ7A 4WKYA 2CZVC 2QT7A 5A0GA 1D1AA 2K7KA 2B8AA 3SQGA 1G6BA 2DR7A 1E6YB 1YITQ 4ELTA 2DTJA 3CJ3A 3OR1B 2HQ3A 4KPYA 5GAMh 3H5SA 1AT1B 2DHSA 1NJIT 3LO3A 2H9ZA 3OR1A 1OWXA 2OPPA 5EX3A 1FWPA 2RS8A 1SUQB 2ZPBB 4K5RA 3B82A 2M02A 2ZOGA 3GIIA 1FE0A 3I32A 2A6OA 4S0MA 2YWKA 3SBMA 3TOQA 4AFFA 2KH9A 3KHLA 4LUEA 1SUQA 4M78D 5E3AA 5J2PB 3GU0A 5KCOA 2VOOA 3ZZOA 3G71A 3VRZA 1XIQA 1LWEA 3DXSX 2KXHA 2WBRA 2ILZA 2QN6B 3CCMQ 2VOPA 4CZCA 1I81A 3W9IA 4C2MA 5F41A 2J5AA 4QQ6A 1FJGJ 2XTJP 2G0CA 1CG2A 2DGQA 2BV3A 2RF0A 4KE5A 3TVYA 3UWTA 1QVGS 3CCSA 2J9EA 4DS4A 2VZ9A 4LBPA 5A0LA 2BABA 2F65A 4ED4A 4MK8A 4NLRA 2IC3A 2DJZA 5J1EB 4RBVA 5IWAJ 3VYGA 4DV6F 1CJKB 3BY7A 4OMMA 4DQRA 3M8ZA 3M2RB 1WXTA 5J1EA 5HY6A 1DTQB 2RHUA 4Y6IA 3RBXA 1S6PB 3D4JA 3M2RA 4XQ3A 3CJQA 2YNIB 3JTOA 3EGWB 2EXUA 3KHHA 3M7VA 1UEVA 2VHGA 4RMOA 1UEKA 5KFKA 4KGMA 4F4KA 2YNIA 2IIHA 5GMKm 3PRDA 2PFDA 1HBOA 1HMVA 3QDRB 4EBDA 1QCNA 4ZGEB 4I4BA 4K4TA 3S3NA 4M7AB 1NSAA 1HL6A 2DO3A 2KI2A 3MMCA 1AVZC 4DX5A 3HK2A 1SV5B 3M1VB 2KI7A 4ICLB 1S10A 2HNDB 2EJFA 3I87A 1NJZA 1YBYA 2DR8A 2WVDA 4U7UD 4C92C 1RHQB 3BDPA 2XIDA 3M4GA 2BM0A 5IV4A 2HNDA 4A4EA 3AQOA 3AD9C 2HMIB 1OEBA 2DTHA 4B3SJ 2BMBA 4PG4A 3I31A 3OV7A 2JXBA 1SKUB 4IO1A 1H7WA 3O2IA 1CJTB 1EQMA 5DS7A 1XBWA 1O0PA 3OUYA 2HMIA 2HHVA 4C4WA 2IY5B 2B7CB 2VC1A 1CJTA 1RAEB 4CP5A 1XTDA 1DQAA 3CPWP 3DHXA 1RABB 5E41A 1IKYA 2J8AA 4NWBA 3M6UA 2EVRA 4OYOA 1RDRA 3ZXWA 2RMOA 2BZ8A 4FF1A 1R6VA 4KQZA 1H641 1VQ9T 3AXKA 4FNHA 1WOSA 2D3ZA 3CD6Q 2AKKA 1JXOA 3EFRA 2PA8D 3CJ0A 2R2UA 2P84A 4NPOA 5C0MA 2JT4A 2QLWA 2DL7A 2ZOFA 3AOBA 1CJUA 1N34J 2F8HA 3ZZ0A 4ZIVA 4ZPDA 2COLA 4RUAA 2FLPA 1SJQA 2DNHA 5EWFA 2RPNA 2DL8A 3UR3C 5DLGA 3SWNC 2FG0A 4MTPA 2CT3A 1KC8R 1UJYA 4LF5J 3ZBDA 1B3TA 3J81j 2QA2A 1N0VC 3CPWA 5D0RA 1YJVA 2GVDB 2ZZDA 4DSLA 2ZCFB 2QTXA 4AUKA 4USVA 2GMLA 3M0PA 3Q8RB 1G3TA 2FB7A 1KWMA 1WHLA 5J2MB 2JUFA 4N4HA 3NOGA 5GAHI 2HBYB 3CCEQ 4P10A 2CAJA 1FESA 1HNXF 2NREA 2VC0A 3J80U 4ECXA 4Y2CA 3PW0A 2D0NA 3A12A 4IRDA 1HBNB 1M3AA 4E7HA 3TP2A 3QWXX 3G6EQ 5KFAA 3P49B 2CJ9A 3REBB 3MEKA 2I0NA 1YITT 3V8KA 3NXZA 2ROLA 2O4XB 1C0MA 2EJGA 1AA1B 2WCXA 3C46A 1TG0A 2V9WA 1NZ8A 1Q0NA 3MPWA 2YWWA 1M1KR 1FHTA 4UTGA 3T3FA 2RQVA 2O4XA 4A0UA 1CULA 3I5SA 3URGA 1PC5A 3D28A 1NK6A 5A0DA 2SRCA 2LJ0A 1AB8A 3P5BP 1RXOB 1MV3A 1V1CA 5LSLA 4CNYA 3OD2A 4IRKA 1KD1R 3CXCP 2E7XA 3QGHA 2DIVA 2LX9A 2YNGB 5D7UA 2LKZA 4ZKAA 1J3TA 1ZLMA 2EYXA 2QLJB 2MJUA 3CCMT 2ZVIA 3L9ZA 4M63A 1A0NB 3TI0A 4NOYA 4ED0A 4AFSC 2JS0A 2ZKTA 2DY9A 3I4HX 3I5BA 8AT1B 1VQKS 4OL8A 3MEAA 3ZFJA 4M5GA 5DQGA 1C0TB 4C3LA 1X4GA 2WOMB 4JUZA 4X62J 2P5VA 3PW4A 3EG1A 2LMJA 1NAQA 5J26A 1SL0A 1O6XA 1TKXB 4QIFA 5F3TA 4I6WA 5HI7A 1LNQA 3TZZA 3EFSA 4M5HA 3TA1A 1RT1A 4X65J 2EYQA 1D8YA 2OP5A 3S01A 5CAIA 3C94A 3THTA 5KE2A 4L73A 3EGZA 3GCXP 1Z1ZA 4QOTA 2LQ5A 1T9VA 4ECVA 2VKNA 2KT1A 4RUGA 3PKMA 2OPRA 4Z7YA 4EMHA 1UMJA 3LD7A 5DLFA 4NLUA 1YJNA 3OYKA 3OHAA 2EEYA 1JJHA 2R8JA 1AFJA 4USKA 2ZBQA 3DN9A 4G65A 1KOHA 1TFYA 3IBCB 2NUPB 3L1AA 1UPMB 4JI3F 2CQ3A 3GJQB 3KG1A 2MMYA 4LJMA 1UGQB 3RBBB 1WPYA 1TQLA 3VAJA 1DBDA 2E1MC 3W9HA 5GANg 2JHEA 1M1KC 2W1BA 3C14B 1VQ9S 4ZJOA 4I68A 2U1AA 3E2UA 4DOZA 3FFIA 2CPIA 2O66A 3FQKA 1KSPA 3DDNA 2VA2A 1Q7YR 2RB7A 3G9CA 3QRQA 3QLHA 2CQ1A 4MKAA 1YFNA 3ISNC 3EFOB 1KD1C 1JO8A 3VZHA 3VU3C 5KFBA 4URGA 4CO1A 2YX4A 2AV5A 2BIVA 2HS4A 1G83A 3PVLA 1V9OA 2OMOA 5J1PA 3R5GA 4EZ6A 2ZPEB 5A8KA 2OI3A 3JB9F 1BU1A 2LQBA 4ILMA 2ZWPA 2GQ2A 3LOUA 3FSYA 5K14B 4EO8A 2PQWA 1X6BA 3FEOA 3GE9A 1BQMA 3UD4P 3P8BB 1RACB 5L8RE 2W4DA 4NMXA 1U0HB 2UU9J 1IB8A 2P6TA 1GTEA 2FVCA 2HBRB 3T5JA 3RAXA 2XMTA 3IXQA 2A18A 2DILA 3DLMA 3SCKE 2AD9A 4ZVHA 2XWYA 1QWEA 2DTIA 5M2UA 2YT6A 4BI4A 4WP9A 4OZ2A 1X0PA 1TELA 1HWIA 5C24B 3NWGA 1YITS 2M51A 4JS4A 2BUDA 1WDXA 3OL7A 1KLNA 2FJXA 4ZVQB 2DPJA 4ED2A 1HYSA 2RK1A 3U23A 3CCET 5KFXA 4L76A 2DCUB 2ALYB 1SIZA 2N7CA 5AXKA 3PGGA 2HQDA 3G4SQ 3SXLA 1VDHA 1SC6A 1UB4A 4OI1A 3G6ET 5I21A 4ECYA 4OYXA 1KQFB 4PG5A 1UJ4A 1OU9A 2E7WA 1GRIA 4U7CA 4OX9F 3MCNA 4KUIA 3CCMS 3TSWA 4ID8A 5IQQA 2QA4A 3GFYA 5E33A 2ZBIA 