1M1GA

Crystal structure of aquifex aeolicus n-utilization substance g (nusg), space group p2(1)
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
240
structure length
240
Chain Sequence
LEKKWYALQVEPGKENEAKENLLKVLELEGLKDLVDEVIVPAEEKVVIRAQGKEKYRLSLKGNARDISVLGKKGVTTFRIENGEVKVVESVEGDTCVNAPPISKPGQKITCKENKTEAKIVLDNKIFPGYILIKAHMNDKLLMAIEKTPHVFRPVMVGGKPVPLKEEEVQNILNQIKRGVKPSKVEFEKGDQVRVIEGPFMNFTGTVEEVHPEKRKLTVMISIFGRMTPVELDFDQVEKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of transcription factor NusG in light of its nucleic acid- and protein-binding activities
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Transcription
molecule keywords Transcription antitermination protein nusG
total genus 46
structure length 240
sequence length 240
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2002-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00467 KOW KOW motif
A PF02357 NusG Transcription termination factor nusG
A PF07009 NusG_II NusG domain II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1m1gA03
2.60.320.10 Mainly Beta Sandwich mini-chromosome maintenance (MCM) complex, domain 2 N-utilization substance G protein NusG, insert domain 1m1gA02
3.30.70.940 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits NusG, N-terminal domain 1m1gA01
1VQ7A 1Q86U 1Q7YU 3P8BB 3CCUA 1VQ6T 3LD7A 1YBYA 1QVGA 1KQSS 1VQLT 1M1GA 3CCMA 1VQNA 1M1KC 3G6ET 2QA4A 1VQ8A 1VQOT 3CCRT 1VQ9T 1S72A 1NJIU 3CC4T 2G3RA 1XNIA 2LCLA 1K8AU 1IZ6A 3G4SA 2E70A 2OTJT 3CPWS 3ER0A 3J80E 1NPRA 1K9MU 1VQKT 1VQ5T 1YJNA 2MWPA 1M1HA 3CPWA 3CPFA 1YITT 1N8RC 4TVRA 3QQCD 1VQPA 3DB4A 3CMET 1YJ9T 4CRIA 1YIJA 3CCLA 3G71T 3KBGA 2QEXA 3CCJA 3CD6T 1YHQT 1VQ4T 3PIOA 1Q7YC 1Q81C 1NZ9A 3CMAA 5LL6S 2JUFA 1UEBA 3I56T 5DLQE 1W2BS 3CCVA 2JNGA 5HY6A 3CCQA 1YI2A 3J7AF 1YI2T 1KQSA 3CCQT 1JJ2A 3CCVT 3OW2S 2IG0A 3I56A 5IAYA 2MI6A 2JVVA 2LVMA 3CMAT 1VQ4A 3LGFA 1YHQA 5A2QE 3CCJT 4X34A 2QEXT 3CD6A 1KHIA 2CKKA 5DM7R 3G71A 3CCLT 3DLLA 1YIJT 1Q82U 1YJ9A 3CMEA 1N8RU 1NZ8A 1KC8C 1RL2A 3LH0A 1BKBA 1VQPT 2E6ZA 1X6OA 1YITA 5J26A 4YTLA 1YJNT 1VQ5A 3OYYA 1K73C 1VQKA 2OTJA 2K06A 3A5ZB 1EIFA 2JOYA 5IT9E 3OW2A 3G4ST 4OBIA 2MWOA 3H7HB 1M90U 3JAME 3CC4A 1S72T 3CCRA 1VQOA 1W2BA 2QA4T 3G6EA 2DO3A 5J3BA 3LGLA 1VQ8T 1VQ9A 1SSFA 3HKSA 1VQNT 4ESNA 2OUGA 3CCMT 1VQLA 2KDSA 1K8AC 3DB3A 3EWGA 1XTDA 1K73U 1Q86C 2XHCA 1QVFS 3CCUT 1VQ6A 2KPPA 2LQ8A 1VQ7T 2OTLT 1QVFA 3LPEA 1YJWT 3CCST 4RG2A 1NJIC 2KVQG 3CCET 3I55A 1VQMT 1K9MC 2EIFA 5FLXE 3CC2A 3CC7T 1M90C 1KC8U 1M1KU 2EXUA 1QVGS 3CC7A 1JJ2S 3CC2T 4ZN1A 3TREA 3CXCA 1NPPA 1VQMA 1Q81U 3I55T 2L3RA 3J81E 3PIPA 3CCEA 1KD1U 1Q82C 1KD1C 4QQDA 4ZN3A 3CXCS 3CCSA 1YJWA 2OTLA
chains in the Genus database with same CATH superfamily
1K76A 1VQLT 4UY85 3EZUA 2KG0A 1XC9A 4LF4J 4PWWA 3OVSA 4PJOE 5GANh 1RHQB 1I0CA 2QK0A 4N4IA 4ESRA 1RHUB 2LQWA 1VQ5T 5KT5A 4A54A 1FXDA 4RCCA 2JLFA 3M8RA 1HWKA 4DPWA 3KUEA 2P0QA 3IGVA 2RMOA 1VHIA 1T9WA 1HSQA 1KSWA 2HQ3A 2J5AA 2PMHA 2QTXA 2GMLA 3NTKA 3OBYA 2IG0A 3IRXB 3JSMB 4RW6B 2EJFA 1UPMB 1C0MA 2ZH3A 1HQUB 2DTJA 2YRVA 2VA2A 4LBPA 1IHVA 4M7AD 1WHLA 1BY9A 2ZH7A 3I9ZA 2ZPGB 3AA9A 2WSCE 1D1BA 3V6HA 3L2VA 4EZ9A 2RF2B 3OYBA 3OYJA 4M75D 3RKXA 3OR1A 3FC3A 4C8QA 3H2VE 3RBEA 3C2PA 4DR2F 4UY8T 1SG5A 4XQ3A 1P6TA 3NG8A 3NPFA 2GGPA 4F4AA 1IJEB 4QPXA 5ETVA 2KYXA 1QMCA 1QUPA 1JX4A 4M5DA 3M9MB 1WI6A 3EFRA 2VC8A 3DRXA 1D9DA 2V9KA 1Q81T 3G1JA 3EX7B 1Z2LA 1RCOB 3GJQB 1GXIE 4A0UA 4R55A 2CQ4A 5JXSA 6FDRA 1FX7A 1VK3A 2O67A 1JLGB 1RAIB 1VQNA 2H5IB 1M1KC 4MT1A 2ZBQA 3AHPA 2KEAA 1Z4UA 3IM8A 4JI1F 1Y9OA 4PZVA 2XZTB 3MF5A 2MY8A 1Y4ZB 5JVHQ 1B3QA 1BGXT 3EZ5A 4OV1A 2YQ3A 2QEXA 1LWCB 2E1CA 2F2VA 1QTMA 2FVRA 1S1UA 4ZVGA 2J06A 3CC2S 1ZM2A 3PW0A 1NH7A 2AU0A 2M8DB 4YB6A 4QIFA 2YUPA 3REBB 4BLGA 4K50A 3NRBA 1WDXA 4JLGA 3OS2A 3TAPA 1WEYA 1I6JA 4M5HA 3UATA 2F9JA 4LR9A 2C2DA 1IR2A 5KYXB 1YITA 3QIDA 3OYYA 2K06A 4J5YA 4DFMA 4NRUA 3OHBA 2H3JA 2W01A 1G8XA 3NGDA 2V4JA 2LXFA 2FJXA 2GVZB 1XN9A 3EGXA 3GR1A 3SHWA 4OHYA 2UXBJ 3K5NA 2UVWA 1D8YA 1OWXA 3PVLA 1RAGB 1LFWA 1H6KX 3EUNA 2W25A 3R5DA 3H0PA 1Y07A 1KQKA 3DLLQ 2LEAA 5AT1B 4H4MA 3V4MA 1JJ2S 3LW5C 1S9FA 4QIEA 1NPPA 4NCAA 1X7VA 2CPJA 4K0KF 2KRSA 2ILZA 4KBIA 4QIWD 3IWNC 1JJ2R 1PC0A 1RJJA 2YKPA 2VJVA 3TEHB 2W2OP 4W92B 1RGVA 2PDAA 2OH2A 1Q86R 1ZUYA 2JDJA 2LQBA 4ELZC 1M3CA 1LK7A 3JB9k 3V8KA 3DN9A 1Q7YC 3R5JB 3DLKB 3MM7B 2HKQB 2NXEA 3BDEA 7FD1A 3B4DA 1F9HA 1UTAA 4IUVA 2QMWA 3WX8A 3SB2A 5A6WA 2AJ4A 3QG1A 4ERDA 4OMFB 4YR0A 3PIOQ 1OYDA 4M78F 1S6PA 1JQQA 4LF8F 4N77A 2DL7A 2PVDB 3JAME 3HJVA 4ID5A 3QRPA 5AJ3J 4O5VA 2DB1A 1WKKA 4HL9A 5THWA 2L5QA 2KDSA 1XTDA 2FLPA 1JLBA 2JMAA 1SKUB 2DGVA 1VA7A 3VTIA 4RW7A 4M75E 3VQTA 2HHWA 1B7TA 1YCYA 3VS6A 2DR6A 4DR6F 5L1IA 1BHNA 3GMGA 1HBUB 1RADB 3QUIA 2DIQA 5LJ3g 1FNOA 3CCEA 4CM2A 1DTTB 4YN3B 3HFOA 3PVQA 4KJIA 3MCAB 1NJIU 3M8QA 3ETMA 1I07A 1K9MU 3NFCA 1X6GA 2HK2A 1U2RA 1M8VA 4KT0E 2OTJQ 1WSRA 4MMOA 3CCLA 5DLOA 1IJFB 2QASA 3A98A 2R57A 2JXBA 1WXUA 1D3BB 2JUFA 2EFNA 1X2QA 2FC9A 3BKFA 3Q8QB 3VU3C 4OMOA 3BH7B 1C1BB 4OP0A 4ECVA 3DLKA 2K9GA 1GNKA 2L9DA 1GQEA 4DLGA 2ZPBB 3WIUA 5GMDA 2CSQA 2X7IA 5KFTA 1MN7A 