1M1GA

Crystal structure of aquifex aeolicus n-utilization substance g (nusg), space group p2(1)
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
240
structure length
240
Chain Sequence
LEKKWYALQVEPGKENEAKENLLKVLELEGLKDLVDEVIVPAEEKVVIRAQGKEKYRLSLKGNARDISVLGKKGVTTFRIENGEVKVVESVEGDTCVNAPPISKPGQKITCKENKTEAKIVLDNKIFPGYILIKAHMNDKLLMAIEKTPHVFRPVMVGGKPVPLKEEEVQNILNQIKRGVKPSKVEFEKGDQVRVIEGPFMNFTGTVEEVHPEKRKLTVMISIFGRMTPVELDFDQVEKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcription antitermination protein nusG
publication title Crystal structures of transcription factor NusG in light of its nucleic acid- and protein-binding activities
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Transcription
total genus 46
structure length 240
sequence length 240
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2002-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00467 KOW KOW motif
A PF02357 NusG Transcription termination factor nusG
A PF07009 NusG_II NusG domain II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1m1gA03
2.60.320.10 Mainly Beta Sandwich mini-chromosome maintenance (MCM) complex, domain 2 N-utilization substance G protein NusG, insert domain 1m1gA02
3.30.70.940 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits NusG, N-terminal domain 1m1gA01
1N8RU 3CXCS 1KHIA 1Q86C 1VQ9A 2E6ZA 4OBIA 1VQ8T 1QVFA 3CCJT 1YIJT 2G3RA 3CCSA 1NZ8A 2OTJT 1K73C 1N8RC 3CXCA 3LPEA 3G6EA 2KVQG 1M90U 1IZ6A 3CC2T 1Q7YU 1VQ5T 4X34A 1KQSA 3LGFA 1VQ9T 1KC8U 2DO3A 3A5ZB 5A2QE 1M90C 1NJIU 4ZN3A 1Q7YC 1KQSS 1VQKT 3CCVT 1YJWA 1KC8C 1QVFS 3CCMT 1K9MC 2EXUA 3QQCD 3HKSA 4TVRA 3CCEA 1M1KU 2E70A 1XTDA 2JOYA 3CC7A 1VQ4A 1YJNA 1SSFA 2QEXA 1W2BS 1Q82U 1VQ6A 3CCUA 4QQDA 1VQNA 2MWPA 1YI2A 3DLLA 3EWGA 4ESNA 4ZN1A 1YJ9T 1JJ2S 3G4SA 3CMEA 3P8BB 5J26A 2QA4A 3OW2A 1M1KC 1K8AU 3CD6A 1W2BA 3H7HB 2EIFA 1YHQT 1VQ7T 1VQLA 3CCQT 1BKBA 3CCET 1NPPA 3CC7T 4RG2A 5IT9E 1JJ2A 2CKKA 2OTLA 3CPWS 3CCUT 3LGLA 3CCST 3G4ST 3I55A 3G6ET 1VQOA 1Q81U 1VQPA 1VQ7A 3G71A 3CPWA 3OYYA 1NJIC 3CC4A 3OW2S 3I56A 2OTLT 3PIPA 3CCLA 2LCLA 5DLQE 3J81E 5FLXE 1Q81C 1YITA 1M1HA 2LVMA 1KD1U 3CMAA 3PIOA 1YJWT 1NPRA 5IAYA 3JAME 2JNGA 4CRIA 1VQOT 1VQPT 1VQMA 1S72A 1Q82C 5LL6S 3TREA 3J80E 1RL2A 1QVGA 2KPPA 1VQ4T 5J3BA 1YJNT 3CCLT 1Q86U 1KD1C 2QEXT 2OTJA 1VQ6T 1X6OA 2IG0A 1K8AC 1VQNT 1YI2T 3CC2A 1M1GA 4YTLA 3CMET 2QA4T 3KBGA 1K73U 1VQ5A 3CMAT 3CD6T 2MI6A 1YBYA 5HY6A 5DM7R 1VQMT 1S72T 3LD7A 1VQLT 2MWOA 3CCRA 1NZ9A 2XHCA 2KDSA 1VQKA 3CCVA 1EIFA 3ER0A 3DB3A 3CCMA 2L3RA 1QVGS 3J7AF 2K06A 2LQ8A 3DB4A 3I55T 2JUFA 3LH0A 1XNIA 3G71T 1K9MU 3CC4T 3CCRT 1VQ8A 1UEBA 3CCJA 2JVVA 3I56T 1YIJA 1YJ9A 3CPFA 2OUGA 1YITT 1YHQA 3CCQA
chains in the Genus database with same CATH superfamily
1XNRF 3R5AA 4ZCLA 1LEOA 3JCMW 1G2EA 2KRRA 1KG1A 4DV3J 1OJ4A 1JLQA 1HNIA 4ECQA 3BKUA 3A5ZB 2VGNA 3QO3A 4LVOP 4C8KA 4W4MA 1TG0A 4EMKA 1FE4A 4DX8H 1CULB 3GIBA 1YBUA 1K0SA 4HI1A 4NLTA 5LSRA 2NPFA 3IM9A 2X35A 3LLRA 2AK5A 4YHHF 3CQTA 3I9ZA 2OEKA 2LQBA 3OQ2A 1NJXA 1VQ7T 2HQ3A 3SSSA 3K57A 4CRJA 4ECSA 3CC7T 2CPXA 3R5DA 1Y7XA 3W2VB 2D3UA 2QYZA 2WVBA 2APOA 2DRMA 3CDUA 2DNRA 2GV1A 2SEMA 4F50A 4J5YA 1CPZA 4U67Q 5M2UA 2W8LA 5KT2A 2MAMA 3KXTA 1S1TA 4WFYA 5JVHQ 1FDAA 1U5SA 5IQQA 2GGPA 4QIFA 2CPZA 2EI5A 1I94F 4KYZA 1XR7A 2CJBA 3CCLT 1KD1C 2L3SA 3PNWC 3M55A 1DLOA 1UWAA 4A4FA 4NRTA 3UN3A 2MKHA 1JLCB 4I6YA 2KDSA 1QAJA 4HCCA 1WNEA 3KLIA 2I2YA 2RQTA 2XLIA 1WHHA 1HW8A 1UTIA 2HKQB 2ZBQA 4I4BA 2QIFA 5EG2A 2MDAA 4KGMA 2M3DA 1NEBA 2NZ4A 4OJ1A 3L2VA 3QJLA 3QAUA 3H0IA 3SFGA 3M2VB 4DR4J 2OHDA 2JDJA 3MM9A 2HK3A 2VKNA 3KLIB 1RT6A 4X9DA 2XGQA 2CZ4A 2B5JA 2BRKA 1YRXA 2BQUA 1QY7A 1TL7A 1TQLA 5G0RA 2O5DA 3S3NA 2M9KA 1T02A 2QC3A 2EFIA 2R2SA 4OB0B 1Y0MA 2H5JB 3CD6A 3US5A 1VQPQ 3UF4A 2I38A 1BWEA 1Q7LB 5E7OB 4RUCA 1OY9A 2IC3A 1SUQA 4ER8A 4CQ1A 2WSEC 1ZM2A 4MKBA 3MR3A 3OMCA 2JLFA 2B9EA 1X5SA 2RVJA 2A0FB 1S1WB 3EVMA 4K5RA 3LTOA 1VQMA 4ZCMA 1PSDA 2RU9A 2FVPA 2IM3A 2E4HA 3QDRB 2DIQA 1NYGA 2FD2A 1MHNA 5DG9A 4AE5A 4ORZA 4F2SA 3H5YA 2MLXA 1Y5LB 4X66F 2ALZA 3OUYA 5A8RB 4KV8A 3KLEB 3UWTA 1RYSA 3I5BA 3ISNC 2UXDF 4DL7A 4RNFA 3Q22A 4J83A 1PD0A 2D3ZA 4RLEA 2F5KA 1S6OA 1VDHA 1Q86T 2XNQA 5IWAF 3DLMA 3OUYB 2CYZB 2M4MA 2E5JA 3SQOP 4ZK7M 4KO0B 1H2UX 1EHWA 3P4UB 5BXIA 5A2QY 3UI3A 4F3MA 1YNZA 3DDIA 4DR6J 2P0QA 3L2QA 1L3KA 2OPRA 4LRCA 4X4NA 3HHLD 3G6ES 1B07A 2ADBA 4M75E 1SSHA 1CEZA 2VQFF 1YX2A 1W2BA 5CYJA 3P5TL 2KXNB 4BY6B 4F7UE 2MZTA 3AB2B 4QWEA 2AJFE 3MEUA 3DLHA 3KFVA 2UP1A 2W1BA 3X3UA 3FC3A 3X1LB 5ETKA 3H5SA 2QMXA 1S1VB 3AOBA 5F3ZA 5LT5A 3MGJA 2DISA 4O0NA 1IVZA 4DV2F 2CQBA 3CIMA 2KG0A 2AKLA 5IM0B 2UXCF 3CCRA 1OS5A 2RQVA 3R6LB 3PX6A 1RE1B 5DQIA 3D6HB 4FIBA 1GMUA 1S97A 3N9UC 4C8ZA 2V8DA 3ZNJ1 1U2FA 1LVKA 3CC2S 1O6XA 4KHRA 2YWEA 3THVA 1CJVB 4FF3A 1FMWA 4URSA 1OY6A 3TI0A 3P45B 2CRLA 3BE3A 1REVA 3RB3A 5EC7A 2LQ9A 2Z57B 2VQEJ 1UGPB 3HHTB 2RJCA 2LP4A 4UZCA 4NZ7A 4NE9C 2LXUA 5FIIA 1N52B 4KH0B 4OYWA 1MUZA 2DGQA 1VQ4A 4GO5X 2GQ2A 3M9QA 1PKTA 2CG4A 2EYZA 4ZVTB 3LAMA 1FA0A 1NSPA 4EUVA 2J7KA 4OYAA 2AQ4A 4QPXA 1M9SA 1K1QA 1T9YA 1SL0A 2P0PA 3A3OB 3I6PA 4DR1F 1Q81U 2R2TA 2VB6A 2CJAA 