1M1GA

Crystal structure of aquifex aeolicus n-utilization substance g (nusg), space group p2(1)
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
240
structure length
240
Chain Sequence
LEKKWYALQVEPGKENEAKENLLKVLELEGLKDLVDEVIVPAEEKVVIRAQGKEKYRLSLKGNARDISVLGKKGVTTFRIENGEVKVVESVEGDTCVNAPPISKPGQKITCKENKTEAKIVLDNKIFPGYILIKAHMNDKLLMAIEKTPHVFRPVMVGGKPVPLKEEEVQNILNQIKRGVKPSKVEFEKGDQVRVIEGPFMNFTGTVEEVHPEKRKLTVMISIFGRMTPVELDFDQVEKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of transcription factor NusG in light of its nucleic acid- and protein-binding activities
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Transcription
molecule keywords Transcription antitermination protein nusG
total genus 46
structure length 240
sequence length 240
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2002-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00467 KOW KOW motif
A PF02357 NusG Transcription termination factor nusG
A PF07009 NusG_II NusG domain II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1m1gA03
2.60.320.10 Mainly Beta Sandwich mini-chromosome maintenance (MCM) complex, domain 2 N-utilization substance G protein NusG, insert domain 1m1gA02
3.30.70.940 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits NusG, N-terminal domain 1m1gA01
2G3RA 5FLXE 3DB3A 3J80E 3G4ST 1VQ8T 1K8AC 1M90C 3CC2A 2XHCA 3ER0A 1YI2A 4ESNA 1VQ6T 3JAME 2JUFA 3H7HB 1QVFS 1VQ8A 1YJWT 1QVGS 1W2BA 3CCVT 1VQNT 3J81E 3CD6A 1VQOA 1NZ8A 1NJIC 3TREA 2DO3A 2JOYA 5A2QE 3CCRT 1JJ2S 3OYYA 3CCVA 2L3RA 3LD7A 1NPRA 1N8RC 2QEXT 5DM7R 2E6ZA 3PIPA 1Q86C 2MI6A 1SSFA 1VQPT 3CC7T 1YIJT 1VQ4T 3LPEA 5IAYA 1BKBA 2QEXA 3DB4A 1YJNT 1VQLA 3LGLA 4OBIA 1NPPA 3G71T 1KC8U 1K9MU 1YJ9T 3LGFA 3CCJA 2OUGA 3HKSA 3CXCS 1Q81C 3P8BB 1VQ5A 3CMAA 3CCST 3QQCD 2LVMA 1S72T 1VQKA 1K73U 3CC4A 1K73C 2LQ8A 2OTLA 3I56A 3LH0A 3CCET 1VQ9A 1KQSS 1Q81U 1YJNA 1VQMT 3I55T 2OTJT 2KPPA 3G71A 1M1KU 3CCLA 2E70A 1XTDA 3CCQA 1YJ9A 3CMET 5IT9E 1KHIA 3CCJT 1KC8C 4X34A 2MWPA 1K8AU 3CCLT 3CCMT 4ZN1A 3CCQT 4CRIA 3CMEA 1M1HA 1QVFA 1Q7YC 3G4SA 2OTLT 3G6ET 3OW2S 2LCLA 3J7AF 2IG0A 1QVGA 3CCUT 1VQOT 1NZ9A 1Q7YU 1VQMA 2OTJA 1NJIU 3CCRA 1VQ7T 1YJWA 5J3BA 3PIOA 1KD1C 1X6OA 1UEBA 1KQSA 3CD6T 1Q82C 1JJ2A 2CKKA 1M1KC 1VQ7A 3CCMA 1YIJA 3CXCA 1W2BS 1M1GA 1M90U 1YHQA 3G6EA 1N8RU 3CCUA 3KBGA 3DLLA 4RG2A 1YITA 5J26A 2JNGA 1VQPA 5LL6S 3CC7A 1VQ4A 1XNIA 2QA4T 4QQDA 1YHQT 1VQLT 1YITT 3CPWA 1S72A 3OW2A 1K9MC 2MWOA 3CPWS 1RL2A 3CPFA 5DLQE 2EXUA 4TVRA 4YTLA 3CCEA 1Q82U 3EWGA 1VQ9T 1EIFA 2K06A 1KD1U 2KVQG 2JVVA 3A5ZB 1VQ6A 2KDSA 3I55A 3CCSA 1VQ5T 3CMAT 1VQKT 5HY6A 3CC4T 1VQNA 3I56T 1IZ6A 1Q86U 1YBYA 4ZN3A 2QA4A 2EIFA 3CC2T 1YI2T
chains in the Genus database with same CATH superfamily
2H9ZA 1IBMJ 2W25A 4CLTA 4E47A 2RI2A 3L95X 3HVAA 3QIPA 4H54A 3LQVA 2JTFA 3EG9B 1NJIC 2EVRA 4RUAA 2AJ4A 4USVA 2V2VA 4FXWA 3T3FA 3CCMQ 4JLIA 1SH3A 1WHXA 3KLVA 1WJ9A 4X4OA 1KK7A 5EN1A 2XEXA 4S0MA 4DR6F 1ZPVA 2Y8YA 2EPIA 4Y3CA 3DOKB 4M5HA 1H7WA 1M1KR 1DURA 4EK2A 4LQ3A 1OY6A 1JJCB 2DXDA 3NBPA 1FWZA 3QAEA 2VHGA 1ZA1B 4BWMA 2RQCA 1U2CA 1LWEB 3AXMA 1VBXA 4KJIA 4ECVA 2NPFA 5C2GA 2L3MA 4WPAA 4RUCA 4OMLA 2OTJA 4JP8A 1U6BA 2HGNA 2R8JA 4TLRA 4YN3B 1BD6A 1TKXA 2HLUA 2C3MA 3MP8A 1VRQC 2JLGA 2WB1D 4LR9A 4J9OA 4RTXA 1OY8A 3Q1JA 3C8YA 1W2BR 1NJIT 4E2FB 3W64A 1BCOA 2NZ4A 2G2OA 3OHBA 1M5OC 2E66A 2W2PP 3GV5B 3CBOA 1MLAA 2LCWA 3RAQA 4EMDA 3ZEHA 2KVQG 2DPPB 3GG1A 1KHVA 1S79A 3NY0A 3OA6A 4HKQA 3QFHA 3H4BA 3T5JA 1NSPA 1WX6A 5MAOA 1W1FA 2VC0A 4TY8A 2CP6A 2CWXA 2K5FA 2V4JB 4ID5B 3MEEB 3VCDA 3LP0B 3WC0A 3X20B 5K8PA 4A4JA 3G9CA 1TUDA 4NMXA 3H4DA 2AZSA 4OYAA 1ZYQA 4ILMA 3FC3A 4ZVQB 2B56A 1X4AA 2ZGWA 3DLHA 3A4TA 2CZ4A 4M7AG 3DHWC 2AYGA 3EE3A 2GMLA 1G1XA 4V19X 3JSMB 4K4WA 1A0OB 5GMKl 1PHTA 1S9EA 3PYEA 1YJNS 1XWLA 1H3ZA 2VG6B 4B9LA 4M7DB 5SUHA 4CLWA 1BYMA 3RRGA 5A0DA 4IFYB 3KLEA 1U02A 1RWKB 2QA4G 3AFGA 1VQOT 3CWJA 5F0UA 4UOHA 2BRKA 1Y5NB 4DPUA 5U47A 1CJVA 2YUNA 3I32A 4ZJLA 1URNA 3KDNA 2O9SA 3EHRA 2EQMA 1QLYA 5IS2A 3EX7B 5IC4B 3CCUA 1S9FA 2D1CA 2KJWA 4VUBA 1Q8LA 2QFIA 3HMJG 3OW2R 3L1AA 3M9OB 2N4DA 4PYAA 1HBNB 4DS5A 4BBYA 1OSCA 2EQJA 1S9EB 1UGQB 2QSWA 1KTQA 2BR0A 1CPZA 2EYXA 3C12A 4LVNP 1M1KT 2G1DA 3H2LA 5CCLA 3C15B 4G1IA 4JI7F 2GO9A 4RTTA 2DPJA 4PPDA 1SVDA 3OTOJ 4DLGA 1ZUKA 2DXTA 3A1PA 4RCBA 1M5KC 3E9FA 3KKFA 4DV2F 4ZGJB 3C66A 4BE2A 1MV0B 4O0NA 2CPYA 1U8WA 4FN5A 2AHJB 3HFKA 1N5VA 5DRKA 4XAXB 5K5MA 2P6TA 2EVZA 5AXKA 3FCVA 4QQ6A 5GAN8 4HR2A 5KFTA 4NL3A 2QZ8A 2KXCA 1TUVA 4NOYA 2BZXA 4BE1A 2B9EA 2I5JA 3VGSA 1GK8A 3OLBA 2ZOGA 4IFVA 1XNRF 1B3QA 1TUCA 1PYOB 1KQSP 4XTYA 3PY8A 1T03B 2HHQA 1V3SA 2CJAA 3VUZA 3NBPB 2EFOA 4F4YA 1HI8A 2B7CB 2GQ2A 3EDRB 1VC6A 3MD1A 1QE1B 3CCEA 2DRAA 5M2RA 1D1UA 2OD4A 1EIFA 2GHPA 3BGOP 5CYMA 1S6QA 4QWAA 2LYVA 4J9EA 5B7WA 4C5EA 3DB3A 3G4ST 1UWAA 2A18A 4HLBA 2UUTA 5F9NA 2OD6A 2Z2MA 2LEBA 4WIQA 3WIVA 3N5BA 1KNZA 5KFJA 1ZSGA 5KFIA 3OYCA 3DLJA 5AE2A 3S01A 5D4OA 3B4MA 3CCSQ 2GCXA 1S9GA 3ZZOA 1QCOA 3N79A 3O3LA 1CJTA 4HDHA 3LGFA 1PKSA 3UE2A 2BQRA 3ILLA 1J5EJ 5J1NA 5CQGA 4USUA 3RB0A 2DNKA 2KRSA 3OL9A 2RNAA 3EICA 4UQGA 2NSCA 3SFGA 4FCYA 2DEUA 4D8DA 