2YNFA 3CD6S 5B09A 3TUZC 4J6YA 2A18A 3BN7A 2IJNA 1QVFA 5D4OA 2EFIA 3MEWA 3BQ1A 4DPUA 2PI4A 4ZPBA 3X20B 4DUTA 5IT9U 5DLGA 2HFNA 3IRXA 3JSMA 2RH2A 1U0SA 4OJ3A 3VS4A 4UF4A 1BI1A 1I1JA 5A8KB 2XLKA 3OFEA 4Y6IA 1GXTA 3G71S 3K17A 2PI5A 4RKUC 5KTQA 3CMAQ 1RE1B 1OPKA 4OLOA 3CIZA 1WUUA 1FKPB 4MIBA 4ANCA 4LDWA 4U7UD 4M7DG 4NLVA 4ZCMA 1J27A 3EYZA 1P27B 2V68A 4LDVA 2X1AA 4JI4F 3R2CJ 1UVKA 2VG6A 5B0FA 2OI3A 3OR2B 4MK7A 3OB9A 3MEEA 2F40A 4AT1B 4WCIA 2E1MC 3W5YA 2L3QA 2DEJA 2VKZG 1B99A 4ZLPA 1WC6A 1ZSZC 2ABLA 2O88A 1PCXA 1M2OA 1IUJA 4YTLA 5KFBA 1M90U 3M2VB 2ZH1A 4C0ZA 3GQCA 3R5AA 4DFJA 3G6EA 3KHHA 2DEQA 3LGNA 1M8MA 2O9SA 4AUKA 2P6SA 4LRAA 3C14A 3C46A 1CJKB 2V8DA 2QGFB 2V4QA 3S3MA 1S1UB 4CLPA 4AG1C 1W2IA 3DRSB 2KL8A 1YJUA 3W9JA 3MM9A 1N4LA 3J7AN 3JB9D 4KGXB 5D6WA 1RWMB 2ZE2A 1S10A 2MPUA 1RT4A 2C3PA 4DV0F 1HNWF 2KT2A 3O3LA 1FCAA 3KK3B 3TZXA 4TVAB 3ZZ0A 1RTDA 2BE9B 5CR2A 2QGGA 5CKDA 4F4ZA 3IAM9 1RABB 3IBCB 3M2RA 4Y28E 5C0MA 2YWFA 1H74A 3M8PB 1DJ0A 1IBMJ 1O8BA 1UZHA 4NL5A 3RGIA 5B08A 1DQ8A 1D8ZA 3SSRA 2M2BA 1OPLA 1IREB 2HHTA 1QAIA 2C3OA 1FWPA 3D3CJ 3J80Y 2KXFA 4JV5J 2LCCA 1U6ZA 3J7AF 4GVBB 4PWDA 4F8RA 5J39A 1XBWA 1UHCA 4L72B 4XTUA 1JMTA 4C92G 1T05B 2KROA 3UN3A 3T1AA 4DBRA 1MNDA 3MEEB 3WIVA 3LGHA 1S9EB 4WK1A 1UPPA 3MXHP 1F2GA 1QKXA 2EK1A 4C8KA 4C0HA 1EIYB 3D4JA 2A0FB 3NTHA 2HGLA 3FZ2A 2MHEA 4ZDNA 2J8SA 2DHAA 4ID8A 4LN2A 5IHIA 5K8MA 4DV3J 1JLFB 3CSKA 3H59A 3V7RA 2KHDA 4KSEB 2HQIA 2EXUA 3SMZA 5KFIA 2DL3A 1V3RA 3JTPA 3MM8A 1MW7A 2WW4A 2CPYA 2M88A 1M90T 2CG4A 2FLOA 2DNRA 4USJC 2W24A 4HI1A 4BY6B 2P8IA 5E3CA 2CYYA 3H2UB 2Y8YA 2DNOA 1QVGA 2MKKA 3SDEB 1UJ6A 3AD8C 4LT6A 5KFYA 2YKMB 1VYUA 2EAYA 3S01A 4DEYA 2E5KA 3BS9A 1DRZA 1HD1A 1EKRA 3MKDA 5GMKj 2NYIA 1REVB 2EJGA 5CABA 2CZ6B 3BZQA 4G3IA 1VQ4T 3JS9A 3W2WA 5F8NA 4W4MA 3BBCA 3OYHA 5LJ3j 4JZ4A 2FPDA 2RI3A 4LDUA 3BQ2A 2H9ZA 5F8MA 3EPGA 3CWJA 4HA8A 2OP5A 3HHKA 2ENMA 2UVUA 5D0GA 2HNIA 5GAOp 2NUZA 3H7HB 4LSZB 3KMQA 4L75A 4K11A 2EW3A 4HI2A 1QW1A 5HMYA 4C5HA 3D7SB 3EWGA 5F8HA 1KC8T 3MEVA 4Y3CA 2FVPA 1SKSA 2DRMA 3H25A 3TW0A 1S0OA 2DAQA 1N27A 1MMDA 3FK4A 1VBZA 4LF5F 2RAQA 2DKOB 4ILLA 4WU2A 3RRKA 1EQMA 4JI7J 4G1QA 1FA0A 2C2ZB 2XNRA 1CULB 1FKAF 5L38A 4M75B 4OI0A 2RDJA 4IG3B 2BA9A 3PTWA 4QQDA 3K5MA 3DRYA 2QTWA 2CJYB 3HVTB 1RK8A 2HQGA 3OUYA 2A2DA 2GC8A 2OFHX 4KRWA 2ASJA 5FU6C 3QYGB 4J90A 2AF6A 2V2ZA 1T11A 2BZXA 4DR4J 1FESA 4XTWA 1JLQB 4F67A 4TU7A 2EBEA 5AE3A 4X9CA 1UGRB 5KYXA 4KHPJ 5LL6d 1VQOQ 1S1XA 5F8IA 2CS7A 2R2UA 4Z02A 4ATOA 4F3MA 4OMNA 1ZM4A 2J6TA 4O3QA 1SL0A 3MO8A 2ZGWA 3MPYA 3HULA 4JZ3A 4OL8A 2PC6A 3OTBA 3MAAA 4WU3A 3EG1A 3HI9A 1YJ9A 1OI1A 1RL2A 4U95A 2DVEA 5ETPA 4BD3A 2EGAA 4JI2F 3A8HB 4LSLB 3PIPQ 1RI7A 5KH6A 2YKOA 4M77C 4M5IA 2LLZA 4PG4A 3CD0A 5J2QA 2YQ2A 1CG2A 4F4YA 2IC3B 4ECUA 2ROTA 1NH8A 5GAN2 4C92A 5C42A 2F63A 3B54A 1VOMA 3JQJA 2G0CA 4CTAA 2PA3A 4EPCA 1HYSA 2HW3A 1KEKA 5GAHI 1VQKS 2DHGA 2PO4A 5DGAA 3BEGB 5ETRA 3MM7A 3MR7A 4IUFA 2IRYA 1RA6A 4JBCA 3H4DA 4PJNA 3FJPA 2CREA 3QJLA 1HK9A 3R1LA 4CRIA 3C19A 1RB0A 3OYLA 2RD5C 2Y4XA 3CMAA 1FXRA 4E7HA 3OSNA 4HT9A 2W4CA 3E2EA 2VHGA 3LP1B 1OEBA 3U1NA 2JTEA 2F3JA 2D9PA 3TQ7P 2OKQA 1BIBA 1UVIA 3KJFB 2BZ2A 4KRTA 1YTYA 3RW6A 1HR0J 5D0EA 2IJFA 4ES1A 1IKXB 2VXEA 2CIMA 4ZLJA 4OLPA 3CNQP 1BD6A 1K73U 2C0TA 2HKNA 1NKEA 4GY5A 1QSLA 1RT6A 1MN9A 3QNWB 9ATCB 3OTOF 3ISND 2R7XA 4XK8C 1BCMA 3VAMA 4BUGA 2A28A 3IS9A 5H9EJ 4C8QB 3GG1A 1WGSA 2XG8D 2MPXC 5DJBA 1FFWB 1QSYA 2E5JA 3TJ8A 2DBKA 3BO2A 4N4GA 2OPPB 1RCXB 1IQZA 3DGVA 3PZPA 4K4WA 2J9CA 1OY8A 1D3BA 4XDDA 4OYOA 4YFUA 5EWEA 3EE3A 2G3RA 4JRIA 2EW9A 1FYNA 1YJNA 2D3ZA 2DYIA 4ZGJB 3PMTA 2D3O1 2M02A 1LXNA 1NDPA 4JJDA 4XPEA 2DO4A 4ZLLA 3DYAB 4DR1F 5LJ3e 3EAEA 4RNMA 3CCVT 1HIYA 2VFUA 5GAMd 4QQ6A 3HJFA 5DM7R 2DM1A 3V7CA 3BF4A 5FIIA 3V81A 2LTOA 3MPUB 3HT3A 1UUEA 1FRLA 2XYGB 3TYTA 3KLEB 5IZHA 1H92A 1EP4B 4QYZK 5I3UA 4R8UB 3W9IA 3QZ7A 1S48A 4J9DA 1OSCA 3MP1A 2GAHC 1YGYA 2QSWA 3K5LA 3Q24A 2QLWA 3B8HA 2X3DA 4RG2A 2E5IA 2DRDA 1M1FA 2AT1B 3JTNA 2L41A 4PJOG 4V19X 1R31A 1WHGA 4C5EA 3GE9A 5F8LA 3OL6A 4PJOB 2KM8C 2PFFB 3PCOB 4DSKA 1SJ1A 1P1TA 1MGQA 3MCNA 3AA8A 1MWYA 1VI7A 2KGTA 1X4BA 3NNAA 5EX0A 4LUDA 4OGCA 4J9VA 1U8SA 4U96A 3TO8A 4HDHA 4M5NA 4I68A 5BR8J 1N36J 2E4HA 5L1LA 1X4DA 2FJAB 1Q5YA 3GIBA 3O6QA 1U48A 1K8AR 4KUIA 1X5TA 5KAKA 4PCQA 2MHNA 4AMCA 2M51A 5IQ6A 1X8DA 2GTOA 4UZCA 2NCKL 2RQVA 3N5FA 3OQ2A 1SUQB 4IG0B 2RQUA 2C2KB 2MIOA 3FGVA 2V0NA 4WKYA 4DUZJ 2MQOA 4C8QG 2KFYA 1JB0C 5FRNA 2DBBA 3RTVA 3HCXA 3UA7A 3JYTB 1WQWA 4PK4A 4TLRA 4H4OB 1K73C 4UUWA 2F2WA 2QG9B 3IXQA 1KD1T 3M55A 5DM7Q 2CP6A 5AE2A 3PY8A 4LF6J 5E2QA 1QLYA 4TNOA 1Q86C 2Z30B 4ECRA 3PNWC 3M9QA 1QAJA 1VQNQ 1QVPA 1S1XB 1NJIT 4PABA 1YBAA 3HFKA 2KFZA 4USTA 4RNOA 3EFOB 1MSWD 1U45A 1YKWA 2UUBF 1H7XA 2C28A 4BE2A 4DSJA 3R5CA 4U7UK 1ZYQA 2FHJD 1KQ2A 4M5JA 1F2HA 1ZSZA 3V4IB 5E5NA 4C0DC 1Q8IA 3VUZA 4FF2A 4A8MP 4FSSA 3M8YA 3QGPA 2XLIA 1NNDA 4S0MA 5CQGA 4FKYA 4WTOB 1WD6A 3QRQA 2X1FA 1UEUA 4FS1A 3ENWA 3P6YC 2MJNA 2DNYA 1OOTA 1PCAA 3CD6Q 2F5GA 2B51A 3H0HA 1AEYA 2EBGA 4ZPVR 1MMLA 1AOJA 3M56A 2DTHA 3PHTA 3FBCA 4OYAA 3FCWA 3KBGA 2KFNA 2PUOB 2EQMA 1IKWA 1AUDA 1TH7A 4FF1A 2HAFA 3K59A 4HCBA 3QATA 4HVWA 