1M1GA

Crystal structure of aquifex aeolicus n-utilization substance g (nusg), space group p2(1)
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
240
structure length
240
Chain Sequence
LEKKWYALQVEPGKENEAKENLLKVLELEGLKDLVDEVIVPAEEKVVIRAQGKEKYRLSLKGNARDISVLGKKGVTTFRIENGEVKVVESVEGDTCVNAPPISKPGQKITCKENKTEAKIVLDNKIFPGYILIKAHMNDKLLMAIEKTPHVFRPVMVGGKPVPLKEEEVQNILNQIKRGVKPSKVEFEKGDQVRVIEGPFMNFTGTVEEVHPEKRKLTVMISIFGRMTPVELDFDQVEKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of transcription factor NusG in light of its nucleic acid- and protein-binding activities
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Transcription
molecule keywords Transcription antitermination protein nusG
total genus 46
structure length 240
sequence length 240
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2002-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00467 KOW KOW motif
A PF02357 NusG Transcription termination factor nusG
A PF07009 NusG_II NusG domain II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1m1gA03
2.60.320.10 Mainly Beta Sandwich mini-chromosome maintenance (MCM) complex, domain 2 N-utilization substance G protein NusG, insert domain 1m1gA02
3.30.70.940 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits NusG, N-terminal domain 1m1gA01
3DB4A 1XTDA 3TREA 1VQ4T 2MI6A 1YI2T 1VQ9A 1W2BA 1Q81U 1Q82C 3A5ZB 1YJNT 1BKBA 3CMET 1KQSA 1VQLA 3DB3A 1VQKT 3CPFA 4CRIA 3I56A 1M1KU 1VQOA 1YJWA 1K73C 3CMAT 1M1GA 1QVFS 1RL2A 3KBGA 1M1KC 4ZN1A 4QQDA 3CC4T 5DM7R 2CKKA 1NPRA 1UEBA 3G4ST 2QEXT 1K9MC 2OTJA 2LCLA 1YBYA 3CCQT 4ZN3A 2QA4A 1VQMA 1K8AU 4RG2A 3ER0A 3CCSA 2MWOA 3CXCA 1YJNA 3PIPA 3CCMA 1M90C 3CCRA 3I55A 2KVQG 1QVGA 3H7HB 3EWGA 1KD1C 3CCEA 3CC2T 2JVVA 2EXUA 3CMAA 1VQOT 3PIOA 2KDSA 1YJWT 1N8RU 1XNIA 3I56T 3LGLA 1W2BS 3CCQA 5J3BA 2QA4T 5IT9E 1M1HA 1VQ8A 1VQ7T 3CD6T 3OW2A 1VQ7A 3OYYA 3CD6A 2E6ZA 3LD7A 3G71A 2OTLA 1M90U 1YHQT 1X6OA 1KHIA 2L3RA 3CCJA 1YHQA 3CPWA 2K06A 1VQLT 3I55T 2XHCA 3CCRT 3G6EA 3CCLT 2E70A 3CCMT 1K73U 1NJIU 1YJ9T 3CC7T 1S72T 1K9MU 3CPWS 1IZ6A 3HKSA 1VQNA 3OW2S 1SSFA 3P8BB 3G71T 1VQPT 1K8AC 1VQ6T 3G6ET 1VQ5A 4YTLA 2JOYA 2MWPA 2LVMA 3CCLA 