2XYHB 5GAOl 3A1YG 1XEZA 4H4OA 4TYAA 3I0RA 1M1KR 5I3UA 4ZA1A 1N32J 3HVAA 1EP4A 2AZSA 2IHR1 2OFGX 3CDBA 4CLKA 2KGTA 5C5JA 1RAAB 4X84A 2I1RA 4IYQA 1S1UA 3CEYA 5GAOm 1OIAA 3LF0A 4Q0BB 4B6MA 2EQKA 3GR1A 4ZVUB 2NYHA 3VZHA 2F8HA 3TARA 5IT4A 1NKBA 3NNHA 2XYGB 3RJMB 4DCOB 3ITHA 3UT1A 2WW8A 1RWOB 1ZBTA 5DZ7A 1DTQB 3FRNA 3NRBA 1YWOA 2EQJA 3OL9A 1UJ4A 3JB9F 4O44A 3PW7A 1JJHA 2C2EA 5J2MB 1Q7YC 2HK2A 4CM2A 3PGGA 3ITHB 2JEJA 2X1GA 3AXKA 5IV3A 2BACA 3JB9G 3JSRA 3QO9B 2RSQA 4JI6F 3KJQB 2OPPA 3DLLA 1KBRA 1I5LA 2QA4A 1ZA1B 1A0NB 2ZPHB 2XI9A 2DKOB 5CQGA 3K8WA 2RHXA 1QWEA 4BS2A 2FHOB 1GCQC 2W0ZA 4B3OB 3A1PA 1YI2S 3UDEA 5IHNA 5HMWA 4LF7J 1UE9A 5CO7A 4MDXA 4J9QA 1NJZA 2H3JA 2GC8A 3HX9A 5CXTA 1M5Q1 1RKIA 2W9CA 3PACA 5EWFA 1E6VA 4DSFA 1T7PA 4M7AF 4UQGA 4LF9F 2DT9A 2BOPA 4RR5A 2CZ6B 1J5OB 3UWNA 4B17A 4JI1F 2YY3A 2NCKL 2CPJA 2J0XA 4M7AG 2YNFB 2XQCA 1U1RA 3QATA 1LWXA 3C6UB 4OB2B 3RESA 4OX6A 3W5ZA 5IZHA 4IUQA 1KD1R 4E7JA 3ZTRA 2R7XA 2DTOA 3R8YA 4LRFA 4RMOA 2O66A 2MKSA 1LNQA 5GMDA 3G87A 3G96A 2UUCF 2L89A 2E7VA 1M5KC 3TAPA 3ELHA 1SJRA 1UFFA 1LKZA 2WCXA 2V94A 2WW4A 2CP5A 4PJOC 3BYPA 1PILA 2E7XA 5A0GA 4JI0J 2PI4A 1YJ9T 4X4TA 2IDLA 5F8NA 1KTQA 3NGSA 1WI7A 1V3ZA 2E5HA 3QLHA 2O2OA 1HNWF 4RNHA 1RWVB 1U6ZA 5IXUA 1Q81T 5KFTA 2V2VA 1G7CB 3BPSP 4JV0A 5K8PA 4DU8A 3M0PA 4ZPCA 3PTWA 3QJYA 3K5LA 4Y0FA 5DGBA 3UE2A 3QLHB 2D3OR 4IG0B 2YUOA 3WVEB 3M57A 3CC4S 4N7TA 3V6JA 2RNEA 2OD4A 3MDFA 5DQGA 4M5MA 4EMGA 1TFYA 3OBIA 2M2BA 4YB5A 1WF0A 2BX6A 1MNDA 1JO8A 3KLGB 3EGVA 1XMQJ 1N5TA 1WEYA 4PRFA 3MAAB 4NLRA 1REGX 1VQ9S 4EO8A 1TAUA 3HPOA 4ECUA 2FJEB 2X51A 2KXDA 3OYCA 4DV6F 2OAUA 1R31A 3K5OA 3PYDA 1N8RC 2M88A 2LXFA 2VPXB 5FU6B 3JS9A 2W4DA 3RBBB 2XG8D 4DEYA 4ZN3A 2P0KA 4PKCC 1O8BA 4B3SF 5GAOp 1U8RA 2Q6BA 1HI1A 1UVKA 4WCEQ 3OMGA 3C15B 1HNVA 2IVMA 4P7VA 5HK3A 2XDBA 2RAQA 3DOMA 1ZLMA 3NTHA 4JOUA 2BM0A 1BLUA 3MEGA 1WHLA 2HBPA 2W25A 1H7WA 2V2QA 2RPNA 2QZ8A 5DM7Q 4ELZC 1U06A 2JM8A 2FTRA 2GW8A 1U1MA 1F9HA 1ZZFA 4DDFA 2MJUA 5CCMA 4CTAB 1KQKA 2KQWA 4F4AA 2Z0GA 5GAOn 2ZZMA 4HEA9 2L08A 3W1YC 3EUNA 3I55S 3OHAA 1HNXJ 2DRDA 4JRQA 3LW5C 4O3NA 2XK0A 1JLFB 4MZPA 2NPIA 1VQ6T 1R0CB 5ITHA 2OPQB 4JV5F 1RISA 3SBMA 3DLBA 4E47A 4A53A 1VMBA 1U4BA 3S6EA 4CYUB 3BGLA 2CPYA 3V8JA 5I11A 2YNIA 3ZFVA 3NS5A 3N01A 1BGXT 2GAGC 3L2UA 4HT7A 2E5KA 4K2JA 3KK2B 5GAHU 5I4MA 1ACMB 3RR8A 2HRYA 1C1BA 1NHUA 2GJIA 5H9FK 1SVDA 1F9EB 2YQ1A 2KM8B 5LMNJ 4R8UA 1T8EA 1WHGA 5ECAA 3E1SA 2L3PA 4OF1A 2JH3A 2YKMB 1Q8BA 4MTPA 3BZQA 1WSVA 1I1GA 3J80Y 4JRPA 3VS3A 3U23A 5BR8J 3CJRA 1BQMA 3RU0A 4RG2A 2GTJA 3B4MA 2K5FA 5KFVA 3V6KA 3KG4A 2FQQB 2XICA 4WXWA 1VQLQ 1ICEB 1LCKA 2DL5A 3OXLA 1X2QA 3MP6A 3UDLA 4CI0C 2J8AA 5DDPC 1E6YA 1T94A 2DNLA 4ELUA 4N41A 3FFIA 4PXEA 3B4DA 1GTHA 4MT1A 3O5TB 2AKWB 5L1IA 3HF5A 3OTOJ 1MROA 3UR3C 4J6XA 2DEQA 4S0MA 2K7JA 2C0IA 5FWCA 1S77D 4DJBA 4LF8J 1M27C 2R9LA 4J9VA 2KR3A 2RB6A 1AWXA 3CD5A 1RYRA 3FFIB 3NGRA 4Q45A 4M5IA 1SG5A 2V4RA 2AYBA 1ZAXA 2YNHB 3CO9A 2YKAA 2ZWOA 3NWGA 3SDEB 5E5NA 1LWCA 4NLQA 1PRLC 2AU0A 4BACA 3JCMh 3IAS9 5CAAA 4QR0A 2Z2ZA 2Q79A 2R8GA 4ZLPA 2C2OB 2A28A 3DDKA 1BI0A 3W60A 4IRDA 5FRMA 4C8NA 4RW6B 1A7GE 2PFDA 4ILRA 1K9MR 5DZ6A 1RLQC 4ZP7A 1LWCB 1RWNB 4Y2CA 4LF6F 4J7CA 1TKTA 2B9YA 1T05A 3HHLC 3IBCB 4OLPA 3TUPA 2H51B 1PYTA 4DV7J 3UCUP 3AD7C 1KEKA 3Q24A 2XHWA 1EIYB 1Q7YR 4Q2LA 2CP3A 3AOCA 4PG4A 2HWTA 1SHGA 2DB1A 5RUBA 2JRSA 2D9TA 3W65A 1WF2A 1UJ0A 3H2VE 1WWHA 3R7NB 3TP2A 1S1NA 3GF5A 3Q83A 1FRJA 2D6FA 3L7UA 1GK8A 1YWPA 2K4YA 2EBEA 1S0NA 2HNDB 3QT8A 4W90B 1HQUB 2KRNA 5KFHA 3PY8A 3PW2A 2E1CA 2D0QB 4P72A 1TK5A 4TKTA 2XMJA 1N5QA 2FG0A 1N0VC 3KK1B 2ROGA 3T1AA 2LX9A 3KLVA 4E8UA 1S48A 2W2NP 2CP2A 3NCQA 3QWUA 3TR5A 3P96A 4X9CA 4L59A 3W8GA 1D0ZA 3M4GA 3RRHA 3Q8UA 3LGNA 1KQ2A 4C92E 1TZ0A 4TU8A 3GPLA 1SHFA 5GAMe 3CCUQ 4B9MA 4NI2A 1CJKA 4I7FA 1G4CA 1JJ2P 4EBDA 5L39A 2PN6A 1FJGJ 2NXNA 4ZTFA 2UVVA 1TXQA 1FF2A 3O44A 5K8MA 3QNWB 1LWFB 2YKOA 2RM4A 5CKDA 4DUTA 3OS0A 4FKYA 1VRQC 1C0TA 4OJGA 2KI7A 4I7FB 1UFKA 3QXEB 4USIA 4Z37A 5JJBA 4FNHA 1NLPC 1BQNA 2AJ1A 2POKA 4DPUA 2ROTA 1OX9A 3HRTA 2FY8A 2LU1A 4P7TA 3UQSA 2YQ3A 2VBYA 1RHJB 4WKYA 1HI0P 1U09A 1JEGA 2U1AA 3NMAA 3WDOA 2FJWA 2BW7A 4MK8A 2AGPA 3O5ZA 1RT7A 4B02A 3A8MB 4CC3A 2CPIA 2CNKB 2V4JA 1YIJS 1ITPA 5KFQA 2NXJA 5CIUA 4PJMA 1OZ3A 3EG9A 3HVTB 4C48A 1M1FA 1VQ9A 4N0AC 4P6QA 3MPYA 2IRUA 1N0UA 2RDIA 4K7QA 1URNA 5FLXU 3CCQQ 3QIDA 3HULA 3SCIE 4IG3B 2MXYA 4ATNA 2XZWA 1N8RR 1FVSA 4N77A 3EWGA 3MTKA 4LFCJ 1JNRB 2QXFA 1R0BG 3GILA 1NM2A 2DXUA 2HVEA 4DR5J 2DD4A 3HPWA 2ATCB 3E3XA 2RQRA 1B34B 4L3NA 1G5VA 2ASYA 3TSZA 1N4LA 1WKKA 5HROA 3HHNB 4YS2A 4RPFA 3CMES 1NLKL 1S9GB 3CCWA 1U8SA 1IKXB 4WK1A 1SJFA 3BBBA 3J7AN 1FDDA 1NUEA 2QI2A 1SB6A 4M4ZA 5KFYA 3RBXA 3M4YA 2J7WA 5HROB 2HQDA 4K8RA 1QMCA 1GXIE 1F0XA 3KG0A 2P8IA 2DMOA 4J7IA 1FXXA 3MFIA 1R3NA 4YB7A 3K7RA 2A3LA 4C8MA 3GU0A 2UU9J 4HLBA 3PFEA 5SUHA 4PCQA 4ANJA 4N76A 2JNJA 1HD1A 5KFNA 4KHPF 2FB7A 4HDHA 1WIEA 3T5LA 1K73T 4USJC 4RCCA 1NM7A 1N36J 2RJZA 1FWZA 3PMTA 1X9SA 2DA9A 6FD1A 3UN5A 1MLAA 4ANCA 1YJTA 1H2VZ 5D3GA 3OYGA 2IJFA 1G83A 3NP5A 1NU4A 1YJNS 3D0HE 3W62A 2XCPA 1YJ7A 4MMLA 3M6XA 4EDUA 2E70A 1GXTA 4TY8A 2G0CA 1TL3A 2XCAA 2HIYA 3PR5B 