1PC0A 4OHYA 1Q5YA 2ZNYA 3CBPA 3NS5A 2YKOA 2KVQE 1FRJA 1QVFA 4EWTA 3DRYA 4W98A 3ILLA 2MQ8A 3K89A 2XHCA 3MEEA 2E5GA 1OJ4A 4ZPVR 4ZVEA 1U02A 5KFGA 1K1ZA 3W5ZA 1REGX 3MECA 2E6NA 4IURA 4HTIA 2L2PA 4QQDA 2NZCA 2CSIA 1NJYA 5D8HB 1FWLA 1B0PA 1QE1A 2JZ5A 5AT1B 1T11A 3O1LA 3P8HA 3GBQA 5K5MA 3I35A 2QG9B 4IFYB 2ATCB 5IT9E 4LQ3A 4G6VB 4ZN3A 4NLGA 2HVHA 3E3XA 2YBVA 1S9EB 1YJ9A 4UW2A 4OJ1A 4Q7AA 5GAN6 1TKZB 2JH3A 3JB9G 2FVRA 2I2YA 5D0GA 3TA2A 1S9FA 2MF2A 3O44A 5GAN8 1TR0A 4C8QE 5IFMA 4CLFA 4Y28E 1TTHB 4KSEB 2OEMA 1S72A 4IOCQ 3F44A 3KKFA 4O3PA 1NK8A 2ESWA 4E7KA 4A8QA 2NXNA 2FC8A 1K8AR 4K4UA 2QYCA 3HHLD 5A8RB 4DR7J 1BE4A 3VRYA 3K57A 2KRRA 5EUHA 1F2GA 2RRAA 2DRMA 4O3NA 4ENOA 2K57A 2LQ9A 5HK4A 2MWOA 4JI4F 4KGXB 2XG8A 1IKWB 4LVOP 1I1JA 4FDFA 2MKJA 1F3FA 4DUYJ 5HMZA 5GJVB 4WCIA 1N33J 5KYYB 2YNFA 1JXLA 4ZCKA 2W0ZA 3MDFA 2H54B 4RWXA 4X9DA 3VAHA 5FJ4A 5KYYA 2PO4A 2YHTA 2V0NA 1WA7A 2CZ0B 2J8SA 2H51B 5B0BA 1VYAA 5FIIA 1WF1A 1GBRA 2HRUA 3CSKA 3CCJQ 2PU9B 1FKOB 2GMHA 3SFGA 3JYTB 2V2VA 3U27A 1BCOA 3CEDA 3WX8A 1EKSA 2UXCJ 4OHZA 1Q1KA 3G6XA 4DZDA 2R7RA 4BCAA 2GMJA 1VLYA 2KT2A 1UVNA 3IBFB 1UA0A 3NGRA 2IHR1 5D4LA 1PRLC 2BE7D 3CPWS 3OYDA 2COZA 1NHKL 5FD1A 3J7YU 2VV5A 2RT3A 4M75E 2W9AA 3PJXA 1T9WA 2B6AB 3CCES 1U1QA 2CP0A 1U2CA 2VBZA 2E5QA 2AYMA 4ES2A 2B6AA 5CVIA 3MMBB 3WHIA 4ZVFA 2MMPA 4WTYA 4JI8F 3G6ES 3TEHB 2GHVC 3N5BB 2DITA 5I3PA 3HX9A 3AHUA 4E2FB 4FYWB 1S1UB 4P7VA 2J6FA 3OYMA 1RT5A 4J6XA 3TQ7P 4TU7A 3DLJA 1Y3KA 1NMEB 1O75A 4QU7A 1S1UA 1B4SA 3ISZA 1C0UB 3KMQA 1Z2ZA 1YJRA 4WFXA 2K3YA 2UV8A 3CMAQ 2XMWA 1K8AC 2D3OR 3G4ST 4JI7J 1N8RT 3TX8A 1X9WA 4M78C 1WOOA 3PIPA 1PSDA 3GG0A 3PVXA 3IR6B 3QAEA 1NKEA 5E7OB 1JB0C 4UC4A 5HQMA 1MHNA 3PIPQ 4LRBA 2M88A 4OZ1A 3P3DA 5AJ3J 2RQWA 4C8QD 4XTWA 2LA6A 2C2NA 4DR4F 2VD3A 1I5OB 4ZVOB 4C8NA 2C2EA 4CI0B 7FDRA 4R0EA 4Q8EA 5GJWB 4PNOA 4NLSA 5KFYA 1JX4A 1LW2A 5LJ3g 2LCWA 5IZHA 4J9OA 2RQRA 4C6AA 2CNNB 3VGTA 2VXEA 4HHJA 3L95X 3OB9A 1UGRB 3ULRB 1I8FA 2KL8A 4H4MA 2GJ2A 1HD0A 3PRVA 3MEDB 2LX7A 1NO8A 1JLGB 1T02A 2FJDB 2BKOA 1HNIB 3V8LA 3CXCS 5C7PA 5EHHA 3QJJA 4LDUA 1JLGA 1OIAA 3MKDA 3GP8A 1HNIA 2ZH9A 2N4DA 2MSTA 2ZZMA 3C16A 4IG0B 3OXGA 4X4RA 2V4JA 1NZAA 5EN1A 4AFUC 4L59A 4O0NA 4OI6A 2R5MA 2QLFB 2PDAA 4J9GA 4IG0A 2AJ1A 2NCKL 3KXTA 1EX4A 2ROGA 3VJPA 2R8IA 3SWNB 1XOVA 2RH3A 1WDTA 4CLYA 4O4RA 1Q95G 3TUPA 1RCXB 2AYEA 3NBPA 1NK7A 2M7SA 4FSSA 3HPOA 3JCMh 3OR2B 2FHJA 2KG1A 3VTIA 3GONA 5ITHA 2CA9A 2QLBB 1TKTB 3EG9A 4M75D 5KG3A 1M4ZA 3OR2A 1PJ6A 4TNOA 2P2CB 3ET6A 2Y8YA 5DETA 1TKTA 1K73R 1K1QA 2MKSA 1K9MR 1SC1B 3D9BA 4MFBB 1NDCA 1ZSZC 3TAMB 4OB2B 1YWPA 3F41A 1U7LA 1CC8A 4OFZA 2LNHB 3E1SA 4K0KF 2KTQA 2DAQA 5KT6A 2LEPA 4IUPA 1XWLA 5IM0A 3RRKA 1RWMB 1RI7A 1LWFB 2G6FX 1RWPB 2CPZA 1MROB 4FPIA 1JJ2R 4ESRA 1D8ZA 1R3NA 1N36J 3QT6A 1HR0J 1XR5A 1LWFA 4G1IA 3QXEB 2O67A 3DRXA 3WDOA 3BEGB 5DM7R 5B09A 3CCJT 1KVKA 3GQCA 4CLKA 2W2MP 2DH9A 1HWLA 1U24A 4DN9A 3X26B 3GG1A 3I6PA 4DF8A 2YNHB 4PKCC 2DNNA 1R31A 3HSDA 2ZJPQ 1RAIB 2XEXA 3RW6A 5B0DA 5ECAA 3OYAA 3L2WA 1VJQA 3G87A 2DJWA 1U2FA 4EEYA 2VFUA 2DL3A 3G4SS 1M90R 3QSUA 2C3PA 1UA1A 3JV3A 3T1YF 4EIKA 3GNGA 2IM0A 4PJMA 4J7FA 1ARKA 2ZM6F 1FXLA 4J9DA 4C8OA 1WIEA 1SPKA 1W70A 4FW2A 1ZM4A 4VUBA 2NR0A 2CUDA 1QSYA 3RMSA 5GAN2 3QJPA 3V4MA 4OVAA 4Q43A 1TH7A 3IBWA 2APOA 1S6UA 4A4FA 4KT0C 3JSRA 1VQ4Q 2AHOB 1VOMA 3CWJA 4I2QA 4UQGA 4BI3A 4F4AA 4F4XA 3CMAT 3SCJE 4FF2A 4A54A 2X3DA 5KFHA 5HMWA 2LCLA 2DGSA 3AB4B 1IGUA 2EVZA 3CE8A 2YRDA 3CIMA 3SYZA 3BW1A 4DPUA 2FY1A 1D3WA 4QWEA 4E8UA 2EQJA 1NH8A 5EC7A 4F17A 1S12A 3I55Q 4NLTA 2MCNA 4KC5A 2L0AA 1QLNA 4N8NA 1UDLA 2K5LA 4NXMJ 1GAOA 4ZCMA 3FCHA 4K4SA 4F8RA 3Q22A 3VYHB 1UECA 1JU5C 4MDXA 4DSKA 1NLKL 2DJQA 4LBHA 4J9EA 2UUAF 4NA1A 4QYZJ 2ZHOA 3POTB 3A8GB 4FYXB 2OJ3A 3PYEA 2HSEB 5I3UB 4DOWA 3BR9A 5B08A 1VQNA 1URNA 3OT9A 2YRCA 3RIRA 2ZH6A 4GKJJ 5LOQA 4OZNA 2R7UA 5I3UA 3MP1A 3GILA 2HZAA 2DEJA 4DEZA 3PVQA 4LVNP 1XMOJ 1FI4A 5GMEA 1EHWA 3CCZA 3AD8C 3GJRB 3JSMA 1DQ9A 4K4XA 4OBIA 4M7AE 5GAOl 3HTRA 2X4WA 1IJEB 1JNZB 2DF6A 1OPLA 5CZXA 1M90C 2B9WA 3L4BC 