1VQMT 1VQ8T 5LL6S 3G4SA 3CCJT 5DLQE 5A2QE 5IAYA 2OTJT 3CMEA 1Q86C 1Q86U 4ESNA 1KQSS 4OBIA 2DO3A 2OTLT 3LPEA 3CXCS 2G3RA 2EIFA 1YITT 2LQ8A 5FLXE 1EIFA 3QQCD 1NJIC 3CCUA 3J81E 3CCUT 1Q7YC 1VQPA 3CC2A 3CCET 1Q7YU 2QEXA 3CC4A 5HY6A 2OUGA 1YITA 2JUFA 1JJ2S 2IG0A 4TVRA 1VQ9T 3CCST 1YI2A 1KD1U 1VQ4A 3LGFA 1KC8C 1KC8U 5J26A 2KPPA 1S72A 4X34A 1N8RC 1YJ9A 3J7AF 3CC7A 3CCVT 3CCVA 3JAME 3DLLA 2JNGA 1NZ8A 1QVGS 3LH0A 1YIJT 1YIJA 1VQNT 3J80E 1Q82U 1VQKA 1JJ2A 1Q81C 1QVFA 1NPPA 1VQ5T 1NZ9A 1VQ6A
chains in the Genus database with same CATH superfamily
2C42A 2MIOA 3BFMA 1RWXB 4Y28E 3SCJE 2M88A 4PG7A 2HNZB 5D6GA 3C94A 2L3SA 2A18A 1RQ0A 4HTIA 3ADAC 3CJQA 4XPEA 4J9BA 2QGGA 4PWWA 4H4MB 1RTJA 2RJCA 4Y28C 2XI2A 2WAQD 4ILRA 4TN2A 1AWXA 2EG1A 4DUTA 2DAQA 4LFCJ 1A0OB 4NMLA 2KVQE 3NY0A 4C0DC 1U02A 3R2DJ 2XMWA 4KH1B 1Y0HA 4MH8A 1VBZA 4IUQA 1N0VC 4TQSA 2L3RA 5GAMd 1YKWA 3G96A 3CC7T 3MEUA 3I32A 1NKEA 2B7BB 3IR6B 2RJEA 3NWRA 1O75A 4CH1A 1KHCA 1OS5A 5KH6A 2XY5A 3OJSA 2OTJT 2NXEA 3OV7A 2VFUA 1R27B 4KRTA 2H4YB 2ZFHA 4N8NA 2IIMA 4FYXB 2M4MA 1L3SA 4C0BA 4X4NA 1FX2A 2R9LA 4S0MA 1KD1R 5I3PA 1AYEA 4OB2B 4E2FB 3MCMA 1P9QC 2KL8A 4LF2A 1ZSZA 3X24B 1YI2A 4HI1A 2NUPB 4RR5A 2HVHA 4X1VA 2KH9A 1Z9QA 1HNXJ 3HLUA 5KYUA 1P1LA 4PUOB 2HNIA 2MK5A 4OZ0A 1U1MA 2GHWA 3TREA 2J0XA 3A8GB 4PNOA 2F5KA 1W2BA 3UNGC 2HL5C 4HVWA 3UATA 2E44A 2EFPA 3ZZYA 1ZSGA 4PQUA 4CWBA 4WZQA 1SC6A 3V6DA 5CA5A 2OJ3A 4M5DB 4ED8A 4K4XA 3CCMQ 2RF0A 4QR1A 1AOJA 3M8YA 1S1UA 1Y57A 2RF2A 4G1QA 4J9MA 4CLYA 4LVOP 2LP5A 1VMBA 3LWLA 3MEVA 1RWMB 2Z58B 5GAMg 1EAYC 1LV5A 1M5Q1 4C8QB 4NL2A 3NPFA 1UGQB 2ZH7A 2NYSA 1QW1A 3NCQA 3PRVA 1W4SA 4NEYA 4KHPF 2QA1A 1NLPC 5A76A 1V3ZA 6AT1B 4MZPA 4GKKF 4PKDB 4ZTJA 3JRZA 2F5TX 3MO8A 2DHGA 4CO5A 4X4RA 2I5JB 1QCNA 2NUUG 5KFLA 3SEMA 4NS5A 4AFFA 1FXDA 2KXNB 1KQSR 3X3UA 2V8IA 3ONQA 4M5GA 1QLNA 1XMQF 3PJ9A 4ZLLA 2E10A 2P9GA 3N0VA 2R2UA 1RT6A 3TJ9A 3EGUA 2IAJA 2NUZA 4C11B 3JCMQ 4F26A 1VQ4S 2UU9F 1VISA 3BDEA 1VQ5T 1EX8A 2HIYA 4N77A 4IH7A 2HW3A 1T9XA 2N4DA 1U1TA 3UA6A 5CYQB 3J7YI 4ZKAA 2O4XA 3VAIA 1P8GA 4MYUA 2X4WA 5A0YA 1NSPA 2E1CA 2AJ2A 4U96A 4ZLPA 3MEAA 4MZMA 1G4CA 4F7UA 3VGVA 2BYCA 1U7LA 4OZ3A 3NAIA 4Z2XA 5GANe 4LRAA 1VUBA 3OYDA 