1RWKB 3G8QA 2WVEA 4YEAA 3VRZA 2RE1A 3VF0B 1TKXB 7FD1A 1U1KA 4FVCA 1RU1A 2DNMA 3MM6A 2ED1A 4RTXA 2V34A 1Q82T 4TY8B 3TZXA 4M63A 2LCLA 3IGNA 1TL3B 2K2PA 2AJ4A 2EC2A 7FDRA 3BPDA 2JTEA 5DETA 3D7SB 2XLJA 1AFJA 1SJ4P 2YQ0A 2XY6A 4KKOA 4HKEA 5EX0A 1X6OA 2COWA 1QVGP 1AROP 3VS7A 4KGKA 1RHMB 2MI6A 2B6AA 4RO0A 3VRYA 2RA2A 1VYUA 4XTXA 4C11B 5GMKa 2HHSA 4DL5A 2ZM6F 1VQ8S 4MFBB 3NS6A 5KFMA 4YN3B 4FF4A 1LW2A 2VC1A 3RYLA 1LK7A 4P52A 3HSDA 3GLXA 2DE0X 2LECA 2B6AB 4PAAA 2VYTA 3DOLA 3H4BA 1NCLA 4PXCA 5B0FA 1WHVA 2A2DA 4UOHA 3RUXA 3HFZB 4J9IA 1DQ8A 1FRIA 3D9BA 2V2KA 1LW2B 2VJVA 2FVRA 2PDAA 2DPPB 3FMBA 4RTYA 2HMIA 1G3TA 2JSXA 1J2VA 3KJFB 4ZLJA 3CJKA 4C3LA 4F2RA 1PC4A 2VONA 4M7AB 5F8MA 3RBEA 4OMMA 4D8DA 1RTDA 4JI7F 5IXFA 4X4OA 1S0OA 4LDVA 2CQ0A 1WORA 3QZ7A 1SRLA 5KYXA 2O4XA 4TQSA 4Q7AA 3T5KA 4O4GB 1VQMQ 3AT1B 1QAYA 2AEFA 2CT3A 4I69A 3C66A 3PTAA 3CJKB 4GKJF 2N7YA 3RMQA 3C8YA 2JNGA 1U2CA 3RMSA 4OI0A 3RDVA 2GFFA 2KNBB 4CLWA 1UGRB 2NYIA 4LR7A 1NMEB 4XQ3A 1MNEA 2R57A 3ZBDA 2RMLA 3PW4A 2HSEB 1SRMA 3NAHA 2UU9F 2DXEA 4RW8B 4ZP9A 1MN9A 1OX8A 3CCMQ 2NXCA 2HHWA 4O3SA 1U1TA 2QFJA 3FIFA 3BREA 2D74B 4U7CA 1VFJA 4M78D 5BJRA 4L76A 1TMJA 2XULA 2ZFHA 2JEGA 3FSYA 5J2QA 2BJDA 5E0OA 3VAJA 1T3OA 1GCQA 4DV1J 2OAWA 2LJ3A 5FJ4A 1NKCA 2YNGB 1IHWA 3HL8A 1JQQA 4WF2A 3R27A 3J7ZT 2QLJB 3QKJA 5LJ5d 2YQ2A 4E7KA 1SKRA 1YN8A 1YHQT 4URGA 3HK2A 5D6WA 3E01A 1U2RA 1Q8IA 3AD8C 2CG8A 4RNMA 3K5MA 1JU5C 3CUNA 4OI1A 2VA3A 2LQKA 2F9JA 3FQKA 4CLZA 4USHA 2B7BB 5FWBA 1X4GA 2K5LA 3M1VB 1NJIC 1CLFA 4M7DC 4XPCA 2CFXA 1JLEB 3BN4A 4ZVEA 4LSNB 3CCRQ 1NDPA 2GJ2A 4BCAA 2AZ1A 1K8AR 2RMOA 2CQ1A 4C5EA 1S49A 2QEXT 5A2QU 3ZO7A 2G2ZA 1U47A 2V4QA 3G6VA 1BQXA 2E9RX 3KTQA 2R5MA 5KFJA 5E3PA 2RQCA 2GNKA 2E5QA 4DPTA 2WSEE 5KCHA 5LJ5f 1IXKA 4E7LA 3EGDA 3H59A 1YIJA 3ZZ0A 2MQMA 3PCOB 3K0JA 1R8HA 5K14B 4JI4F 2RF2B 3BSNA 1F2GA 4PJOA 4QQGA 3F41A 2GO9A 3VHQA 2COYA 4RUGA 1N9SA 2FJXA 3M8ZA 3UDVA 1WKJA 4K0KJ 4F3OA 3MOZA 1B7TA 2DZ9A 3BO4A 3EGDB 5KE2A 2HZVA 5FRNA 1K4US 4AFSC 5KCOA 1VRUA 3D6FB 4FYWB 1BHNA 3G4SS 4I68A 4GO7X 1FFWB 2DGUA 4C5IA 4ZJOA 3LAKA 4DOZA 2VC0A 2X3GA 3L2WA 1Y5NB 3GE9A 2XMMA 4H4KC 2DX1A 5GAMh 2C28A 1PNJA 4J9RA 1UVLA 3V8LA 3K59A 4BDPA 3B54A 3I5SA 2Z2YB 1DBDA 4AYBD 1X6BA 1WJ9A 4O3PA 2AT1B 4M5DB 2X1FA 5JMNA 4TYBA 1FKPA 3I56Q 1E6GA 5GMKi 1WTFA 2A6MA 2HWHA 4IDKB 3I5CA 1R89A 2QQSA 5LJ5g 2FDNA 3VWSA 5DJBA 5ETOA 1X4CA 2I2LA 1VYVA 2XGPA 3EMTA 2ASDA 3HRSA 2DBKA 2CQHA 1HBUA 3G9CA 1AB8A 4ED6A 4MKAA 5HVFA 3CCVS 3A8IA 5KT4A 1AEYA 2MKCA 5KT6A 4PR6A 3MO8A 5KYYB 2FYXA 2BR0A 1W2BP 3W9HA 4KPCA 4F0MA 5C2CA 3PV8A 2ZE2A 2FO0A 3Q0AA 4DL6A 4WE1B 3BSCA 4UOCA 4NOYA 1YJNA 2V8VA 2KYMA 1HPZB 3D66A 5DLFA 2NLWA 2CAJA 2P5VA 5CCLA 1GTEA 3PNIA 4N4GA 4C97A 2Z4PA 3DLKA 5L1LA 1VQOS 2CKKA 1HSQA 4P5NA 1FD8A 4PYAA 3SEOA 1VQNS 5DO2A 2C2NA 2KH9A 4DS5A 3J81Y 5GMKe 2DYBA 2XYPB 3OJUA 4USKA 1FHTA 2HNIA 3DLKB 5I3PA 3CT9A 1QUPA 4J9EA 5I21A 3KJNB 1HFEL 3RKXA 5D0GA 3CJ3A 3CD6T 2BV3A 1D8YA 2AV5A 3KHGA 1NB7A 4HHUA 5ETPA 4I2PA 1X2KA 4UW2A 2JC1A 1AFIA 1U26A 1UWBB 3BQ2A 4FCYA 2B8QA 1UPPA 4IRCA 5D7UA 1VQ8A 3E51A 3JSMB 4HCBA 4DQPA 4NXMF 4HA8A 4DQ2A 2Y9HA 3BKFA 1Q86C 4WP9A 2JFDA 3ZTSA 3W3SA 1OULA 3UA7A 1C0UA 2VFUA 1J5EF 5HI7A 3OSVA 1UA0A 4PUOB 3JXOA 2CUBA 4FXVA 2X1BA 2DJQA 5FDLA 4NX9A 2GIRA 4RW4B 4BC7A 1IKVB 4EGLA 4DPOA 4JV2A 1SKWA 2VDIA 3GV5B 4XTVA 4USWA 1GEHA 2L48A 1WC3A 3H2UB 4C9DA 1B99A 4IIMA 1FDBA 4AFFA 4HVZA 2WB1D 3IM8A 3M30B 2HHQA 5D4PA 4JJBA 4DL0C 2DRAA 2HFVA 3G8SA 1S72S 3GNFB 2KVQE 3A8EA 3MEEA 3TZWA 2DH8A 3ZFJA 2OPSA 2CQPA 3CJSA 4M77C 2XO6A 2MB0B 1NBEB 1DZ5A 3I32A 5F3TA 3W5XA 2K1RB 3QZ9B 3S1TA 2EKNA 1YWXA 2KEAA 3ZTOA 3HMJG 2QFIA 3M58A 4A47A 3QIPA 1QCFA 3CBPA 3FBBA 3CCJS 4XU3A 2FLLA 3EZ5A 2CNOB 3DRSB 4K4XA 1BIAA 2XI3A 1VQKQ 2RHSB 1HXDA 4ZHRB 2UUBF 4LSLA 1IBMJ 2OD6A 1B70B 2C3OA 3HHLA 4OI4A 5CCAA 1UZHA 2DGVA 8RUCA 4CNZA 3UD3P 4RTVA 2MKJA 4ICLB 4ZP8A 5BYQA 2D41A 3VV0A 4J9FA 2VG5B 1XNQJ 3G6EQ 4LSLB 2FJBB 1Z9QA 2MWPA 2YSQA 4PWDA 3SMZA 4DR2J 1C1CA 2DNZA 5BYSA 3CCET 3L1AA 1PJ6A 3UA6A 3MAQA 2R42A 4C92D 5GAN7 3ENWA 3GIMA 3EYZA 3R6OA 1WF1A 3QGPA 3MP1A 3QZ8A 1TMMA 2Z2MA 4KGZB 4Q2MA 2A1BA 3TEHB 4PWDB 4HHJA 2W4PA 2KDOA 4QR1A 4QW8A 4PJOE 4MZMA 4NLDA 2KPPA 1VQ4T 2NWMA 2CPEA 1JBMA 1S6QA 3T9ZA 1YCSB 2NLUA 2VFRA 5DM7R 3CJ8A 2R8KA 2B4PA 2KRBA 4K4SA 1VC6A 5CZXA 4ZPVR 2HHHF 3CC2Q 4USTA 5KE3A 1RWUA 1C2PA 1D1CA 4NA3A 2MQPA 1MMDA 3I35A 2V50A 4NLUA 1UTAA 3PRDA 3OYNA 1N5ZA 1WELA 4Z8AA 4N47A 4M75F 5LJ5j 2JZ5A 2KFNA 4E7SA 3M9MB 1DQ9A 1WACA 2I8EA 2K3YA 2XMUA 5B0BA 4HCKA 4JZ4A 1QP2A 1PSEA 5MLCV 2LRQA 3OS1A 4M75G 1S12A 1J3TA 1ZM4A 2MOXA 4X62F 3EGXA 2FVQA 1OPZA 1PYOB 4NEYA 3BF4A 5CHCB 1YP5A 1QAXA 5CYQB 3TZZA 2YUNA 3BDPA 4DUZJ 1YGYA 3LOUA 2Z8QA 1P1TA 5KG1A 3VYGA 1HWLA 3LO3A 2CDQA 1SC1B 3D6TB 3G4SA 5A0LA 4M5JA 3EGXB 4NS5A 4RU9A 3HI9A 1YJWS 2V69A 4NXNJ 1LOJA 4ZKAA 5F8JA 2C0TA 3NBPA 4U8VA 4JI3F 2CXEA 2IIMA 3MMBB 1U8WA 4G1QB 5HP1A 2K7KA 2DYAA 2E41A 2FLOA 4I64A 1X4DA 2COLA 3V81B 3RBZA 4LFBF 1JJ2R 5DM6Q 4ES2A 3QT5A 2VKRA 5C6SA 2QA4T 3KDNA 5HBMB 2HWIA 6FDRA 3PO5A 4A8XA 5M2RA 2ZH8A 3VKIA 1CQNA 4WYLA 1KKHA 2YXYA 3NGKA 1EETB 4P2XA 1SC3B 3J80U 3VS6A 1H3ZA 3SSRA 4KHMA 8AT1B 2KG1A 2J6SA 