2IFXA 4P74A 3QGGA 5GAHU 1S1TB 1B64A 4TYAA 2YVSA 3RTVA 1WQWA 3QJYA 2RI2A 3E9GA 4FKYA 2B9XA 1J27A 2VBWA 4AG2C 3CCLQ 5HVFA 1P1TA 1Q81U 3N6LA 1M9SA 5BXIA 2GHPA 2BJ8A 2ZITA 4M5NA 4IUVA 1WC5A 2VQFJ 2DHXA 3CCJS 1R43A 4KO0B 5CQGA 1N9SA 3H6ZA 2MKKA 2Z2MA 1HQUA 5IC6B 1DJ7B 4JI5J 3OYCA 1J5EJ 4KO0A 3VGSA 1UTIA 5CYMB 2ZKUA 3VS6A 1FXRA 2R8GA 1FTRA 4DX7A 2FHDA 1YI2Q 5IT0A 3MEGB 3IC1A 2Q1LA 5CYMA 3ZTPA 2LJ1A 2H3JA 2BXJA 5KH6A 5F8MA 2HGMA 2QDYB 2EFQA 3ZZTA 3OFHA 1PHTA 2AIRB 3TZWA 2LYVA 3MEGA 3NNAA 2NPIA 4F67A 4ALZA 4A4GA 1WSRA 1MNDA 2QTVA 1WOPA 1N6AA 5ETOA 5CD4H 5F0UA 1LJOA 2V8DA 2MQNA 3VVTA 3I9QA 1QAYA 4QVZA 1NNDA 2WSCE 4MMOA 2Y8WA 4QWDA 3EDQB 4CCHA 3EGDB 4JJBA 4B3SF 5M9OA 1YP5A 4DEXA 2CDTA 4XU3A 4TLRA 4IUFA 1W2IA 2JM8A 4IG3A 3EGDA 1N6QB 2W7PA 3CO9A 3CMAS 1I07A 1ZUYA 3R6NA 4JI1J 3IWLA 3R6GB 2OH2A 3UD5A 2PEBA 4H54A 2QRRA 2CXEA 4K5SA 4MZTA 1X75C 4FBTA 1ELOA 4J9PA 4B9WA 4OB3B 1RHJB 4C3MA 2OSQA 4TQSA 5HLFB 2W2QP 2D8JA 1EB0A 4YB6A 2LQ8A 2V8JA 1VQ4T 4LSNB 1PWTA 1KC8T 1IBMF 3A8JA 5HLFA 5G0RA 2VC8A 3TUJC 2QEXA 1SJ4P 3KJFB 2XY7A 3QPHA 2VPZB 1U49A 1TXQA 1GFCA 1IN0A 3QWUA 4M7AD 3D6HB 4BD3A 1D1CA 1U6BA 1I0CA 5DLQE 1V6HA 5KFJA 1M2OA 2KRBA 2B86A 1LKZA 2P4RA 3M5AA 3HVRA 3TQEA 1KFZA 2BM1A 1U4BA 1R7IA 3Q8UA 4Y34A 4WWSA 4AXIA 3HSZA 4F4YA 4TY8A 3I55T 4ESNA 2CADA 4WE1A 3M58A 3A13A 1MGQA 3SCIE 2VGMA 1HW9A 4E47A 2JRSA 2WB4A 3KNAA 2OIHA 2CRLA 1JXVA 5LSOA 3M53A 4O44B 1S77D 2ZH2A 2AEJA 3VF0B 3MI7X 2EBEA 4GVBB 1MN9A 3CCRA 2UVRA 2F4VJ 4NCBA 3FBBA 3RAQA 4DBFA 4QR0A 4FIBA 4QYZK 2OPSB 1E7OA 3HFVA 4CLWA 5LJ3Y 2CDRB 2DRDA 2RKIA 2GCXA 3KJQB 4C8YA 1HWKA 5IV3A 4U8YA 1Q4RA 1KONA 4AFZC 1FEHA 4CH7A 2W25A 2DD5A 3FB9A 2WK4A 1YX2A 3I0RB 4HVWA 4WIIA 2CJBA 2J7IA 3QT8A 1U1LA 3FK4A 2F4FA 2VASA 2M9KA 5IAYA 1LWCB 4ATNA 3I0RA 1S0OA 3MM8B 3R5BA 5MAOA 3OTOF 5KFPA 1CLFA 2WSEE 4M7DE 3T6JA 2PD1A 4QWAA 4NLPA 3HD2A 3HHLC 2O9VA 3T9ZA 4HCBA 2IA0A 1JLBA 1FX7A 3IAM9 2RVJA 4PFPA 3GP9A 1X31C 3CC2Q 1KLMB 3GIMA 1RZMA 4OB0B 3S3MA 1NYGA 1M0SA 5D6WA 1NDKA 1FT8A 3W5XA 2E3HA 5KG0A 3M8SA 3MR3A 2RILA 4WP3A 1FDDA 4Q8FA 4XTUA 5FU6C 3CNQP 1RT4B 1VQ5Q 1UHCA 4HACA 1YTYA 4Y2AA 2KRMA 2XDDA 3CCLT 3ME9A 5HBMA 1RT4A 4NLOA 2L89A 2ABYA 3BKTA 4EK2A 1DJ0A 1IGQA 2V94A 2K1RA 2MXYA 2PMZD 2RD5C 1YJTA 4XIUA 1S48A 1BI1A 1X4CA 2K9GA 1L3TA 1BQNA 1A9NB 1EP4B 2DISA 5KFSA 4QR1A 1WG4A 4FNIA 4RW6A 1YI2T 2HL5C 2R2SA 4W92B 3MHYA 5IXFA 3JCMP 3RDVA 4DFJA 2VONA 3C4SA 1BCMA 4BDPA 4F7UB 1YHQA 4RTVA 3KDNA 2JNJA 1VYVA 1AFIA 2XDPA 5LMUF 2UVVA 2DZ9A 2GZOA 5KYXB 3MM5A 4F7UA 3L2UA 5C2GA 3D67A 3TR5A 5RUBA 1Q7YT 3QZ7A 1O9SA 3DYAA 2HHSA 4L6V3 2ATLA 1KOOA 2LT1A 1U8SA 3M8YA 1Q82U 1SCJB 3PDNA 2OPQB 3MGJA 3W2VB 4CO0A 1ABOA 3M8QB 2AHJB 3VAGA 1VQ4S 3DMJB 1FK9B 3I9ZA 3JQKA 4DV2F 3M0RA 4C8KA 4P5NA 3FVYA 2LVWA 3IQLA 2OPQA 3W2VA 2DT9A 1RTDB 4TY9A 2AF6A 2RIJA 3PJ9A 3JCMQ 4PJOG 2JFDA 2GO8A 4JRKA 4N76A 1RTDA 2XYGB 1N54B 1RT6B 2OAUA 1QSSA 2B56A 2DXBA 4ZJQA 4PWWA 2KY9A 4C8QC 4Y28C 4KHPJ 2E6ZA 2EGAA 1X69A 4WIQA 3LALA 1IM6A 2EG1A 3RGIA 5CABA 2HNYA 3V4IA 2JM9A 1VRTB 2R5AA 4ZLLA 3I55S 2RMLA 2Z56B 4Y00A 1FA0A 4QU6A 1C1CA 1C4CA 1NK0A 4PK4A 2QSWA 4M7DD 5GVQA 3D7SB 2YUNA 4EDUA 2GIFA 1CBKA 5KT7A 3M8PB 1VQOA 3MJXA 5I3QA 3DM2A 4DJBA 2QA4G 1PKUA 1VQOQ 1ULRA 4DV6J 4KV8B 2CJYB 1S59A 1AEYA 3EZUA 3E01B 1NJIU 2EK1A 2FEIA 4XTYA 4KAIA 1KQSR 3SCLE 5J1NA 5GADI 3GJTB 1XR6A 3FZ2A 4PLLA 3HXMA 3IG1A 4LSZB 4ECQA 4W90B 2I38A 4LRFA 2DB1A 4QW9A 3OFEA 3K8VA 1LV5A 4LSLB 3TX0A 4DSJA 4TVAB 2DD8S 4RW9B 3CCRT 1FRKA 2J9CA 2HDAA 3QQCD 1JKHB 2RQTA 1AZSA 3TO8A 2EYWA 4RW9A 4C8ZA 5DGAA 2BW7A 4QW2A 4NI2B 3VS7A 1W4SA 5FU7B 2MLYA 3KHGA 5DQHA 1IR2A 3LP0A 1CEZA 4DQPA 3HP9A 4NI2A 4ECSA 2VBXA 3H2VE 2DO0A 5THWA 4M75C 1VIEA 4B08A 3KJVA 3US5A 4NXNJ 5GAMf 1H72C 5CCLA 3CCLS 2X1AA 4RBUA 3GFZA 1Q8BA 1MWQA 3KLGB 3A3OB 3GPAA 5HQ8A 4KKOB 3PX0A 4N56A 3GR1A 4FPRA 3RW7A 4M5LA 2W9BB 3RYLA 4CC2A 4JV0A 2XYPB 2FRWA 4GLKA 5H9FJ 1HA1A 1PAUB 1SIWB 4C0BA 2D0QB 1TV6B 1VQ5T 2UUTA 2W9BA 3A8LB 4RJVA 5HATA 2D3O1 1GXLA 3HO1A 1Y0MA 2LNVA 1VQ6A 4M94A 3R2DJ 3ICLA 1HHTP 1F9EB 2BX6A 3AFGA 