1UJYA 2IYGA 2AW0A 2E9TA 1DLOA 1BK2A 5GAMf 2BEFA 3OYGA 2WZ1A 3JCMh 3KLFA 3FSXA 3PJXA 2DGQA 4G1PA 2I5JA 2RHXA 1AWOA 2KI2A 1X43A 5EDWA 2Z8QA 1R6VA 5FU6B 4URGA 2ZH6A 2FLLA 3P3DA 2W9BA 3Q2TC 2I0XA 1S1TA 1RTZA 5IXFA 4RU9A 3F41A 1QP2A 5IOLA 1WC4A 2MQPA 5ETNA 1U3OA 4DUYF 3B4MA 3KLIA 2LDMA 5I3QA 3AOBA 1N32F 2GQVA 3T9NA 2MJUA 4C8OA 2KY9A 4CLZA 2Y1LB 2X9HA 4ED8A 2P9GA 3MR2A 1M9SA 4KH1B 1ZTWA 1S1VB 2MKCA 1REVA 2ZVSA 4PXCA 2C2NA 1IKXA 3M0QA 3DFEA 2ZD1B 4QVDA 1ELOA 4M7DB 5CYMB 3TA2A 2DE0X 1S0VA 2HHQA 2ZPHB 4DOVA 1OS5A 1UETA 2DD4A 5GAN7 1TG0A 3CMET 3SSSA 1DTQA 3G6EQ 3W64A 3HTRA 3CJSA 4LD6A 2MK5A 5IC4B 1U1TA 1AWJA 4QWCA 1EARA 2CZVC 2EG1A 4IUPA 2RD1A 4OI1A 1IGQA 4ZVHA 4DL0C 1PILA 1MMAA 7AT1B 4NCGB 2HBRB 3IC1A 1K47A 3QMQA 2JHEA 2IYIA 1X75C 5IXUA 2QFIA 3T1YF 1X01A 4Z37A 2YNIB 2OD4A 3MUTP 1KJWA 4RKUE 2XMWA 2BMBA 4X4SA 4MDXA 2DO3A 2M0YA 2J0SD 5I22A 2R7TA 2PT0A 4F0MA 2BW7A 3CCRS 3GSDA 4WYLA 1N5VA 1N9RA 3VCDA 4CT9A 4IRKA 3X24B 3QO9A 4ZLNA 1BWVA 2CFXA 2AGPA 1U1NA 4U7CA 4F7UG 2HNDB 4TY9A 1QDUB 3DRSA 1Q7YR 3S6EA 3KLIB 1HLWA 2QLFB 4X4RA 3CXCS 4UZBA 4DL3A 4NLXA 3REAB 2B4UA 2XGPA 2DGWA 3P4UB 4NA1A 5B0DA 1PAUB 3GSIA 4C92F 1RTDB 2LT4A 1KOHA 2HRTA 4DN9A 2FHJA 1CJVB 1W2BR 4YB5A 1SL2A 1SV5A 2ZC3A 4ILRA 1KLMB 3KOAA 4K4YA 2DO0A 1VQSA 3JCMf 3M8PA 4DV5F 3DI6A 1PKTA 4LBIA 1TFYA 1X5PA 2V8JA 3GIIA 1YLXA 4DR5F 1H7WA 1EX4A 4NMLA 2DL8A 3S3OA 4PJOA 5CCLA 4QWBA 3FNNA 3BSOA 1WHVA 2ZNYA 1YWOA 3I9V9 1AA1B 3N6MA 4OX9F 3MP8A 4A8YA 1Q82T 2ZZMA 4WBFA 3AJDA 1Q7LB 4XU0A 2E6ZA 3C15A 1M3AA 4DQ2A 1M30A 4ED0A 3TANA 2XZDB 2HVZA 4PJOF 2NREA 1VQPQ 4OJGA 1TXQA 1KHWA 2BR0A 2MB0B 4M77G 4LRBA 3G9CA 4ZVTB 3W7BA 4FU6A 1AFIA 3VQSA 3CB4A 3DXSX 4RUCA 1KHCA 1IHWA 1RUSA 3GFYA 4OX8A 4M7DE 3M2UA 4BI4A 3PR4A 4KIAA 1CPZA 1YJNQ 2O4XB 4LF9F 2FTRA 5I2SA 2X51A 4MIWA 4C8QC 4ES3A 1RP5A 1L3KA 2ASLA 3K57A 4TY8B 3NS6A 3CC2Q 3UR0A 3H40A 1UGSB 1HQEB 3MAQA 4LRDA 4EBEA 5D0HA 5KFVA 3PX4A 1RT2B 3CMEQ 3PM9A 1HNVA 4Y91A 2PSZA 3BSCA 3V7SA 2GHWA 4ANEA 5HBMB 3V5RA 2O5DA 3KG0A 3EGVA 3TEGA 1XMQJ 2FZKB 4PFZA 2M4MA 2WB1D 3EGXB 4QQBA 3W2WB 1UVLA 2QEXT 3LTOA 4J9OA 3KLHA 4CO5A 4ZOSA 1QTNB 5DZ7A 3FMWA 4CLUA 3HK2A 2MSSA 1LWXA 1BBZA 2ALZA 5CXTA 4LUEA 2RK1A 3D9BA 4KKOB 1HWIA 4ZJLA 2VONA 3CPWP 3PKYA 1EX8A 1TKXB 3GJTB 3VAGA 4CYUB 4Z7YA 5AXMA 1FKOA 4K0KJ 4HKEA 1X31C 4N8NA 5CQYA 1RTHB 2BABA 2MXYA 3DHXA 4CM0A 3KK2A 3QLHB 1I3OB 3IG1A 2HYIB 4A4FA 3JCMQ 1HARA 2VC0A 4N56A 4X4UA 3IP0A 4LJMA 1Y5NB 4DCJB 4L76A 3RUBL 1WSVA 4ZPDA 5G0RB 2EWNA 3MEKA 3RB3A 1E6HA 4NYZA 2K1RB 2VQEF 5IS2A 3GZ7A 2YNGB 4YR2A 3VAHA 3GP9A 2ZH8A 4WF9Q 3NGTA 2E44A 5IN1A 1TUVA 3W66A 4KFBB 2GCFA 1EZZB 3A13A 3QFWA 3JCMg 4F7VA 3K0JA 1RU1A 3N5BA 4NWBA 4OGEA 1BLUA 2IPOB 3VAJA 3T5LA 2XKOC 2YBVA 1HW8A 3UI3A 3Q8VA 2QTVA 3HL8A 3DLLA 1C6VX 2HRUA 5DG8A 1E6VA 4ZP7A 5J26A 1RYSA 2OI2A 2BVZA 5GANg 1U02A 1TL1B 2OPRB 2Y1RI 5CKFA 1BB9A 3F56A 2FD2A 4CP5A 3EMTA 4ECWA 1IKYB 2U2FA 1T0HA 2JLEA 4DV2J 4ED6A 4DBFA 3NMAA 1K9MT 2HWTA 4YDDB 5LJ5e 1H3ZA 4F0KA 3W65A 2YHTA 2QYZA 4EBDA 3CMES 1RWPB 3CXCA 3N9UC 4EGLA 1OULA 4KYZA 1IR1A 5C42B 2PQWA 5CHCB 1WG4A 1KR4A 1BYMA 1YJ7A 2EEYA 1WTBA 1KK7A 3UPUA 1LW0A 4FNHA 4PJOD 2RHUA 1TKTA 2H5EA 2NUTA 4A0TA 1ZAVA 4ZP6A 3QHSA 3CDAA 4TVRA 4DFPA 2CSIA 5KFNA 4GLMA 1P9QC 4I2QB 2VKNA 2HBZB 5LJ5d 4PFPA 4M5GA 2HBYB 3I5AA 3HMJG 4F25A 2RK2A 4JI5F 3PACA 4GKJJ 3CCQS 1ZOTA 4LFCF 3PV8A 1MMNA 3GCWP 1S57A 2EBPA 1KFSA 4FF4A 5RUBA 5KT2A 1MV3A 1MROA 2CJ9A 1XJWB 3EZOA 5D4PA 4LF7J 1VQKA 3BGOP 1S4EA 4FF3A 2HVDA 1FRKA 3EFOA 1ARKA 1R8OB 4FYDA 3VS5A 3MD1A 4X65F 2ED1A 1S5ZA 5GAOr 4LR7A 1ABQA 2OPSB 2DVJA 2K3KA 5L46A 5A8KA 3AB4B 2OSRA 2XSJA 4WYWA 4O44A 3LP2A 3MMCA 2OPQB 3FEXB 4TU8A 4DOZA 1VUBA 2QLJB 1HI0P 3HHLB 1VC5A 2MCNA 5IM0B 4NLOA 2I6WA 1ZAWA 3EDRB 4U6PA 3BGFA 1AROP 1I5OB 1N36F 4C6AA 5A0LA 3M4GA 5FLXY 3CJ2A 2KZMA 3TUJC 4LF1A 4ZJQA 1D0EA 4CI0C 1A6LA 3FRNA 3LF0A 1TK8A 3TI0A 3M59A 1KOOA 1LVKA 2CVIA 3VRYA 5FDLB 2KT8A 3MAAB 4OX6A 3OYKA 2BZYA 2GBQA 1CULA 4JI1J 2DH7A 3PW5A 4KB7A 2QQBA 2BE7D 2JNGA 3CCQT 2VQFF 2M7SA 4FT2A 1CKBA 2K3YA 4MKVA 2BW2A 4X66J 2PVGB 4CC4B 2YQ0A 4LF6F 3CGIA 2AYGA 4AE5A 4ID5B 1DJ7B 2EQIA 1JLAA 3KJNB 4MMLA 1WC5A 3GV5B 3DCAA 2BJ1A 2FJBB 3DGPA 4J91A 5HP1A 1KN6A 1N33F 1Z9ZA 5HMWA 4C11B 3MPWA 4EI2A 2ZBRA 1NXIA 3QWXX 2V8PA 2MLYA 4WFZA 4DEXA 1DHMA 1AYEA 4KR0B 3MMAA 5C7PA 2ZC4A 1W2BP 3A8LB 2P4TA 4IDKB 1SRLA 2Q6CA 4AFZC 1VRTB 3UF4A 1G2BA 3OMGA 4WWSA 2A08A 1UGPB 3BGRB 1YX2A 4K2JA 3MOJB 1NKBA 2W7AA 2R2TA 4A53A 2RSQA 1IQTA 2QEXS 3UCGA 1RAHB 3UDCA 2DIUA 1NJYA 1VC6A 1JLEA 4TKTA 1A0NB 3UDEA 2JZ2A 3VS7A 5EWGA 1VJWA 3I0SA 2XMVA 5C5JA 1AZSB 3FEOA 3PFEA 3KDNA 1F9EB 3N6NA 3BPDA 2COZA 5KFHA 3R6GB 5KFEA 2HVIA 4J6XA 2XDPA 2C2EA 1I4K1 2AYEA 4EO6A 2UVVA 1C0TB 2LJ1A 3OTDA 1G3OA 2CJQA 3BFMA 2W2MP 1JLFA 1GCQA 3PMIA 4IRDA 2F65A 2Z2LA 4BDPA 3MFIA 2WONB 1NEBA 4M7DF 3OD2A 2V2QA 4PPZA 3C94A 3HHEA 2E7XA 1ZS6A 2R5AA 3T19A 4LF8J 4PYAA 2EC2A 4HYKA 4ZCLA 1L5UA 5K14B 3CCET 4I1TA 1UA0A 4DQPA 4J6WA 4LF2A 5KE3A 3KUGA 3AQPA 1DQAA 4RUBA 2IAJA 1B7FA 2KT5A 5HQMA 5B0CA 5KFGA 2B43A 2G2ZA 1X69A 4HXJA 5DY9A 1KDNA 1ZHIA 3FB9A 2WW8A 3IR6B 4BCAA 1SHGA 2MZSA 1P1LA 4OHVA 2E6NA 1OYEA 4CCHA 2G9OA 1FDNA 2VH7A 3WC2A 3MTJA 