4WFYA 1RLCL 1HWUA 4ZCKA 2GVZB 4EZ9A 1OY6A 3HL8A 1FWZA 2HGLA 2JHEA 1BIBA 2FTRA 2YXLA 3H42A 3QZ5B 2QYZA 2BM1A 2XQCA 1YHQT 4FYYB 1JXMA 2Y1JA 1J3TA 3A8JA 3H2UB 5F8LA 1QVFR 1DTTA 2FDNA 2CPHA 1WGSA 1S72Q 2EEYA 3DRRB 1MLAA 3CW2C 2YNFB 2QYCA 1BD6A 1FWPA 3VJPA 4B9XA 5DLQE 1K9MR 3VS5A 3SFUA 2MMPA 1X9SA 5AXMA 2QXFA 2IHR1 3UA7A 4X65F 2V2KA 2V26A 1AROP 4M4ZA 2W7AA 2GJ2A 4F2RA 1UWBA 2ZM6F 3SDEB 2DR7A 1XJWB 3C6UA 2COYA 2HAIA 3CO9A 1HNWJ 1I81A 3N5BA 1P27B 2FLPA 2VQFJ 3HD2A 5BJRA 1Q81C 1WEXA 1MWZA 5KT7A 3HP6A 4HCZA 3VS0A 1NZAA 1K1ZA 2L41A 2V34A 2IA0A 3D2WA 3SQOP 4BI3A 4QU6A 2P8IA 3JB9D 3CDUA 1HQ2A 1REVA 5C0MA 1FJGF 5CKBA 3R9LA 3GIBA 1VK8A 4V1Ak 4ED3A 1TL3B 1HQEA 2R8HA 4DR2F 3JCMf 3M30A 2EWHA 4DZ6A 3ZZRA 1OULA 3BF4A 3I5AA 1VQOT 3WXMB 1KRPA 4RZRA 4OI2A 3OVSA 5J3BA 1S76D 2GVDB 3DHWC 1KSPA 4O3SA 4NZ6A 2YY3A 3F0NA 5JUMA 2JX2A 5T7LA 3VAFA 3AA9A 4L3KA 3DLHA 2DXCA 4KFBB 3V5RA 4DS5A 2EBPA 3R27A 3HSBA 3BS9A 5KFOA 2RAQA 4FS1A 4RNMA 3J81j 2LCWA 4LE9A 4OP0A 4J9EA 2HHXA 1J2VA 4P2XA 2XI9A 2XYPB 2EQKA 4RNOA 3NTIA 1C0MA 3CCST 5A8KA 3CCVA 1GCPA 4CT9A 2J9DE 2EPDA 2W8LA 2I2YA 5GAOl 4CO1A 1AZSB 1RISA 3MEDB 1N48A 2I9SA 3A4TA 2VQFF 3GIMA 2Z2ZA 5LT5A 3V6HA 1S59A 1GCQA 1U5SA 3CC2Q 5HKCA 4X4PA 3L7PA 4H4OB 3AJ1A 4XTUA 4DV4J 2DNHA 2CKKA 2QA4A 2AT1B 5FRMA 2CT3A 2CJBA 3NBPB 5HMZA 1FERA 2PA3A 1I1JA 1BWVA 1ZAXA 1BQMA 2E7WA 1K9MT 3ENVA 4C8QD 5KE2A 1VQPQ 2I8EA 2YLBA 3F56A 3M54A 5EUHA 4IRKA 1Q82T 2MLXA 2RMLA 3FRYA 2C2DA 1UGPB 1RHMB 2DGXA 4NLTA 5RUBA 3KLFA 3DRPA 2SXLA 4WF2A 2RHXA 2DIQA 2B4PA 2RH2A 2BABA 2WONA 2OO4A 1TP7A 1WOPA 4OZLA 3JB9H 2HMIB 1M5VC 3CJKA 2X3GA 1UVMA 5CKHA 4JI0F 2J6SA 3D67A 3A8MB 1FDDA 1ZA1B 4UF4A 3KXDA 2RI5A 2MGZB 2FB0A 1WI6A 1S1WA 1R0BG 4OMNA 2M02A 1AUSL 1T7PA 3E2EA 1RT3B 1U1KA 3JAMY 4NYPA 2O2OA 3FRZA 4RX6A 5K14B 2RJZA 1S0NA 4RCBA 2CZ9A 3EGWB 4J9KA 4ZK7M 4C8OA 2DL7A 2MQOA 4M75G 2VPWB 1VQLA 4NLOA 5KYWB 2DXUA 1VQKT 4EMKA 4O23A 2XCPA 1EARA 4ZLNA 1ZM4A 3GILA 2KRSA 4QQDA 3BGUA 2LCLA 4HCBA 3UVJA 1CKAA 4ZPAA 2DEUA 4WP3A 5KFQA 1HXDA 4HH0A 2HSPA 1NRKA 1U8SA 3OR1B 3KLEB 4OMLA 2YWKA 4UT4A 4B6MA 4ZIWA 4LFBJ 1QTMA 1C4CA 1M27C 1C2PA 3IWNC 4XTWA 1M90U 3TJ8A 2PIIA 2MZSA 3CC7S 4B3RF 1U47A 2FPDA 2BR0A 4PJOG 3PVLA 