1FKPA 1V1CA 4OI1A 2VDHA 3SSRA 3CCQT 4CRIA 4PQUB 1IWAA 4E6RA 2DGQA 3TUPA 1M5SA 1YJWS 1PAEX 3DLGA 1YN8A 4BE0A 4XTXA 1R8HA 1YRXA 1GRIA 3KG1A 1ZBJA 3NGUA 2KZMA 3WZ0A 2I0XA 2ZHBA 3U27A 2AT1B 4V1Ak 5KFQA 2OJ2A 2VQFJ 3BPSP 4USTA 4J7CA 2DHHA 3THPA 4DR6J 3BE3A 4ZPBA 5DO2A 4ZKAA 3UN3A 1Q82U 3TP2A 1DBDA 3CCSA 2WAQD 2WBMA 3CCSS 1BQNA 5H9EJ 2CQPA 2ZZMA 4DPYA 4XAKA 1GXTA 1KLMB 1YRTA 3FJPA 4EYIB 1H3DA 2HHTA 1Y9OA 2APOA 3OFFA 2BDPA 3CCVS 2OEMA 2MKIA 3C14A 2V1RA 3CD6A 1ZA2B 4LDYA 2QX0A 2QEXT 2ABYA 3EFSA 3FBBA 4XIUA 1M5PC 4LFBJ 3X26B 1RXOB 2Z58B 5J2NA 3AOCA 1KG1A 3RDVA 4B08A 1JJHA 2CREA 3UD4P 5HROB 3SMZA 3BZQA 4K5RA 3KJQB 2XHWA 3AY0A 2E64A 5L8RC 3KUFA 2KPPA 3VTIA 2KJVA 2QJ3A 2K79A 2RJDA 1BQNB 3UFCX 4WFZA 3TJ8A 1NDCA 5E0OA 3T9ZA 2BKPA 4U9RA 1CG2A 2J8AA 1HYOA 3OYEA 2IY5B 1T9XA 2ZZDA 4FPIA 4EGLA 2BM0A 4J9GA 3H41A 3GFHA 3LA0A 3MTJA 3PKMA 1GH8A 3FQLA 3DOLB 3V6HA 5KFHA 4WFAQ 2O01C 1RWPB 3N6LA 4BS2A 5HI7A 4NEYA 2PUOB 5C7PA 2HFSA 1YTYA 5AT1B 5KCOA 4OMFG 2WBRA 4M75D 3VS7A 4DR4F 4QR1A 3OY9A 4C0HA 1HNWF 4DUZF 2XS5A 4C2MA 3GB0A 2ZBIA 4IH5A 5A8RA 2C2OB 4LDUA 1YQHA 4LIWA 1X6GA 2WRMA 2B5JA 2OSRA 4DU8A 4JYAJ 1T8EA 4FYXB 3NP5A 4ANDA 3JB9D 2JX2A 3OSPA 3KHRA 5KFRA 3H2UB 1DFDA 2L9WA 3KFVA 5L9XA 2ZH2A 1WA7A 1QP2A 3BKFA 4NYZA 2M52A 3S3NA 3AB2B 5I3QA 1NK4A 1HR0F 2BV3A 4HVZA 1FXDA 1HPZB 3H5SA 4JYAF 4L75A 1NDLA 5KYNA 1X4GA 1JEGA 2O66A 3EGUA 1YJRA 3LGMA 3HHLC 2L2PA 1F3FA 1RT4B 1FF2A 3VGUA 1OY9A 1WHWA 4QQBA 1MROA 2BOAA 3NMAA 1M2VA 2IJNA 1MMDA 2Y9HA 4DEYA 3S3MA 2ASLA 3W2WB 4ZLJA 4KQZA 1Q82T 3JTNA 3QZ7A 4B9TA 3P3DA 5ETNA 2KNBB 4C8YA 1K0SA 3QG1A 4DZDA 3HF5A 1VQPA 4KIAA 1PKTA 2R5AA 2V8IA 1LW2A 2KXDA 4TU7A 5ETPA 3PJWA 1ELOA 4EEYA 1SUQA 1J5EF 1K9MC 1WEYA 1IKVA 1RT6A 3MDFA 4Q5VA 5GMKe 4NZ6A 1I3OB 1M5HA 4M7AB 4ZVRB 2YQ2A 1TKDA 4JI1F 3HHNB 4RG8A 3GU0A 2XY6A 5J2PB 3DGPA 2Y0SD 4Y28E 4KBMB 3AQOA 1UG1A 1VQNT 2COYA 5KFNA 3UD5A 1WXBA 4PJOC 1RT1A 4CDIA 2JFDA 1UPPA 2EYWA 2RI3A 2JMAA 3J7YI 2EFNA 1QVFR 3SCLE 3KLHB 4MMLA 2VVKA 5CQXA 4ILRA 1M3BA 3RERA 1SBRA 4KHPJ 3CXCS 1RAJA 2UXDJ 2RN8A 3A98A 1NHVA 3OYBA 2BE2B 5IM0A 4IQXA 1R0AA 3T1YF 4C8QA 3G6XA 2L41A 2OTLQ 2XG8A 3I55T 3V7RA 1UJ6A 1FMWA 3J80U 1M5Q1 1EETA 3QAUA 3NNAA 1LKZA 2FLLA 4M75B 3MPVA 2AJFE 2NUTA 1F5BA 1UDLA 1CJKA 2BA9A 5GAOm 2HBPA 1HBUB 1L3TA 5EWGA 2MZ1A 3HCXA 3I4HX 1M1GA 3UVJB 3QJPA 4GO5X 1U1NA 2B8AA 2V8DA 4OZ2A 4M77A 1KJWA 5LJ5h 1YITS 3FRYA 3OD2A 1ZZNA 2FIUA 2LQKA 1JLFB 3C95A 2VBYA 1VIXA 2WOMA 7FD1A 4O23A 3MWBA 2CQ3A 5HMZA 3V4IA 1B70B 2W01A 1YJWT 3A12A 3C94A 2DBKA 3BREA 3I5CA 3QIIA 4WKRA 3HHLA 4JOUA 9RUBA 3E2UA 2CUDA 3H90A 2CPFA 4HCCA 1N5SA 3LANA 4J9SA 4DR1J 4DQSA 3CCLQ 4DV5F 2BANB 1ZBTA 3LPEA 4M7DF 5A8KB 1BXNA 4LRDA 1D1BA 2HRYA 4Q0BB 1HLWA 4WCIA 1Q86T 2BQ3A 3BV8A 5F9LA 4ZCKA 2EWHA 5K14A 4OJGA 2R7QA 4LR8A 5KFWA 4ME7A 1C0MA 4PXBA 1YCYA 4CO0A 1JLEB 2H5IB 2Q43A 4DSLA 4GC7A 2HMIA 1SL2A 3VUBA 2DBMA 2HG4A 5AXNA 4C8OA 4LF5F 1FVQA 1SUQB 2LQJA 4HVVA 3HSJA 1WI8A 3TSWA 2R7VA 2ZH9A 1S72Q 1Y0HA 1YGYA 2NXEA 4DR3J 4JV0A 4DR2F 5B09A 2RQUA 1QDUB 1S1UA 2MKKA 2XIDA 4X9DA 5LMUF 1D1AA 5LL6S 3DFEA 2E65A 4RW8B 2NLUA 3NEKA 3OW2A 3O6QA 1UJ0A 1DQAA 4MJKA 1KD1T 3OR1B 4ID8A 3TWZA 3KLHA 2UP1A 2DNPA 2RUGA 1R27B 1K9MR 2RB7A 3H9NA 3NG8A 4LIRA 2BJEA 2ZHOA 2X9HA 3MEEA 4WP3A 2VQEF 4HVUA 2FPHX 4PXEA 4HVWA 4QIFA 2CNNB 2V2ZA 2K1RA 1EIYB 1K0TA 2DEJA 3KMSA 3QLHA 4M78A 3TUZC 2CJXB 3SDZA 4U7UK 2DD4A 4PFPA 2DNOA 2L9DA 5KG1A 3EG9A 1HMVB 2NYIA 3R7NB 3J80Y 5BXIA 3EGVA 3MFIA 1K9MU 1N54B 1X01A 4KGXB 4OQJA 1Q81C 2VC8A 1NAQA 1SPBP 5DDQC 3EFOB 3M0QA 3MCAB 3R1HA 1DJ0A 2ENMA 1KHWA 3O2IA 1IBLF 1IN0A 2MJUA 2SXLA 1TOVA 1H8KA 1HKAA 4Y2CA 3RAXA 1G5VA 3HFNA 1R31A 2JHEA 4DQIA 1E6GA 3G6ET 3Q83A 3TR5A 1J27A 5KFPA 4RJVA 4DFPA 3BY7A 4C98A 2BTTA 2YNGA 1Q82C 2HD0A 2E1PA 3M2VA 3Q23A 3EAEA 4XU2A 1JLAA 2ALYB 2DXCA 1OYDA 4B6MA 2QA4T 2C2NA 3BBFA 2FJVA 3EFRA 3GF5A 5KYWB 1IBCB 3IWLA 2DHXA 1FYNA 3EWGA 3IGNA 1NYGA 1DTQA 2ZBQA 2JWNA 3I56T 2MYFA 1AVZC 3FFIB 4FT4A 5FU7B 2F63A 3HFVA 1K8AC 4RTVA 2G4BA 2OHDA 3CJ3A 3EUNA 2WK4A 2LX7A 2FVPA 4LFCF 1UP1A 3LWHA 3ZFVA 5L39A 1NYFA 2YWEA 1KEKA 1FFSB 1IVZA 4IRCA 3M6XA 3OS5A 2IVMA 3TEEA 4RUHA 4II1A 3TA2A 4MK8A 3TX0A 3OYKA 3KJVB 2GQCA 3H5YA 1YIJT 1JKHB 1RYSA 3M2UA 1H7XA 1I81A 3M8QA 1TL1A 5ETRA 1GAOA 4HHHA 4USIA 2JH3A 5A8WA 2H4YB 2CIMA 1P6TA 1BI0A 4WK1A 1HBOB 3OYNA 1RADB 2E3IA 3EMTA 1NEBA 3VZIA 5LL6d 3DI6A 2QL9B 4K4ZA 3A3NB 1EZZB 1TMJA 4DV3F 3M8WA 1VRUB 4B3MJ 3G87A 3BQ1A 1QM9A 3SQGA 2QLWA 2PA3A 1YVFA 3GBQA 3N28A 4MT1A 3RR7A 3CXCA 4E7KA 2PTKA 2B51A 4Y00A 2MK5A 3GYNA 1RL2A 4IKFA 4V19J 3C46A 2KM8C 2CQIA 4RPFA 4C8NA 3H20A 1NH7A 1WEXA 4QVCA 4WFYA 4LD6A 3FCHA 5FLXY 4UOFA 2ADCA 2D3O1 3I9V9 4E98A 2FY8A 1REVB 3E3XA 1QTNB 3CMQA 1NEGA 4AL5A 2QQSA 4CRJA 2ZEJA 4F50A 3I35A 1VC0A 2NCKL 4YOEA 1JMTA 5F0WA 2BOPA 5IT9U 1T11A 3DB4A 5KFXA 3G6VA 3G71T 4X4QA 1VQSA 1WI6A 3HHTB 1FRJA 1Y10A 1MNDA 4ZTFA 3R7SB 2M02A 3IG1B 2UVRA 1TAQA 1RAEB 5HANA 1NKCA 2XDPA 3HI9A 1JU5C 1BQMB 1MW7A 1K8AU 3IR5B 2HNYA 3MO8A 2LRQA 1K0XA 4PAAA 3K8WA 1L3VA 4CI0C 2WZ1A 3BGRA 2K5IA 1S4FA 4IFYA 1Y11A 4QWEA 1Y3JA 2J9EA 4UOCA 2R7SA 1S6PB 1HWJA 3M56A 1YITA 4E7LA 3M53A 4K4UA 2L9NA 3LP1B 2J76E 4BDYA 2ZWPA 4QWCA 2CPEA 