2E6ZA 4B3TF 2QTWA 1PKUA 3LW5E 3LUYA 2ZOFA 1X27A 2EGCA 4M78C 2DRKA 3QG1A 3GFXA 1VQ7S 3CC7S 4OV6A 1J27A 2UUTA 2J6TA 3VUZA 4J8OA 2X3XD 1I6JA 1NE8A 2EK1A 4LBHA 5KFZA 1S9FA 1BE4A 3HP9A 3FRYA 1R43A 3BS9A 1S10A 4DUYJ 1YI2Q 2GJFA 3SEMA 3CCLS 3HP6A 1VQOA 1FWKA 4P2MA 3G1JA 4CH0S 5IOLA 2J0WA 2DL4A 1Q81C 2Y90A 3J7Z5 3LP2A 3PDNA 4I2QA 4F4WA 1AUSL 3SV4A 1MWQA 3G86A 3BY7A 1FDNA 4QCLA 1RAHB 4K4WA 2GHVC 2V2ZA 1KQSR 4DSLA 4C8QC 3I9V9 4UT4A 1H641 2E65A 2VBXA 2E7WA 4NLPA 1D1AA 4HACB 4NCGB 3LP2B 1JNZB 4FU6A 1UEBA 4EFAC 5J1EB 1NK8A 2LMIA 3EH1A 1XR5A 4CM0A 2KYXA 3PVQA 1VIFA 2NSCA 3DMJA 2BJ1A 5J2PA 2YKNA 3O8WA 1Y71A 2LDYA 4RW9A 2DO0A 4UY8T 1X7VA 4KBIA 3VS2A 4NA2A 4Y65A 2DCLA 2ILYA 4BUGA 4KTQA 1WC1A 5GAN3 1G2BA 1QKXA 1KQSS 3MKDA 4DG1A 5J2NB 3DMJB 2HL5C 1V5VA 2CGHA 4RW9B 1T3LA 4ZVRB 1IGQA 4CLUA 4QVZA 4O4RA 4ZS6A 3D3CJ 2CVEA 1S99A 3ETOA 4RX6A 3RAQA 5K8NA 3C6TA 5KFKA 5GAEI 3BO2A 3CMQA 3SXLA 1V9OA 3CB4A 3DCAA 1Q0NA 4OMLA 5CKBA 5GANd 5C42B 3CCZA 4OX9F 2ZHAA 2GHPA 3TOQA 1TUDA 2WHOA 1S72A 4CNYA 3CC4Q 1LXNA 3J80E 5HVGA 4DQIA 1WEXA 1TKDA 3C6TB 1KFSA 5GAMf 4DX7A 2BZYA 2DF6A 3D28A 2BBEA 1IBLJ 4M5HA 5DG8A 1IKWB 2KXHA 2VF3A 2JS0A 1QAIA 4PEOA 4JUVA 4FDFA 2FB0A 2G0IA 5GMKh 2J9DA 3DB4A 1VQ9Q 2HQFA 3FCWA 1RQ0A 4LRAA 1TAQA 3CCJA 3UW1A 4L73A 2XG8A 5L46A 4ED7A 2EG1A 4ZVQB 3IWNC 4DS4A 4E6RA 2L0AA 4HHHA 3QRPA 4L75A 3M56A 2G2OA 2DH9A 5JUMA 1QVGR 1WHXA 2MYSA 5GANf 4NLXA 4B9SA 2FUG9 4OI2A 3UD4P 4OYBA 3KLHB 5IN1A 4NMLA 3QQCD 4ZJLA 4QYZK 4HTIA 3OVAA 1LJOA 2B4UA 3HDSA 4P10A 4IFVB 1ZBXA 3OXFA 2EGAA 5AT1B 3Q86A 5MAOA 1FKAF 1TV6A 1FVQA 1WUUA 1F5BA 3PEHA 3GFHA 4IFYA 2HBYB 5GAMg 2X4XA 3HJVA 4LSZB 5LL6d 1FEEA 4IH7A 1PWTA 2GGRA 3I55Q 1EX8A 3KOAA 3GMGA 3WXMB 3OYMA 3PHTA 5HJYA 2HHVA 2RUGA 1Z2ZA 4DV4J 4LF1A 5H9FJ 1GCPA 3I9QA 3ZXWA 1HNZF 5C25B 2BA9A 2D1CA 3EPIA 2C22A 2IVYA 1W25A 3HSZA 2QE5A 4PXDA 2HHUA 2W8KA 4RBVA 1WHMA 4KT0C 5I2MA 1R8AA 4EIKA 3CVKA 3CCQS 1VC5A 3BM7A 1EKRA 2IYIA 1WNLA 2HGNA 4CWBA 3ONQA 4EZ6A 2GS8A 1C0MA 1S4FA 4Y2MA 1YDLA 2XSJB 2OELA 2OKQA 4CLYA 4OMNA 3EZUA 5B0AA 5KOXA 4JI5J 1VIEA 5A76A 2DAQA 2DHHA 2FY1A 3JRZA 1OYEA 3IBWA 2DR9A 2EKYA 4KH1B 2E64A 3ILOA 2CREA 3S6WA 2WK4A 4YR3A 3FVYA 4RNOA 2ZDOA 2V8GA 3FKBA 1ZAWA 3O2IA 2ALYB 4TNOA 1WXTA 3Q2SC 2E5LF 4ANDA 2KHDA 3MM5B 4M7DA 1S9EA 5H9EJ 1OQ3A 3M8RA 3BGRA 1EFNA 3KDOA 2UUWA 3M6WA 1KLMA 5GAOr 1RT1A 2IYGA 1W2IA 3ISND 1X4BA 2O67A 1FXDA 3ZZOA 2CZ9A 3JAME 2NUPA 1IWAA 4ID5B 1VIXA 3BGRB 1LFWA 3LPYA 1CJTA 3A8GB 2IMOA 3PKYA 4HVUA 1RT1B 2Y0BB 3H5UA 2GZOA 2WVDA 1QDUB 3M6VA 1HIYA 3TRGA 3J7AF 1GBQA 1ZAVA 4AFZC 3WC2A 1S5ZA 4NOHA 3OR2B 3LWLA 3IN5A 2A3JA 3H25A 4A8SA 4OZ2A 1RT3B 2KXCA 1KHIA 2D7SA 3MEDA 3G7ZA 4OBIA 1HQ2A 4JYAF 2YWGA 2UUAF 4GKKJ 3A3PB 3T41A 3GBQA 1MMLA 4I1TA 4CO2A 3F0NA 4RJVA 3T3FA 1KC8R 2KKHA 3GIKA 3HFOA 5AJ3F 5CYMA 4ED2A 1WG4A 3CC7A 4OMQA 1Q79A 3EM1A 1AZSA 1ZOTA 1CSJA 4KR0B 4C8YA 2KROA 2QQRA 2JLGA 1UDLA 1NKEA 1IKYA 1VQLA 2ZUAA 1FRXA 3J81j 1TUWA 1N34J 3AD9C 1HYSA 4RUHA 1UVJA 3RW6A 1KS2A 3MM8A 1UGVA 4EPCA 3M0TA 2HBQB 2OTLT 3CCLA 3R1LA 5DLQE 1UCNA 3T1HF 1XQHA 1IKYB 4JI2J 4PPDA 4JB8B 2PT0A 2YLBA 4FSXA 1XC9A 4AFQC 3PVLA 3MMCA 2JVRA 2QA4G 4A8FA 4AQYJ 4LIRA 1YRTA 2OIHA 4J37A 3W66A 1Q81R 3M0QA 4P9SA 2M02A 3G6YA 1OU8A 2IA0A 1KD1T 2Z58B 2J8SA 1XNIA 1XK8A 1K0VA 4NRUA 5HSPA 1VA7A 1WOPA 3WX8A 1BU1A 4B9WA 2G9OA 2R7VA 3CDAA 1DJ7B 3VJPA 4ED4A 3NTIA 5HANA 2PTKA 4J9KA 3I0SA 1YJ9S 3OBWA 2JJ4D 2ZC3A 1X5TA 1NJIU 5L8RC 2HBWA 2BANA 1UHCA 3LH5A 4DI6A 4BHQA 1BIBA 4XDDA 2CIMA 2VFVA 1V76A 1ZM9A 4ETZA 1KQSA 1F60B 4C0GA 1YRUA 3GOXA 3Q8QB 3P8BB 2CZ7B 2V0NA 5C2GA 1UJ5A 2LFVA 2ZEJA 2COZA 2MLZA 2E5GA 3HT3A 2DHSA 4DFPA 5IS2A 5A6PA 2BZ2A 5D8HB 3PZPA 4RKUC 3EFSA 3G71Q 1YZ7A 3IAM9 3C12A 3H0HA 4ZLNA 4LNPA 1RAFB 3SCLE 3T6BA 2MGZA 1V1CA 2C0OA 3KWMA 2GQQA 4MK7A 1FE0A 4J9NA 5GAMj 2BUDA 2ATLA 1ABQA 4B3RJ 4LRBA 2LEAA 1AA1B 2F8MA 1F3FA 1YIJQ 1M5PC 2GVDA 4C0DB 3OYJA 1JLAB 3QYYA 4OHZA 3WQPA 3ER0A 1NB2A 2XZDB 3VCDA 4KGXB 2MGZB 2DLPA 2IY5B 2GIFA 5D0RA 1UJYA 2KK4A 4ZGJB 1X6GA 4E7HA 1B3TA 2DGSA 5LMUJ 3VAMA 1HWIA 2GVDB 2ZH1A 5I42B 4LJMA 5FW9A 1K73C 2HFUA 4UUWA 1FX7A 3KXDA 2LQ5A 1FK9B 2D9OA 2RI3A 5GANj 2Y8WA 1G3SA 2QN6B 1H98A 3SHWA 2G13A 2JX2A 1KHWA 1I0CA 2MJNA 2QYCA 4M77A 3EJMA 3SI8A 3B6BA 3CMEQ 4IUPA 1VOMA 1FNOA 4F7UA 2HDAA 4V1Ak 2ZH3A 1TUVA 2F69A 1S1XA 1T9WA 2QG9B 4N56A 5CKFA 4H4MA 3ICLA 1U48A 1X4EA 1Q82C 2LLZA 4B3MJ 4M75B 1RT4B 1QVGA 2C3PA 4CO4A 2JW4A 3BYRA 4C0OC 2RKIB 4USMA 3E9FA 2D9PA 1WHWA 2ADCA 2FRYA 3CGIA 3PX0A 3E2EA 4A63B 1QTNB 3IG1A 3EFOA 3REAB 1VQ5Q 4KFBB 4FNIA 3EICA 3OTCA 3F70A 1VRTA 2OI2A 3DGPA 2OJ3A 2R58A 3WIUA 3KYLA 4PJOD 4XPEA 3AHPA 3KLFB 1EARA 1VUBA 5CA5A 5F9LA 1S0VA 4M7DE 2KYZA 3CCQA 4GLKA 3O8VA 2QV6A 2IAJB 4LF4J 1ZSZC 5U47A 2RI5A 5KFSA 2F9DA 1PBAA 3RRGA 2EAYA 4DHVA 2GVZA 2AJ0A 2GQVA 2N7CA 1FNMA 3DGPB 1Y4ZB 2F4VJ 3JYTB 1RB0A 3EXCX 2HNZA 4PFZA 2E3IA 3DLGA 1AHJB 2WSFC 4HDGA 1FERA 1CG2A 3I5RA 2H4WB 2PA8D 4TVRA 3KJVA 5IFMA 1DTTA 3A13A 2XM3A 2EQUA 3PE0A 2PUOB 3PFSA 3GJRB 4UY85 2MZSA 4LUEA 2F5TX 2DVJA 2DD5A 1ZBJA 4X64J 2HHPA 2XKOC 5C24A 2B9XA 1EX4A 1U3OA 3M8QA 4FXDA 3T5HA 2XD0A 1JLGA 2PE8A 3W2WB 1Z9ZA 3GYGA 4WFZA 3T5JA 1HD0A 3OXGA 5AXNA 3TJAA 5GAHI 2H65B 