1YI2S 2KFNA 5A2QY 2BE2A 3GIJA 2N82B 3H5XA 3UDCA 1XQIA 1K8AT 2LT4A 1HI1A 1S4FA 2XMMA 3SDEA 2H3EB 4GY5A 1MV0B 1JLAA 4OHXA 2CKKA 1HIYA 1X01A 4ZPCA 1HNXJ 5KFOA 1XMQF 4PKDB 3C6TB 2KYMA 2IIMA 1QTNB 1ABQA 3H25A 4H4OB 3VGVA 1YHQT 4N0AC 1GCPA 1SEMA 1N33F 2PMHA 2XWXA 1SC4B 3TCJA 2B4PA 4F2RA 2GA7A 4N5SA 1WKLA 2E29A 1U1NA 4ZOSA 5DM7Q 3MPVA 3WIVA 4PQUB 1Y7PA 2XSJA 3EGXB 4Y3CA 5ETPA 3IN5A 5G4DA 4OB1B 1UGPB 1V76A 1SH2A 1D0ZA 5BYQA 4L74A 3EGXA 2KBTA 4WU3A 3EZ5A 2GFUA 3JCMW 1BLUA 5GANe 1BI2A 4ZGJB 1M1FA 4QYRA 3N01A 1IKXA 4ORZA 1IRXA 2UXCF 2UV8G 3KLFB 3HMJG 4C92E 4DR1F 2VGNA 3OVAA 1BBZA 2CPFA 3LH5A 4P2SA 2E1AA 4BDZA 9ATCB 2DGTA 2WZ1A 2ZUAA 1WNEA 1CVJA 3KLFA 2LU2A 2P6SA 4FT4A 2RRBA 4OV6A 4J7CA 4FZVA 1RE1B 1B34B 2IJFA 1VCTA 1KRPA 4J9VA 2EC2A 1XJWB 1VBYA 1SG5A 1D0YA 1VQOT 2GBQA 2IBOA 1B34A 1S0VA 1X5SA 1WI7A 4GVLA 1VQ8Q 2Z2YB 4XDCA 3IRWP 4ELZC 1YBUA 4LIWA 2DRAA 1RWUA 2DYIA 2ZDOA 3MAAB 2Y3YA 3TANA 5AE1A 2HHTA 2C3UA 1S1XB 3B6BA 3L7PA 2XZTB 3JRZA 3B78A 1U47A 2YXLA 5C25B 1WYXA 3FBFA 2LVMA 1JIHA 4OMPA 1RWNB 2MB0B 5C25A 2QQSA 2YUOA 3C66A 3JAME 2PT0A 5KFZA 1H73A 3K8WA 4WJBA 4OJHA 1HI0P 1PYTA 4MYTA 5AJ3F 3AODA 1QMCA 4LBIA 3ZNJ1 4JI3J 3G96A 3SV4A 2ILYA 3PHEA 3EHQA 5GAN7 4E0DA 4A8FA 2HNIA 2AJ0A 1WKKA 1HQEB 4AFQC 2X7IA 2NXEA 3NG8A 5BR8F 3EVOA 4NRTA 2UUBF 1SJRA 4JV5F 1OMSA 5HK0A 3M0TA 4F3OA 1UUEA 1HQEA 1UFFA 1FWZA 2FL7A 3GSDA 3WC0A 1VQ5S 1U06A 4QVDA 4B02A 3W2WB 3JCMX 3BSCA 3R8YA 1FF2A 3V8JA 3MR6A 2G0JA 4BY6B 2RNEA 2WVBA 1FO1A 2GJIA 3OJUA 1IJFB 2MQOA 3OYLA 1D9DA 2CZ9A 2KPPA 2ADCA 3FC3A 4TVRA 2DRBA 3LGMA 3R5DA 3JB9J 1W7WA 1YKWA 2OTLQ 4QQGA 1W2BP 3WX4A 3N28A 2DBKA 1VQLQ 3EPIA 1VQMA 2XMKA 3LX7A 1WG1A 2D7SA 2MLXA 1UVJA 1EKRA 2HFNA 2DNKA 1X9MA 4M4ZA 1PM3A 3F0NA 4KBIA 3D1OA 1VQMQ 3DLKB 4UY85 1U1SA 2H5JB 1LQ9A 2ZDPA 2B9EA 3NTHA 2QFJA 2NXJA 3MAHA 4USJC 2R2TA 4BBYA 3T5HA 3W5YA 5FW9A 2LXUA 3B8HA 2Y1JA 2IRXA 1IVZA 4ZCIA 4DS5A 5DZ7A 1WHXA 4I1TA 3K58A 3QRRA 2HHWA 2VODA 4IUQA 1K73T 2JSXA 4EO6A 1UHFA 2YH1A 1S0MA 1K9MT 3THVA 3I5AA 3MR2A 1KFSA 2CQ2A 4NCAA 4CIOA 2N3OA 1E6VB 4F50A 4AL5A 3CPWR 1NJXA 2OEJA 4NYZA 5GAN5 4DG1A 3AY0A 4X2BA 1E6VA 2F8EX 3MF5A 4R8UB 4P2XA 4RTZA 2O1PA 4XK8E 3T1AA 4BWJA 2HEQA 2DGUA 1F60B 4HH1A 3VAMA 2VG6B 1BWEA 4BI8B 3IR7B 1D0XA 4PYAA 2B8QA 1WI6A 2VG6A 3ZO7A 1VC0A 4EZ9A 3DDKA 2DKOB 3IRXA 3KDOA 1N36F 1FWKA 5KG1A 5GAEI 1AUSL 2CH4W 4IDKA 2ZEJA 4PJJA 2HKQB 5LJ5g 2DK3A 2BEFA 1WZOA 4M7AC 4CTAB 2C2DA 3Q2TC 1VQOS 4G1QB 1NYFA 2GGPB 2E64A 5L46A 2AGOA 4OJ3A 1FDNA 1UVKA 2AZ1A 4TXSA 3LTOA 4OI0A 2MPUA 1T9TA 4DFKA 4G1QA 4PG6A 4E7JA 1ITPA 1UG1A 4Q45A 4C7QA 3CJKB 3G82A 1M90T 4TN2A 2DBMA 2HQXA 3T19A 5GANd 1GBQA 3UDEA 3CJKA 2HZYA 1QAIA 1B7FA 2FVUA 5FLXE 2B51A 5KE3A 5KT2A 3ZTSA 2XCPA 4ECTA 1TKDA 1VQ8T 2CJQA 4AG1C 3KUHA 1WC6A 1CS4A 3MR7A 5CH7B 3DLEB 2ZH3A 2WB1D 2UVWA 4LF7F 2EQUA 1YWOA 4UUXA 2VG7A 3IWNC 1M1HA 1EJ7L 3R27A 4CM0A 2MZRA 3DLEA 2NUUG 1RU1A 4Z88A 3MEVA 4D6WA 3OBIA 1OV3A 1RHMB 4RTWA 2QK0A 3UA6A 1WEZA 1RLCL 1S1WB 4JI4J 1TL3A 2RI5A 1SQFA 2BW2A 4PXCA 1OOTA 2P0QA 4B9XA 2MQQA 2MSSA 1N5YB 3CC4A 3J7AF 2DIGA 3WBZA 2BJEA 2FLOA 4NA2A 2ADBA 4Z8AA 1N5YA 3L42A 1YWXA 1BXNA 1H6KX 2WSCC 1O8BA 3KK1A 3MFIA 1LOJA 2HHHF 3CMEQ 4EYHB 2HBPA 3R1LA 1X2QA 2ZBPA 1V29B 5DDQC 1HHQA 4NXMF 4LE9A 1RWWB 2K3IA 3QKJA 3M0QA 4F2SA 2EBPA 2F1FA 1Q79A 1NLOC 4A8MP 2GCFA 4Y92A 5LJ3e 5F8IA 3D0HE 2DD4A 2Y0SD 4NLYA 3R5AA 1DRZA 2HBZB 4OP0A 3OS0A 3RRHA 2YKNB 1FEEA 2ZOMA 3KK3B 2VICA 4LRCA 1VQLT 3ENWA 3V6DA 4BC7A 3DRSB 3NCPA 2K6DA 3NL0A 1VQMT 1HFEL 3KK3A 4IOBA 4P72A 4ETXA 2FZKB 1P8GA 5FWBA 4JPBW 4LFBJ 2FGOA 3IO1A 3BF4A 3UI3A 3DRSA 2A1BA 1C1BA 2YKMB 4NL3A 1SL2A 1M5Q1 4DV3F 2W2NP 4X64J 1UVMA 4A4JA 2YKMA 4JI8J 3BH7B 3AJDA 4ATOA 3JCMg 4DV4J 5GANj 3NTIA 1UZDA 1JJ2S 2W2PP 3RB4A 3PYFA 4R25A 3UN5A 2A7YA 1L3UA 2DPIA 5IHNA 4GKKF 1TWBA 7AT1B 9RUBA 4II1A 3K17A 1RAAB 4IRCA 3PMTA 1TVRB 1NH7A 2YQ1A 1OY8A 5A2QU 2HVZA 5CD4A 2Z0WA 3J81E 2I8EA 1S97A 1TVRA 3CGIA 1S0NA 1UAWA 2BQ3A 1S57A 4JI5F 2WAQD 3FNNA 1XN9A 1N5QA 1I5LA 2V63A 2GJFA 1KN6A 4DSIA 4FCYA 1VQ7A 3PIOA 1RT7B 2E1CA 4ZHRB 2L5QA 