3JTPA 4KGMA 2YT6A 2DM1A 4C8QE 3EGZA 3MCNA 3QWXX 1LOUA 1AFIA 1IKWA 3FVYA 4J9QA 2DRDA 5J1PA 3MEVA 3RUXA 3R6OA 1OI1A 2CZ0B 1H641 1IKYA 2AJ2A 4B3TJ 1HNIB 3H42A 3V7CA 3M8PB 1C0TA 1N5ZA 1UW9A 3VS2A 3LP1A 3BR8A 1OJ4A 3GPLA 1NJWA 1KVIA 3PG9A 4ES1A 4QU7A 3BB5A 4AFFA 1AZGB 2LCCA 1JLFA 2D41A 2E9ZA 3CEDA 1S1XB 1CBKA 2LDMA 1NM2A 2WHOA 2YLBA 3QJYA 2BJ3A 1YBTA 4C92E 3LO3A 3CC2Q 1RAGB 3CCRS 1HNXF 3JCMX 2RQ4A 4WU2A 2HQIA 3LYIA 2GIFA 3BSAA 2FGCA 4QIWD 5JVGQ 3SCJE 1R6VA 1W2BS 5H9EK 2N3LA 4HHUA 3CSKA 1IKXB 4NZ0A 2YQ3A 3DRRA 4J9NA 4OZ0A 2MKSA 4GKJF 2ASYA 3IWNC 2NSBA 3NNHA 4N8OA 4QR0A 5E33A 3TW0A 2FYKA 2DRBA 1JLEA 3I5SA 3D68A 5HN0A 4O3SA 3Q22A 1W26A 1V76A 4DS4A 3J80E 1LEOA 3TVTA 4UZCA 2GIQA 2QLFB 2HAIA 4ZMMA 3EG3A 3QT5A 3H7HB 4NLRA 2HHPA 4ED4A 2Z30B 1PJ5A 5I2MA 2RO0A 1JKHA 1KBRA 2YKAA 4DF4A 1UEKA 1KQSR 3ULHA 2J0SD 3C6TB 2PQWA 3MPDA 3Q8UA 1QUVA 5KOXA 4B3OB 1G2BA 2DVIA 3MEGB 1QP3A 3M8ZA 4RNOA 3QMQA 5KFDA 1X4HA 1WTBA 2QLXA 4GKJJ 2ZDPA 4USHA 4QT7A 3R5DA 3P8HA 1KS2A 5KT5A 4M95A 3JB9F 2E9TA 4ZGEB 2KT1A 4G3IA 1YZ7A 3BO3A 3CMEQ 3CD5A 5D6YA 2N7YA 5D8HB 4DSKA 2GX8A 3KNGA 2IG0A 4PWWA 1K1QA 2V69A 2ADBA 5L23A 3V5RA 3A8EA 2XWXA 3OYAA 1RZMA 1SCJB 2CKKA 4AFUC 4O3RA 1YJTA 1XMOJ 1HBMA 3VQSA 4EMKC 1HYSB 2DR9A 1SKRA 1JLBA 1FEEA 2PU9B 3RBBB 2CZ6B 4C48A 4W92B 4EO8A 3HP6A 1A7GE 3BQ2A 1VQNS 1VQ6Q 1VQNA 4J9BA 2DX1A 4M7AA 2DNNA 1TZ0A 1RAHB 2GFAA 5F8MA 4HI1A 3MUVP 1ZM2A 3FSIA 4J7IA 3S6WA 1I6JA 4JV2A 5B0CA 3D6HB 1AUSL 2KFYA 1IHWA 3CDWA 4ITSA 3JQKA 3R5CA 5CAIA 3H5XA 2DITA 2RH2A 2DXBA 2VUGA 4TVAB 1UA1A 1PSDA 3VAIA 1TVRA 4AXJA 2VH7A 2JRSA 2FRYA 4M7DG 3OYDA 1IKXA 5T7LA 1QSLA 3UNYA 2VDIA 4BD3A 4RR5A 3HSBA 3D3CJ 1UGVA 3TZYA 3EPGA 1NK9A 2PC6A 2NUPB 2J0XA 1YHQQ 2XLKA 1Y5LB 1CJKB 1V5IB 3CEYA 4FM4B 4KGZB 2D7SA 2KGTA 4PEOA 3BYPA 3TVYA 3IMQJ 1KD1C 1VQNQ 2W0ZA 2VKRA 3CCMA 4JI6F 1CKAA 4ETXA 1LXJA 3BH7B 3MCSA 2EEYA 4PCQA 4OMOA 1XN9A 1IXKA 4ZOSA 5KYXA 4J9DA 1P9QC 1B64A 3V8LA 2YLCA 2FYXA 2QASA 4YB6A 4X65J 5FU6C 1ZOTA 5KYUA 2I9SA 1CEZA 2DGWA 4GRSA 2ACMA 4LBHA 5HP1B 3T1HJ 2C0IA 3NRBA 3OYGA 3CCWA 2MEWA 1Z2ZA 3NWGA 3QZ5B 2BUDA 4AQYJ 2UXBF 3M58A 1WDDA 4RO0A 4H4KA 3BPDA 1KVKA 1XJWB 2FUG9 3SDEA 1RCXB 2ZCFB 4ORZA 3MPUB 5C2CA 3W65A 4NLOA 1MUZA 4NWBA 2PNIA 1XBWA 1RAIB 2XI3A 2DBBA 1MV3A 4HDGA 5DGBA 2HDAA 4WP9A 5HO4A 4XDDA 2HQ3A 5HVHA 5HJXA 1VQ9A 2V50A 1KQSS 2G13A 2UUAF 5LSOA 3F70A 4OJ1A 4F26A 1WQWA 4ZVEA 2K3KA 2R7RA 5IM0B 3M8YA 2EGAA 4ZCIA 4I68A 4M5MA 3DXSX 1YNZA 2VG7B 5HATA 2GBQA 1VQ7T 2FVRA 1BQMA 4LF7J 3FEXB 2KYBA 3AD9C 3KG4A 4P10A 2RQRA 1N0VC 4P52A 1S9GB 1HD0A 1VJWA 4FXDA 1WNLA 5G0RA 4JRQA 4NRUA 2ZZTA 4NLYA 4P5NA 4NCBA 3GILA 3OS0A 1VQ9T 1Y96B 2J6OA 3ZTOA 4QQGA 4LBIA 4YUDA 1X4BA 1KN6A 2JEIA 1RWMB 2XSJB 2CS7A 2MHEA 3GIMA 3VAFA 2PFDA 2HVDA 1C1CA 4QPTA 3TAMB 1E6YA 4A8SA 2RF2A 4URQU 3JCMQ 5HMWA 4A54A 1P1LA 3PIPQ 4B3OA 2FD2A 2ZJQQ 4GVBB 4A8YA 1UECA 1FJGF 1QUPA 5M2UA 3TZXA 2ZH3A 4EU0A 1VQLA 2AEFA 1KVJA 3SSQA 2H1YA 2GMJA 1S7HA 3CDUA 3ZC4A 3RB6A 2AIRB 4NXNJ 3BSOA 2OMLA 2QMUB 1VQOQ 4DN0A 2DF6A 1GMVA 1MG7A 1KQFB 3M55A 1UL3A 1S1VB 1HQ2A 3RYLA 1Q86R 2PMHA 1U7LA 1NSQA 5A0LA 1UVLA 5FD1A 4K11A 2XQCA 2DD8S 3VAKA 4ZP7A 4GLKA 2G2ZA 3J7AN 4RW7B 2IJRA 2IVYA 4A8KA 2YBVA 2HURA 3KBGA 3PX4A 2CYYA 3G8TA 4PKCC 3BGRB 2DMOA 4NPOA 2JW4A 1RISA 1BC6A 1ZQ1A 4IKAA 2OPPA 4X84A 4DCJB 3CMAT 2B4PA 4F04B 2EKYA 3AA9A 2IM0A 4ECWA 4QR2A 2QA4A 1FK9B 4A4GA 4FDFA 5K8NA 3MM7B 4Z02A 4DSJA 2VWFA 4ECYA 5DM7Q 4K0KF 4AFZC 2XMVA 2Y4XA 2KFNA 5L1KA 5ETLA 4OF1A 4BY6B 3CCRQ 2FPEA 2LXUA 3CDAA 2F69A 5CO7A 3ASKA 4AMCA 2DCUB 3DRPB 3I0SA 8RUCA 1F2GA 1T7PA 3HD1A 4J9VA 2I2YA 2A6MA 2UU9J 1WJRA 1Q5VA 2LMIA 4IOAQ 2M9UA 2EG1A 3I56A 3OJSA 4C8ZA 3W2VB 1Q7YT 2X4YA 1RDRA 3F0NA 4N4HA 3D3BJ 1Q7YR 4N7TA 1DTTB 1RTHA 4YHHF 1PC5A 2PEHA 4CQ1A 2DJZA 2XMWA 1U48A 1M2VB 2ZC4A 2QQRA 2D69A 2GVZB 2LQBA 2DVEA 2K8GA 1W2IA 4E7SA 1PM3A 1VIOA 3K8VA 2CUBA 2OLWA 1T05A 4DL3A 4L59A 1WORA 3R7BB 4MIAA 1JK9B 4IO1A 2RNEA 1ZM9A 2ROGA 2L3SA 3IG1A 4KV8B 1R0AB 1QTMA 1PCXA 2UU9F 3CPWR 4PZVA 2LQNA 1HPZA 1TVRB 1RAFB 1SC1B 2HNYB 1VBKA 2OTJS 1GBRA 4B3RJ 3WC2A 5GANd 3T6JA 4ED6A 3HTRA 4E7IA 3IRWP 1M0SA 3OXGA 4LJMA 2O5DA 4DMZA 2Q3PA 4C9DA 4CI0B 3J81E 5D7UA 2J6UA 2DNUA 2L3RA 2HWTA 3LD7A 3ET6A 3SFMA 1EQ0A 3W8GA 4KRTA 2MDAA 1S6QB 4OMQA 3PVXA 5GAOr 1T9WA 5DZ6A 4UOGA 3JB9G 2MZTA 5GJVB 1VQMQ 1T95A 3HKWA 3VS4A 1ZTWA 5BJRA 2XNRA 4F4AA 4PJLA 1TL3B 3JQJA 4U8VA 1HHSA 3HPWA 5DGAA 3AOBA 1QWEA 4QW9A 3HP9A 2XMTA 3Q8VA 3DOLA 1VQ5S 1B34A 2P8IA 4DSEA 3GOXA 2DY9A 2JXBA 3IGVA 2VKNA 4KT0E 1FMKA 3CCUT 4FYDA 5GAEI 1N9RA 3CCRA 2EJFA 3ADAC 3U1NA 5CKBA 3A8MB 1KR4A 2DY1A 4A8OA 3DYAB 2BJDA 1EX4A 1VYUA 4HL9A 2KFZA 4K4TA 3HFOA 1HHQA 4TLQA 1UJ5A 5HQMA 2MWOA 3IWXA 3D6FB 4YR0A 2FLOA 2YWHA 2YWWA 1TL5A 2HVIA 2MLYA 3I87A 3DRPA 3I0SB 4C5GA 1TH7A 1RA7A 1VRTA 3H0IA 2DNQA 3H0PA 5CHCB 5KFCA 3C14B 4JS5A 2D0NA 3EGDA 1QVGS 3KWMA 3ZNJ1 3KK3A 2HQXA 1WI7A 4HA8A 1NKBA 5B08A 3CMES 5GAEU 4ZP8A 5ETTA 2ED0A 4KHRA 1NJIR 2X7IA 1S6OA 5I11A 1TS9A 3UA7A 5GAOq 3HKSA 2AP6A 4I2QA 3UO0A 1S1VA 1KSWA 4R0EA 1YJ9A 3CJ0A 1X4FA 1VQLQ 4EIKA 1LWCB 1U25A 1HNZJ 2Q6BA 4Q8FA 2YH1A 1SKUB 2HGLA 2QK0A 4ZP9A 4GO7X 5L38A 4ZHRA 1T9VA 1EETB 5KFVA 4DUYF 4JJDA 4BWJA 4GBQA 