1IBKF 3THKA 2CPDA 1Q86U 4YR0A 4C0FA 2O01C 2PU9B 2R3VA 1M2VB 1MGQA 5A6WA 3A8HB 3S8SA 1OYDA 3IRXB 1UW4A 1VQ8Q 4FYYB 2MQQA 2ZAEA 1S6PA 2V9KA 1JMTA 3NGTA 5GAGU 3SCJE 3ZEHA 1T3NA 1M4ZA 3E2UA 2ZD1A 4GLMA 1KFDA 3M8WA 3JTOA 3ILJA 2VPZB 1RLDA 4OP0A 2DL3A 3J81U 2PGCA 4HT8A 1ZH5A 1JLQB 1HNIB 1K9MT 2ZD1B 4ECRA 4X4SA 4EMKB 4XU2A 8ATCB 2VL1A 3P6YC 2Z2LA 3Q89A 3MD3A 1HD3A 2AWZA 3SSQA 2YXLA 2HNYA 3MP8A 2LQJA 4EBCA 3POTA 1VI7A 3AHUA 1MW7A 2ZH9A 4DV5J 4LFAJ 5CKEA 1X4AA 4MH8A 4TVAB 1S1TB 2VASA 1X01A 4QQ6A 1Y07A 1JB0C 2IIHA 2GGPB 2Q66A 4NYOA 1HWJA 5GAEU 2RU3A 4YDDB 1KN6A 2R5AA 4X4QA 4FF1A 3RAXA 1T9TA 1X31C 3RB0A 4FT4A 2JS2A 4OZNA 1DLOB 4WBFA 5FROA 1M2OA 4I6AA 2K2MA 1YJVA 1M3AA 4E98A 3CMAT 2DJWA 3FGVA 1V5IB 3NGUA 5HO4A 4X4VA 5GADU 3OQ5A 2V6AA 2RHYA 2V26A 4GY5A 1SL1A 2QGGA 4EU0A 3HVWA 3GFZA 3ZTPA 3EG0A 4Q8EA 2LDMA 2EG2A 4NL2A 4M78A 1OWXA 3VZIA 1IUJA 4CLSA 2G1DA 3V7SA 3G82A 2GIQA 5E3CA 2RQUA 3MM9B 4M8LA 3DFEA 1RT6B 2VXEA 4PJLA 5HLFA 1TKZA 2B5JB 3THPA 4LDYA 3HD2A 1TL7B 4DN0A 3F56A 2LNVA 2ZNZA 5KFLA 5G0RB 4FSSA 3TANA 3G82B 2FLNA 4KUIA 3CNQP 3HTRA 1SH3A 3EG2A 1SIZA 3H7HB 3W8PA 1TKZB 3D6MB 1QP3A 2F2XA 1BY9A 4AXIA 3SQGA 3GIRA 1ZPVA 2IC3B 1SUQB 1UFWA 1ZUKA 2I5JA 2WAQD 3PYGA 3MCMA 3OYYA 3C46A 4C8QA 3OW2S 3T1YF 1DURA 4WU3A 1RWPB 4J9OA 2A36A 3UNGC 4CIOA 1VQKS 4JI8J 4KV8B 1E6HA 2V63A 1CJUA 3J7YU 2N3OA 2OJ2A 1Z2LA 2O1PA 2C06A 2KRMA 1URRA 2RRBA 4ZCKA 3CCMA 2BE7D 2EFOA 4RBTA 2YWKA 4ZPBA 5IXBA 1VIOA 4DV3F 1IWGA 2W2QP 1BCMA 4J9SA 2XMFA 2H9ZA 2Q6CA 2DPJA 4M77E 5GJWB 1KSWA 2F8EX 3HHDA 3NCRA 4JP8A 3S3MA 2HURA 4K4VA 2M9UA 5LJ5e 4UOGA 4DR7J 2BEFA 2HQCA 3CJ4A 2GTOA 1D0YA 3G4SQ 2OPRB 2PEBA 1WJSA 3H41A 5ETMA 2ZBIA 4FM4B 3SWNA 3U02A 3ZZPA 3AB4B 4ATOA 3H20A 3MUVP 1WTBA 2KE9A 1N5SA 5K5MA 2R8HA 1NPPA 2D0NA 5GAOq 1QW1A 5AE2A 1RAOA 1GBRA 1RDRA 4IQXA 1RHRB 3BDUA 3M32A 4MMKA 3DXSX 1HBOA 2DNUA 2M70A 3D1QA 1N5YA 1KWMA 2Y1IA 1VJWA 4I6WA 1HR0J 4FS1A 1IM4A 2DR5A 2DR7A 3R2CJ 2HZAA 1YJNT 1TH7A 2AJQA 2O3DA 3HD1A 4FVMA 4Q43A 1YITQ 1VK3A 1SQEA 1CS4A 3KBGA 3CDWA 4AUKA 3LD7A 1IQZA 3DRPA 2OTJQ 3B8HA 3PO4A 1FCAA 1SH2A 4OVAA 2ZVIA 4DR4F 1WC6A 3LH0A 5A8KA 3BN7A 2UXBJ 3CCVQ 4OHXA 5DS7A 3N5BA 3FSXA 2VG7A 2V9WA 4OHVA 1REVB 5SZTA 2Q1LA 2O31A 3N6MA 2YUQA 3QDFA 5K20B 2YBVA 2L3QA 4AD6A 4DR3J 4C7QA 3CEDA 2ZVSA 3KFWX 3MUMP 2LX7A 1G3OA 4J9PA 1UA1A 4JZ3A 1LV5A 1R8OB 2P4TA 3L9ZA 1GFWB 3WZ0A 1B4SA 2JVOA 2CNLB 1VQOQ 1N6QA 1OZ2A 2VODA 3H6ZA 2PVDB 1FKOA 3I31A 3FLGA 1VQNQ 2DIUA 4H54A 4XTUA 2E12A 2EQMA 4ZPDA 4PFOA 4MIWA 3MXHP 1MMNA 1E7OA 2H5EA 2RRAA 4MYTA 5FU7B 1JXVA 5T14A 3I56A 2WBMA 4H4OB 3I0RB 5I3UB 1YLXA 2ZH6A 1KOOA 2Z0WA 3PIOA 1EP4B 4IR9A 3IS9A 4ECTA 1YJRA 3LALA 4BY6C 1FKOB 2LP5A 4ERDA 2IFXA 5KT3A 1B0PA 1S1UB 4MK9A 2XMWA 2DNNA 1JJ4A 3MR5A 2VPYB 2DIVA 1NZ9A 3C94A 2P6SA 2DY9A 2DEJA 3RZAA 4MIAA 1OMSA 1KP6A 2NUHA 3JCMQ 4Q5VA 2OUGA 4B9NA 4DR6F 3DHWC 4FPIA 3PYEA 4F4XA 1SC6A 4O3QA 1UVMA 2G4BA 3BDEA 2DEUA 2FGOA 3HKZD 3EGNA 2K5IA 5LM7E 5GMKj 2LJ1A 4O44B 4OMOA 1VHIA 1UL3A 5KTQA 3LP1A 2ZKTA 4F4ZA 4J9DA 1ELOA 4XO0A 2OPPB 4QQDA 1OEBA 1MN7A 2EW3A 1FX4A 4NCBA 3DOKA 2HCKA 3AFGA 1BKBA 2ZJRQ 3JV3A 3LGLA 1S72Q 3K5NA 4DZ6A 1FJ7A 3VVTA 2LT1A 4M78E 2L41A 1JKHA 1RBAA 1JXMA 3PRVA 3DOKB 2VBWA 3J7A1 2W9CB 5KFRA 1O51A 1VQPT 3D2WA 1E6VB 3N0VA 1PM3A 4WJBA 4A46A 2A2CA 3JCMX 4ELVA 3CJTA 2P9GA 1AZEA 1RK8A 3EAEA 1Y9OA 3CCJQ 2J05A 1RTHA 3VU3C 1RI0A 2H5IB 2QGFB 3EG3A 2DPIA 2CQ4A 2CQIA 3IC1A 4ZPWR 1XTZA 4RUAA 4DN9A 1U0SA 5GJVB 2VQEF 1T0TV 3C3LA 5EUHA 1SPBP 2YX7A 3OL8A 1FTCA 2HIQA 4Y00A 4OX8A 2QL7B 1TTHB 2WONA 3BH6B 1HBNA 4PQAA 3TVZA 2MF2A 4B9LA 1GMWD 2HS3A 5LSOA 2ZOGA 2I6WA 1G8XA 4C8QE 3WIVA 1WQ7A 1YHQS 1YFNA 1Q1KA 4R5PA 3OVBA 4OGEA 3WX4A 3GV8B 4KY3A 4KIAA 4C92A 1QVFS 1R6YA 2Z30B 2RJFA 3GSIA 1KTVA 3MPWA 5DDOC 4B08A 1WKLA 2CP7A 1DAXA 3R3TA 3LP0A 1N32F 3C95A 3DLJA 4KUDK 3CJ5A 4F36A 3DKMA 1M5HA 4C92B 2QEXS 4RU2A 2RQWA 2KBTA 2FJDB 3MR2A 3PYFA 1RTJA 1UECA 3E9GA 2KVIA 1XQIA 3GCWP 1K8AT 4YY3J 4CRIA 3V4IA 2G2YA 2MPUA 4PQUA 4XTZA 2B86A 1OI1A 3LYIA 2L3MA 1APSA 1QM9A 2ABYA 2QMUB 2YT6A 2JEIA 4D3GA 2AKKA 2R7TA 1RXOB 2XIDA 3QYGB 1VQKA 1VQYA 1D0XA 4U7UK 4FYXB 2EYWA 1FO1A 5AE3A 3JCMP 1R0AA 3MHXA 1UZDA 5EWEA 1LW0A 2RHIA 3LQVA 3EFRA 5CK9A 3CXCS 2CJKA 1SF9A 5L9XA 2JLEA 1PHTA 2N82B 3G6EA 2Z56B 2ZGWA 4X1VA 2C2MB 1RT5A 5ETQA 1U6BA 4AFUC 1KQFB 3HXMA 3IFEA 2V8KA 1D8ZA 3RBDA 3C16A 3L42A 3CCSQ 2RQMA 1M30A 2VOOA 2VG6A 3BR9A 4TLRA 2HMAA 1HNVB 1ABOA 2LQNA 1Q53A 3GTYX 3DOMB 1NK4A 4PJOF 3NKYA 1YJWQ 4A8MP 4LF7F 3MEGB 2KT1A 4A54A 3KMSA 3JQKA 2K3BA 4K5SA 4JS5A 4LT6A 1PAEX 1WSRA 3C16B 4USVA 4PJOG 1GXUA 1PG5B 1HK9A 4K4ZA 2RNAA 4ENOA 4WF9Q 1O75A 1RJJA 2ZH2A 1RCXB 4ECWA 1TU0B 2KMTA 3P8HA 1EQ0A 4QQBA 1C4AA 2IMWP 3CC2A 2VJUA 2V68A 3NFCA 2FIUA 4LMZA 1P9YA 1H3DA 5A0YA 3MF5A 2AEJA 3Q8RB 4KQZA 4DU7A 2B9WA 4OHWA 2YNIB 2HW3A 2FHKA 4WK3A 4DV0J 4GRSA 1OPIA 4JJDA 4ID8A 2V1RA 1C1BB 5LJ3d 4HKQA 4LR8A 3MM7A 5A0YB 1IBCB 3GG0A 2QQ9A 3FRZA 1VQ7Q 2MZJA 4JBCA 3CC7Q 4JI0F 4R8UB 1SV5A 1N33J 5ETSA 1BUXA 3BBFA 1Y96A 2N4CA 2W9BA 2VVKA 2IRXA 4GMKA 2JOYA 3CBMA 4KT0E 4A8WA 1P6TA 4L5GA 4M7DD 3A8JA 1KR4A 2ZZTA 3MI7X 3ZZUA 5FU6C 1BQMB 2AYGA 4FYVB 4QZVB 3VAFA 3CCLQ 1EB0A 5LJ5h 4BWMA 5H9EK 4LUBA 3HFKA 