2PMWA 2HCKA 2KXNB 1QVFP 3L09A 4JJBA 2K2PA 5HQLA 1VQ8Q 3CCJA 3CCQQ 2ZE2B 3V6DB 5CCMA 2Z2ZA 1C1CA 1EB0A 1RT4B 2V2KA 1EAYC 4LE9A 3D6MB 2X3XD 1OU9A 4A46A 3QIIA 3T1YJ 2JVVA 2APOA 1YJ9Q 2XQCA 2HNZA 4O3RA 1NSAA 1FFSB 4OMPA 3BGLA 5F3ZA 5A2QU 2KR3A 1KC8C 2ZHAA 3UDLA 2Y3YA 1F6TA 2A3LA 2PNIA 4YHHF 3J80U 5B0AA 3M6WA 2RI2A 3RW7A 2K7KA 1VQOA 1YJTA 1TKTB 4QR0A 5C24B 1WHJA 3T1HF 3DB3A 3D1OA 5CZVA 3J7YI 5EN1A 2EJ9A 1SH3A 4JI0J 3M0PA 2VPXB 2WONA 5IT4A 4ZHRB 4TY8A 2LCWA 2RJDA 1WTFA 1HD3A 5LOQA 2VFSA 1WIEA 2R7SA 3TAMA 4MKYA 2HVHA 5M9OA 2UXCJ 2B8PA 4ZIVA 1VQ6Q 4X2BA 2HAXA 1PIEA 3MM5A 2P9EA 3ZTQA 4ELVA 2X4JA 5A76A 3SFUA 3MMBB 2LECA 2J0QD 4FNIA 3PG9A 1HPZB 5CCAA 2FPFA 4F7UF 1GCPA 3GB0A 2DIGA 2PA8D 2CQCA 5F0UA 3NGRA 4F2SA 4KHPF 3CCVS 1KNZA 1V1CA 2VODA 1I5LA 4DXLA 3DRRB 5IHNA 3JYTA 2AEMA 5A0YB 3MM8B 2K3XA 3QIPB 4M5KA 2YXYA 4GVBA 2CQDA 2CADA 4CO4A 1GX5A 3K8WA 2BV3A 3DMJA 3CCJT 2F4FA 3G71A 2HQFA 1G3YA 3PW2A 1BKBA 3BBBA 4HHJA 1EKSA 1JXLA 2GMJA 2M0OA 2CPHA 4BC7A 3G4ST 1KQGB 2C2MB 3IMQJ 1U1OA 2HIQA 3MEDB 3HKSA 3MP6A 2MYSA 3KK2B 2Y1IA 3FCVA 3QPIA 4TYAA 4TQSA 2JH3A 2XO7A 3G6YA 1X60A 4ZHRA 2DY9A 1TL4A 4QWAA 3MZIA 1TL3A 3JCMc 1RAOA 4E8UA 1SI9A 1SJ3P 4I0WA 5LMUJ 4MZPA 4ZGEB 5ETOA 3W2VB 2XI2A 5ETLA 4PQUA 2QT7A 5T41A 1OZ2A 1JEGA 2XLJA 4KO0A 2HL5C 1TAQA 1M0SA 2OAUA 1IKWB 1CC7A 4M7AE 5HP1B 4RWWA 1F3VA 2QYGA 3M1VA 2GZOA 4DFKA 3CDUA 2IM1A 3OVBA 1VCTA 1VISA 2RQTA 3HPWA 2EFVA 3FBEA 2AEJA 1TOVA 3DRPB 4EK2A 2DYBA 2CJKA 4ED4A 2MQQA 4X4QA 3O2IA 3TEEA 3UPFA 4B9XA 4BC9A 3RYLA 3H6ZA 4NXMJ 1CJUB 2XM3A 1YJWS 5KFUA 3QJPA 4LDYA 4ZVPB 4WP3A 4OB0B 1HBNA 5IT9E 4O3NA 4XTYA 2JFKA 3I32A 1HD0A 4L6V5 3HKZD 2XSFA 4ZVUB 3A3OB 1ZPVA 1FI4A 4H4KA 2YLBA 4DBQA 4L73A 4K4UA 1OY6A 2BOPA 5LSOA 1RU2A 1S9GA 2RVJA 1KTVA 2PTKA 5CVIA 2IBOA 2JM9A 1YNZA 4USVA 4J7IA 2LNVA 4HKQA 4A8WA 4FXVA 4DV4F 1FJEB 3GJRB 2LJ3A 4IG3A 5J1EB 4AFSC 1U25A 3BKTA 2VQEJ 5H9FK 2O4XA 3H0FA 4DA4A 3P96A 1TUGB 4KULA 4I2QA 2DNUA 2R4FA 1YBYA 2B0GA 4OZJA 3KLVA 1H73A 3KHRA 2F8EX 1TL5A 2ZCFB 3GU0A 4QVCA 2N82B 4K5SA 3HSJA 2IDLA 2V34A 4PYDA 1D3WA 4ZKAA 3VJPA 3CD6T 4BE0A 2ZZTA 1NJZA 1S1VA 2KXCA 4BB7A 2LKZA 4DU8A 2GF7A 3CCQA 3IQLA 1JJ2A 1IKVB 2MKSA 1Y71A 3MECA 3L7OA 4NLTA 3NGPA 2YRCA 2DXUA 4GO7X 4NL3A 5CKBA 3I0RA 2AZVA 2IRXA 4DCOB 2E9ZA 5CYMA 1JXEA 4R0KA 2KSSA 2GCXA 1UJ5A 4B9UA 3KLHB 3AODA 2CQHA 1ABOA 2FHKA 3CBMA 4P10A 4QOTA 2CPIA 1DTQB 5L23A 3OR1B 3HZGA 4V1Ak 4E6RA 1T05A 1GTEA 4DWIA 3TSWA 2PMZD 2EPIA 3PDNA 1WI8A 2MQMA 4C9DA 2RKIB 2HSPA 3QAUA 4J9EA 4ZN1A 1RWOB 2IY5B 2XYHB 4CO0A 4RTVA 1T95A 2J05A 4J37A 3META 2KG1A 2HQCA 1OX9A 3D67A 3J7ZT 1LQ9A 2B9YA 4WE1A 2I0NA 3LAMA 3P5BP 1R6YA 2WACA 3TP2A 2MLXA 4B3OA 4Y2MA 1YHQQ 4Z2XA 3MTKA 1AVZC 1IZ6A 3A8KA 2K1RA 1BMQB 1OSDA 2RRNA 2JS0A 4F16A 2RB6A 2HNDA 3SEOA 4DV6F 1CLFA 1F1BB 4UUXA 5HN0A 1MNEA 2BANA 4C0OC 1U2CA 3UT1A 1UGQB 2F1FA 3OJSA 2K5LA 3I9QA 3QBYA 4ECXA 2GIQA 2C0OA 4ELTA 4ED1A 4P72A 3PVXA 2FZGB 3VVTA 3HLUA 4JP8A 4X65J 2V8HA 2QLXA 4N76A 4YMEA 1R8BA 3MMBA 2DXBA 2LQNA 3I6PA 1OPIA 1KLMA 2HQXA 2HNYA 4I64A 4BI8B 3PJWA 1W2BA 1O9SA 3CBPA 3KFVA 4DMZA 3UVJB 2ROEA 4JI2J 4D3GA 3CD5A 2UUBJ 1ZM9A 1K8AT 3QIPA 3OYNA 1VRUA 3FFIB 2UXBF 2JM8A 1PD0A 5HVGA 3GNFB 1TVRA 2VOOA 4K4ZA 1K0SA 4USMA 2R42A 1WKJA 5KT4A 3NCRA 1Q81U 3I55T 2RKIA 3L9ZA 3IBFB 3NP5A 8AT1B 4OYZA 2N7YA 3GIMA 2LQ5A 4I67A 3C16B 3X26B 4OYXA 3NOCA 1KD1R 5KT7A 3MHXA 1CSJA 3N6LA 1Y96A 1LWFB 1UJ4A 1UCNA 3THKA 4ELYC 2YKNB 2RPNA 2ZZNA 5L1JA 5HO4A 1EHWA 3QGHA 3OSSC 3M30A 5BXIA 2KAFA 4PWDB 2KRMA 2W9BB 3OYAA 3CXCP 4HACA 3MUMP 2GGPB 4O3OA 1LFPA 3M6UA 2CZ4A 2ZNZA 4MTPA 1GTHA 1RAJA 2VWFA 1YZ7A 5K14A 3N01A 1LEOA 2V50A 3GP8A 2GQCA 2AHJB 4I6YA 4GVLA 3M4XA 3W60A 3A12A 4OZ1A 1YQHA 2BJ7A 4KPYA 1C2PA 2L2PA 1HR0F 4C2MA 1XMOJ 4Y2CA 3A8MB 5DQGA 1OZ3A 2Z2YB 2CP7A 1Q82R 3ISNC 2NXUA 2UU9F 4X4OA 1V5VA 5HJXA 3UR3C 5G0RA 4O44B 4A4HA 2BIVA 4GC6A 2H3EB 1CJUA 2FGOA 3AJ2A 2ZPFB 4C8NA 3OTEA 3DM2A 2AKLA 3EHRA 3SWNA 1UW4A 3D0GE 1M1KT 2OFGX 4N41A 1ZH5A 3E9FA 4MKBA 1U1RA 1L3SA 3ZL7C 4C98A 4QIVA 1MLAA 4O0NA 2HRYA 3KTQA 4AL7A 2CPEA 5EUHA 4PUOB 3QLHA 5GAMh 1M5PC 3OXGA 1C1BA 2N3LA 4J9MA 4MK9A 1FTCA 4OI2A 3LAKA 4LQ9A 3IWXA 4OZ3A 3PX6A 1WELA 2GA7A 3H5UA 4DPOA 3BB5A 3VS0A 2ZAEA 2A1BA 1B34A 3L2WA 1A0OB 1XERA 2R7WA 1YFNA 3NEKA 3GONA 3UA6A 4GRSA 3NTIA 1FK9A 3CJ0A 5KFCA 1RLDA 3L2UA 2KMTA 2QLBB 1URNA 3TQEA 2VGNA 5ETKA 3HVAA 1VQLA 3KK1B 3ITHA 4A8OA 3PX0A 1EETA 4WKRA 1IBLF 3QKJA 4YDXA 3NBPB 5KYYB 1TMJA 3L2ZA 1REGX 2DT9A 4C8QF 2O01C 2CWKA 1RT1B 3CCMQ 1PGZA 2FVSA 1HI1A 4WFNQ 1F5BA 2UZAA 3C3LA 3PFSA 5DO2A 3OW2R 2H8HA 5D15A 4CO1A 1S6OA 1PG5B 1SIWB 1TL1A 4JUVA 1TV6B 3K7RA 5DDRC 2GNKA 4RTTA 2JN0A 5KFDA 1YITQ 2P2CB 1QM9A 5GAN3 3SWNB 1BQMA 2XIDA 2YDLA 1JNZB 2C3YA 5GAEU 3CC4S 2DNGA 3IM9A 4DR5J 3TRGA 4OMQA 5BR8F 4U67Q 5GAOl 3DB4A 3FJ2A 3MJXA 2DNMA 1FXLA 4LRFA 3DLEA 1WHHA 5JVGQ 3UW1A 1FMWA 2Y8WA 1Q81C 2CP3A 2DJZA 2ED0A 4ZA1A 1UA1A 1GL5A 4JI4J 1QVGR 2JVOA 4WFYA 4I4BA 4RTYA 1BQXA 2LEBA 1HMVA 1BIAA 3JRZA 3BREA 2AIRB 3LH5A 3UN2A 3F0NA 2OD6A 2XSJB 1C0TA 1NK4A 1N9SA 1GMWA 1SC4B 2VOPA 2K5IA 4HTIA 1S1WB 4JI0F 4X64F 1XNQF 3HPOA 1WXBA 1WDTA 1R0BG 2EGEA 1JWWA 1TL3B 2J6OA 1RLQC 3JV3A 2E12A 4XTTA 5U47A 3W2VA 