2W8KA 3SFUA 4IG3A 2GGPA 1YIJA 4ESRA 4Y2KA 2B8PA 1ZH5A 3JCMP 2MF2A 5F3TA 1D9AA 4NLGA 2HFOA 4B9SA 4XPEA 4E7ZA 4EZ6A 3L7OA 3I55A 2OIHA 1VQ7Q 2RUSA 3ETOA 2KYXA 3GSDA 2AYEA 5CYJA 4OZLA 3J81U 2KY9A 4DPTA 1M3AA 2HWHA 3D5MA 4C92C 1RT3B 2JOQA 2GGRA 1XQHA 5DDRC 2N82B 3EPIA 5EC7A 2XSJA 3W1YC 5HP1A 4DA4A 1OIAA 1NO8A 2W10A 1FFGB 3D2WA 3CPWP 1DTQB 4EWTA 1NRKA 4OYXA 3LGHA 4Q8EA 4ED2A 3DKDA 2HGMA 2XO7A 2Y1JA 3OPKA 2RK2A 1PG5B 2NUZA 1Q81U 1T03A 2NYHA 2JVOA 4RTUA 1NDPA 1YJUA 3CCZA 2HNZB 4ZCLA 1UZDA 4X62J 3OR1A 2R2UA 4CLFA 2XYHB 3CCMT 3T6BA 3LWIA 1KKHA 2OI3A 1HNVA 1I51B 1F3VA 4AE5A 2V8PA 1WDXA 5CABA 3MPYA 3GONA 3MEAA 1G3OA 5KFGA 4E8UA 1RBOB 4JZ4A 3PR4A 2RHYA 5T7LB 4M78C 2PFFB 3Q8QB 2E7VA 4CTAB 3P49B 3GCXP 3VS1A 2CQGA 1NJZA 4JI8F 2RRNA 5KFKA 2LC4A 4I2PB 2BZYA 3VQTA 2HKNA 2FVSA 4B3SJ 1YDLA 3PRVA 4F0KA 3W63A 3CT9A 4O4RA 7FDRA 3VJPA 4JI0F 3W9JA 5K20B 4YEAA 1YG0A 1LW2B 1ZLMA 2GJIA 3I55S 4EI2A 1ZPWX 1LK7A 3EHQA 3DDNA 2AQ4A 1YSJA 3BBBA 3KXDA 2LA4A 3KK1B 2ASDA 4UC4A 2LT1A 3FBCA 4AT1B 3AODA 2X3WD 3ITHA 3M0SA 4LSZB 4FT2A 4NI2B 3FBFA 2AYMA 3EVMA 5KG2A 2IVWA 1PC0A 3VHQA 5GAMj 4B9XA 1Y3KA 3A1YG 4WJBA 4MH8A 3GQCA 4DV1F 3CCQA 1VIEA 2Z0WA 4C11A 3ZNUA 3VS0A 1SRMA 1JQGA 3U1LA 3K57A 3GZ7A 4DV6J 3SWNC 4IRDA 2D0QB 4QIEA 1VS3A 4CZCA 3M0TA 4NL5A 4C8QB 2DH7A 3PE0A 3G6EA 4B3TF 5KE3A 3JB9H 1TL7A 2UUAJ 3DOMB 3NMRA 1V29B 4LF9F 2JN0A 5LXYA 5ITHA 3K7RA 1EKSA 4OX9J 3M1VB 2HFUA 1FWPA 4I64A 2FHJD 4UTGA 1G6BA 4P6QA 1H92A 3W66A 3GP8A 1FCAA 2MQNA 1BWVA 3NMZC 4P73A 1HR0J 5KT3A 3C15A 2RD1A 2DZCA 3KK3B 2DR6A 2LKZA 1LOJA 2GJFA 3D54A 2JTEA 3QO9A 2KT5A 1Z9ZA 3N6NA 2AZ1A 4PWDB 1JO8A 4LNPA 2BJ9A 2GO8A 1V3RA 2QYZA 2C2MB 3W2WA 1VBZA 5J1EA 4J6WA 2DL3A 2NXUA 4M5DB 3PFSA 1Z2LA 4Q2MA 4M7DC 3BKUA 2DNMA 2RS8A 4IDKB 4DQQA 2DK3A 1BIAA 4J7FA 1S72T 3QPIA 2CP3A 2IM2A 2HMIB 1FO1A 2RHQB 5DG8A 4DG1B 4JI5F 4N4GA 3PYGA 1CVJA 4ZPWR 5FROA 3W7BA 1H72C 3MHXA 2LCLA 4TKTA 2PEBA 4PJNA 2RQKA 2YPYA 3JB9J 3NOCA 4RCCA 4C92F 2J9DE 4YB1P 1KQSA 3TAQA 5GANj 2DH9A 1MN7A 3HK2A 2UXCJ 3M6UA 3UT1A 3OFGA 2Z56B 3N0VA 5HKCA 4CC7A 3KG0A 1S72A 1WWHA 3I0RA 2PN6A 1YJWQ 2BZ2A 1RUSA 2AU0A 3L2VA 4C4WA 4IOBA 2DHSA 5D0RA 4IG0B 4DL7A 4QW2A 2E5IA 4N77A 3DLMA 4F67A 4OL8A 4ILLA 2HBRB 1QVFS 4F4KA 1VQ8A 2LP5A 5JJBA 5KT7A 1FXXA 2CDQA 2HHWA 2DETA 4YHHJ 4DHVA 2OPQA 1ABOA 4U95A 3N9UC 5IOLA 4UT4A 2PO4A 2YHTA 5GAGU 4BC7A 1CC8A 2IIMA 2MZRA 3PEJA 3TJAA 1UZHA 1GMWD 4HT9A 5FJ4A 4KV8A 1FKPB 4M5JA 4KHMA 2HNZA 1X60A 2VXEA 3FMWA 2QG9B 1K9MT 2FLNA 2B43A 1RSCA 3OSVA 4M77E 2CP2A 2XSFA 3ULRB 2AKWB 1LW0B 4LF6J 1Q82R 2OTLT 3I9ZA 1GCQC 4F17A 3HJVA 4ZVFA 2P2CB 3G1JA 3L7UA 2YKMA 3ITHB 1MGQA 3FUYA 1GT8A 2RHUA 3MZIA 2M51A 2BKOA 5DG7A 3TA1A 3PV8A 5F8GA 5HLFA 3DMJA 1XIQA 1WD6A 1HNIA 1YWPA 4ELVA 3GFZA 3ILIA 3LX7A 2VG7A 4USJC 5AYFA 4WK3A 1LWFB 4RWXA 5I21A 2YX4A 2EJ9A 3BSNA 3FBEA 2D74B 3MR3A 2VBXA 4Y34A 2RKIB 3LOUA 2BYCA 3CC4T 2BABA 4WBFA 3HXMA 3T5HA 5K8MA 1XNQF 2E3HA 2COWA 5CYMB 5D3GB 3D28A 1S59A 5C42A 4A8WA 2CVIA 1S72S 4A46A 1HFEL 1U0HA 1ZX6A 3GIKA 4M8LA 1LJOA 2CQDA 2XCAA 4X65F 2QFJA 2XNQA 3CJRA 3MEGA 3RTVA 3SHWA 2E6ZA 3KOAA 1ULRA 2C22A 3RMSA 3CIMA 2KZZA 2B9XA 5EX0A 4RTZA 3MJXA 1NG2A 1HNWJ 4DR2J 4M78F 3VYHB 2A7YA 4B3RF 1A6LA 2Y0BB 1RWOB 4J37A 1DTTA 4CO1A 1HW8A 1VHFA 2RT3A 3DDIA 4WTYA 1SPKA 2GJ2A 3I0RB 1S10A 4JJBA 3BGFA 2J9CA 3OW2S 3J7AF 4LRCA 1IBMF 2D3ZA 1N52B 3PO4A 1SQFA 3OUYA 2MY7A 3D67A 4JI0J 2J0WA 4AL6A 4G1PA 1LWCA 1PCAA 2E1RA 3D9BA 5EDWA 4CNZA 2GIRA 2PIIA 1VQLS 1VISA 3KHHA 2IMWP 1RI9A 1JX4A 4DR7F 4DQPA 2IA0A 1Q4RA 3EDQB 4U6PA 3D1OA 2VFSA 4I6YA 2FZKB 5BR8F 2E29A 2V63A 2HNIA 4A8MP 1EP4A 4ZJOA 3DC2A 4JI5J 1NK5A 4FSSA 2FB0A 3L9ZA 1JLCA 2L89A 2DXFA 3HHEA 3UNGC 2C1EB 1EX8A 2YUPA 2KU7A 2L0AA 1SJ1A 2V4QA 4ZPDA 1OU8A 5EWEA 2ZH6A 3WDOA 1GX5A 2U2FA 2EBPA 5J2QB 4OP0A 3UN2A 2IRYA 3KLFA 2GHVC 5BYSA 3MM6B 3ILJA 5DM6Q 1VIFA 4UW2A 2Y1IA 1PRLC 2OPSA 4PLLA 5D6XA 5ETQA 4PJMA 3KLIB 3LH0A 2EQIA 3SB2A 3EXCX 1HBOA 3R5BA 4YR3A 1SV5A 5A0YA 4RMOA 1HBNA 2IJFA 1G3SA 5IT4A 5IT0A 4KH1B 1G4CA 1OPKA 1Y0MA 3P6YC 4RW8A 1N32F 1RKIA 4RNHA 2H65B 4MK7A 1ACMB 1S1WA 1DARA 1LWEA 3FEYB 4F4ZA 2EC0A 5KCHA 1JIHA 1SB6A 2KYZA 1S6PA 5L46A 2ED1A 1WC0A 3OYJA 2DIVA 3LAMA 4LMZA 3EYZA 2ILZA 2PVOB 2KB2A 2ZHAA 1TKTA 1XNIA 3GWCA 5A6WA 3LAKA 3PW5A 1HQUA 3J7YU 5DLQE 5D77A 5GAOl 4YB7A 4XQ3A 1U1MA 1AROP 4K2XA 1KD1R 4J9CA 3J81j 2K3IA 1FA0A 4M7AD 3JSBA 1NHUA 1PSEA 5FRMA 2W2QP 3HL8A 5GAOn 5ADZA 1UVNA 2AJ1A 4FL6A 3C16A 2YNFA 2GTJA 2M70A 1SJRA 3AHUA 1S6UA 1RA6A 3SSSA 4PWUA 1HQUB 5LMUJ 1C1CB 3UW1A 1K8AR 1APSA 2N4CA 5IZHA 3CC2S 2V94A 3T41A 1BI2A 2GQIA 2M0OA 3CO0P 2IBOA 1TKZB 4P2SA 2MSSA 3AHPA 3LALA 1RUWA 3QWUA 4NLVA 4M7AE 2HK3A 2QXFA 3S8SA 4L72B 3FQKA 2VODA 4XTZA 1RT2A 1AZEA 4KUDK 1GL5A 1U6ZA 4P75A 4M7DA 1BCMA 3POTA 2MCNA 2OPRB 4ZLNA 4DX8H 3CQTA 4ER8A 2XI2A 4A0TA 1M2OA 4HCKA 4RNFA 3BM7A 5J2QA 1OYEA 3NGKA 4Z89A 4DL5A 4PRFA 1U49A 1SL1A 4L76A 4IR1A 3UA6A 4Z7YA 1X9WA 2WSFE 1RKJA 3QPHA 1S1TB 3UCGA 2NQPA 1H74A 3RRHA 1XR7A 5GANh 3GLXA 1TFWA 2C2KB 2VFTA 2WVDA 2CADA 3NCRA 1HJDA 2IRXA 4OYBA 1DQ9A 1IHVA 3UF4A 4FS2A 2DNGA 3QBYA 2JOYA 1Y4ZB 1KHCA 1S4EA 2ASJA 3HRSA 3MAAA 4I2PA 4NA3A 4DX7A 4CLLA 2DIQA 1WOSA 2ZPEB 1OYXA 3CO9A 