3CD6S 1E6YB 4YUDA 3TU4K 4PFPA 3NLCA 3FCVA 1LK5A 4M7AD 5LJ3f 4OZLA 2ZPEB 3KG1A 4A8QA 4ILLA 2QLWA 1MROB 2BXJA 3U7JA 1XMQF 2B7CB 2YLCA 4N8OA 4P71A 5KFXA 1VGYA 5AYFA 1Q5YA 1OOTA 1GL5A 2OGUA 2KYBA 5DLGA 4LF5J 1XWLA 3QMQA 1ZQ1A 3L3CA 4EBEA 4Z88A 3G2XA 4WP3A 3V6DA 2UVRA 1RTIA 3W9JA 4DSEA 1XERA 4FP9A 2XWYA 2EVRA 2DETA 1C6VX 5A8WA 2V67A 1T0HA 2RHZA 3PHEA 1U1NA 3TA2A 2BKNA 3U1MA 1XMOJ 3AA8A 5C0MA 4YQWA 2P9CA 2FJVA 1TL5A 1V3RA 1AXQA 3IBFB 3INZA 2V8IA 1LWEA 3V6DB 1EZZB 2YTCA 3VGVA 1XNRJ 1TKTB 1T05B 2QSFA 4OX7A 2WOMA 4IUUA 1YI2A 2FZCB 2OI3A 2CUDA 1UEKA 2HGLA 2KM8C 1YKWA 4K2XA 3TSWA 3FBCA 3MTJA 4MIBA 1BYMA 5LJ3g 2NSBA 1HNXF 1UPMB 4OYOA 3TYTA 3PJ9A 4YHHJ 1QE1A 4BE1A 2RO0A 2ZCFB 4WXOA 4ETXA 1QWFA 2Y3YA 2C3UA 4DL4A 4HVVA 4G3IA 2YVSA 2EJFA 2F1FA 2DXBA 4M5GA 1I1JA 4DWIA 1EKSA 1NDCA 2Q43A 3GCXP 1Q78A 3GYNA 4L6V3 5KFWA 3MMAA 4J9LA 3LWIA 4LF2A 1K73U 3NNAA 5KYUA 2RK1A 2E1HA 4Z89A 1MWZA 4QWCA 1I94J 4ZVPB 4QVCA 4JUZA 5J1NA 2CPHA 3C14A 3OYDA 2ZPBB 3D1OA 4QYZJ 2L9WA 4P2SA 1ZUUA 2EFQA 4NYZA 2HEKA 4F04B 5LMNF 3CPWR 4A8YA 1KLNA 2F5GA 2G6FX 2ECZA 2DGWA 5LXYA 5K9FA 3MUTP 1OSCA 2HRTA 2G3RA 3MHYA 1G6BA 4V2SA 1N48A 1IZ6A 1JXLA 4BLGA 1ZETA 1NSKL 3KUHA 4NI2B 1CJKB 5KFEA 3U27A 5KG4A 4O3OA 1IN0A 5BR8F 3CCES 2KN4A 4FS2A 1MMGA 3FB9A 2YRDA 1TP7A 1Z4UA 3HSGA 5FD1A 1Q82U 1QD1A 2L5QA 1C0TB 5GANe 4CDIA 3OTBA 4F4KA 2JC0A 3MEVA 2YPZA 3PRBA 4LE9A 3CPWS 3C19A 5D4LA 2QSWA 4WFBQ 3G71S 1RT2A 3HM9A 1VQ4S 1NRKA 5KFIA 3OTOF 2C42A 1D1BA 1BQNB 3PG9A 3CC4A 4HL9A 4U8YA 4ZVHA 2GQIA 5L8RE 4LF8F 2CQGA 2CQCA 3NCPA 1ZYQA 1W6XA 3Q8PB 4WFAQ 4XTTA 4CO1A 2CYYA 4RWWA 1S7IA 1FRMA 1AWOA 4UZBA 1QUVA 4PZVA 3G8TA 1ZX6A 1RT7B 4R56A 3W61A 2BOAA 2QLFB 2V4JB 5LJ5Y 1T03A 3DLEA 5KFGA 4Z02A 5LOQA 4CO5A 3EG9B 4X66J 1R27B 1F3VA 2PIIA 2VZ9A 2DH7A 2HZCA 4RKUE 3Q1JA 3PFOA 2MK5A 2XEXA 2UXDJ 2B51A 4ES1A 1KQSP 4HCZA 1FEHA 3CXCA 3M05A 3DLEB 1UW9A 4KC5A 3LGFA 4DV7F 1IRXA 5GAN5 2CQDA 4B9TA 3P49B 2OX7A 2XZTB 1KVIA 4O23A 2VUBA 4DX5A 3ENAA 3OLAA 1VS3A 2MY7A 2DL7A 2QQBA 3G6XA 2JZ2A 4F02A 3JCMJ 4IRKA 1QCOA 4M77D 1HARA 4DQSA 5KOWA 1RUWA 1R77A 2MLYA 2K79A 3W2VA 2KRSA 4F8RA 2DXCA 1YVFA 3I55A 4XTYA 3ENVA 2VQFJ 3M53A 2QA4S 2MKKA 1X60A 2XI2A 3H98A 4DFJA 3DKDA 3MD1A 4M5KA 5ETNA 1VQ5S 5D6YA 1UFLA 2CUYA 3BW1A 2FJAB 4R0KA 1NK5A 1SBRA 5L38A 2EFGA 1VQLT 4U6PA 4LBIA 3TAQA 1JLCA 1B7YB 2B8PA 3ILIA 2BYCA 4I0WA 3EDRB 2DGXA 3HLUA 2X4WA 5GVQA 3PM9A 4XU0A 4ZP6A 5D15A 4DV2J 2HKNA 2BKPA 3E19A 2DVIA 2UXCJ 1L3VA 1KHCA 2DNGA 3M9NB 4ED1A 5GAN8 2M7SA 2F4FA 1FJGF 1XIQA 3M2VA 3LPEA 4WYWA 1HWUA 5D3GB 5IT9Y 3WBZA 1RKJA 3GSDA 3CULA 4MYUA 3QRQA 1NHVA 2RHUA 4OB3B 2DL8A 3OSSC 2FHJD 3OFHA 3GV7B 2D3O1 2Y8YA 1HL6A 1IREB 3GYXB 2OLWA 3JTNA 3H2LA 1AD5A 3R7BB 3JB9k 1UB4A 3TQ1A 3LA0A 4YDXA 3ZZYA 2I9SA 2WACA 2HVHA 2JT4A 3MM6B 5DQHA 3RAMA 2KI2A 1WI6A 1U1LA 2DNHA 5FLXE 2WSFE 3NWRA 1FI4A 1S1WA 2F3JA 1O9SA 4F16A 2JJ9A 4KKOB 5LJ3j 3A98A 4DR1J 2B56A 3VGSA 2J0QD 2BZXA 3RW7A 5A8RA 3KLEA 3MOJB 3DB3A 1PCXA 1KQGB 4UUXA 3X24B 2BZ8A 2QL9B 4M5NA 5B7WA 1N5VA 2C3MA 5DY9A 2F2WA 2JTFA 3NGDA 3DOLB 1OV3A 3JB9H 2ZC4A 5KFDA 4DSIA 4JDSA 4A8KA 3TCJA 1YJ9Q 1H0HB 3RRKA 2O01E 5IQ6A 3BSAA 3IP0A 4KO0A 4K4YA 5HMZA 2GO8A 4LFCF 4BBYA 3EE3A 2BJ8A 4DR5F 1BI3A 1CKBA 2HMIB 2KSSA 2XTJP 3BGUA 4OFZA 3JB9J 4FW2A 4BDYA 4P75A 4CCHA 1X4HA 1RTDB 1R8PA 5KYXB 4Y92A 3CCUT 2O4XB 1VR6A 3SFMA 1C1AA 3M7VA 3IO1A 3AJ1A 4JI6J 3C4SA 2KT2A 1MV3A 4QWBA 2ROLA 4XU1A 1CKAA 1FTRA 2XLKA 4NZ6A 4FN5A 1F6TA 4LQ9A 3GPAA 3M8PA 4DXLA 2IBOA 5GAN4 4IR1A 1S1VA 2FVSA 3D0IE 3R97A 2ZUGA 4Z7YA 2MHEA 1TOVA 5IM0A 1N36F 2QAZA 1JJCB 2NXEA 4G1PA 3DC2A 2DBBA 3RKYA 2FZKB 1H92A 3EZOA 3M8PB 4LF9J 1JB0E 2F1LA 5KYNA 4JI1J 3JCMe 2MQOA 1CJVA 4TQRA 3KKFA 2E5IA 4C3MA 4Y34A 3NXZA 5IHIA 4DPWA 5ETLA 1I4K1 4ZNXA 5KG3A 1K1SA 1T9UA 1KC8U 1PSFA 2DO3A 1A6LA 5J2QB 2HAFA 1HA1A 4NPOA 2L9DA 3NNCA 2UUCJ 1NEGA 1WDXA 2IDEA 3CCEA 2H1YA 4PKDB 5B0EA 1X43A 2VUGA 3IGVA 3V6HA 2FPEA 2YWWA 1K1ZA 3P5BP 3GFYA 3E01B 2OEMA 3QRRA 3CCQT 4NASA 1X0FA 1VQ6Q 2KFYA 1H7XA 4C8QD 4JLIA 2WB4A 4R25A 1H8KA 2M0GB 3K5PA 3G71A 3CPWA 3S01A 1F5AA 4DF4A 4X4UA 4ZPAA 2GFAA 2OH2A 3OHBA 4M5LA 4IURA 4M7AC 1SKUB 2HVZA 4MDWA 4AG2C 4J9UE 1UHFA 1HNWJ 1WFWA 5D0EA 2XDDA 4UTGA 2W9AA 4WIIA 5JXSA 1U7LA 3M4XA 5D4NA 2XMVA 3QWXX 2FPDA 2V8PA 1WX6A 2P4RA 1KHVA 3BEGB 1PKSA 4Q0BA 4ITSA 3QFWA 2MMPA 1FT8A 4PG6A 4XDCA 3UFCX 2W24A 1SPKA 2E1RA 2QYGA 1WPYA 5GMEA 2HS0A 3PW0A 4PJOB 1JXEA 3Q2TC 2HVIA 5E41A 3MR6A 1DTQA 3AJ2A 2HYIB 3EHQA 1M8MA 2HQIA 2DTJA 2HFOA 1VRUB 3VQTA 3V2UC 4HT9A 4DV6J 5J2MA 1SJ3P 3HZEA 1EAYC 2DNOA 2F65A 1K9MC 1HHTP 3EHRA 3QO9A 1WHKA 4ESNA 4QPTA 3CMEA 4C3KA 2EYYA 4ECYA 4ECVA 2CQ2A 4B3SJ 3MZIA 3BGFA 3PIOQ 3SFUA 4B3OA 1YITS 2MEWA 1IO6A 5KFBA 3NPFA 2O88A 3NEKA 4QU6A 1UETA 1HHSA 3NMRA 2OTJS 1RA6A 1FKPB 4C98A 2BJ7A 1TUGB 2HRUA 2LZ6B 3OB9A 1S57A 3FK4A 4M7DF 5HQMA 1HKAA 1UJ6A 3PIPQ 2PMZD 4GVLA 5GANh 4FBTA 1Q8LA 1K76A 4P73A 1VQ5A 1TELA 2MMYA 4XAKA 4M7DG 3R5CA 5HQLA 3FZBA 1J5OA 2LA4A 4IKAA 4AMCA 1VYTA 2YNFA 2DYIA 3C6UA 3TWZA 1FJCA 2DXDA 4QVDA 1HBUB 1K44A 3R2DJ 2OO4A 3UR0A 2XY5A 2CPFA 4JV5J 2DEIA 1FWLA 1AUDA 1PCAA 4G6VB 3QFHA 2RD5C 2J9EA 3ZTQA 5I3QA 3OS5A 1SKSA 4NLYA 3B78A 1PGZA 1ZS6A 4DV1F 2OEJA 1W70A 