The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
46
|
sequence length |
240
|
structure length |
240
|
Chain Sequence |
LEKKWYALQVEPGKENEAKENLLKVLELEGLKDLVDEVIVPAEEKVVIRAQGKEKYRLSLKGNARDISVLGKKGVTTFRIENGEVKVVESVEGDTCVNAPPISKPGQKITCKENKTEAKIVLDNKIFPGYILIKAHMNDKLLMAIEKTPHVFRPVMVGGKPVPLKEEEVQNILNQIKRGVKPSKVEFEKGDQVRVIEGPFMNFTGTVEEVHPEKRKLTVMISIFGRMTPVELDFDQVEKI
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Crystal structures of transcription factor NusG in light of its nucleic
acid- and protein-binding activities
pubmed doi rcsb |
| molecule keywords |
Transcription antitermination protein nusG
|
| source organism |
Aquifex aeolicus
|
| molecule tags |
Transcription
|
| total genus |
46
|
| structure length |
240
|
| sequence length |
240
|
| chains with identical sequence |
B, C, D
|
| ec nomenclature | |
| pdb deposition date | 2002-06-19 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF00467 | KOW | KOW motif |
| A | PF02357 | NusG | Transcription termination factor nusG |
| A | PF07009 | NusG_II | NusG domain II |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Beta | Roll | SH3 type barrels. | SH3 type barrels. | ||
| Mainly Beta | Sandwich | mini-chromosome maintenance (MCM) complex, domain 2 | N-utilization substance G protein NusG, insert domain | ||
| Alpha Beta | 2-Layer Sandwich | Alpha-Beta Plaits | NusG, N-terminal domain |