4Q44A 4KKOA 3V4MA 1YI2Q 3WX4A 4ZVHA 2LZ6B 3MEUA 3BEGB 3R6GB 4MAKA 1OS5A 5G4DA 2ZH1A 3G2XA 4X34A 2KHCA 3MR5A 3CCJS 5K8OA 3HHKA 2RHIA 2K3BA 2LJ3A 2F8HA 1KTVA 4Q45A 3LP2A 1WKJA 4OJ3A 5LJ3Y 2MLXA 4M75G 3OV7A 4F7UG 4JI2F 1YJ7A 4U8YA 1VYTA 1LNXA 3Q24A 5A76A 1Y57A 3OMCA 2VASA 4O5VA 1FJEB 4RUGA 3CC7S 3CJ5A 3W5YA 1T9YA 4ED0A 3MMAB 3RB4A 4FVCA 1ZSZB 4IUUA 1GCQA 2PMZD 5LJ5g 5C25A 4IR9A 4ES2A 3IXQA 2CQCA 2DRKA 2G0IA 4HH0A 1YI2T 4OI2A 1FE4A 4C7QA 2DERA 3CJQA 3THTA 1ZBXA 1QVFP 2JJ4D 4U96A 4F3QA 2V8HA 2QMWA 3K89A 4DOZA 4FXVA 1DHMA 3QZ8A 4GKKJ 2FC9A 2LTOA 4I67A 2R9LA 1YIJS 1N8RC 2M1HA 4CLZA 4RW7A 3HSGA 4AUKA 1BUXA 2K2MA 3M5AA 1WDTA 3HVTA 2HHUA 5KG7A 1QVPA 3MURP 2NUTB 1RYRA 3K5LA 4WCEQ 3C4SA 4LN2A 2PI4A 3I56Q 4E7JA 2RQTA 1FJCA 3FDSA 4F14A 3KMQA 3QT8A 1NZAA 4DCPB 1Q95G 2RRAA 2DJWA 4EYHB 1SRLA 4LF1A 1U2RA 3KUGA 3QRQA 4M77B 3SD4A 2HBQB 4NXMJ 3E8OA 5KFYA 2JT4A 1B07A 1Q8BA 1OQKA 3BN4A 1BE4A 3TEHB 1YHQA 3UD3P 1NBEB 1UA0A 4PG7A 2AGPA 2HWIA 2HAXA 2HHSA 3PFEA 2MQ8A 4HCBA 3ZZRA 3FIFA 4C8MA 3CJ8A 1VQ9Q 3DLEA 4DEZA 3W9HA 2EBEA 2B9WA 1N56A 1TK0A 4WTOB 1S49A 2VA2A 1BQXA 4B9NA 1IM4A 5D4NA 1RWVB 5MLCV 4N0AC 1MSWD 3QDFA 1NJXA 1HARA 4CO2A 6AT1B 1WG4A 1FESA 3DM2A 4OLOA 3QT7A 3U02A 2V68A 4AFQC 2HSPA 1EARA 3B4DA 1NHKL 4K4YA 3T1AA 4J9HA 5D78A 1BKBA 1LPLA 2KL8A 3AB4B 2RMLA 2LVWA 2KG1A 4FS1A 4KUIA 1AA1B 4LF5J 1Q0NA 4PQUA 3VKIA 1GX6A 2FZGB 2VFVA 3PJ9A 1HQEA 1FFWB 2GHWA 1LCKA 3B54A 3CIZA 4DSIA 4DR1F 4DG1A 3PO5A 3CDBA 5AE3A 4Y2MA 3QSIA 2RJEA 4WF2A 5HCKA 1KIKA 2F5GA 1X0FA 3R5GA 4M75C 1GTHA 4LF4J 1TV6B 1VQMA 2WSCE 1O5JA 3VGTA 2DEIA 4MKAA 2D9PA 1OV3A 1HHTP 4JJNK 1PNJA 3BDPA 4BC9A 2OFHX 1QAIA 3AAWB 5GAN3 1D0ZA 5CCAA 2K3YA 1YJVA 2DTIA 4X1VA 3ENWA 1NLPC 4QJVA 3CPFA 2WSEC 2W7OA 4TVRA 1VQMS 4C8QD 4PG4A 2ZBRA 1XMQF 4PJOG 5GAN2 1VQ6A 1RB0A 2NR0A 1AWWA 3I5BA 4FW2A 5HAOA 1IZ6A 2C3PA 4ECSA 5GMEA 3G7ZA 1GFDA 4M5IA 1FRXA 1V9OA 1Q8KA 1U4BA 1AUDA 1VK8A 3HHLB 3A8IA 2J5AA 2LP4A 3S6EA 2ZJRQ 2VGNA 1C0UB 2LXFA 1RACB 4AL7A 4M7AC 3JS9A 1S77D 1WEZA 2Z8QA 2CNLB 3TNVA 1ZUUA 4BB7A 1PGZA 1YWOA 4EMHA 5KH6A 4JBCA 1VQPS 4OZNA 4R25A 1R0BG 2OTJQ 3NKYA 1Q5YA 1O8BA 1RAAB 2CPJA 4PUOB 2IYIA 4KYZA 3PJXA 3NTKA 3FDRA 5HBMB 4CM0A 2C2ZB 2EFIA 1KQKA 2L5QA 4I69A 3DHXA 5AE1A 2ZFHA 3K5OA 2CXEA 3HJFA 2BMBA 4M94A 1RCOB 3TVKA 1VQOS 4H4OB 1F60B 2E6NA 3PX0A 1JBMA 3PNWC 3CPWA 1CQNA 2P4TA 3CPWS 2GTOA 4MKBA 3CXCP 2C28A 3ENVA 2E4HA 2G6FX 2RF0A 1NSAA 2KE9A 4F02A 2GAHC 1QJHA 3CCQQ 3W3SA 4GY5A 5AXLA 4IH7A 3CC2A 5GAMd 2XS2A 2XC9A 4DBQA 5HMYA 3G86A 4M78G 4OYMA 4QVZA 3SI8A 1OPIA 4DFKA 1Z9QA 3QWYA 1NXIA 2LU2A 4K4VA 3DMJB 3OHAA 3CC7T 4DR7J 5IAYA 4DDFA 1TWBA 2DFUA 5FDLB 1RQ0A 1VR6A 1M8VA 5I42B 4DF8A 4P9SA 1L3SA 3CCST 5F8NA 3OS1A 2B5JB 1AFJA 4OHWA 3CF5Q 4MIWA 3MAQA 4MYUA 3IQLA 2DGOA 4ED1A 4GLMA 3IRXA 4LF9J 4A47A 2HQFA 3PW0A 2MGZA 3OYHA 3IM9A 4ALZA 1VUBA 3G4SQ 1QVFA 4C8KA 2CAJA 2MY8A 2OGUA 3ZTPA 2DTJA 3R6LB 1Y07A 4F7VA 3BYRA 1PIEA 2JZ5A 4TNOA 4AFSC 3DN9A 3KJVA 4C5HA 1T0JA 4BY6C 1KRPA 2JC0A 4LFCJ 1NH8A 3MOZA 2YKMB 4IQMA 3WXMB 1HWUA 2OSQA 4P2XA 3MM8B 1Q78A 4MMKA 4YP3A 4DL4A 2CFXA 5D4PA 2DL8A 2B4UA 3OVAA 2W4CA 4DV4J 4JPBW 3DU6A 4ZVSB 4EZ9A 1PYTA 4XTWA 2C2DA 2EQUA 1TAUA 1FKOA 1T9TA 2L3PA 4O3PA 4CH1A 1JJ2P 3ONQA 2QYCA 5A6PA 4OZ3A 2ABLA 1W2BA 3CJ2A 2YWGA 3KLGA 4O3NA 3MEDB 3DDKA 1H2UX 2FVCA 3U23A 3NNCA 1YRUA 5FRNA 4ZA1A 3JSRA 2XMAA 2VG5A 2EGEA 3VVTA 3I9QA 2EFGA 4NLDA 4JI4F 2B86A 2I5JB 4CTAA 4X64F 2W9CA 4X4PA 3X1LB 2VL1A 3QJ6A 2NPIA 1WC4A 2KVIA 3NGTA 5LJ5d 3US5A 3UR3C 1FWLA 1FEHA 1IO6A 2IAJB 4CT8A 3HFZB 3VV2B 2YH0A 1Q7YC 3JCMb 1ZSZC 1I4K1 2X3DA 2BJ1A 3V8KA 1AT1B 2JL9A 2W9BA 2QE5A 5I3UB 1IRXA 3R8YA 2ZITA 2GW8A 2CVEA 3NS6A 1AD5A 3DLLA 4C3KA 4EPCA 2LJ1A 2M5YA 3O8WA 1VQ4A 4NI2A 1NB2A 2ZAEA 3AD8C 4DV7J 3UCZP 3IBCB 1KC8T 1D9DA 3PZPA 3PDNA 3VALA 1U1QA 4DPOA 1KOHA 1U1RA 2XBPA 4OB1B 3Q89A 3JCMJ 2XTJP 4EMGA 1H2TZ 2PSZA 4OLPA 3X28B 3W2VA 5KG5A 2ACYA 1P1TA 2AK5A 4XTVA 1ZSZA 1UB4A 1X5TA 2WSCC 4A48A 2VBZA 3R5AA 1X9MA 3CMAS 3CD6Q 3SBMA 1R8CA 3OL6A 4OMNA 2EBGA 3VRZA 1J2VA 3M9NB 2CRLA 3J7Z5 5CKEA 4P2MA 2PE8A 4KRWA 4PABA 4DJBA 1Z4UA 5GAMh 3H0FA 1RHRB 1QE1A 1QCNA 2BE7D 1UFWA 4F7UB 1OPZA 4OV6A 3W9IA 3PACA 4H4MA 2RQMA 2IDEA 1GNKA 4TQRA 1N36J 3PM9A 4ZCMA 1AB8A 3M2RA 1B34B 1Q81T 5B0FA 4ZVOB 2OI2A 3CCJT 1W2BP 4QYZJ 2AV5A 2YWKA 4HKEA 3POTB 3RRKA 1VQ4Q 1VDHA 3QDRB 3W5XA 4JI3F 5FU6B 2LFVA 3FSYA 4ECXA 1VQ7S 1RABB 1X43A 5KYYA 4NL2A 4NLUA 3SEMA 3JCMd 1FXRA 1SQEA 1UKUA 4UY85 2HL5C 2YKNB 3OTOF 3D6TB 1ROFA 1N4LA 2F7VA 1EB0A 1QSYA 2HRTA 5F8LA 5I2SA 3PXGa 2FL7A 4F7UA 1S57A 1ZM4A 3GV8B 1KFDA 1ZAXA 4M5DA 2YNIA 5FLXU 1O9SA 1F5CA 3OBIA 4IYQA 4DLEA 1T0HA 3NXZA 1JJ4A 5KFBA 2YXYA 5A8WB 3M4YA 3TQ7P 4LREA 1WJQA 2IFXA 1Q1KA 2KDOA 1RT3A 1SIWB 1Q16B 1FNXH 1QKXA 3HO1A 3RNJA 3MECB 2R3VA 5HK3A 2IVFB 2CG8A 4LFAF 1XR5A 2O01E 2B8QA 2BBEA 2F4VJ 3H25A 3CD7A 3DYAA 2CYZB 4HHJA 2DHGA 2EFPA 1YWXA 4RL1A 2OH2A 1ZETA 3BDLA 3BW1A 3I96A 4DV0F 2AKKA 2GNCA 2IA6A 2BKNA 1SKSA 5D3GA 2JZ2A 3TJ9A 2KRNA 2E5GA 3ETMA 4QBUA 3FRZA 2XG8D 4L6V5 2CP7A 1OSDA 5GANg 2MMPA 3LP2B 4YQWA 4P71A 4I6WA 3JYTA 5SZTA 4WXOA 1WELA 2G2YA 1UGRB 1UEBA 2NUPA 2CZVC 2RB6A 3H0HA 3D6MB 4RKUC 2H51B 2K7JA 3T19A 1AZSB 2P0QA 1IXDA 