4WZMA 3CJ0A 2M16A 1M90U 2QX0A 2GAHC 4LXCA 2FZGB 3TUJC 4QW9A 1VBXA 1KC8T 4V19J 3GP9A 1XMBA 4TLQA 5A2QE 2ZE2B 3MECA 3Q8SB 3SB2A 3Q23A 4U7UD 1NAQA 4USUA 3A4TA 3CTRA 5DDRC 1WDTA 4BB7A 4E2FB 1JX4A 4PG7A 2AD9A 1H2TZ 2GFUA 3HT0A 2OTLS 1M3BA 2A18A 2AP6A 2XY7A 3MECB 1NXIA 3UPFA 2NYSA 3QBYA 4DMZA 2KT8A 3EH2A 4CZCA 4PK4A 3HJFA 4WTYA 2W2OP 2JMCA 2DXTA 3TEEA 5E3RA 2GCFA 4IG0A 2VKZG 2XS5A 4LDWA 4QWAA 4OZ5A 5THWA 3DM2A 1OU9A 2FEIA 5E33A 1VQMT 4I2PB 2CH4W 3OY9A 1RLPC 4F7VA 1W26A 2GMLA 1JLBA 4I67A 3KLGA 4JV1A 2VA2A 4K0KF 3MAAA 4AG1C 3NAIA 2EJ9A 4J9CA 3DM2B 4IUTA 1C0UB 5JVGQ 1GQEA 3DGVA 1FRLA 3MEWA 4RWXA 1Y10A 4RUBA 3N79A 1R8CA 1FXLA 2RIJA 5FDLB 2BKOA 3MCAB 1JLBB 4OYZA 5F0WA 5D4OA 2XNRA 1CC8A 1NEEA 3CCMT 1CBKA 3M2RA 3NMZC 2ASJA 4YP3A 4CI0B 3C15A 3HKWA 4O3RA 2MSTA 1LQ9A 3I87A 1N6AA 1FMKA 1LPLA 1PAUB 1VJQA 1T9XA 4OL8A 1HMVA 4W92B 4WPAA 2CKWA 4NL3A 2WBRA 4OZ3A 4LF6J 4WZQA 4TN2A 3M2RB 2D8HA 1JQGA 1I5OB 1V29B 3QT6A 2XMTA 3MEEB 2RILA 2AGOA 2OPSB 4CTAA 2NR0A 3JB9I 2N3LA 5IAYA 1HMVB 3QJJA 1GNKA 2RN8A 2CQ3A 4CO3A 1JLFA 5M2PA 4OI6A 3GB0A 1NJYA 3CWJA 2OPQA 4E7ZA 3M54A 2MWOA 5F41A 5DG7A 4LD9K 3QIPB 4ES3A 1PIEA 2K57A 3HSJA 5T7LA 2LQ8A 1WC4A 2JUFA 4CYUA 3CCRT 2A7YA 1RADB 2DGTA 2GCXA 3KK2A 3KUFA 3HHLB 1I8FA 5GAN2 4U96A 1M90T 5T7LB 1XOVA 1S0MA 1RTZA 3GR0A 2E6NA 1QJHA 4MKVA 2J7UA 1K0TA 3OYHA 1FD2A 1DARA 3CE8A 2L9NA 2Y1LB 2YKMA 4OYXA 4WU2A 2UV8A 4A0UA 2YKPA 1C1CB 1KVKA 2GQCA 2P2CB 2CZ0B 2DHXA 4PJNA 3MPDA 2J7IA 2HFNA 5EN1A 2XDPA 4ZIWA 1TL4A 5AXKA 2A08A 4QOTA 3JSBA 2M0YA 1NJIR 3FJPA 4DCJB 2BTTA 2PI5A 2OFHX 2PMWA 3RTVA 2MPXC 2QJ3A 5D77A 4NEZA 3T6JA 4DF8A 3OT9A 4FZVA 2MZQA 3GQCA 1YK9A 4J9GA 3AQOA 4TU9A 4M77F 1S6QB 1GAOA 4NLGA 3BQ1A 2KU7A 3D54A 2PSZA 4PL6A 4GC7A 4M77G 4F7UF 2DHAA 2B43A 1TL1A 2ZPGB 3ADAC 2IM1A 2HFZA 3OYEA 3A3NB 1RU2A 3I56T 3QGGA 4F7UG 6AT1B 2U2FA 4A4JA 2YNHA 2RUSA 4X2BA 1BD6A 3CCSS 2MKIA 3SDEA 1N56A 1HWKA 1NZ8A 1TL1B 3W9IA 1DQAA 3ZZRA 5DDQC 1RGVA 1YZ6A 2M52A 3PX4A 1O0PA 2EPIA 3TQEA 1HYOA 4RW6A 1JWWA 4YOEA 1D09B 1Y11A 4DLEA 3E8OA 3X26B 1SSFA 3N5FA 2J0SD 2LJ0A 3QGHA 3R7SB 4NLOA 2ASLA 4J5OA 3OW2P 3QJ6A 2ZJQQ 2ZJPQ 3QBCA 2YRCA 3FSIA 3NBPB 1DHMA 1ZTWA 3OL6A 3THTA 4BWJA 1SQFA 2QTVA 3QPHA 5HP1B 2VOPA 4N0AA 1NG2A 2H48B 3LANA 1YITA 2IVWA 1WA7A 1DFDA 3OPKA 4DA4A 2F63A 2Y1RI 1B3QA 5F8GA 5AXLA 4CC7A 1X4FA 4EK2A 2OTJA 3C0CA 4RG8A 1KOHA 2HNDA 1F5CA 1QLNA 1HQUA 4ECXA 1WQWA 5B0DA 5KG7A 1IBMF 3A8LB 3TX8A 4BI3A 4BE2A 3CCVA 3V7CA 3DXBA 2ZPFB 2YH1A 5IV4A 4CLFA 4LIWA 5IC6B 3TX0A 4MAKA 1RA7A 3KK1A 2DGOA 1EQMA 4CO0A 1X5PA 1YCYA 1W4SA 5E3AA 1BWVA 3UCZP 2VXFA 2V8JA 1XNQF 3QZ5B 2XMAA 4FYDA 3H5XA 4JLGA 2J5AA 2QA1A 2MZRA 1T9VA 3HVRA 2J6UA 4KHPJ 1MSWD 3AJDA 3LX7A 2X4JA 2WTFA 4RTUA 3HRUA 1VQSA 2R2UA 4DR2F 3VQSA 4A8OA 1U1PA 5J1PA 2CDTA 1X9MA 2EXUA 2EYXA 3HKSA 1FRHA 2DY1A 2MCNA 1WYXA 1VQNA 2FPFA 1LWFA 2Y1JA 3R1HA 2R7SA 4M94A 4AL6A 2X4YA 1XN9A 2OTLA 3IR7B 3PXGa 3OFEA 2FGCA 1V3SA 1CQMA 3QHSA 1L3UA 1SQGA 2EWNA 5GAGI 1WOSA 3ZZTA 1RWMB 4DQQA 3CMAS 2K9GA 1VK8A 2CJXB 2RK2A 3R6NA 1VLYA 3JAMY 4I2QB 1WZOA 3O3LA 3I96A 4LQ3A 3NL0A 2PQWA 4PYDA 4AXJA 1K8AC 1M1GA 2BVZA 3NOGA 4PG5A 2M1HA 3BB5A 3GONA 2HFSA 1UUEA 1G3YA 1WHJA 2XMKA 2VHGA 5F8HA 2GMHA 2KFZA 3X25B 3ME9A 4B9UA 4GBQA 1GMWA 1G3WA 1Y5IB 1QLYA 1QKWA 5ETVA 1Q86R 1MG7A 5J2PB 2YKNB 5IH2A 3HVTA 2HZYA 4GC6A 2ZM6J 4AL5A 1VCTA 5EDWA 2JFKA 2EKOA 4LREA 2LKZA 3HO1A 2RRNA 3R9LA 4DUZF 1NK7A 1YHQQ 5HCKA 2KL8A 1TUCA 3VAIA 1ZZNA 4OMFG 4DG1B 4M78F 4EMHA 2MTLA 4RTZA 4IG3A 3PKMA 3F73A 1VQKT 3UD5A 4F0KA 4KJIA 2B8AA 2J76E 4NXNF 1M1KU 1U02A 5HK0A 3GJQB 1FXRA 1NLOC 3EPGA 4M78G 2AMCB 4HH1A 5GADI 2QEXQ 4NMXA 2QRRA 2CJ9A 1X69A 1B34A 2M51A 4IQMA 5KG0A 3G6ET 2KB2A 2ZNYA 4DZDA 2C3YA 5CD4H 2DXFA 2HQHA 2ROPA 4RL1A 4O5VA 3TA1A 3GJTB 1I07A 1S9GA 5KFPA 2DKGA 1S7HA 2RQ4A 4JI7J 1IKXA 3EDQB 1RP5A 2HHXA 1GFCA 2DHGA 4GKJJ 1PYSB 1U25A 2VBZA 3KHLA 1BBZA 5D0HA 1IJEB 2GX8A 2MYFA 3S7RA 4C8QF 4WWSA 4M75D 4KSEB 2KHCA 1D3BA 1MV0B 1YTYA 2NREA 5LSLA 2BKDN 4C8QG 4PWWA 4D3HA 4ELYC 2OMLA 2HEQA 4UC4A 3SCKE 1RSCA 1QTMA 2KXFA 4OV1A 2LXIA 2CT4A 1RAIB 3GNGA 1GT8A 2HSPA 2JMAA 1NJWA 3CC2T 1NO8A 2ZKUA 2RB7A 1D3BB 2OP5A 4OHYA 2ZOMA 1YBTA 4QBUA 2WVCA 2KZMA 2KT3A 4DUYF 4DOWA 3UCGA 4DBFA 2XU8A 4KRWA 3GG1A 1H73A 1NSQA 4ZN1A 3D4JA 1PJ5A 3R5JB 1TVRA 1BI2A 1BI1A 3J7YI 1TV6B 2HL3A 1WEZA 1PJ7A 1CSKA 5CKHA 1TKXA 4IFYB 2ACMA 4ELTA 2YKQA 1DY3A 4C4WA 3OBYA 3UATA 2L2PA 4NWBA 7AT1B 2HHTA 1TVRB 1KD1U 4ZVOB 1UEVA 4LBPA 2D8JA 3ZL7C 1Q4RA 1K0XA 1R6VA 2KAFA 5HMXA 3FDRA 4WTOB 2V8HA 2B4OA 3VUBA 5EX3A 1H38A 5GANg 3CSKA 2MKYA 2ZH5A 1FX2A 2JWNA 2LA6A 4C11A 1NK0A 2KO1A 4ILMA 2YWFA 2CWKA 3HSBA 2HVDA 4MFBA 3TQ7P 1HJDA 3NOCA 3AODA 2LT4A 2J9CA 1HLWA 3FEOA 2DVEA 3JCMb 5E3QA 4II1A 1ZA2B 3L2ZA 1SCJB 2QMWA 1U1SA 3CCSA 2AJ2A 4A0TA 1QVFP 4DBQA 3QIIA 2K3XA 4IUFA 4Z7CA 1XJWB 5I2SA 2LEPA 4JI4J 4FKXA 4JJNK 1YJWA 2NS1B 1W1FA 1M1KT 4C5GA 1XTDA 3PT9A 4N5SA 3UN2A 4M7DB 1S9EB 1KFZA 4ZDNA 2RH3A 4M7AA 2EFPA 1D1UA 3DYAA 2X1AA 1T95A 2WSCC 2PC6A 3CD6Q 2VFSA 4EEYA 1L5UA 4R0EA 4IO1A 2D1XA 1KLMB 2W2MP 3TA0A 4O4GA 1FNXH 4W98A 4Y28C 1IBLF 2DK2A 4IH6A 4NZ0A 2NUPB 1H3HA 3I4PA 2MQ8A 4DOVA 3BO3A 4RZRA 3DYAB 5IT9U 1CJTB 1YI2T 3CD0A 1SJQA 5BYRA 