4B9SA 1HQEA 4AD6A 1F5AA 5D3GB 4E7IA 3FEYB 2UXCF 3KFWX 4LF9J 2RU9A 3H5SA 2RRAA 1YJWQ 2KQWA 4M77F 3QT6A 3K5OA 4X1VA 1VGYA 1YDLA 5LXYA 4JOUA 4AG2C 5I3UB 3J81E 3CULA 3H8YA 4HLBA 1ITPA 1PHTA 4XDCA 2DRAA 3EH2A 3LD7A 1LOJA 4DV0J 1PSDA 2YXLA 4CC2A 1N5ZA 2O1PA 3MGJA 1D0ZA 4Q0BA 5L9NA 3INZA 2J6FA 2QRRA 3NL0A 5ETSA 3R3TA 3UO0A 2E5GA 3UFCX 3KNAA 2D1CA 2QL9B 1Q8BA 4CLLA 5KG2A 4FN5A 4A4KA 1VRUB 2CT3A 3B6BA 1F60B 1AB8A 4LFAF 3L1AA 1TZ0A 3TJAA 1HWUA 4IOCQ 2DKGA 3CQTA 4NYPA 1NAQA 2QL7B 5DM6Q 4EMDA 4ECTA 4JI6F 1Y3KA 1FVSA 1HWJA 5FU7C 1O75A 2QQRA 4RLEA 3FZBA 3GFHA 3CMEA 4IH7A 4JB8B 4F4WA 3ONQA 1Q86T 5HCKA 3VGTA 1WHWA 5EX3A 1NB7A 1NZAA 3IA0A 2YNIA 4B17A 5KFJA 1RLPC 1CJVA 3VWSA 2CQPA 2VPZB 1AT1B 2GJ2A 2BOAA 4OYMA 4C48A 1QE1B 3HSBA 4BWJA 3QGIA 4IR1A 3FQKA 4WZMA 4PPDA 3C4SA 2JEFA 4DX5A 3L3CA 3CDEA 3GTYX 4EFAC 1Y57A 1XTZA 3A1YG 4M95A 3CC2A 3UCZP 1AW0A 4DL4A 4CH7A 4DV3F 1NCLA 1FF2A 2EKHA 4YY3F 3G82B 3G2XA 2MYFA 1KHVA 1J5OA 1JXOA 3CF5Q 5J2MB 4A8SA 1T8EA 1BWEA 1WQ7A 1TUWA 2VL1A 2LYVA 1AWXA 4DBHA 2HHPA 2KM8B 2GAGC 1FJ7A 1B0VA 5C6SA 3RB0A 1QJHA 3PGGA 3KLGA 3FCHA 1R3NA 2FLNA 3Q8SB 1WC1A 1G3TA 3AXKA 5GVQA 4P7VA 3W5ZA 2L8DA 1YWPA 1Y0HA 1SIZA 3CCVA 3Q8YA 3M9OB 3DC2A 5ETTA 1YI2T 4KHRA 2VZ9A 3QO3A 2JWNA 2ROLA 2FVQA 4Z8AA 3G4SQ 4DG1A 1FJGJ 3RKYA 3DMJB 1SJ4P 4HDGA 3P8DA 4L59A 3OT9A 4D3HA 4NZ0A 4M5MA 2MZTA 2E7VA 3KLEA 1T3OA 4DV2F 5FROA 1RHKB 4PG6A 1R7IA 2IBKA 4DEZA 1V6HA 3MR5A 4DQIA 5IV3A 1DLOB 4IOBA 1N0VC 2GS8A 1X0PA 1VQLS 4OZNA 4E7JA 4FL6A 5HROA 2B3TB 2VFRA 4UC4A 1B34B 1VK8A 4LF5J 4J9RA 3SBMA 2NZCA 4KV8A 2H65B 1JJCB 3CO9A 1G6BA 1TKDA 2W9CB 2WSCC 3CCUA 1SQGA 2GHVC 4PJJA 3EJMA 3FQLA 3DU6A 4RW4B 1FRXA 1CQMA 3DOMB 1VQMS 1M27C 1U1PA 1S9EA 2QJ3A 1XIQA 4WK3A 3SIPB 4ZPTR 1M1HA 4RTWA 2GGRA 3GIJA 3O5ZA 1MROB 4X62J 4NPOA 2E5HA 4JI5J 3JCMX 2ADCA 3FSYA 2HAIA 4LFCJ 4RW7B 2EQUA 5LJ5f 2HNYB 3IFEA 3M32A 3ZZUA 4BWMA 3KLGB 2K7AA 3ILLA 1KQSA 4JI8J 3M4YA 2I2LA 2JTMA 4LF7F 2MY7A 4Q7AA 2DFUA 1NK5A 1I81A 1KQFB 4QYZJ 1HBUA 2YX4A 2B5JA 1ACMB 1K0VA 2QMUB 4DL5A 2JC1A 1NEGA 2WVBA 5DDPC 3ZTOA 1BI3A 4MH8A 4OX9J 3AFGA 1Q16B 4OB2B 1PWTA 4B3TJ 4DG1B 1FWZA 2Q43A 1NU4A 2YNHA 2AZ1A 2FJEB 1N48A 3PT9A 4CLTA 4FVMA 4PLIA 1U24A 4N0AA 2CQ1A 3RU0A 4CH1A 2GIFA 3M6VA 3G6ES 1TELA 4KE5A 1X4AA 4NLUA 1E6VB 4RO0A 5GAHU 3MR3A 2EKOA 4C8QE 3DDNA 1TAUA 1W6XA 1U0HA 2QA4Q 4M4ZA 3RBBB 2LU1A 2OHDA 3RAQA 2Z2MA 3EHQA 3P8BB 4TN2A 2KYMA 1WJQA 1NJWA 4DZ6A 2YNFB 2IHR1 2W9CA 1YRUA 1RTJB 4HVUA 4KGVB 1BQNA 3R6OA 2JT4A 2OEMA 1YJ9T 2VQFJ 1D1UA 4XIUA 2FHOB 2KN4A 3HFVA 4GC7A 5DLQE 1RT3B 3SQGA 3EGUA 1UWBB 2B86A 2W2QP 3OW2S 1WOSA 3OSPA 3VR1A 2CWXA 3PHEA 2GQ2A 2EFOA 1XMQF 4B3MJ 2VASA 4F7UB 3KXDA 2X1BA 5IFMA 4IR9A 3SXLA 2JNJA 4LVOP 4L5GA 3MMAB 5D7UA 4J9HA 2WVEA 1G4CA 1Y5IB 2B5JB 4ZIWA 3DRRA 3R97A 2D9OA 3S8SA 3I5RA 1QVFS 1VQ6A 2LVWA 2MOXA 4W90B 2KO1A 3ZZZA 4O23A 2FY8A 4Y65A 1N34F 1LNXA 2QO3A 4G1IA 2HZVA 1PSEA 2CA9A 3PJ9A 1MHNA 2G0IA 3ZZOA 1JLBB 1W7WA 5KG5A 4DX8H 4NRTA 1HYOA 2YWKA 2XWYA 3PRVA 2J9EA 1VQ6T 4J9QA 4WIIA 4ECSA 2W10A 1KKHA 1TUCA 2W9AA 5L1KA 3CCES 1IBKJ 3CC4T 3AB2B 2MSTA 2P9CA 3TX8A 3RAXA 2DETA 4GLKA 2C42A 3TUPA 1V29B 4LSLA 4B9LA 4CNZA 1YJ9S 4XTXA 1GK8A 2CKWA 2L9NA 1N6AA 5IAYA 4V19J 3MM9B 5KFZA 3E3XA 1EETB 2PEHA 2CUYA 3KG1A 4C0BA 4NZ7A 5A8RA 3IN5A 4MYTA 4JDSA 4C92B 2KZZA 4MAKA 3LQVA 1WC0A 4URQU 2XMKA 2OLWA 2VB6A 4RL1A 3OL8A 2E64A 3F70A 2OPSA 2CQ0A 1OQ3A 3W9HA 5FWBA 4USUA 2U1AA 4ZNXA 4TQRA 5M2UA 5CYJA 1RBOB 4CWBA 5GMEA 3TVZA 3CCUQ 1HNZJ 3CEDA 3B82A 2HIYA 5E33A 5IM0A 1LXJA 5KFOA 1Y10A 3TREA 3W8PA 2GJFA 5KYUA 1B7YB 3ISZA 4NA2A 3CT9A 2RT3A 3UDVA 4NLRA 1FO1A 2KKHA 1A9NB 1T3SA 5KCOA 2K79A 1K1ZA 2FRWA 3ZFJA 5HK3A 3CCRT 1RT7B 7FDRA 2W2PP 2R7UA 4DX6A 4LDXA 2VU5A 2JLGA 4FDFA 4PKCC 1RTHA 3M05A 1T3LA 4N4HA 5HLFA 1M90R 1VQ9Q 3W61A 1WLPB 5KE2A 5HROB 4RX6A 3EPIA 2RQWA 3JCMd 2QQSA 3JCMJ 2J9DE 2ZDOA 2DEUA 3CJQA 3MAHA 4P2XA 3IAS9 3JSYA 1SH2A 1SQEA 3PW7A 4GKJF 3T1HJ 3AOAA 2DGTA 2VBXA 1IBLJ 3K8VA 1IVZA 3SFMA 2ROGA 4XPCA 2B9EA 2B56A 2HWIA 5KOXA 3DGPB 3SDEA 3FEZA 4RW8A 2E3HA 4USWA 3FC9A 4K4VA 1CEZA 1FE0A 3MDFA 2K4YA 5GAGU 3BN4A 3GFZA 1FE4A 5CAIA 1ZETA 3HD1A 2UUAJ 5DETA 2ZH4A 4M78B 1SKRA 5EGYA 2F5TX 4J9FA 2ADBA 4HCZA 4IO9Q 2C22A 1U6BA 3CBOA 5FWCA 3Q8UA 1OU8A 1YBUA 5AXKA 5CKHA 1YJWA 3ZFVA 4HVVA 4CC3A 3DM2B 2A10A 1IO6A 1U2FA 1V76A 1G5VA 1WEZA 3SYZA 1IWGA 2YWGA 1RTIA 2YKQA 3HRUA 1RT7A 4ER8A 3S3NA 4IURA 2LC4A 2HZYA 3E8OA 3Q89A 1PSFA 5G4DA 3VS2A 2CZ0B 3IBWA 4R56A 2VGMA 2BM1A 5T7LB 1GBQA 1VQYA 5LSRA 4IKFA 4OYBA 1NMEB 1N56A 4IH6A 3UD4P 3DLMA 1T7PA 2PN6A 2M5YA 4Y28C 2LXUA 1FFGB 3G86A 2Y1JA 2BKDN 3ZZPA 2XULA 4X66F 3UWNA 1RHJB 4QW9A 2JJ4D 4JLIA 1U7LA 3I56S 3I87A 3WVDB 1S6PB 4HVZA 4M77E 3EFSA 4EO8A 5J2MA 4RW8B 2ZFHA 2I8EA 1Y3JA 4PEOA 3EH1A 2E1PA 1UWBA 5LMUF 1PKUA 3OLBA 2Z57B 4Q8FA 2J6SA 3KUHA 1RI0A 3L95X 4IFYB 1JJ2P 3A8EA 1N32J 3A8GB 1ZTTA 3GOXA 1LJOA 3H0IA 3UVJA 3ADAC 2KXDA 1HBOB 1QD1A 1FX2A 1WF2A 3OFFA 2R8KA 2DH8A 3QWUA 4ORZA 3F73A 4FYWB 2AYBA 1U1SA 4ENOA 2RE1A 3I5CA 4BI3A 4L74A 3JQMA 1NJXA 5CIUA 2HLUA 2KJWA 1R0CB 2MTLA 2QC3A 3GBQA 4NMXA 1NPKA 1YHQT 4E0DA 3VS1A 3MM5B 5C25B 4F7UE 1WF0A 1TL7A 2QN6B 3I35A 1KVKA 2GJIA 1QCNA 1AZEA 2D8JA 2ATCB 2RIJA 