5EWFA 4FSXA 1YLXA 3A8HB 3OMGA 1KOOA 2QDYB 4QWBA 2Y8WA 4Y0FA 2W4PA 1X5SA 1AW0A 1YHQS 1N5YB 2MLZA 2QO3A 4ELZC 1ZHIA 4PPZA 2BW7A 4ECZA 3BN7A 3HHLD 3CC2T 1D1CA 4ZPAA 3MOJB 2FZCB 4J90A 5KG6A 3RJMB 4DV3J 4JRIA 1BMQB 2RRBA 2PVDB 5EUHA 2AD9A 1E6YB 1I0CA 3HDSA 2FO0A 5KTQA 4CC2A 1PC4A 1S7IA 4FF3A 1GXUA 2B7BB 2CP0A 2P0KA 4YFUA 1TG0A 1HNZF 1SSFA 1DLOB 4M63A 3OSNA 1Q53A 5KOWA 3L7PA 3MXHP 2MQOA 1RK8A 3M32A 4NCGA 4R55A 2M4MA 2AJ0A 1CQMA 3IAS9 4Q7AA 5A0GA 4M78D 3PVLA 4DWIA 3M6VA 4ZVPB 2O4XA 2Z57B 1FHTA 2IM3A 4CC4B 4A4KA 3C6UB 3MM9B 1WZOA 1KC8R 5CYQB 1NJIU 2PGCA 1X6OA 5HL7Q 3NCPA 3H8YA 3M0RA 3LPYA 5FU7C 4B9MA 3VWSA 1YJ9S 2WB4A 5ETVA 2ZPIB 4DV5J 1B0TA 1VQLT 3OBWA 1NCLA 2HS0A 4UY8T 1UWBB 2FVUA 3MM7A 4M78E 2O3DA 2FY1A 4ZN3A 3PVQA 1O0PA 5A8RB 2YVSA 3DLBA 4ID5A 3CC7Q 3V7SA 1K1ZA 2W1BA 3MR2A 4C8QG 4U7UD 4CP5A 1EQMA 2J6SA 4DXLA 3RKYA 1N0UA 3RR8A 4JUVA 4O3OA 1IQTA 1RU1A 4RW4A 2FJAB 1QW1A 2XYGB 3HULA 5DDPC 3PR5B 4KGKA 3CCJA 2WVCA 5GAHU 2OUGA 5FWCA 4QU6A 2LX9A 3GJRB 5CXTA 3QRRA 1S0OA 4PJOF 2CQ4A 3E2EA 2W2NP 2I1RA 3VZHA 2PMWA 3M9MB 2H8HA 1UAWA 5F8JA 3CCLT 1T05B 1PJ7A 2EJGA 1C2PA 4DN9A 2NLWA 3ICLA 4KC5A 3S3OA 1RWXB 2HQHA 1C1AA 1IBLJ 2AGOA 2WW4A 4N8NA 2MGZB 2X1BA 2YNHA 1UVJA 1N8RU 3SV4A 3MR6A 2D6FA 1TSFA 5F3ZA 4QQDA 2KMTA 2XS7A 1H6KX 2OPSB 4KT0C 3G8QA 3CB4A 2MHNA 4HI2A 2DYAA 2C3OA 2HEKA 1SEMA 3GJTB 2FHMA 2J9DA 5LJ5j 1B0PA 3AQPA 4DV1J 2ZOMA 2JEFA 2X4WA 1OZ2A 2DTHA 8AT1B 1BI3A 4PJOB 2CSQA 1BGXT 4TY9A 2M7SA 4ATNA 3TAPA 4RBVA 4OV1A 5THWA 1QKWA 4H4OA 1PD1A 2K5LA 2MAMA 2ZVIA 3K2YA 2KSSA 1IBKF 2EW3A 2R8IA 2ZBCA 1I07A 3SV3A 5AJ3J 2HIQA 3EG2A 3LH5A 2A1BA 3M8SA 5BR8J 3QJJA 3Q8RB 1UPMB 1Q79A 3CC4A 2WOMB 2W8LA 5GJWB 2D3UA 5LJ3j 1VQYA 2QA2A 1M4ZA 2XGPA 1S1UB 3HZEA 2XMFA 3KLIA 4QOTA 1JLQA 4C5IA 4I4BA 2Q66A 3JAMU 4OZJA 1RTIA 1U5SA 2ZPGB 2GNKA 4C92B 3OW2P 2X51A 4A4FA 4CLSA 3U7JA 1G2EA 4OYPA 1WG1A 2CJQA 3R3TA 2UV8A 2VJVA 2QA4Q 3G6ES 2IYGA 2UVWA 4CC3A 5DS7A 1CS4A 5K14B 2DILA 2SEMA 5DLFA 3WX8A 3NOGA 1LQ9A 4JRKA 5LJ3d 2VB6A 1LW0A 3T1YJ 3QGIA 3JCMh 1VOMA 2JDJA 4FPRA 4PUOA 1OWXA 5CZXA 4Y6IA 1C1BB 1WF2A 2MMYA 2RF2B 4IUTA 2AGQA 3IS9B 1IGQA 1W6XA 5C0MA 2X3GA 3FJ2A 4PXCA 3JCMg 3CCRT 3RESA 1R8AA 4DL0C 2L48A 1NM7A 3OL8A 2RKIA 4R8UA 2XB2D 3QO9B 1EFNA 3K59A 1FJ7A 1D8YA 3OFHA 2VOOA 1A9NB 2EI5A 2QTVA 1VQ6S 3CCET 4FU6A 4AG1C 1UVIA 2YNHB 1FX2A 2FVQA 4PK4A 4G65A 3T9NA 2UUCJ 2RU3A 2V8VA 4KFBB 2QQ9A 3CE8A 4O6JA 4RWWA 5KG4A 3CMEA 4N56A 1BB9A 2OAUA 5GAOp 3IBFB 3OT9A 4PQAA 3PEHA 5HBMA 1KFZA 4BCAA 4OVAA 2RD5C 1PYSB 4RNNA 4IG3B 3IR7B 2KKHA 4K5SA 4NLQA 1OO0B 3KFWX 2ZM6J 3V81A 3DNCA 1KP6A 1VLYA 3VU3C 5I42A 4IO9Q 1RHQB 3SYZA 4UZBA 3TCJA 4UUXA 1BK2A 1U6FA 2AJQA 3B6BA 4NLTA 2HL3A 4D3GA 1GMUA 1D0EA 2OJ3A 4A4EA 5ETSA 2V1QA 3TA0A 2A28A 2A08A 4F7UF 1YI2A 2C3UA 4DR3F 2JUFA 2DGXA 5LJ3e 1YKWA 2GMHA 2CQ0A 4USKA 3L09A 1VQKS 2W9AA 1FKAF 3AJ2A 1HYSA 5I22A 1FTRA 3GYXB 4CO5A 4GVBA 3C0CA 1GTEA 4LF8F 1HBMB 1W25A 3CCVQ 1J5OB 1U24A 1B7YB 2ZJPQ 2MTLA 2HQCA 1IQZA 3MHYA 1UJYA 2QEXA 5HMXA 3NGRA 5HQ8A 4JI8J 1RHUB 3KK2B 3E9GA 4C8LA 1Y7XA 2HS3A 3H59A 2D8HA 3PCOB 5C24B 1UEUA 2A36A 3Q2TC 4XK8C 3M4XA 2BQUA 1SC3B 2EKOA 2K4YA 4XPCA 3HT0A 4PKDB 1XTDA 3ZO7A 1WSRA 1VI7A 1Y96A 2K57A 4O4GA 4BI8B 1F9HA 4Z88A 3D0IE 2XZTB 1LVKA 4RLEA 4ECQA 1U1OA 2FDNA 3BFMA 4KO0B 4DOWA 1VCTA 2YY3A 2YXLA 1M90R 2Y1LB 1X9SA 2O88A 4RNMA 3OXLA 2MZSA 4UF4A 1F2HA 1Y71A 5CKDA 1WKLA 3IA0A 2O31A 5T41A 5LOQA 3CNQP 2K06A 4R8UB 5CR2A 2FGOA 2JTMA 3PX6A 1RLDA 3HZGA 3K5NA 4J9KA 3FMBA 1UJ4A 5LJ3f 3NTHA 3A8JA 1T3SA 1RTDB 1QVGP 2KN4A 1M90C 2FQQB 3EG1A 1VQ6T 4M5LA 2UXDF 1X31C 1HW9A 3LLRA 1FVSA 1FKOB 2UUBJ 2YNFB 2DAQA 2CT4A 1UFKA 3ISND 4P74A 2BJ7A 2DLPA 1MMNA 3RBZA 2DJQA 3CCJQ 2CGHA 2XMKA 3UDLA 4ZIWA 3QGGA 4DQRA 2E1AA 3RAMA 2YQ1A 1B7TA 3JRZA 3CUNA 4DUYJ 2YQ0A 2RQVA 2R7TA 1SV5B 3CMET 2UUBF 2QA4S 1XMOF 2NXCA 3OQ5A 1MNEA 3L42A 2DD5A 4F4XA 3MFHA 1WLPB 1QAYA 4GKKF 3CC4Q 3BGLA 3I56S 2H5EA 2DH8A 1TUGB 3CD6T 2DIGA 4BI3A 1ZAVA 3J7ZT 1IR1A 4IRKA 3O44A 4M4ZA 2N7CA 2RS2A 4QYZK 4MYTA 4GC6A 2V6AA 3OS2A 3OL7A 1URRA 2VIHA 1DLOA 5HY6A 1T3LA 1Q86U 1G83A 3NGPA 1G7CB 2CQ1A 2W4DA 1I5OB 4LDXA 1AYEA 4HT8A 5ETKA 2IPOB 3N01A 4ZGDB 3LW5E 1ZAWA 2COZA 2JM8A 2EG2A 9ATCB 3TO8A 2F9JA 2MPXC 1AXQA 5CH7B 2EYQA 1DZ5A 3SQOP 4CYUA 3EZ5A 4M77C 3DRSB 1H98A 4L5GA 4JRPA 3FFIA 3PIPA 4DU7A 4D8KA 2H4WB 4CLKA 4CIOA 2KI2A 2MQMA 2IBKA 1IB8A 2V67A 1WPYA 1RWNB 3D0GE 2K7KA 5E2QA 1SJ4P 3JCMW 1NK8A 5JVHQ 5E3QA 2VKZG 2LNVA 4WWSA 1TKZA 3TZWA 1VJQA 2W7AA 4XTUA 4LQ9A 3CJ4A 3BDEA 2L08A 2PD1A 1FRKA 3EXYA 3DLKA 1I8FA 1TL1B 3GSIA 1OZ3A 3JYTB 5IXFA 4NZ7A 2AW0A 3IBWA 3JB9k 2Z2YB 1R7IA 3PKYA 2VUBA 4X4NA 1N27A 1F1BB 1OU9A 1N6QB 3OR2B 4MZTA 1M1KC 3MAHA 4X4SA 3IN5A 2JVRA 3ZBDA 1EAYC 4C92G 2DXUA 4NASA 3JTOA 3R2DJ 4C92A 2Z2LA 1B7FA 2QN6B 2FHDA 1IREB 2M8HA 3WVDB 2E1CA 5GMDA 2MSTA 3NAIA 1TL4A 2MJNA 1JB0E 1WXUA 4L6V3 2ZVSA 3CCTA 2VPWB 2FG0A 3FCWA 1WC6A 2WSEE 5A2QU 2E5JA 2J7IA 2PDAA 1EJ7L 1GFWB 2FJWA 2JM9A 3PW7A 3REAB 4MZMA 5DM7R 4ZVTB 2RK1A 5C25B 2QTWA 3OR2A 1KFSA 3CJKA 1UGSB 4ZS6A 3AJDA 1REVA 1PAUB 5LJ5e 4WYWA 4OYIA 1X5OA 1R8BA 4ZP6A 1YBUA 4O4GB 4C3LA 2CWKA 4NS5A 1CULA 2I8EA 2XLJA 3NL0A 1S1XA 1M1KU 3MMCB 3R2CJ 5D6GA 3W61A 1NMEB 