4TU7A 1M5SA 2I0XA 3A12A 3VGUA 1RAGB 2PD1A 4M95A 1YG0A 3FJ5A 3HFNA 3IR5B 5LJ3e 2K8GA 2EFNA 2PUKB 3CXCP 3IRWP 2CSIA 5M9OA 3K58A 4IH5A 4H4KA 3MCNA 4EWTA 1HW9A 4RW8A 4Q8FA 1U1QA 1N88A 2JXBA 2NZCA 2ESWA 1VQ7A 5KH6A 3DU5A 3MEDB 1F2HA 2JTMA 2PVOB 3TEGA 1GMVA 3BGOP 3CJQA 3JTPA 4OIXA 1UAWA 4ZJQA 4XK8C 3MPUB 2QQAA 2B0GA 2CDRB 4PXBA 1KRPA 5CYMB 4NLSA 4CH7A 1ZHIA 4ZMMA 3TVYA 1AZSB 2HPUA 2YNGA 4J90A 1B0TA 2VPWB 5F8LA 1WC0A 2K2VA 5L23A 1D9FA 4J9HA 2QDYB 3VS5A 2DRBA 4P74A 3MR7A 2R7WA 1S59A 1VQPS 2K3IA 1HYSB 3MM8B 4FL6A 4YMEA 3VS0A 3M0SA 5G4DA 4DV4F 3WC0A 2VWFA 4RTTA 3M1VA 3ENQA 4PJJA 1FRKA 3FJ2A 2MHNA 5ETRA 1PRMC 2LCWA 3CMAA 3BBCA 2R8IA 1JLEA 3T19A 3NHNA 5LL6S 5ETTA 4LSNA 4ED8A 4DBHA 3MMCB 3FMWA 1KSPA 1M3CA 5HY6A 1T3SA 3OD2A 3U1LA 4BD3A 1HBMA 4PLIA 2CVIA 1YJUA 1RACB 4C8OA 3O6QA 3SYZA 5B0CA 1TS9A 4LDUA 3H0FA 3CC4T 3QSIA 4JI5F 3JCMd 4XAXB 4PABA 2ED0A 3BKTA 4A4EA 5D6XA 2LCCA 5K14A 2RF2A 4LD6A 4QIGA 1L3SA 1IR0A 1QQJA 2QASA 1PBUA 1HBMB 3VALA 2ZH7A 2NXUA 1D0EA 2OMOA 3I0SB 4A48A 5KFCA 2ZWPA 3CCEQ 3RKWA 3L09A 1VQ9T 3V8KA 2V1QA 3QUIA 4RTWA 4NYPA 2BANB 4NXMJ 4F14A 2IVFB 3OTEA 1SL2A 1J5EJ 2G1HA 4Z2XA 2HLUA 3Q8YA 3BJYA 3IR6B 4O0IA 4LR9A 3VAKA 2FHDA 4F26A 4J9MA 4QU7A 4RNNA 1VQ4Q 4F0HA 1WLPB 5IT9E 1UMJA 3OJSA 2MZ1A 2LDIA 1U6FA 1IXDA 3JCMf 4KB7A 4C92F 2M0OA 4XIUA 2R8JA 3BQ0A 4QIEA 1QSLA 4CC4B 2UZAA 5IC4B 4M5DA 3WHIA 3NTKA 2VC8A 4R55A 2DR6A 4C92G 2W2PP 2IJNA 4OYMA 1M5VC 4OQJA 4IDKA 2F40A 1AWWA 2PFFB 4CP5A 3EGWB 5CVIA 4OLOA 1RZMA 2LYVA 3X20B 1RHKB 2MQLA 2AYMA 4EO6A 2K06A 3I55T 3TVTA 1OQKA 4GKKF 1K9MU 3ISZA 5H1SV 2GBQA 2JVVA 4YFUA 2LVWA 2JOQA 1KIKA 3H90A 1RHQB 2IA6A 3RG6A 2GF7A 5LXRA 2KJWA 1WXBA 3R6GB 2HQGA 5KFFA 2OSQA 1M0SA 1X0PA 1Q7YU 5KYYA 2EBGA 2ZBPA 4LN2A 4CH1A 3EGZA 2R7RA 3HHKA 2UUBJ 2VH7A 2HBZB 3K89A 4BI8B 1VQ6S 1N34F 1GX6A 4WE1A 2CH4A 2AHOB 3RNJA 1HPZA 4EZ9A 2BIVA 3QJPA 3JCMg 1AVZC 4HVWA 4Y2IA 4K59A 4M77B 1IB8A 5CR2A 1Q95G 3DLLQ 1OPKA 4JI2F 3RB4A 2QA4Q 4OJHA 1VHFA 1TK0A 2M5YA 3ULRB 4F7UB 1UKUA 2XBPA 1S1XB 1FWPA 3N6NA 3X28B 4OZ0A 4AQYF 2DTHA 4H4MB 4BDZA 1AWJA 3H9NA 4ZVSB 2J6OA 2QL5B 2PZ1A 1S4EA 4L6V5 2EWHA 2WZ1A 4L74A 3A8OB 4YTLA 4C6AA 4KBMB 4URQU 4ED5A 3TVKA 2H3EB 3IG1B 2JEFA 3EFOB 5CQYA 2DO4A 4QJVA 3CBOA 1UWBA 4ZLLA 1VRTB 2ZZDA 4DX6A 1I81A 3W63A 3CPFA 3Q8VA 3JSMA 3DRYA 1B7FA 2GMJA 3EX7B 2HHHJ 2HQXA 4WKRA 4BC9A 2E66A 2FHJA 4M7AE 4MJKA 3PR4A 2AYEA 4C0DC 3NGPA 4DBRA 2GVZB 2AHJB 4PUOA 1I3OB 3MEAA 2RQKA 3ULHA 3HZGA 2E1PA 2V5HG 3MPVA 2HNZB 3DLGB 4IOBA 4RW4A 2RDJA 1IKVA 4JRIA 4Y2AA 1WGSA 2CP0A 3UNYA 2BE2A 1G1XA 3H8YA 1RWWB 3KJVB 2R7UA 3VV2B 1DTTB 3CPWP 2CWXA 3FEXB 5CH7B 4X62J 3EVWA 2ILZA 2ZH4A 2EIFA 3LH2S 5HJXA 1KNZA 4FBUA 2YX4A 5CQXA 4FPRA 5C24B 3M8QB 2AZVA 2BE2B 1JLGB 3M30A 2BDPA 3C2PA 2QLXA 3KHHA 2DBMA 3QSUA 2EQIA 1WC5A 2LMJA 3RUBL 4B3RF 2ACYA 1IR1A 3URGA 4P2FA 2LVMA 4KGVB 4EYHB 4PNOA 3GP8A 5DGAA 2QT7A 4JI3J 2ZBCA 3K8VA 2HBRB 2K1RA 2JN0A 1S6UA 1TR0A 4LFBJ 2CJQA 1S6PB 1NNDA 2DM1A 9RUBA 1VBKA 5LMUF 2ABLA 2ENMA 4ESRA 3ILLA 3ET6A 3OFGA 3OSPA 4M75C 3BDLA 4Q5WA 3TUIC 3DRSA 2BRLA 2E1AA 5KFUA 2DNKA 4ZHRA 4OZ1A 1N8RU 1JRIA 1NK9A 3LWHA 2GA7A 4B9XA 1LNXA 2W4CA 3K2YA 1Q7YT 3TUZC 4X65J 3ET6B 3IWLA 5HQ8A 4CLTA 1KVJA 3I4HX 2KT5A 4ICLA 3SZ2A 2HQEA 2VG5A 2F7VA 4WFNQ 4B3TJ 4D8KA 4XTWA 4F25A 2YX1A 2QLBB 2ZZNA 4YB6A 2FC9A 2HNYB 4NL5A 2XO7A 3IMQJ 1BMQB 4FXWA 2HAIA 3POTB 3BH7B 4B3MF 3FZ2A 1VQPA 4PLLA 5KG2A 3D1HA 4HR2A 5D78A 3IA0A 4J7FA 2YRVA 1WOOA 2C2ZB 2ZHOA 1MWYA 4J6WA 1N9RA 2NUTA 4NA1A 2FL7A 1F9FA 1IQTA 5HVHA 2JM9A 2K7AA 4IOCQ 1SH0A 3REBB 3PW5A 3OYIA 5CZVA 1U49A 4OMFB 5A0DA 2AW0A 2CJYB 1RAEB 3LWMA 1RAJA 4K50A 1U24A 3OW2R 3QT7A 2IRYA 4LF4F 1XR6A 4Y6IA 2NUTB 3JSCA 1SEMA 4M78B 2QK0A 3G71T 2RI2A 1K9AA 2VFTA 2ZDPA 1YJ9A 3AQPA 4J9BA 1QCNA 2F4VF 1RI9A 1NDLA 3KK3A 1YIJT 4KRTA 5HMYA 1Z1ZA 2A6OA 5HLFB 2R2RA 1O5JA 5LJ3h 3FC9A 4JPBW 1PO6A 2PVGB 1XBWA 3VTIA 3NY0A 2AGQA 3GJSB 2LTOA 4X64F 1NH8A 3JQJA 5CYQA 2RJDA 2VDHA 3RB6A 3DRRA 3KK3B 4K11A 1WG1A 2PEHA 3L7OA 4HH0A 3S3OA 3I82A 4R0JA 5J26A 5HKCA 1IJFB 3SQGB 1BB9A 1SXLA 4OI3A 2LQWA 3BFMA 1NZAA 4EMKC 3MJXA 2I5JB 3DRXA 3TZYA 5IHKA 2DZCA 1NH7A 3DRRB 4C8QB 5HATA 5AE1A 2E29A 3MMBA 2A10A 3SDZA 4Y91A 4G1QA 2D69A 3J81E 2YHTA 3V81A 3ZNUA 1UVNA 2DR8A 5I22A 4UF4A 2KY9A 5KFOA 2IBKA 4DL3A 2HKEA 2KJVA 1RLCL 3ETMA 3CMET 2HS4A 2RS8A 2W01A 1CJUB 4OX9J 1UG1A 5HBMA 1NDKA 4NLWA 4LRDA 1SI9A 2B4VA 3MURP 1CVJA 2IPOB 3CDEA 2EC0A 4KULA 4VUBA 1EETA 1P1LA 1JXOA 1Q5VA 5F8IA 2UVWA 4ZVFA 1N8RT 4C5HA 4MMOA 2YH0A 3HHEA 2BM1A 1K73R 2R4FA 2EKHA 3MCSA 3BSOA 4C0HA 1VQ5T 1A9NB 3M8YA 1WHYA 2C2KB 4X65F 2EPDA 2R7OA 1KJWA 1KC8C 2KZZA 2XWXA 2DFUA 2P9EA 3SWNB 4F17A 1U0HA 4DV5F 4LFAF 1VQ6A 4IUVA 2HGMA 1JJ2S 3BR8A 2YWHA 1RBLA 1KONA 2O9SA 2A37A 2E9ZA 4HT5A 3D0GE 3CIZA 3VS1A 4KE5A 3M32B 2MY8A 2HG4A 1GH8A 1HBOB 2GNCA 1U0HB 3PJXA 1N5YB 3SD4A 3DN9A 1VQLS 3D5MA 1Q82R 2QDLA 2DD8S 3TREA 3VR1A 4QW2A 1D9AA 2I0NA 3FBEA 4F3QA 4K4TA 3WVDB 3OYAA 1CS4B 2XC9A 3L4BC 5AXMA 1QVPA 3DRPB 3RERA 2G0JA 2H54B 2K6DA 2BQ3A 1ZSGA 4NCAA 2CZVC 3OYBA 4B9VA 4HACA 4NCGA 3QSYB 5A8KB 1PC0A 4QIVA 5D6GA 2WVFA 1BXNA 1P27B 1HNZJ 2QO3A 3N5BB 4A4KA 2VG7B 2QTXA 2XS7A 3TJ8A 5J1EA 3CJ2A 1TWBA 4PG8A 4QYRA 1R8BA <