4IR9A 4XU0A 3CVKA 1CPZA 2BQUA 1V5VA 3IMQJ 4M77A 3QDFA 4OYZA 4Q5WA 4M5JA 3UFCX 4QWCA 1VS3A 1RT7A 4C98A 4CYUA 4YQWA 1KHIA 3DLBA 5LL6S 1QM9A 1FNOA 1B70B 1V5IB 2NXUA 4A63B 5DDOC 4V2SA 4OI3A 1VQ8S 3MMJA 1C6VX 3QBYA 1QVFR 2IRYA 1ZX6A 3NAHA 4FU6A 1RTJA 1KQSP 3RUXA 2ZH5A 3X24B 1LEOA 1PSFA 5IC4B 4ZPTR 4OYIA 1WEXA 5CYQB 1AWOA 1X4BA 2XMUA 5H9EK 2XS2A 1UEUA 2MDAA 3QJLA 1RQ0A 1RUSA 2E5JA 4J7IA 4F0KA 2DXUA 2HS0A 5CYQA 1RBAA 2X4JA 5AXNA 1WHWA 2B4UA 2A3JA 2EJ9A 2RHZA 5T7LB 4DBRA 5CKBA 2JEGA 2CNOB 5L1LA 2J9DA 2FIUA 4EPCA 1YSJA 4QWBA 2M2BA 1DURA 1G7CB 1RP5A 4J9HA 2DCLA 5L38A 3QFHA 2DYBA 1R0BG 3NTKA 1DLOA 3QFWA 1NPRA 4P2FA 1BD6A 2WTFA 2KNBB 3S7RA 5GAOq 4ZTJA 3BFMA 2K4YA 3CCQQ 2BBEA 1OSDA 1R77A 4CT8A 1Q8KA 4F7VA 2DNMA 4FN5A 4KHRA 1IM4A 3CCUQ 5T14A 4LR7A 5GAOr 1REVB 2KG0A 1X4EA 4NRUA 4V19J 1LW0B 3S8SA 3W63A 2XI3A 1V3ZA 3HVTA 3KLHA 3RR6A 2RN8A 1YJWQ 1DTTA 2KO1A 4HLBA 1REVA 3OTCA 3OLAA 1RUWA 3V6HA 1S99A 1SL1A 3KMSA 5JUMA 1N8RC 4FKXA 4DQQA 2OTLS 4DPXA 3CMET 5EDWA 1VQLS 1SB6A 3OSNA 1T3SA 1VQMS 5MLCV 3HM9A 2XCAA 1M5HA 3O5ZA 3MR5A 4DR5J 2KB2A 1JB0E 2NSBA 3LP2B 2CPDA 3V7CA 2CZ1B 1TMJA 2CWXA 2FPHX 2FQQB 2W4PA 4PWDB 2FB0A 4D3GA 4JS5A 3LP2A 3NGKA 2ASJA 4N4GA 4M78A 4PWDA 3QSYB 1IXKA 3OL9A 1UE9A 1Q82R 4DPWA 2CG4A 2EAYA 1VRUB 4DSFA 3EWGA 4E7IA 5LJ3d 4BHQA 4PRFA 1R8CA 3RJMB 1JQGA 1SJFA 3MCAB 3AD7C 3NEKA 2RF2A 3C95A 1W2BS 4DL5A 1T0HA 4A4KA 4F7UE 3G1JA 4JZ4A 1UWBB 4DPOA 5D77A 4LF2A 5GADU 3T1YJ 1NHVA 3BJYA 3QNWB 2RHSB 5D3GB 1U45A 4PXEA 3LH0A 4GLMA 2NYIA 5IXBA 3D0GE 1UWBA 4B9TA 4EU0A 3GIKA 2V9KA 5FDLB 4Z89A 4X34A 2EBGA 4URQU 3QZ8A 5B7WA 2GAHC 5K20B 1JLCA 1ZBXA 4YB5A 2LMIA 2Y1LB 4ED7A 1U48A 3JCMf 2VH7A 1K4US 5E3QA 3CDEA 2DETA 2CZ7B 4J9BA 1R89A 3SSRA 1N52B 4IIOA 2QXFA 1AZEA 1OULA 3I0SA 4M95A 5CK9A 3QO9B 2ZE2B 5KFLA 3LYIA 5IXUA 3O8WA 5HN0A 2RQKA 2HIYA 4IUUA 1T3NA 4RX6A 1D3BA 1YJ7A 3KBGA 1VK3A 4DL0C 1JXMA 4DWIA 3BE3A 2KKHA 2K5FA 2RA2A 3MTJA 3CC7A 3ZTOA 3ENQA 2UUAJ 4H4KA 3LWLA 3LH2S 4PJNA 2OPPB 2O9SA 2HRYA 3U1MA 2ZBRA 4CO2A 1V3SA 3NGTA 4DA4A 3DOLB 4LT6A 3D66A 1IO6A 2WW8A 3KJNB 3R6LB 3DOLA 3IFEA 3LPEA 3QYHB 1Q82C 2V4RA 3ZEHA 4ECWA 3A8KA 1LWEB 2BJ7A 3FJ2A 1JMTA 4BWMA 5ADZA 1G5VA 3G71Q 1V3RA 2W2OP 4JI2J 4U8VA 2RQCA 1UVLA 5LJ3j 1N56A 2MLZA 3HHKA 5J2QA 4IQXA 4KHPF 2H4WB 4WK3A 2RQMA 2Z57B 2IC3B 4A8SA 4K4ZA 3CCSQ 3OSPA 3CMES 2OX7A 1WJRA 1X5PA 4ER8A 3D54A 2JW4A 3CCQT 3PFOA 2PVOB 1PBAA 2R7QA 2Z2ZA 2J0WA 5GANh 1CJVB 3GV8B 2AZ3A 4O3QA 4J37A 4C0FA 4HXJA 3CCUT 3IM9A 1CJVA 3C15A 4DOVA 1QUVA 1KQ1A 5AYFA 1RJJA 4I7FB 3DHWC 3FRNA 2KR3A 3CQTA 2HK2A 1YJWT 4HR2A 4WFZA 4CLUA 4ZIWA 2HQHA 3M2VB 4KT0E 2E66A 4P75A 2D9OA 2DNQA 4I7FA 4DV1F 1OY6A 3DOMA 2M70A 3HRUA 2AZSA 2ED1A 1WC1A 1HBOB 5L9NA 1HMVB 3M2VA 1IZ6A 2HNZB 2BJDA 2YKQA 4LD9K 2BYCA 3M2UA 4LUDA 3MMCB 1SPBP 4FYVB 1XNRF 2HNZA 2HWHA 3KLEB 3K0JA 1CSKA 1NKBA 3C2PA 1C4AA 4RL1A 4KH1B 4CO5A 5CKFA 4HVUA 1T0JA 3KLEA 4JJDA 1X43A 4LDVA 2VQEF 4CI0C 4X4PA 2RJCA 2AJ4A 3ZC4A 2JEJA 4RNOA 2FDNA 3B4MA 3AA9A 4WPAA 2JOQA 3OUYB 4KGZB 2HPUA 2LCCA 1LK7A 1N27A 4GO7X 2PI4A 2JTFA 1QAJA 4NXNF 2ZH4A 4PWUA 2J7WA 4ZP6A 4HVZA 1IKYB 3D6MB 1FD8A 3RKWA 1WF2A 2Y90A 3JCMc 2HAFA 5B0EA 2IM2A 2Y1RI 3MCSA 1T05B 1SVDA 1D9FA 1WEYA 3W8PA 5ETSA 3VQSA 5KG6A 4HL9A 2ZUGA 1HKAA 1CJUB 2DIQA 2VKRA 2B0GA 1T05A 2E70A 4PUOA 1PSEA 1UJ0A 3PNWC 3M57A 3LUYA 3MFHA 2YRVA 5A76A 2GQCA 3CCVA 2PN6A 5K8NA 1IBMJ 1ZBJA 2X1BA 5I2SA 3W62A 4DQSA 4NYPA 4RW7A 5KFMA 5E3RA 4RW4A 3CCWA 2IVWA 1T8EA 3QZ9B 1D1UA 2DGWA 2R8KA 1VUBA 2K2VA 4I6YA 5AE3A 4DR3J 3DRPA 3DGPA 4DSEA 4DUZF 5C5JA 2HHQA 1DZ5A 1IBKF 3I82A 2VDIA 2EPDA 4XO0A 2J6UA 4X4VA 5HMYA 2DFUA 2PGCA 2MAMA 3CD5A 5E3PA 2MEWA 2RUSA 4XAXB 2EIFA 1N5TA 4J90A 4O23A 3TW0A 1ZM9A 3PE0A 2N3LA 3HZEA 4WYLA 2HYIB 3GLXA 2DA9A 2OGUA 1H3ZA 4A8WA 4DV5J 1CULB 4QVCA 3KK2B 2HZVA 1R8OB 4BUGA 1RHUB 3J7ZT 2XMAA 2F5TX 3HHDA 1RLQC 3KK2A 2FJAB 1H8KA 1YRTA 4FM4B 1KFDA 4FP9A 1QLYA 4B6MA 2CG8A 1YCYA 3KFWX 2BDPA 3SHWA 3OTOJ 5GMKl 3C19A 2R7XA 1QKXA 2HGNA 1MUZA 4MK9A 1GCQA 4HI1A 1KQSS 1U6ZA 3VS3A 3CCQS 4J9SA 5DLOA 1BK2A 3H0HA 3G71T 4ZP9A 