1QMCA 2R7UA 1NNDA 2XYPB 2GAGC 1LXNA 2X4XA 1JWWA 1TKTB 2A3LA 3HVTB 4LRFA 3HPOA 5D0HA 2QC3A 4KFBA 1P92A 1PJ6A 4OZ5A 4CM2A 4O44B 5E5NA 4NYOA 2BX6A 2E5LF 5FW9A 2BIVA 2ERRA 3OYLA 5L1JA 2W9CB 3VAMA 5BYQA 3QXEB 2HHXA 5KFMA 2FHOB 5E41A 2CQ2A 3MUMP 1Z1ZA 4DV6F 1PO6A 2HRUA 1JNRB 3M9QA 3WIUA 2DVJA 5CKFA 1RTHB 3GTYX 3C16B 5I4MA 1JLCB 3LWLA 1T3OA 1WIEA 5GADI 2MYSA 3DGVA 4H4KC 5GMKa 2X4JA 2VF3A 1NK7A 1WOPA 4KBIA 2GFFA 3M8QB 2ZH7A 2QGFB 2J0QD 2I6WA 1K4US 1HL6A 3CCVA 1B99A 2R7OA 2G0CA 4BACA 2QTXA 2F8MA 3HD2A 1RHKB 4N4IA 4F25A 5H9FK 1HWLA 3NS7B 3R97A 3IR6B 3MM8A 2IRUA 3IO1A 5ECAA 1TFYA 2E7XA 3K5PA 1FTCA 2OTJT 1D0XA 5GAHI 1JXLA 1IBKJ 2C42A 2OPRA 2LNHB 2GCFA 2ZPBB 4LSNA 4UUWA 4JI7J 2VFUA 3WBZA 3PYDA 4HCZA 2I38A 5J3BA 3NTIA 1QD1A 3M2VB 1UHCA 2AZ3A 3R6NA 4LSLB 5J1EB 2V26A 2JC1A 1BHNA 5KT4A 1YIJQ 4FF4A 3QLHB 3P45B 2AKLA 4NMLA 1TR0A 2ZBPA 2F5KA 2RJZA 3E01A 3BDUA 2C0OA 4ES3A 3CD0A 2JVVA 3H6ZA 3OVSA 1F9FA 2M0YA 1ZUYA 5IN1A 1NLKL 5GMKj 3VYGA 5DY9A 5KFZA 1GEHA 4TN2A 4R5PB 3GJQB 4NE9C 3OLAA 1MN9A 2GF7A 1PD0A 2MPUA 4KHPF 4P7TA 5CCMA 4B3MF 3FGVA 3EJMA 5KG3A 2HKEA 3QRPA 2MB0B 2F2VA 3HRTA 5IV3A 5GAGI 1X27A 1OX8A 1IKVB 1HD1A 1NPKA 2DNRA 1V6HA 3CCES 1AWJA 3QQCD 1JLQB 3H5UA 2A10A 2NZCA 1YJNA 3JAMY 5GMKh 4F36A 2QL7B 5HLFB 5E3CA 2HHHJ 5IXBA 1H3HA 3TI0A 2MOXA 2VYTA 2ZUGA 1CJUB 4D3HA 4M5NA 4PR6A 2NXJA 1LWFA 2GV1A 3M59A 5ETOA 5KAKA 3QATA 2DL4A 2O4XB 5KFLA 1UFLA 1U26A 2VD3A 4CNYA 4J83A 4DUTA 2ATCB 1YJNQ 3A8KA 1UVMA 5IHIA 2K6DA 2XM3A 4KO0A 4B9WA 4CLUA 4YY3J 4K0KJ 2QAZA 3QWPA 2V34A 1LNQA 1T02A 4AG2C 1FX4A 4H4MB 2VGMA 3TYTA 1WKKA 4YTLA 2OTLS 1WHMA 1FX7A 5EHHA 3Q8SB 1VQ5T 1MU2B 4F4WA 2YUQA 3EH2A 1F6TA 2D3OR 4QKUA 4C0BA 1D9FA 2WSFC 1SXLA 2B4OA 2DO4A 3JSMA 1C6VX 1W7WA 1QWFA 3JCMV 4ZLLA 4CLPA 1O75A 1D3BA 3H8ZA 1WHLA 4KPCA 1OPLA 3RUBL 3OTCA 1AOJA 4WE1A 1HXDA 2XMMA 4TQSA 1M27C 3QFWA 3OB9A 3HVRA 2U1AA 1DJ7B 3VS6A 1VHIA 2LVMA 4MZPA 2BRLA 4NLXA 3GLJA 4UQTA 4R0KA 5IT9E 4ZITA 2JLEA 3U1MA 2HVHA 1K9AA 4RTYA 2XKOC 3KJFB 2Q6CA 3DRRB 4AQYF 3I82A 1SKWA 4C11B 5CK9A 4J9PA 4DEXA 1XNQJ 2F2XA 3A8LB 4EMKA 1VQ7A 3L2RA 2ZKTA 1S99A 1NEEA 1VLOA 3V8JA 3PFOA 4GMKA 3R27A 4WU3A 5J26A 3M32B 4NCGB 4LD9K 3VV0A 3EGNA 3GIBA 1S48A 2HNDA 4V2SA 2D8JA 5KFUA 2IM1A 1VQKT 1O6XA 2J8SA 4IG0A 2DHAA 3C6TA 3OXFA 1M1FA 5HVGA 2YSQA 5KT6A 1EHWA 4W4MA 2YTCA 2XI9A 2HKQB 3DRXA 4OYZA 4DPXA 1X4DA 3D1HA 1P27B 5L1IA 3TSZA 2RDIA 3FLGA 1VC5A 4JI2J 1YCSB 5GMKi 1TXQA 3R9LA 4NXMF 2OPQB 2F3JA 2NXNA 3TVZA 3VVUA 2RJFA 3UWNA 3T1HF 3SIPB 1KONA 1WC1A 4F2SA 2DYBA 4Z8AA 1LWXA 2VPYB 2A37A 3HKZD 1TV6A 3JSCA 2MXYA 4HH1A 3LW5C 5J2MA 3ZL7C 4D6WA 3KTQA 3OSSC 2OTLA 3S7RA 1NKEA 3ENQA 1MWYA 4OMFB 3Q2SC 4N47A 2R7WA 2E70A 1N33F 2GVDB 4PL6A 3OTDA 3KDOA 5H9FJ 3FEOA 1HNVB 1N5TA 2M8DB 3RZAA 2ROTA 2R8KA 1MWZA 1M3CA 3M6WA 1MMGA 1YJWA 2Y3YA 1ITPA 1PILA 2QDLA 3KK1A 3G4SS 2JMCA 4K8RA 4RBTA 3I5RA 1JB0C 3ZZYA 1N5QA 1C4AA 2F8EX 1VQPQ 4RU9A 5ETMA 2CSIA 4J9IA 3BO4A 3FC9A 2P9GA 3KK2A 2V2QA 3DU5A 1C0TB 3F56A 2SRCA 2A0FB 2V0NA 1D8ZA 4URSA 3VAGA 3N5FA 4ZJQA 2LMJA 3EZOA 1HK9A 3CCMS 1R3NA 4OI0A 1HI0P 3EG0A 4KULA 2RILA 4ESNA 3HSZA 2B3TB 1T3NA 1BY9A 3UATA 2DRMA 2DNLA 2R42A 3JCMf 3UCUP 1TL7B 2L3QA 2QIFA 4RZRA 1N8RT 4AXIA 4IUQA 2N3OA 3GR1A 2XULA 1MMLA 1RTJA 4X62F 4OBIA 4OYOA 1CSKA 1Q7LB 2DZ9A 1U1PA 1XTZA 2J7WA 3VR1A 3L2UA 3ZZPA 4EFAC 1K73U 2DGUA 3QSUA 4HACA 1UE9A 4ZVGA 2Q1LA 2HW3A 4FIBA 4N41A 1BBZA 2YDLA 1RT5A 1BLUA 5CAAA 4IFVB 2FPFA 1S1WB 1S0NA 4DV4F 2J7KA 1FDNA 3EGXA 2P0PA 2IC3A 1WHYA 1TK8A 4ANEA 3PT9A 4XTTA 4HT5A 4G1QA 4M77G 4RW9A 3V6DB 1S0MA 1PBUA 4Z7CA 1SC6A 1OX9A 2HQGA 4X4UA 3L2QA 2MKYA 3REBB 2ECZA 4I6AA 2EQKA 3ELHA 2EXUA 3I55Q 1K1SA 4A53A 2HVZA 3V6JA 3A5ZB 3AD7C 1WJSA 3X3UA 1TMMA 1SH0A 1YK9A 2ROPA 2YUOA 5FLXE 4F8RA 1LFPA 2CJ9A 2KT2A 1W4SA 2EWNA 1ZM3A 4NRTA 2PUKB 2HAFA 2R8HA 2JNJA 1RWWB 1WC3A 1FK9A 2H48B 3HHDA 2KROA 3UWTA 1WTFA 1VQPT 4B02A 1IR2A 2RAQA 4NX9A 2EK6A 1E6VA 2ZM6F 5B0AA 2R2TA 3L2WA 1WC5A 2LQ8A 3KJNB 2FPDA 4ED5A 3TU4K 2J6FA 2VPXB 1OMSA 2K9GA 1FD8A 5LM7E 2QL5B 1XERA 1IWGA 2HMAA 5IWAJ 4ZLPA 3DOKA 2BACA 2LA6A 4F16A 2HS4A 1SJQA 3C3LA 2VBWA 4YDXA 3SXLA 2NUHA 2R57A 2QMXA 5C5JA 2BW2A 4PWDA 1KWMA 3C2PA 1SHFA 4XO0A 4FBTA 1YITT 2E5HA 3HT3A 4DV2J 4TYBA 3EZUA 1G3WA 2W2OP 3JB9I 4I7FA 1KD1U 5EGYA 1H38A 2CUYA 2CG4A 1WG5A 1U0SA 1WSVA 4PNOA 4CO4A 2H3JA 3ZZZA 2WTFA 4C92D 1FJGJ 2E5LJ 4QIGA 4YR2A 5F41A 2W2MP 4A8XA 2KRBA 2Z0GA 5J2PA 3ZTQA 1K0VA 2VOPA 1X2QA 4WP8A 3DRSA 2CPDA 5IFMA 1WACA 4IUPA 1VQ8Q 4DQ2A 4JI1J 2DR7A 2QYGA 3MPWA 3JSYA 1WF1A 1VQKA 2DNZA 1SG5A 4QW8A 2DGTA 1J3TA 3G71A 1AEYA 5DQIA 1KC8C 1Y7PA 1HQEB 4RX6A 1UGPB 2P9EA 4NLSA 1SJFA 2ATLA 1RT2B 4M7DE 1VGYA 4JV5J 4C97A 1IUJA 3X24B 2POKA 3DLKB 2EFQA 2DPIA 1LV5A 2GGPB 4O44A 4AYBD 1TTHB 4OB3B 5AJ3F 2A2CA 2DXEA 4DV0J 2EW9A 4EBDA 3F44A 4M5GA 3LWMA 1KLMA 3RU0A 2DT9A 3BJYA 1QVGR 3JXOA 3ER0A 1KQGB 2UUCF 2LEPA 6FDRA 3JV3A 3C19A 5LXRA 1JXVA 4FKYA 1O51A 2IDLA 1U09A 3MMJA 5LSRA 1FRIA 3P5BP 2LDIA 4Y65A 1UWBA 1GMWA 4ELTA 1HD3A 1HBUA 1DY3A 1U3OA 3FZBA 4FP9A 4USWA 3FEZA 1YJNT 1U45A 2V5HG 2DE0X 2NWMA 5KG0A 4JJCA 3IFEA 1I94J 2DNYA 3V81B 1RT5B 2FTRA 3PNIA 4K4SA 3WVEB 2X1GA 3GP9A 1PRMC 2YKNA 4F3MA 4PG8A 3BH6B 4J9UE 3HLUA 3OUYB 