3CJ8A 1TKZA 1HFEL 2VFVA 4OYPA 3BO4A 2HVEA 2KTQA 4DV1J 3HRTA 1WJSA 2EVRA 2HMAA 2OGUA 1U09A 4OMFG 5J2NA 1BI2A 4P2MA 5C24A 1R8PA 3RR7A 1UHFA 1FD8A 2CXEA 1U47A 3GFXA 1FTRA 4FT4A 4E98A 2L3PA 4DV4J 4QU7A 4PG7A 2Q66A 1O51A 5CKEA 2MDAA 4RCBA 4CO3A 5J1PA 3EDQB 1ZAXA 2LJ0A 5KFPA 1R27B 4FSXA 3C0CA 1UVMA 4J5OA 2SXLA 4D8KA 1PRMC 3ZZYA 5L8RC 2W7OA 4C11A 5JMNA 3OVAA 5BYSA 1RAAB 1FWLA 4N8OA 2F7VA 3CCMA 2X4WA 3DLGB 4JUZA 1H98A 1HBOA 2EFPA 3I0RB 2HHSA 1OQKA 4DSIA 3WQPA 3C95A 3OUYB 1YHQS 2GX8A 2GO8A 5KG0A 2DNNA 1YCSB 3RBXA 3D68A 2H54B 5K5MA 1KWMA 3GV7B 4WP9A 2SEMA 3KK1A 2RNAA 3CCLS 1QVGP 2KHCA 3PYDA 2VG6B 4WFBQ 2BDPA 4L3NA 5HK4A 1GBRA 2HURA 4DV7J 4OJ1A 2IVMA 3CMAS 3CCSQ 2HEQA 2AK5A 1ZUKA 1S7IA 3CJTA 1GX6A 4YHHJ 2AJQA 3R7SB 3IR5B 1NK9A 2R7QA 1WDDA 1RKJA 4I7FB 8ATCB 2QA4S 2KI7A 5EHHA 5HKCA 3T6JA 3VV0A 3ZNUA 5KFRA 4N47A 4B6MA 3OYCA 4M94A 3QXEB 4AFQC 1H3DA 4KTQA 2LQKA 4DSLA 4IRCA 3FRZA 3G8SA 2R8JA 4ME7A 2WRMA 1NYGA 1X4EA 1BI0A 2H48B 3G96A 4YOEA 4Z89A 3ZC4A 1J5OB 2E1HA 4GBQA 3KK3A 4X62F 4TU9A 5HBMA 2XS7A 2CVEA 5DS7A 2YH0A 4FM4B 3WZ0A 2ZKTA 1DURA 1N8RC 5DG7A 2RDIA 5F9NA 2MGZB 1Y11A 1P92A 5DQIA 3ETOA 3KDOA 4LD9K 1RHRB 1TV6A 2M0GB 2FPEA 1CS4A 1SPBP 5LXRA 3NGKA 1WWHA 4B9VA 2HL3A 1BQMB 2F5KA 4H54A 3GJSB 3X3UA 3NOGA 4PJLA 3LGLA 2OJ2A 3NMRA 4I2PA 3T6BA 4PRFA 3AY0A 3O8WA 2MKHA 4M5DB 3OMCA 1B07A 1VJQA 4J7CA 2M9KA 3G4SS 2YUOA 5FLXU 4OX7A 4JYAJ 5F8GA 1GCQC 2C0IA 5L9XA 2YTCA 2O01E 1TTHB 3JCMb 3QT8A 4JRQA 3DNCA 4MJKA 1A7GE 1SSHA 3OBWA 1Y96B 2KBTA 3A1PA 2FL7A 4LQ3A 2D9TA 1BXNA 1NK8A 3G8TA 1FKPA 2W8LA 1D0YA 1ZZNA 2G1DA 1GH8A 1YN8A 3RMQA 3I4PA 2XCAA 2P0KA 3HZEA 3I55Q 3GLJA 3HHNB 3E2UA 2HMIB 4JRKA 1RWXB 2GVDB 2VUGA 1WOOA 4QVZA 3C12A 3CPWA 3K89A 2CG8A 2AHOB 5GAN6 1R8HA 1Y5LB 2ASYA 2YWHA 3W3SA 4EU0A 3KKFA 4ZITA 4KGKA 3SWNC 5K8PA 2VBZA 1IKVA 4NI2B 2JOQA 3M32B 1NRKA 4OZ0A 1ZSZB 2VV5A 3RB4A 1UL3A 2ZHOA 2RU3A 2M3DA 2LX7A 4NXMF 3HT0A 1I1GA 5F8JA 1VQNS 3LLRA 4NYOA 3R8YA 2J9DA 4WTYA 4C0FA 3BM7A 4PG5A 4ED2A 2ZWOA 2WBRA 4F04B 1UP1A 1S1NA 2UU9J 3L4BC 3D6FB 2MKIA 3MM6B 2XI3A 4UOHA 3MD3A 3I55A 2FYXA 3NLCA 2R5MA 2IM0A 3WVEB 4DF4A 3SV3A 3CC7A 1EQ0A 2E1AA 5BYQA 1ZSGA 2NSCA 1IR0A 2ZJRQ 1JNRB 5KFAA 4QWEA 1YP5A 2ATLA 4EZ6A 1LW0B 2EYWA 2XK0A 1WFWA 2Y90A 1VQ7A 1X5SA 2R3VA 3KMSA 4LREA 2AJ1A 1S59A 3BDUA 3E9GA 2EQKA 4E2FB 1VFJA 4RTZA 1TP7A 1JKHB 5GANj 1DFDA 4DZDA 1R8AA 2D0NA 3PYFA 3LPYA 2UUCJ 2R7RA 2OJ3A 3CPFA 1XWLA 4XU1A 2EK6A 2HG4A 2B7BB 4IUTA 3C6UB 2HMIA 3FBFA 4ZJOA 2EQJA 2HS0A 2X3WD 1JLQA 6AT1B 4ECZA 3E01B 1RT3A 2OMOA 4MDWA 2ZOMA 1IM4A 2MAMA 1YIJT 1RT1A 4OZLA 5KCHA 3LWMA 3PW4A 3P49B 2V8KA 2CAJA 2JZ5A 3OW2A 2A36A 2ZJQQ 3CMQA 5CQXA 3IO1A 4KGZB 5L39A 5KOWA 1JK9B 1LWFA 2JC0A 2Z56B 2LP4A 3CEYA 2RJCA 1E6YB 2HBPA 3X25B 3JB9F 4P52A 1HNZF 1BU1A 2VVKA 3QDRB 4H4OA 4DPXA 1Q8LA 3N28A 3R6NA 3K58A 4C5IA 1K9MC 4O0IA 1QP3A 4NLPA 2MMPA 4FBUA 5J2PB 1TWBA 2L3MA 1K73T 2CZ7B 1JIHA 3ENQA 2J8AA 3O1LA 4YUDA 1NLPC 3IWLA 1HBMB 1Q95G 1ZM3A 4DL6A 3N5BB 1U1KA 2JTFA 1M5SA 2B7CB 4C3KA 4N7TA 1LWEA 3HVRA 3BBFA 2DCUB 1FERA 3CJRA 1S6UA 4B02A 1N5SA 4MIAA 3V4IA 5FDLA 2F69A 4A63B 4IQMA 1N5QA 3A8JA 3U27A 4Q5VA 2VIHA 3M53A 2KDOA 5FU7B 2KJVA 3DLJA 3TJ9A 4IQXA 2RHIA 3EG9B 3Q23A 2DH9A 5LJ5j 4KGMA 1PRLC 2WBMA 1RBAA 2WSFE 4LVNP 3RB6A 1VDHA 1N0UA 3OYDA 4X64J 1XNQJ 2FJWA 3MFHA 3L2QA 1Q7YT 1O0PA 2WB4A 4Y92A 2Y9HA 2E3IA 2EKNA 1VMBA 1OV3A 3MOZA 4PXBA 1VIEA 2XWXA 3OLAA 1LPLA 4BDZA 2DITA 3TWZA 2YT6A 4ZP8A 2UUAF 1Z2ZA 1VIXA 2ZUAA 3D0IE 3BYPA 1BE4A 4F2RA 3PKMA 5GAEI 3VVUA 4DR7J 2YPZA 2ESWA 3OYEA 4J9LA 4KC5A 2DZCA 2HGNA 4IDKA 4ICLB 4QJVA 2OTLS 4Q43A 1K73R 3HFZB 2IJRA 2IA0A 2ZBPA 4EMHA 2E5LJ 2BQRA 4FYVB 1WZOA 3CIMA 2YNHB 4R5PB 1W70A 3BYRA 3R7BB 5KT6A 3EM1A 2QFJA 3TVTA 1GXUA 4C8ZA 2CPZA 4P6QA 1HBMA 1KLNA 2OTJS 2ZBIA 2HEKA 3IGNA 1AZSA 5KFWA 1RYRA 1KONA 4NE9C 2G2OA 4LFAJ 5GAGI 1LWEB 4QBUA 2W4DA 2AQ4A 2CNKB 1K44A 1D9FA 3DRPA 1XQHA 3CUNA 4OMMA 5D4NA 1BC6A 2VFTA 3BPSP 2ZOGA 4F4KA 2J7WA 2VJUA 2R2SA 1QWEA 2LT1A 3I56A 3M2UB 2YWEA 1XOVA 2WSEE 3H9NA 3PO5A 1VHFA 4HH1A 4B3OB 2JFDA 4ZGDB 1SEMA 1IN0A 2XYPB 4ZVEA 2ROPA 3RNJA 2OIHA 3OL9A 2MWOA 1PO6A 3JTOA 5BJRA 4X84A 5J3BA 5D6GA 4X4VA 5H9EK 3OYIA 1JRIA 4BACA 3NBPA 4RNHA 3J81Y 2YLCA 4PJMA 2M52A 2QIFA 4ANDA 2PEBA 1YJWT 2KXHA 4O6JA 2Z0WA 4LBHA 2A7YA 1HXDA 2JVRA 2EIFA 1SJRA 1FX4A 3NGSA 2IAJB 2HBQB 2M8HA 1XMOF 3TU4K 1S72S 1HHTP 1YK9A 2LFVA 1UZDA 1CBKA 5GMKh 1VQLQ 2K3BA 1ICEB 4QR1A 1M5VC 2RF0A 3M8ZA 5L8RE 2F8HA 1NDCA 4BS2A 3D1HA 5F3TA 3L42A 2YUNA 4B3RF 2RRBA 1H2TZ 1NSPA 5D3GA 4MYUA 2LCLA 1M5Q1 1YVFA 5JJBA 4C8YA 2OTJT 3D5MA 5KFXA 3HHDA 3H41A 3IRWP 1WX6A 2Z58B 1C1CB 4DJBA 4CIOA 2GQQA 3PYEA 3LA0A 2EYXA 2RUSA 4FBTA 2LDIA 1TKXA 4PFOA 5HSPA 2NZ4A 2E29A 1WHMA 3NAIA 2DZ9A 2XCPA 5E3PA 4PNOA 4TYBA 4DV1F 4MZTA 5CAAA 5DDOC 3CMAT 4ZCKA 2DJWA 3UN5A 4K2XA 5LMNF 1QCFA 3IG1B 1NG2A 2LP5A 3LH0A 1FDAA 4Y00A 2D3UA 4LNPA 4JV2A 3ULHA 3OV7A 1EIFA 1RWVB 3WXMB 5IWAF 2XMFA 2DXCA 2NXNA 1PJ5A 1Q53A 3MCOA 2B6AA 1Y00A 2MZQA 4IH5A 1K8AC 4Q2MA 2JSXA 1U6FA 2XS2A 1GAOA 4A48A 2DIVA 2B9XA 2RS8A 5A6PA 1RZMA 2GFUA 2YQ1A 2JS2A 2NSBA 4D6WA 5KYWA 2OPPA 4M5LA 2CQGA 1JXVA 3CC7T 4NCBA 4K8RA 2MMYA 2CUBA 2YKMA 4WFXA 3CPWR 1W1FA 2G4BA 2IM2A 3DDIA 