4NMLA 1WUUA 2MQMA 2ZPHB 3OQ5A 2G2OA 3CCUS 2I5JA 1IR1A 1URRA 2QLXA 4M5DA 5DQIA 5DM6Q 4MKBA 2KZMA 2CVEA 1YJWS 4X9CA 1YG0A 2V34A 3CCST 1M1KU 2PA3A 4WCEQ 1Q86R 1F0XA 3FC9A 4L3NA 3H5UA 3AT1B 1Y5IB 4YDXA 3W65A 2J6SA 3RBZA 3BGOP 2VU5A 1E6GA 1RT1B 3Q86A 2EFOA 4MDWA 1KD1U 3TA0A 3FIFA 4CLSA 5KFWA 3HT0A 1GXUA 4XK8C 5L1JA 2R7TA 1KC8C 1WELA 1Z2LA 1YN8A 4J5OA 3P96A 5U47A 3W64A 4FXVA 2GVZA 2E10A 4NLDA 1VHFA 3NWRA 2CP2A 3EVWA 4LFAF 5GAEU 2OPRB 4F4WA 3CJ2A 5DG8A 2XD0A 5JVGQ 5KT4A 1UETA 2MY8A 3VS5A 4YUDA 3FSXA 1AUDA 1SRLA 2VPXB 2FO0A 2RU3A 4PPZA 4A8YA 4EBEA 2E1HA 4AD6A 4USMA 4O4GB 1YJNQ 5LMUJ 1PYSB 4B9VA 1HARA 4KFBA 3BKUA 3FEYB 4ZVGA 2C0TA 4NZ6A 4WFNQ 3JSCA 4CWBA 5I11A 1K76A 4O4GA 3FFIB 3K7RA 2YKPA 1WDDA 1KTQA 3DU6A 4WFBQ 3HFNA 1RWVB 2Q43A 3M4YA 4QZVB 3QLHB 4HTJA 4A53A 3HULA 5A6WA 2X3XD 2ACMA 3ENVA 4DV2J 3J80E 2L48A 3QUIA 2HBWA 3QAUA 2F8MA 2O3DA 2DY1A 4QKUA 2AU0A 2B8PA 4O3OA 1Y00A 2LDMA 2CQDA 3I5RA 5A8KB 4FS1A 2OFHX 2BVZA 4A47A 1VQPA 2KU7A 4RNMA 4V19X 1IHVA 3QT7A 4DXLA 4K2JA 2FGCA 1NJWA 1BQMB 1HNVA 4R5PB 1PJ5A 2FD2A 4PFOA 2EWNA 3OW2A 3UDLA 1TL4A 3PHTA 3FQLA 1ZUUA 4R5PA 2HVIA 2J06A 2MYFA 1QCFA 3CCVT 1EETA 4NCGA 1SI9A 3UDVA 1IR0A 1Q86C 3LANA 5LJ3h 4E6RA 2KEAA 2VF3A 2M8HA 1OX8A 4AT1B 2QQBA 1VJWA 3EHRA 4F0HA 1YIJA 2Y4YA 2VJVA 3I56A 1SF9A 2R2RA 3MM7A 3ETMA 4ZMMA 3BBBA 1YIJQ 4PJOB 4BB7A 3NRBA 2QGFB 3QIPB 1HYSB 2AX0A 1TS9A 1UVIA 4PJOA 4I2PA 3DKMA 3QIPA 3N79A 4OHWA 2EQKA 1QVFP 1S79A 2M0YA 3CDBA 1SBRA 1VYTA 2V1QA 1PCAA 1F5BA 1YK9A 1ZAWA 2XK0A 1YLXA 2RDJA 4FVCA 4OYMA 3M8RA 5AXMA 4OZ3A 2F1LA 2AW0A 3G71S 4JLGA 4NLXA 1Y7XA 3NMRA 4RNNA 2KM8B 4OX8A 1PJ7A 1X8DA 2QA4Q 3LAMA 3RAMA 2PTKA 1Y10A 3MEEB 4P7TA 3SEMA 3BKFA 3CCSS 2ZFHA 1I94F 1U1TA 3MECB 4C11B 4LN2A 3EAEA 2FYXA 1Q7YC 2E5LF 3KXDA 1EX8A 4LQ9A 1X2KA 1KS2A 1QE1B 1Y0HA 1RHKB 2B9YA 4C11A 1N9RA 4EMGA 3LQVA 1GX6A 4CRJA 5D6YA 1M8MA 2CQCA 2HAXA 3ILIA 1WFWA 4FVMA 2RJDA 1OZ2A 1QVGA 2H4YB 1YRXA 2L3SA 3FCVA 2M52A 1CSJA 4AL6A 3VV0A 2GAGC 1S4EA 2CP6A 4ZK7M 4Q0BA 4M77F 5IHKA 1XR7A 2JTEA 4ECZA 3N5FA 3BO2A 1XQHA 1P92A 1YJ9Q 3R9LA 4DR6F 1RI9A 2ZGWA 4J9KA 1HNZJ 3VQTA 1Q81T 1X4DA 3TREA 1RGVA 1WXBA 3QGIA 4DCOB 3RMQA 2XLKA 1RTZA 3LA0A 1GL5A 4X4UA 3BV8A 3PNIA 3NS7B 1S72Q 5J2NA 1TUWA 1S1NA 5IOLA 1VISA 2VDHA 4C8QA 2C3MA 3D0IE 3NS6A 1XMQJ 1MMDA 2JMCA 2RB6A 4LF8J 1AD5A 2XU8A 2YNFB 4X4OA 1WC3A 5EWEA 1YJNT 1BQXA 2JTMA 1VYUA 4LF4F 4KHMA 2XNQA 4YMEA 1G4CA 4RR5A 1QW1A 1H0HB 2BJ1A 2LP5A 3X25B 2B43A 4F36A 4C9DA 1S6OA 3K5NA 3GYNA 1UJ5A 1FFGB 2KJWA 2Y9HA 2LRQA 1F2HA 2LDYA 3GB0A 2J7KA 5D78A 1WHGA 4DFMA 1TUDA 1U1KA 2IRUA 1YGYA 1WHHA 1K8AU 4A8OA 2DHGA 3CD7A 1D1BA 1JLQA 1PKTA 1R8PA 2DVJA 2W9CA 1GNKA 2V8IA 1RAGB 1JNRB 3PW7A 4PL6A 2QL9B 1UKUA 2J7UA 3F70A 1OPZA 2XY5A 2OAWA 2V2KA 4F16A 4DR1J 5IT4A 3UCUP 1U26A 3PG9A 3A8HB 4LFBF 4WTOB 4CO3A 4DX8H 1AYEA 3KLIB 1RYSA 2FPEA 4UQTA 2XMJA 4X64F 5HP1A 2P4TA 1RT5B 2L08A 2RDIA 3KLIA 2B5JA 3JQMA 3D68A 3JB9D 5KT5A 1KQ2A 1YIJT 4M75A 4DV4F 1FRHA 1S49A 3TAQA 2HVEA 1HD1A 2BRLA 4DV7J 4M78F 3SI8A 4KTQA 4TYBA 3LGHA 3RR7A 3MM6B 4M77G 3JTNA 1B3QA 3VAFA 1UGVA 3H4BA 2AZVA 3MM6A 3WVEB 2MZSA 1ZTTA 2K2MA 1PG5B 1UW4A 3O5TB 3QGPA 1TUCA 1MU2B 5BJRA 4AYBD 2W7AA 3U1LA 2HWIA 4X4SA 1RTIB 2F2XA 1MU2A 4XTZA 1LW2B 1F3VA 3PO5A 3NFCA 4HI2A 2LCSA 3RKXA 1S6QA 1RTIA 1WQ7A 3KOAA 2QA4T 5BR8J 5B0GA 1T7PA 3PCOB 4PCQA 2MKIA 2L9DA 4J9FA 4MT1A 2UUBJ 4JV5J 3H2LA 2FHMA 1RKJA 5C2CA 1RTHA 4H4MB 2D3UA 2BANA 2ED0A 2JMAA 1M5PC 1NDPA 3IS9B 3PTWA 3L2RA 3TZYA 5F0WA 3NAIA 3IS9A 1G3WA 3TJ9A 2KXFA 1PKSA 2ZPGB 4LF1A 3FUYA 3UATA 1QUPA 1J2VA 2CFXA 3C16B 4Z2XA 3OSVA 2H65B 1BI0A 2V4JB 3CF5Q 5L1KA 1VQKA 5LJ5e 3DI6A 1JLFA 4N0AA 2E7VA 1NDLA 2KT5A 3SV3A 3AAWB 2VPYB 3AJ1A 3H42A 2FPFA 4L5GA 1FRIA 3NBPB 3W66A 1YJ9T 2RM4A 1KSWA 3S6EA 1NK5A 1RT2B 1PCXA 3EXCX 4RNHA 1YJNS 3HRSA 4OI4A 4F0MA 3V7RA 3VR1A 1JBMA 4ZPBA 3EG9B 1RT2A 1L3SA 3HJVA 3ET6B 3GZ7A 2IM1A 3UNYA 5HAOA 1S72T 2O01C 2RUGA 4EMKB 2JJ4D 4J9IA 5KCHA 1BWVA 2CYYA 4EMKA 5BYRA 5E0OA 5L1IA 2CQ4A 4M78G 5LM7E 3A8EA 4DPYA 1AWJA 3HLUA 1S9GB 2RDDA 1WX6A 1T3OA 4YDDB 1UGSB 