3C6UA 3ILOA 3MM9A 4ERDA 1VFJA 2D1XA 1Q7YU 2MQPA 3M0PA 1WXTA 2CH4A 5LMNF 2HVEA 5KE2A 2DR8A 1UEVA 1YITQ 2KI7A 3KHGA 4R0JA 3M0UA 3GFXA 4HT7A 2JS2A 2F9DA 2F5TX 4DOVA 4JS4A 1CJUA 1YZ6A 2E9RX 1V3ZA 2UUWA 1X6BA 1SJ3P 2P4RA 2XU8A 2BANA 2VG6A 4LF2A 3ET6B 2C3YA 3MKDA 4C0GA 1U06A 1U1LA 4J9LA 3CJTA 3MGJA 3KLGB 4ENOA 2DGVA 1NE8A 4QWDA 4YS2A 3L3CA 3QIPB 4BHQA 3SEOA 2HZAA 4JI6J 2E5KA 1UTAA 3QYHB 4CO3A 2Z4PA 1X69A 2ZOFA 3GIJA 1GXIE 4LF6F 4YY3F 2C2RA 1SHGA 2MZQA 2R2SA 1DAXA 3EM1A 2DTOA 4NLWA 2CJKA 4NA1A 4OMPA 4WYLA 2VPZB 3RG6A 3LGNA 3JCMc 3NS5A 2EFVA 3PW4A 4DR4J 4KGVB 1RHJB 3CVKA 5CKHA 3H98A 4Y2AA 2ZH8A 4QPXA 5J2MB 1RTIB 5KYYB 3DRYA 4K2JA 2GVZA 4RUBA 3PMTA 5H1SV 2HBWA 4L73A 4WF9Q 1RLPC 4J9RA 5HQLA 2RE1A 2VFRA 2KO1A 4DX5A 3KLFB 4M78B 1K73T 1Y00A 2KQWA 4DPWA 3RBDA 4EBCA 2QV6A 4ZNXA 2HPUA 1S12A 3MMBB 4M75E 1KSPA 1FNMA 2CA9A 4X4RA 3G82A 3MCMA 2DA9A 4F2RA 1UTIA 1CLFA 1AWXA 4R56A 2COLA 5DG9A 3QSYB 4NEZA 4URGA 2V8GA 1ZTTA 3VF0B 4JI3J 2ESWA 3ZZUA 2A2DA 4HEA9 2W24A 3DXBA 3OYMA 2LQ9A 3DGPB 2VXFA 1VQOA 1SIZA 2BJ8A 3M7VA 5A2QE 4ZTJA 2ZPHB 4RW9B 3V6DA 1R77A 1N9SA 2FJEB 2WVBA 1VQ4T 1UETA 2J6TA 4MDWA 5B0DA 3NAHA 1SL0A 5KYXB 3MMBA 3OTEA 5DLGA 2FHKA 1HA1A 3ZTSA 3CCQS 2BZ8A 2HEQA 1K73C 3PTWA 1JLGB 1P8GA 4I56A 1AWOA 1S0VA 1G8XA 2ZD1A 1EP4B 2LU1A 4G6VB 4Q5WA 1OEBA 2ZE2B 4EUVA 1CKBA 1S1NA 2DKOB 2F4FA 1MROB 2BE9B 4LFAJ 4A63B 1GCPA 4M75A 5HK0A 1T0TV 3PGGA 2IAJA 2MIOA 2KXNB 1AZSA 2H5JB 2ZH5A 4RKUE 1G3TA 4OMMA 4ELYC 1UFFA 4ZVUB 3DM2B 1U1SA 4K50A 1YHQT 3GJSB 5IQQA 4OI3A 4PJJA 4NXNF 2CJYB 4FF2A 1FDAA 1RP5A 2KTQA 4BUGA 2X1AA 1DRZA 1N34F 4L3KA 3M57A 4WZQA 3TUIC 1GBQA 2J06A 4RBUA 1IM6A 1FWKA 1YBYA 3NFCA 1VQ8T 5KFAA 1VYVA 2DYIA 2K1RB 3IS9A 1C0UA 1FRMA 3K0JA 4ZK7M 3ME9A 1N8RR 2X35A 3N5BB 3AOAA 2LECA 2LQ5A 4FYWB 3QYYA 1RT7A 4X64J 2CZ1B 1T9UA 2P6SA 1RT1B 3AJ1A 4OB2B 2UZAA 5GAMe 1TP7A 3LH2S 4RU2A 2YX1A 3EGXB 2IC3B 2OPPB 2XO6A 3MMAA 5FIIA 2ZC3A 5GANe 2IMOA 1N34J 1RI0A 3I5AA 1M5VC 1MHNA 2O1PA 2XD0A 1KLNA 3RBEA 2GS8A 1NK0A 2ZKUA 1VQ9S 3TOQA 4DI6A 2EC2A 1WNEA 4FKXA 1A0NB 3S1TA 1I5LA 1ARKA 1HWIA 3HSDA 2DIUA 4WFBQ 3META 4J6YA 1SSHA 1X4EA 1NZ9A 5GAMg 1TQLA 4A4HA 5A2QY 4ATOA 1FT8A 2MZJA 4ECRA 2ZPFB 2X1FA 3M8PA 5LT5A 4ZPVR 4K4XA 2HHHF 4NA2A 1JJ2A 2GA7A 2HYIB 3OFEA 1RT4A 2KT8A 1LFWA 4LE9A 2LEAA 1ABQA 1UHFA 3CJSA 4IOCQ 1HSQA 1LK5A 1B3TA 2KRRA 2KK4A 3QNWB 2CQHA 2ZZNA 2KEAA 2Y4YA 2P5VA 4OHVA 4OYWA 2DCLA 3SWNB 1CSJA 2ROEA 2AEMA 2CP5A 2EIFA 2WCXA 1E6HA 2WONB 5E3PA 4HYKA 1JJ2R 3A3OB 4JZ3A 3RKWA 2HNDB 2XK0A 4OHZA 3W60A 1C1BA 1RTJB 1J5OA 4RW4B 2PT0A 5KFSA 2FRWA 2HZYA 1UMJA 3VRYA 5IHKA 1WFWA 3MM5B 4X9CA 1B4SA 1MU2A 4F0HA 4PJOD 2D9TA 1NPPA 1KC8U 4PFOA 3QJLA 4R5PA 4Y2IA 2OP5A 3CD6S 1RU2A 4ICLA 5G0RB 2DISA 5LJ3g 4LDVA 3UPUA 2VV5A 3UI3A 2VZ9A 2EKHA 4OHXA 5IHNA 4OX6A 3LTOA 2HQDA 3H40A 1WF0A 2RPNA 3N4WA 4M5KA 1K73R 4YDDB 3ENAA 1FE0A 4I7FB 2XDDA 1L5UA 4A8QA 2HFNA 2UVVA 2F1FA 4ELUA 2UV8G 2CT3A 2V9KA 3B78A 2HK2A 1VQ5Q 1WGSA 4C0DC 5IH2A 3PRBA 3L2ZA 3PIOQ 2PI5A 3ZZ0A 3MM5A 3QZ9B 2NUUG 3AXKA 3INZA 4LF8J 1NDKA 3PW2A 5GANf 4CLYA 3DKMA 3NCQA 4C0OC 4DBFA 4KH0B 3HX9A 3R5JB 4X66F 1AHJB 3P96A 3IC1A 2F2WA 2KDSA 3M30B 2QLJB 2HZCA 5B0BA 2CNKB 1I1GA 3NPFA 1NJYA 4NOHA 5DQHA 4M77D 3QHSA 1R6YA 1FRLA 3Q0AA 5B0GA 3QYGB 2KVQE 3GYGA 3KHLA 2I2LA 2E7WA 2F65A 5HJYA 4N5SA 1JXOA 3CXCR 1M90T 5DQGA 2E41A 2DEQA 3WHIA 1N88A 2OAWA 2HCKA 1QAXA 4KE5A 4XK8E 4MK9A 3E01B 4F0MA 1U0HB 4Z2XA 3SCIE 3RB3A 1P9YA 2XWYA 3RW6A 3P8BB 1ZS6A 3CW2C 1VQ5A 1PWTA 2LT4A 3T5LA 1SH2A 1M30A 1VQMT 3GIIA 3RW7A 5T14A 2VQEJ 4X4VA 2UXCF 4YMEA 4ZDNA 5EX3A 4C0FA 5C24A 2CNOB 3UDCA 3EVWA 1WQ7A 2M3DA 2EKNA 2OKQA 3JQMA 2ZUAA 5GAN6 1RTZA 1JRIA 2OO4A 3PRDA 2YPZA 4JV1A 1K47A 2QRRA 1TU0B 1NK6A 3GE9A 1K76A 1OOTA 3SQGB 3FRNA 1FI4A 2M16A 4PG6A 4J9FA 4A0UA 4Q2LA 2B6AB 2MKCA 4OB0B 1NSKL 3MUTP 5CZVA 2G1HA 3VAJA 3P5TL 3CBPA 1VK3A 3ISNC 4LUEA 2KYMA 2G3RA 5GAMf 2HIYA 4DL6A 4DSFA 2XHCA 1HWKA 1YP5A 3SZ2A 1S5ZA 4OZ1A 6FD1A 1NZ8A 1RTDA 4A8FA 3G96A 1N33J 1FERA 2EK1A 2DO3A 1YI2S 2E5QA 2MKHA 2D9OA 2KAFA 4FYVB 3SWNA 3D66A 3TQEA 3BSCA 1IJFB 4FNIA 4K7QA 4Z37A 2QA1A 2ZDOA 1N5YA 1CC7A 1X4CA 5E3AA 5JMNA 2RMOA 1SC4B 5GADU 3DOMA 1WHHA 4IURA 1OQ3A 3OQ2A 4AD6A 4PFZA 2AWZA 2YX7A 2FEIA 2LXIA 3LUYA 3DLEB 3RMQA 4XU0A 1OULA 2RQWA 1M1HA 3G4SA 3KNAA 1VRUA 1H0HB 4IH6A 2RA2A 4MTPA 2M2BA 2ZNYA 4RW6A 5LJ3h 1CJTB 2CH4W 2YRCA 1VA7A 5KFEA 1X5PA 4LT6A 1CULB 2F40A 4HACB 2Y90A 2JNGA 4I2QB 2RHSB 1X75C 4N0AA 3OYIA 1I94F 3O5TB 4LR7A 4F7UE 1L3UA 3UDEA 4KY3A 3MP1A 3M4GA 5KFOA 1K44A 4QYRA 3F41A 1IR0A 4IUFA 2J6KA 5CVIA 1Q81R 2G9OA 3SCKE 4C8QF 2EYYA 2AF6A 4HTJA 2EAYA 2GZOA 1XK8A 3GIRA 4QVDA 2DGSA 2VQFF 2XMUA 2RVJA 3UPFA 4PJOA 2I0NA 4OIXA 3KUEA 3ZXWA 3VS5A 4P7VA 3AT1B 4EMKB 5C6SA 2QI2A 1N48A 2O9VA 5L8RE 3CC4S 4B3SF 4CYUB 2RDDA 3K58A 4Q43A 3LGLA 4OI6A 3RGIA 2KM8B 4Y92A 2OEKA 2CDRB 3T5KA 4WZMA 2K2PA 1IJEB 1QAJA 2MKJA 3NHNA 1KQ2A 3UVJA 2CDTA 2BVZA 1S76D 2DKGA 2GFUA 1TKXB 1XQIA 1BI1A 2YNGB 2RM4A 1CJVB 3MCOA 5CYQA 2DL7A 2HLTA 5F8IA 1TL3A 3GFYA 4LUBA 4DR5F 1VBYA 4MKYA 1Q8IA 5J2NB 2E1MC 2ZE2A 4JB8B 4OGEA 3D7SB 3VAHA 2J05A 5IC6B 2R4FA 4U67Q 2Q79A 4ED8A 2FJBB 5FWBA 2WACA 3RR6A 2JS0A 5IV4A 3URGA 2QSFA 1YFNA 3D0HE 1D3BB