1G2EA 3VUBA 1KVJA 4DQSA 1Q86U 4YR3A 3JB9G 2LCSA 1QAXA 2R7VA 2RS2A 3US5A 3PE0A 2OPRA 4CO2A 4N0AC 3J80E 3PRBA 2DR9A 4FPIA 1YITT 3TARA 4X4PA 1NUEA 1AD5A 2KNBB 4JI8F 3GF5A 4AFFA 2YY3A 2Q79A 2VPYB 2XGQA 9RUBA 1FMVA 4M78G 3LO3A 1JXMA 3CJ3A 4B3TF 2HFVA 4RW6A 2H1YA 3JB9I 1HHQA 1X6OA 3CTRA 5KFKA 2UXDF 4QT7A 3ZBDA 4ZCIA 3RERA 3M2RB 2DD5A 2NR0A 3NS7B 2OUGA 3ZTSA 5A0GA 3CCMT 2P84A 4C92D 2ALYB 3LWLA 1HA1A 1T0JA 1PAEX 2QV6A 2YX1A 3MEGA 2FVCA 2M70A 1QQJA 2FHDA 4Z88A 1OPZA 4Y2AA 1NHUA 4RG8A 4ZS6A 3EG2A 1RDRA 2FC8A 4RBUA 2E10A 1TVRB 4IUQA 2EC0A 4M75F 5CA5A 1RTJA 2QQAA 4ZMMA 1VRQC 4LIWA 2QX0A 1S79A 4Q8EA 2D7SA 2DA9A 2QDLA 1F5CA 2BM0A 1Q7YU 3SQGB 4QQGA 3HSDA 4RUGA 1FKOB 2DR5A 3BH6B 1MWZA 3M1VB 2N4DA 1SUQA 4IG0A 1UDLA 3EGDA 1T03A 4LMZA 1SRMA 5E7OB 5GMKi 1R0AA 5ETMA 1K0XA 2J7KA 2R8GA 3L2RA 2VXFA 4K59A 2G6FX 2XY5A 3J7Z5 2AX1A 3MMCB 1M4ZA 3T9ZA 2XU8A 3A4TA 4B3MF 1NSKL 2COYA 2PVOB 3M30B 3AD7C 5ITHA 1VQ6S 3HHLA 2DJQA 2KYZA 2CH4A 1YIJS 3LGFA 1YHQA 1QVFR 2CKKA 1M1KR 2BQ3A 2L0AA 1RQ0A 2XD0A 5B0GA 4JI6J 1VQ5A 5KG1A 4ETXA 4FP9A 3DLEB 2X35A 4NCGA 1L3UA 3QSIA 4JYAF 4ETZA 4HH0A 2FIUA 2LMJA 4QPTA 3UD5A 4XO0A 2A6OA 5HAOA 3URGA 3MI7X 4L6V3 4ZVFA 3RG6A 2Y0BB 3MEGB 1XR5A 2QYCA 2XICA 2NQPA 4U9RA 1VBKA 4I7FA 5A0YA 4ZP9A 4DR3F 2DILA 4ZN3A 2BE2A 4F26A 1YJNS 2PUKB 4OYIA 1HNXF 1IBKF 4NZ6A 4MFBA 4F36A 5GANd 2BQUA 1OX8A 4EEYA 4B9WA 5D6XA 3OJUA 1UB4A 5KFMA 5GADI 2QXFA 3FVYA 4QIGA 4FXWA 4CRJA 1JLAB 1TMMA 1UEVA 4JV0A 1U4BA 2NUPA 3QAEA 3CJKB 3RAMA 2FGCA 2LA6A 4ILMA 1YRXA 1U0HB 1G7CB 4G1QB 2OMLA 2DNHA 3KLFB 3ENAA 2CT4A 4EDUA 2CZ9A 1U8WA 1E6YA 5D8HB 3TSZA 3PEHA 5A2QE 3Q8PB 2ERRA 3OL7A 3TCJA 4EMKB 4YS2A 2UP1A 5AJ3F 4HEA9 1B4SA 3Q8RB 2BKNA 2AV5A 1S1TB 1N5YA 1FRJA 3IS9B 2VBWA 1FJGF 1RA7A 1RT5B 1WG5A 1PNJA 2UUWA 4WP8A 1PC4A 1Q0NA 5LM7E 2OELA 2UVRA 1NM7A 2VA3A 3TZZA 1TL7B 2HWHA 3C8YA 1FMKA 1I94F 1Y7PA 1PYSB 3LW5E 1U1MA 5HI7A 4IFVB 1I8FA 3FMBA 4OIXA 4C7QA 2E66A 3HSZA 3SCJE 5GMKa 4ED5A 3I5SA 2JJ9A 3HP6A 3RJMB 1X0FA 3ULRB 3WDOA 4KH0B 4CDIA 4O4GA 2W8KA 1SBRA 4UOCA 3M2VA 1B3TA 5HK0A 2VBYA 3GNGA 1T3NA 3H20A 2MZJA 2FB0A 3KNGA 4KAIA 5KG3A 1MMGA 1GMWD 2YKAA 5H1SV 5KG6A 4K4TA 2R8IA 2KH9A 3GIRA 2AGOA 2HS3A 3CXCR 1RUWA 1XK8A 3OXLA 1NPRA 4DCPB 2G13A 4RW9A 2BACA 2WHOA 1W26A 2IC3A 5KYWB 3WHIA 2NUHA 1M5OC 1S6QA 3PIOA 5M2PA 1NLOC 2CDQA 2NWMA 4JI3F 1W2BS 2QL5B 1YI2A 1FEEA 4DV6J 3QT5A 2ASDA 1RLCL 2N4CA 1P9YA 3QSUA 2CQIA 1JO8A 1LKZA 1KQ1A 5KYNA 2HHUA 3UNGC 3K2YA 3A5ZB 4A8QA 3QWPA 3AXMA 3I55S 3JB9J 3Q2SC 2L89A 4ESNA 2ZM6F 4HCCA 1PC5A 1H2VZ 3TZWA 2IMWP 1VBXA 4R25A 5E3QA 1M3BA 4AXJA 3SD4A 1J5EF 3R2DJ 1R43A 3JQKA 1XMBA 4CQ1A 2I1RA 2DF6A 3AQOA 4USKA 3SFGA 3Q86A 5D0RA 3BR8A 2NPIA 1RI9A 2CYZB 2P6TA 1GFWB 3PR5B 1CC8A 2HHHJ 1NM2A 1UFKA 4MMKA 1SV5B 2PGCA 3BQ0A 1JJHA 1D09B 2CPFA 1Z1ZA 3D6HB 3DOLA 4WFAQ 3QT7A 2XZWA 1FHTA 4NLGA 1N52B 3THTA 2XY7A 3OS5A 4ALZA 2SRCA 1SJQA 2L9WA 1O5JA 2OSQA 3ZEHA 1C0UA 2YNGA 2M1HA 4AXIA 1KS2A 4RNFA 2HFUA 4KY3A 1MUZA 5KYUB 1JU5C 3LH2S 4HACB 5HVFA 4DF8A 4KT0C 3TX0A 3D6TB 2J7IA 3OYFA 2FHMA 2NPFA 2HQHA 3HXMA 4FVCA 3SCIE 3ZNJ1 1GMUA 3DOMA 4AQYJ 1S97A 3OXFA 3CCLT 4F4XA 1X5OA 5ECAA 1KC8R 1T02A 4OF1A 4QW2A 2RJZA 1WNLA 4E7ZA 1YJNT 2KVQE 3GYXB 4I6WA 2VD3A 3N0VA 1HPZA 2IA6A 1H2UX 3LYIA 2CQ3A 4RUAA 1JQGA 2XHCA 2J6KA 4MKAA 2FZCB 1K4US 1IGUA 1S72Q 5IC6B 3CO0P 3GLXA 5KT3A 1AZGB 2IVFB 1SC6A 1LCKA 2WOMB 1CJKA 3TA1A 2F4VJ 2MKYA 4P2FA 2A3JA 3HDSA 4K7QA 2BRLA 2DL5A 2E5LF 4GKKF 3LP0A 1URRA 3BO3A 5C2GA 5I42A 4FZVA 3TOQA 4F14A 2W1BA 5LT5A 1YITS 2EFQA 1BCOA 3VZIA 4YQWA 4XU3A 1PYOB 4Y34A 3VGSA 1IM6A 3KHLA 2RN8A 1HKAA 1HQUA 1FVQA 3G4SA 1H72C 4I6AA 5GANe 4NI2A 1WF1A 4B08A 2MWPA 2WK4A 4JV5F 2HZAA 1IRXA 1VQPA 2DHXA 3DOLB 3A8OB 4P74A 4F17A 1IXDA 3MR6A 1KRPA 1CKAA 3O8VA 1M5HA 2BJEA 2RF2A 3VRZA 3H8ZA 2WAQD 3O5TB 2QA2A 2J0XA 4FYYB 4X34A 1NYFA 2W4PA 1TR0A 1S12A 2EFGA 1RWWB 2QAZA 2JEGA 1KVIA 5GAOq 1OYXA 3CVKA 1YG0A 2NYHA 1QAYA 4DPYA 2DD8S 4RZRA 4C8QD 2JMCA 2MF2A 2CDRB 3CCEQ 4NX9A 2HNZB 4P7TA 5HL7Q 3LOUA 3C16A 3OYMA 2B9WA 2CGHA 2CH4W 2I38A 3CCSS 5HQ8A 2DNPA 2HGMA 3UD3P 2IMOA 3MEAA 3L7UA 2JX2A 3K5PA 4A47A 2K3IA 1FT8A 2XMJA 4V2SA 4M7DA 3OW2P 1Q81R 3L7PA 2DXDA 5CD4H 4B3RJ 2DPJA 4EBCA 5FJ4A 2VKRA 1YRTA 3CCVQ 2DMOA 3VAIA 2E41A 1U1QA 1Q78A 3VGVA 3ZTRA 1VR6A 3U1LA 2EYZA 1UECA 2ZUGA 2E70A 1RTIB 4PQAA 4DQQA 3W5XA 3ENVA 3NGUA 3PRDA 1UVNA 3U1MA 3TVYA 3CCMS 1PKSA 2IDEA 5GAMj 3G87A 1RACB 3LANA 4GMKA 1HMVB 2DR8A 1WPYA 2ABYA 5T7LA 3BR9A 1T9VA 2LU2A 2XBPA 1HI8A 1HYSB 4DDFA 2CNOB 4F3QA 4DV7F 4G6VB 1KHIA 1JKHA 3AD9C 1N8RU 2FUG9 2VG7A 4E47A 4EYIB 4Q44A 3RIRA 5T14A 4OMLA 4PL6A 4C0DB 3H5XA 2DBMA 4OZ5A 1NK7A 3PXGa 2EPDA 2QDYB 3QO9B 1VQ9A 5IHKA 3C6UA 2OAWA 1VQNT 5F0WA 2ZVIA 4A8XA 1UG1A 2RH3A 4G65A 2Y0SD 2P0PA 2OTLT 4A4EA 3DKDA 1F3FA 4HT8A 3CCST 1EFNA 5ADZA 4AL6A 2DEIA 1VYAA 4NOYA 2JRSA 2EKYA 1NB2A 2FO0A 2I2YA 5GMKm 1V3SA 3M0RA 3G6XA 2E65A 3J7YU 2JEJA 1Q4RA 2MKJA 2CQ2A 2DLPA 2ZPEB 2LQ9A 5AXNA 3PIPA 2VDIA 5J2NB 5I21A 2Q1LA 2FY1A 3PYGA 2GV1A 3UCUP 3JSBA 2I5JB 3DI6B 3Q0AA 2LNHB 5CYQB 4DR4F 1KQSS 1RAEB 3BY7A 3RBZA 2BRKA 1K1QA 1TSFA 3G71Q 3CE8A 2AEFA 2BXJA 3BGRA 2QA4G 3JXOA 4M77B 3U02A 3VGUA 1U06A 2YRDA 2UV8G 1ZZFA 3HD2A 3JAMU 2POKA 