2C0OA 5IM0B 3FEXB 1FVSA 3D6TB 1M5SA 4I6AA 1PGZA 4QW8A 3K5OA 3A1YG 1S9GA 3FJ5A 3OMGA 3MD1A 2NSCA 3ELHA 3GV5B 3BO4A 2IVFB 1VQ9A 2QYGA 2CZ4A 3TAPA 1LVKA 2VUBA 3INZA 2ASLA 2FVSA 2RHXA 1VIXA 2CQGA 2MQLA 1FXXA 3M54A 3IP0A 3DLLA 3D3BJ 3EGVA 4DR5F 3AH6A 1KTVA 2VKZG 3W7BA 3CW2C 2GGRA 4K11A 4DCPB 2XS5A 1Q82T 4EYIB 5DGBA 2F5KA 2V69A 4CC7A 1TP7A 3Q24A 2V8GA 3QIIA 5B0FA 1YIJS 1M5KC 2XHWA 4C48A 1FMKA 2HFZA 5FU7C 2MY7A 1IUJA 3UN2A 1NM7A 2J0SD 3K2YA 2PSZA 2LFVA 3OJSA 1ROFA 5F8GA 1XEZA 4CO4A 1RYRA 2J6TA 3Q89A 3BDUA 1T94A 3MURP 2NS1B 4N8OA 2EKNA 1ZYQA 3RUBL 3SFUA 1N4LA 2DXDA 4CLTA 2GFAA 5DRKA 1B7TA 1X0FA 5D15A 2DZCA 3MOJB 1TMMA 1RAOA 4OJGA 4DI6A 4N47A 4JJNK 4PLIA 1YITA 2HHPA 3CCTA 2PUKB 4HEA9 3OXLA 2MKHA 3BQ0A 4I2QB 4LF7J 3X20B 1G2BA 4KBMB 1Y71A 3M9QA 1E6YA 5L39A 2QA4S 1D9AA 1L3VA 1JLEB 3S6WA 3BYPA 3JCMe 5A6PA 3T9NA 2QSFA 4ED3A 2YQ0A 5KFTA 1RWKB 3TWZA 4F04B 3GCWP 4F3MA 1JLEA 2K79A 4UOGA 3HKSA 1QVFS 3P45B 1K73C 3UVJB 2RHYA 3PACA 5KFNA 2IBKA 1K9MC 3GR0A 3IM8A 2GTOA 3CCMA 4URSA 3UVJA 4RU2A 2MHNA 1M90U 3T5KA 5J2PA 2COYA 4RUBA 3SMZA 1U1RA 2BUNA 4ZLPA 4PEOA 2DK2A 2KSSA 1PD0A 4OMQA 4LFCJ 5D0HA 4J6YA 3OYGA 2E4HA 3PFSA 2JDJA 2XY6A 2HHHJ 1TU0B 3FBCA 2MZJA 3ZZRA 4K7QA 4WXWA 1HNWF 4A8XA 5KFFA 2CZ6B 4BE2A 2DR9A 2J6KA 1GQEA 2FJVA 3LGLA 1VMBA 2N4CA 3FZBA 1FFWB 3GPLA 4TU9A 3LAKA 1H2VZ 2QASA 3QZ5B 2R9LA 4YTLA 3FKBA 4B9UA 2OI2A 1YJ9S 1Y57A 3CO0P 1R0AB 1SJ1A 4JRIA 2EKHA 2CQ0A 1WJ9A 1VFJA 2DXFA 1W25A 2HLTA 4KH0B 1PD1A 1CJKA 1R0AA 1VQNQ 2FJWA 4QR2A 3JSMB 1BB9A 1VQKT 2EFVA 8ATCB 4NE9C 2JOYA 2QMXA 3RKYA 3Q0AA 3VALA 1S72S 3OYEA 3GYGA 4LMZA 1DTQA 1TAQA 1S6PA 3VS2A 4OHVA 3HFKA 4J9LA 2J0XA 4DV3J 4Q44A 1LCKA 2UXBF 2CYZB 1NHUA 3OSSC 4C0HA 4GC6A 3V5RA 4JI2F 4HKQA 1QSLA 5LJ5d 1TSFA 4C8LA 4Z37A 2BOAA 1UW9A 4IUTA 3NGDA 1B07A 1I4K1 3M0UA 4L72B 2WVEA 3TSZA 1GK8A 2BA9A 4M7AA 4USHA 1IWGA 4GKKJ 4LR8A 3VS1A 7FD1A 2L3PA 4YOEA 2HZCA 1SV5A 2RAQA 3M1VA 4ICLA 1AWXA 1FRLA 1EFNA 2YWHA 3O8VA 3N4WA 1K0SA 2BR0A 1DY3A 2XGQA 2GQVA 1AOJA 3DGVA 1HQUB 5L23A 2LTOA 4M1KA 3META 4NLVA 4RZRA 2EPIA 4DR2F 3DU5A 1W2BR 3MMAB 2AP6A 4LRAA 3E19A 4V1Ak 5CIUA 3BSOA 8RUCA 4B3TJ 5K8PA 2FYKA 3OL8A 5FROA 2ROPA 3MMAA 4M5IA 1OI1A 2A0FB 4ED8A 3CD6A 3HJFA 1NLPC 4C97A 4YHHF 1SRMA 5KG4A 1NRKA 1YVFA 1A0OB 4LF6F 1KHCA 4F4ZA 4DEYA 3OA6A 3OYJA 1HLWA 4PAAA 1KDNA 1QP2A 4X4QA 1IQZA 5GAGI 2I6WA 1NK4A 3B54A 4IO9Q 2ZZTA 4HDGA 4B9NA 3HVAA 3TUZC 3MEWA 1Y96B 2DH8A 4ES1A 3HHNB 2WW4A 3LWMA 2YX1A 3IAS9 3PZPA 4JUVA 2JJ9A 1UWAA 5I2MA 3CMQA 2RH2A 1Y96A 3MPYA 2FLNA 3M9MB 2IYIA 3HP6A 4IG3B 2D9TA 3W3SA 2JVOA 4OYBA 3UPFA 3OBYA 1UTAA 4ZVUB 4N41A 3CCEA 1RL2A 5KFIA 4YR3A 1VA7A 2I1RA 2GVDA 3M8WA 4Y65A 4ZDNA 3G8QA 4BY6C 5J2MA 3ONQA 1KK7A 1NEBA 2JS2A 4DV0F 4FBUA 3G6EA 2HKNA 2LQWA 3SQOP 2W8KA 2JWNA 3CDUA 2O5DA 2Y4XA 2JVRA 5C6SA 2LA4A 3KTQA 2JZ2A 1HBNA 5G0RB 1QDUB 3HKWA 3PV8A 4DFPA 1EIFA 2O2OA 4D8DA 4LUBA 3TRGA 2VFTA 3UT1A 2I2LA 5LJ5j 3PR5B 2CT4A 4HA8A 3BQ1A 2ZNZA 2C28A 4BACA 5KFDA 2QEXQ 4UF4A 2FRYA 2F9JA 3SZ2A 2AGPA 4DR3F 2E3IA 3EE3A 1LK5A 4B9SA 1NXIA 2M4MA 4TY8B 1Q8LA 4WE1B 4YFUA 1OSCA 4JRPA 2UUCJ 1O5JA 3OPKA 5GMKe 2XLJA 4USUA 2YNGA 3JCMd 2X3WD 1Y07A 1WHJA 2OFGX 3BGUA 2K06A 2IVMA 3BSNA 2ROTA 2U2FA 1NM2A 4UOFA 2QAZA 1OU8A 3BREA 2RKIB 1U0SA 4Q5VA 1ZH5A 2R7OA 3CCRQ 3HPWA 5GAMg 1XNQF 2G4BA 2CP5A 2EGCA 1C0TA 2DNLA 1A7GE 4FS2A 4DV5F 2WOMA 5K8MA 2Z2LA 3CXCA 3VAIA 3R7BB 1AHJB 1NCLA 4OMLA 3UNGC 1LFPA 2KQWA 1S5ZA 4PJOF 1KQKA 4PG8A 1TKXA 1VQNT 3BPSP 3VZIA 2M3DA 1JLBB 2H48B 3J7A1 3RR8A 1ZS6A 4Q2LA 2EFIA 3UD3P 4R56A 1RSCA 1ZZFA 3QRPA 1OZ3A 1TOVA 3TEGA 2CP3A 4IH7A 4JV1A 4M7DB 4HH0A 2CGHA 4IQMA 2CJXB 4NX9A 4O5VA 1PBUA 1N5ZA 4DZ6A 1Q86T 4M7DA 3M30B 4ZVRB 4P52A 3TZXA 2FPDA 2EGEA 4HACB 4PQAA 4PFZA 4KUDK 4J9RA 2LZ6B 5HBMB 4XU2A 1I1GA 3M30A 3BN4A 4B3MJ 2DGXA 2NUPA 1Y11A 2K1RB 2IA6A 3IWXA 1VIOA 3VCDA 5IT9U 2DVIA 4RCBA 3RZAA 3KUEA 2QO3A 2YLCA 4LIRA 3RU0A 2QA1A 3C14A 1BQNB 1QJHA 2DX1A 2EYZA 3A5ZB 4KB7A 3E2EA 1AZGB 4ECRA 3AXMA 1LXJA 1LNXA 1D09B 4RW6B 4MKVA 4MZMA 3BO3A 3EFOA 2YY3A 1X60A 4XDDA 2VXFA 2IMWP 3CD6T 3LW5C 4YR2A 