3I56T 4F3OA 2ZHBA 3S1TA 4DU7A 1G3SA 3RUXA 2CJAA 1VQ4A 1TKZB 3R5BA 2WSFC 1X6BA 3GV8B 4WXOA 3MEUA 2CUDA 3UQSA 2BYCA 2JL9A 4NLQA 2WTFA 2YX7A 2CP5A 1OJ4A 2QEXQ 5HLFB 2OPQA 2BZ8A 1YSJA 4I69A 4PJOC 2AZSA 1B64A 1DTTA 3C14B 4TLQA 4J9NA 2RHSB 2BE2B 4JJCA 2RUGA 2DHHA 3PFOA 2IIHA 3HHLC 2HD0A 1IXKA 3MUVP 2HSEB 3QJ6A 1CQNA 3POTB 2QSFA 2G2YA 4WXWA 3S7RA 1Z9QA 2M16A 2BKPA 4KUDK 1T9XA 3X28B 3NAHA 4NLDA 3UWTA 4YY3J 3OS1A 2D3OR 2HFSA 1GXLA 2R7OA 4PWUA 4OHZA 2CP2A 2WCXA 4DSEA 3ER0A 2XY6A 4C92C 2GNCA 4X4NA 4EMKA 4UTGA 4DHVA 4NEYA 1U26A 1EJ7L 1WHKA 3EG3A 3SV4A 4LFBF 4M7AG 3OBIA 2EYYA 1SF9A 2ZZDA 5ETQA 1U49A 3OS0A 2RQCA 4VUBA 2MZ1A 2O31A 3GYNA 4M75G 2XI9A 1N5TA 2PFDA 4BDYA 1WOPA 3NWGA 2GW8A 3SSQA 2KT1A 4M78D 3QPHA 1HNIB 5AYFA 3DHWC 1SSFA 3HHLD 2NS1B 3X1LB 5IQQA 4RTUA 1SH0A 2ZWPA 2XO6A 2GVZA 4QU6A 4HT7A 2KVQG 5CZXA 2CDTA 4RBTA 4Y0FA 4M1KA 4A4GA 2DPPB 5D4LA 1FRHA 4QZVB 1QSSA 2D0QB 2BTTA 2DX1A 5HANA 1F9FA 4ZVQB 3EVOA 3H98A 4EIKA 4JS5A 4OZ2A 4FW1A 2GHPA 2EWHA 1JJ4A 5GAN5 3NWRA 2YH1A 3D28A 4JJNK 3RKWA 5FW9A 1OMSA 4NXNJ 4QWDA 1M1GA 2NUUG 5MAOA 2KE9A 1NKCA 2V69A 3KG4A 3HM9A 2E5QA 2LRQA 1YZ6A 5B0EA 4CLSA 3HFNA 5D78A 3HX9A 2ZKUA 1C4CA 2GFAA 3AH6A 3NKYA 3M58A 1RSCA 4WE1B 4IFYA 4LF4F 3EGWB 1SCJB 2YWWA 1RWNB 2LZ6B 3M0TA 2N7CA 3ILJA 3EGZA 1V5IB 2W2NP 1E6GA 4W98A 2MI6A 1E7OA 2XMMA 5E3RA 3FBBA 2JW4A 1N8RT 4ED7A 2HS4A 1NK6A 1D9AA 3EICA 3EVMA 1S0NA 2BANB 4J9UE 3CW2C 3CCRA 1RT2A 2AJ0A 3V81B 2LDYA 2QMXA 2ZITA 1I94J 2ZH2A 2YVSA 4RU2A 3W62A 1WYXA 2V1RA 3RESA 4WPAA 2F2XA 2O3DA 1VYVA 3UE2A 4KQZA 1VQ7Q 2H4YB 4C97A 2RMLA 1M90C 3RDVA 3D2WA 2O66A 2DNQA 2D41A 1SVDA 2NXCA 2O2OA 5GMKl 2MLZA 2NUTB 3J81U 1NO8A 4FYXB 1G83A 2C3UA 4ZK7M 3P5TL 4YB7A 1X27A 5LJ3d 5BYRA 5AE1A 2CZ1B 4M8LA 1FK9B 1ZX6A 5E41A 2X4XA 2K2VA 2GMHA 2GVDA 4TXSA 4DX7A 4DQRA 3MM6A 4HHHA 1KQSP 2LXIA 4IKAA 1BQNB 8RUCA 1T9UA 2PIIA 2VPWB 1G3WA 4FPRA 1RWKB 3FIFA 5DRKA 2J6UA 2DCLA 3M9NB 1AFJA 4X4TA 3GPAA 4DN0A 2R8HA 4II1A 1WEXA 4F7UA 4X9DA 2KB2A 3CDWA 4OVAA 2RI5A 2NXJA 4HT5A 2NLUA 1I51B 3DLGA 4Q5WA 3MPVA 3QZ8A 2RJFA 2KK4A 4CI0B 2WOMA 4J9CA 5F41A 3CC4A 3GCXP 4E7KA 4KV8B 2BJ3A 1M2VA 2AZ3A 4WCEQ 3DLBA 1VQMQ 2HFOA 1TQLA 2CPXA 3LP0B 2CNLB 5KFQA 3CCZA 1VLYA 4PG8A 3R27A 3FDSA 3NMZC 1RHMB 2DY1A 1VQ5Q 3QFHA 3E01A 4PAAA 3KHGA 5B0BA 4L3KA 4CLWA 4J9BA 3MPDA 1N34J 2D1XA 3VAKA 3BSNA 2XEXA 3NHNA 3EGDB 1UVJA 3R7NB 2ECZA 2BKOA 3OSVA 3KJVB 5IT9Y 2OTLA 3F44A 1IBMF 4IO1A 5KG4A 1QWFA 3P45B 3ZZRA 2FG0A 1QKWA 4WZQA 4OV6A 4B3SJ 5DLFA 3DLHA 4J8OA 1JLCB 1QUVA 2DK3A 1LW2B 4OI6A 1Q5VA 1X4HA 1UAWA 3SZ2A 3I5BA 1WACA 3V2UC 2RJEA 1VQ4S 3G71T 1LOUA 2AYMA 4QKUA 3EVWA 1IWAA 1NZ9A 4NLWA 2K7JA 4AQYF 2DNZA 1QCOA 1FWKA 3EG0A 2V8IA 5LJ5g 5LJ5h 3VAFA 2WVFA 2K57A 3MEDA 3KJQB 5MLCV 1TUDA 1T03B 3CC4Q 1NHKL 3LWIA 1R0AB 1T9TA 1VC0A 2F8MA 3G7ZA 1X4CA 2GFFA 2OEJA 2Z4PA 5GADU 4DI6A 1WG1A 2A37A 4M75A 3QSYB 2CNNB 1KP6A 4DUYJ 4RTXA 2CJBA 2V1QA 4BHQA 1ROFA 3D3BJ 2AKKA 2F4VF 1UW9A 3BGUA 3EG9A 1LNQA 4F02A 1XEZA 1X4GA 4C4WA 1J3TA 4GKKJ 1VQMT 3NS5A 4C92E 1FRMA 2F9DA 4BE1A 4NS5A 3FDRA 5J2PA 2X1GA 3RR6A 4KO0B 4E7SA 3VS3A 2DGXA 1S77D 2XS5A 5I11A 4O3PA 1FXXA 3SI8A 4KBMB 2VF3A 1U5SA 5K20B 1VQMA 1X4FA 1KD1U 3THPA 1AWWA 5FD1A 3CD7A 3CJKA 1VYTA 3GG0A 2BJ9A 3Q22A 1VQ5S 2B4PA 1WORA 5J1NA 4J9SA 1WXTA 1KQSR 3PO4A 1KIKA 1K0TA 1QE1A 4UT4A 2XG8A 3AJ1A 3DOKB 3OPKA 4QR2A 1N6QA 1N5YB 3CCUS 5LMNJ 3ME9A 3JSRA 2GIRA 3DDKA 2AJFE 5CH7B 5GAOn 4ANJA 3M8QB 3BKUA 2JEIA 4O4RA 1NZ8A 1VQPT 3N79A 3HP9A 4OBIA 2Z0GA 1S9GB 3H5YA 4OI4A 2ACMA 4R8UA 1HL6A 4RJVA 4XU2A 1MU2B 1WA7A 4ECQA 6FD1A 3H90A 2DHSA 5DGBA 3QJYA 4O4GB 4DPTA 4JI7F 2ZBCA 5LJ5Y 4FIBA 4N5SA 5J1EA 1CJTB 3SCKE 4M7AB 4WF2A 2D74B 5CYQA 3GPLA 1DARA 5LJ3f 4OB1B 3TZYA 2V9WA 4XAXB 2ZJPQ 1PJ6A 2L48A 4ZTFA 1RBLA 1GMVA 2XC9A 4MK8A 4FXDA 2PZ1A 3CCSA 4RW9B 3HHTB 2RHQB 1UFFA 3DXBA 2EI5A 5EWFA 3HO1A 5FRMA 1VQ9T 1VIOA 1HJDA 4FCYA 1W25A 1FDDA 3M54A 2J76E 3BDPA 2FQQB 1UEKA 3SDZA 2EVZA 3JB9H 1KG1A 4C8MA 3MECB 2GTJA 2MGZA 3CC7S 5LL6S 1YIJQ 1XNRF 5F9LA 1YWXA 3CJ5A 2LX9A 3TR5A 1RT6B 4CZCA 1VQ8S 1J2VA 2G0JA 4ZPCA 5GAN8 4XTZA 4C5GA 3DOKA 1VRTA 2ZH9A 1UTIA 3CD6A 2BJ8A 2YKNA 1RWUA 4IUUA 3FUYA 1R8CA 3O44A 4H4MB 3JAMY 1VQPS 3CCRQ 3RMSA 4AFUC 3BW1A 3LX7A 2KRNA 2FB7A 1JLEB 2K5FA 4R0EA 1SL1A 4IYQA 4CNYA 2G1HA 1UMJA 1WI7A 3NNHA 2B8AA 3LWHA 3THVA 3M57A 1NJIC 3TVKA 2C3MA 2A2CA 2XTJP 3RRGA 3S6WA 2DERA 4WIQA 4K4SA 1ZBJA 4IIOA 2V4JB 3VALA 3NCQA 1TS9A 3NY0A 4R0JA 4P2SA 2IFXA 4M7AA 5CO7A 4OHWA 1KD1C 1PJ7A 2DXFA 2V6AA 2QE5A 3I96A 4LIRA 4NLSA 1T94A 2EYQA 2Q6BA 3T5KA 4ZVRB 5LSLA 1DY3A 1HWLA 2V67A 5GAOm 2HFZA 2AP6A 2K2MA 2J7UA 2FEIA 1XR7A 3ILOA 3MCMA 3A8IA 3E1SA 3ASKA 3MMJA 1LK5A 1C1AA 1KTQA 3C66A 3MHYA 3W63A 4ECYA 1NE8A 1TK0A 5GAMg 3D0HE 3ELHA 5C2CA 3VYGA 1MV0B 1SB6A 5KFFA 1V9OA 3P8HA 1Q82U 4DL7A 1GRIA 3D54A 2P4RA 2C1EB 3OY9A 2EG2A 2DVIA 1U8RA 3EXCX 1OQ6A 2DGUA 1GEHA 5EG2A 2MEWA 4C8LA 1VQ8T 1C4AA 2PU9B 4PKDB 3OTOJ 1C0UB 5B7WA 2OO4A 4P75A 1Y0MA 5K9FA 3ILIA 3CCTA 3M0UA 4MFBB 2C06A 3V6DA 4PQUB 2KYBA 1N8RR 4OHXA 4LUBA 1AXQA 2FDNA 3NCPA 1ZBXA 2N3OA 5DG9A 3BSAA 3FJ5A 1FNXH 2QZ8A 3BJYA 1M1KU 1HNXJ 3QZ9B 3NXZA 2QQ9A 3RR8A 5H9FJ 4FW2A 2DTIA 1Q79A 2L3RA 2E9RX 4NA3A 2XDDA 4USIA 2UV8A