2WBMA 4E7ZA 3EPGA 1MWYA 3KG0A 5EWGA 3PR4A 2GIRA 2X3GA 2HIQA 1IHWA 3MM5B 5DG7A 5K14A 4XPEA 1WHMA 2MQPA 2BZXA 3DYAB 1YHQQ 4PJOE 1U0HA 3NKYA 1OQ6A 2OD6A 4G1PA 2R7VA 3TU4K 4BE1A 2LEAA 1RBOB 3GFHA 2DM1A 3G8TA 1Q7LB 2KYBA 4FYYB 3GTYX 3CT9A 4RPFA 3OYIA 2QTWA 2QX0A 2JC1A 2AK5A 2X1GA 4C8QF 5C24A 2MK5A 3L2VA 3FEZA 2CJKA 3KNGA 4QJVA 3JCMb 4YP3A 4NL5A 5L9XA 3G4SA 3Q83A 1X4AA 1GXTA 1R8BA 2NUTB 2DEUA 4M5MA 1HWUA 2NYSA 1Y5NB 3MCMA 4IYQA 5ETQA 2DPPB 3CJ4A 2AJFE 2HNYB 3V4IB 5KYNA 2NUTA 1K0VA 3JS9A 1C1CB 4J9MA 4IIMA 2DHAA 2YWGA 3LP1B 3JCMV 3DM2B 3FJPA 2QMWA 4X66F 2FC9A 4KULA 3FGVA 3E9FA 3LP1A 3A98A 2DGOA 4HCKA 4K4YA 2QEXT 1NU4A 2R57A 1T03B 1MW7A 3IG1B 3O3LA 4R55A 3GLJA 3HFZB 3DB4A 1T03A 2EW3A 4HT5A 2PVDB 3ZL7C 1KVIA 2HFOA 5IN1A 1R27B 2M0OA 1MN7A 1H92A 5KG5A 2BRKA 1GT8A 4DV1J 3FRYA 1YCSB 1KEKA 2HRTA 2HQIA 2XO7A 1VQNS 1NUEA 2AT1B 1HBMB 3ZZUA 2VIHA 2DHHA 1Y4ZB 3DCAA 2KVQG 3A1PA 1GFWB 2JC0A 2P9CA 4GC7A 1AZSB 2R4FA 1HBMA 1XNRJ 3QO3A 2V50A 4EBCA 4IFYA 2NZ4A 1EAYC 2K2PA 3DC2A 1Q8IA 2LU1A 4M75F 3M9OB 3LP0B 4UZBA 5LL6d 2XICA 1S9EA 2VQEJ 1GEHA 2C2MB 2BJ3A 2VPWB 3H8ZA 2AKWB 1BUXA 1TKZA 2YQ2A 3KJVB 3CB4A 2IG0A 4ME7A 2C42A 4DL6A 2NXCA 1TL1B 4HT8A 4K59A 4M77C 2VJUA 4RTUA 2IDEA 2X4XA 1H7XA 3BBCA 3B4DA 2OHDA 3SFMA 1TL1A 1HXDA 2L8DA 2ACYA 1NZ9A 2KHDA 5CQYA 2R8HA 1FVQA 4PJOD 2EG2A 3CBOA 2ZD1B 5A8RA 3F73A 2Y1IA 1FRMA 2AWZA 2LJ3A 2MGZB 4AQYJ 1FMVA 2WVFA 4C8QG 1NSKL 2Q6BA 4B17A 3T6BA 2ZD1A 3I9V9 1T9UA 3EGNA 2MGZA 1PRMC 4NA3A 1NB2A 1IKWA 4UT4A 4AL7A 4LNPA 1RISA 3KHRA 4ERDA 1PILA 2SXLA 2FUG9 2BE2B 2POKA 4DLGA 1RA6A 4E7LA 3CD6S 2EI5A 1VQ6Q 3VWSA 3HT3A 2HEKA 3H20A 2E9ZA 2NQPA 4QIGA 2QYZA 3SDEB 3CCJA 3OS1A 2XB2D 3ADAC 3HZGA 3AA8A 3EG3A 1HNZF 4DUZJ 1JLAB 2FZGB 5LJ5h 5HMXA 3NNCA 2KE9A 1IBKJ 5DDRC 3MOZA 5GANf 2DVEA 5LMNF 3H2UB 4N7TA 2OJ2A 2CNKB 4IKFA 1FKOA 2JX2A 4D3HA 3JYTA 4YEAA 2JEFA 5JMNA 3DB3A 2P9GA 2XI9A 1X6OA 2WVCA 5CAAA 2ZC4A 2DNGA 2J76E 4PYDA 4LF8F 5KYWB 3M59A 4RBTA 3O6QA 2EW9A 3H98A 2HG4A 2CP7A 4U6PA 2IM3A 3NP5A 2V6AA 1VR6A 4RUCA 3P8DA 5KYWA 1B7YB 2XSJB 1DQ8A 2ZPIB 5HVHA 2M9UA 1CKAA 4NOHA 5GMKj 3MMBA 2MOXA 2C2KB 2NWMA 3N5BA 3R2CJ 2QMUB 4M75G 5D4PA 1HPZB 2DR6A 3CMAA 2ZH1A 1IKXB 1X4HA 1Y5LB 4BDYA 1ZAXA 1HPZA 2QEXS 1G3YA 1C0UA 3LF0A 4DN0A 4I69A 2LECA 2V8HA 3EICA 2G1HA 4DL2A 1K0TA 1NE8A 3UCZP 4JDSA 4PPDA 3JSYA 4C92B 2IAJB 2XG8D 3M05A 2LEBA 2K8GA 2HCKA 4KR0B 1WJQA 2J0QD 4C92A 2IAJA 2YUPA 2XYHB 4Y2IA 1F6TA 3ITHB 2M8DB 2UXDF 5CR2A 1OQ3A 1KG1A 3CCRS 4DBQA 2PMWA 4DV7F 2DE0X 3ITHA 4DLEA 3MXHP 3CD0A 2WACA 2QZ8A 2VL1A 2MHEA 1U1OA 4R0KA 4LFAJ 2CREA 3MEDA 4L3KA 3RBDA 1GMWA 4F25A 5B0CA 2E5KA 2DNYA 1F9FA 2YDLA 2OMLA 1H74A 1P6TA 3N6NA 3G6VA 4FSXA 4OYPA 1QKWA 3D6FB 1UPPA 4IH6A 2P9EA 1JJCB 4MJKA 3BZQA 5M2RA 4LXCA 4KGKA 2A2CA 3T1HF 2DL5A 2V2ZA 3M6WA 4WK1A 3OVSA 3HHTB 2HQFA 2YPZA 4K4VA 4HT7A 1OO0B 2E1RA 2C06A 1MNEA 2QL5B 2VB6A 1FX4A 3SWNA 5CA5A 2XC9A 4U96A 1UCNA 3D1HA 1TK8A 1IKVB 2V1RA 4FF3A 1ZQ1A 4EFAC 4OMFB 4KYZA 5AXLA 4H4KC 1IKVA 2HFUA 3NGSA 2CQBA 2EFPA 2CIMA 2CUBA 2P0KA 1NBEB 4ZPWR 3VGUA 2K7JA 4RKUC 3PMIA 1R6YA 4NEYA 2MI6A 1U1PA 1VHIA 1R0CB 5H9FK 1WC0A 3BBFA 2BKPA 3R5CA 4MIAA 1EQ0A 4PR6A 4XAKA 4MFBA 4J8OA 3TAMA 1CKBA 5FRNA 1VI7A 2W7OA 3CJTA 2RQUA 3H5YA 4RW8B 2GC8A 2H1YA 1VQ6T 4OF1A 4RW8A 1AWWA 3GSIA 1BI3A 1RHRB 1MROA 3AQPA 1K47A 2VFRA 1TK5A 2XS7A 4B3RJ 3CPFA 1YHQS 2PNIA 2OKQA 2W8LA 5GAOm 1YQHA 2FTRA 4E7SA 1RT3B 1SXLA 2F69A 2DIUA 1ZZNA 4KJIA 1P27B 5DG9A 1RT3A 4NYOA 4DG1B 1RCOB 2V8VA 2YNHA 1Q53A 4EUVA 2VA3A 2DLPA 2CVIA 1WF0A 4QPTA 3GIBA 3DXBA 2KT8A 1Q78A 3WZ0A 2D69A 1SQGA 5CXTA 4ZN1A 5D4NA 5ETLA 4CC3A 3BSAA 1BY9A 4ZLJA 5E2QA 2KK4A 3H90A 2LQJA 4MIBA 2GO9A 3R3TA 3IRXB 4M7AF 2R42A 4NLWA 4N4IA 3ZTQA 4JBCA 3V7SA 5HJYA 2C0IA 2CQIA 1CQMA 1VQ4A 4IDKB 1P9YA 3QIDA 3V2UC 3BGFA 2KHCA 1SSHA 4X1VA 1OY9A 1FCAA 3W8GA 1U5SA 4O3RA 1I94J 1BMQB 1WXUA 2DXTA 3GWCA 3P5TL 1DHMA 1GX5A 3CTRA 2KDOA 4LDWA 2E5LJ 3GMGA 2HLUA 2CPJA 2FHJD 3QG1A 1MLAA 4L6V5 1HYOA 1NSQA 3X28B 2A3LA 1VC6A 2UUWA 5HQLA 3G82B 3ENAA 2BACA 2EQMA 2AKLA 3RB3A 3M4XA 3Q8YA 2V2QA 4O0IA