4KRWA 3OL9A 4XO0A 4HCKA 1U0HB 5FRNA 4A0TA 4IG0A 1DQAA 1UW4A 2DKGA 2M70A 1B99A 2F9DA 1Q0NA 2R8KA 1FK9A 1KLMA 5KG3A 1EP4B 3FLGA 3H41A 1Y07A 2DL3A 5AE3A 2QYGA 1HHSA 3NGKA 5HK4A 4XK8C 2CPIA 2JH3A 1YVFA 4P7VA 3ETMA 1F5CA 2B9XA 2CG8A 2K3KA 1JJ2S 4N4HA 1RT2B 1RUWA 3PTWA 4L76A 2MKCA 1RYSA 3BB5A 3DLLA 2V4RA 1RK8A 4RO0A 4DN0A 1SPBP 4I7FA 5LXRA 4NZ7A 1ZTWA 5KOXA 4C8QF 2CZ0B 2ZDPA 3DOLB 2ENMA 2PNIA 3OTOF 1V5VA 4J37A 4K2XA 2R7XA 3SDEA 1WHYA 5E3QA 2HCKA 1FRIA 1XWLA 2N4CA 5GAGU 2AX1A 3BSOA 4PXBA 3IBFB 3UCZP 3OFEA 2Q3PA 4D3GA 1Y00A 3M8PB 1XNIA 2IC3B 1WEZA 4J9UE 3M2RB 3EGXB 4DSFA 2QLBB 3T9NA 4M77B 3L3CA 3P8HA 3SMZA 2JJ4D 4IO1A 4LJMA 5D0EA 4DF4A 2KRRA 2RDIA 3QFWA 4LD9K 1JJCB 3MUTP 4YQWA 3MMJA 3BEGB 1MSWD 1VCTA 5HK0A 3AD8C 1PSFA 3HSGA 4IRCA 1NLOC 4F4YA 4KUDK 1Z9ZA 2ZBCA 4CLKA 5T14A 3J7ZT 1IBMF 3E01B 2J7WA 4YR2A 2XIDA 3EGVA 4MKBA 1NJXA 2X1BA 3K89A 3EGZA 5EHHA 2E5JA 3KK3A 2ZZTA 3MMBB 1JLEA 2WZ1A 2D8JA 4QWEA 4ECXA 2RQCA 2D3O1 3OSVA 1D0XA 4G6VB 1NZ9A 3UPFA 2CNLB 4WF9Q 2E5QA 1NB7A 2GC8A 1WTBA 5GAN4 5GAN3 4D3HA 3G6XA 4EYHB 2B86A 1OU9A 2PI4A 4YB5A 1Q81T 4DLGA 1QVPA 1S57A 1PAEX 3CEDA 4M7AB 4DV1J 3OYEA 2CJQA 5L9XA 2VUGA 3C14B 4A8MP 5G0RA 1PBAA 3MEDA 1LEOA 1U26A 2H9ZA 1PAUB 2QMXA 4ZPCA 1EIYB 3VAJA 1JO8A 2HQGA 4P7TA 2HHUA 4QQ6A 1IBMJ 2DYAA 3OT9A 1XR7A 5C6SA 3OYGA 4RWWA 1WUUA 3META 2DPIA 4RMOA 1L3VA 4HI2A 1AUDA 1XNRJ 5DDQC 2RILA 2ZVIA 3QWPA 4HYKA 5LSLA 2A08A 4YTLA 2B8AA 3NGPA 1ABOA 1HD1A 2DZ9A 5A0GA 2OTLT 3O44A 2EIFA 4OGCA 4GLKA 4QOTA 1OPIA 1HR0J 1QAXA 5F8JA 2RUGA 4BI4A 1X43A 3Q86A 2UZAA 4ZVTB 1RT1B 3M05A 4EBDA 1D09B 2BKDN 2HZCA 2ASDA 4OI0A 2K57A 2HDAA 2HNZA 2FJEB 2QDLA 3QAEA 3R7NB 2OTJQ 1WIEA 4B9WA 4O0NA 4U8YA 3AHUA 3OS1A 2Z2MA 3L2VA 2BXJA 3K2YA 5CO7A 4WP8A 1MU2B 3AQPA 4FT2A 4C92E 3R5CA 2EW3A 2NUHA 2R5AA 5D4OA 1IBLF 1Q7YR 4XTZA 2P0QA 3G6VA 1H3HA 3FIFA 1WHHA 2DEJA 2XGQA 4LRCA 3CCQQ 2IM3A 1VRTA 5IOLA 2G2ZA 4C92C 3IG1A 3V7SA 3S6EA 1NSAA 1D1AA 3HKSA 3AODA 2H51B 5HQLA 4DBQA 1ZTTA 3P5BP 1RKIA 1HNVA 2KT3A 1NHKL 3QBYA 1FDNA 2XMMA 2QRRA 2V8JA 2UUAJ 3G8SA 1K9AA 3CXCS 3WZ0A 3SFGA 1RA6A 1M5PC 2JLGA 1OYEA 1RADB 3CCET 3FEXB 1WX6A 2EQJA 3ASKA 1GTEA 1YNZA 1OYXA 2G0IA 3UDLA 4ZJQA 2Y1RI 2P0PA 3DOKA 5J26A 3N9UC 2DVIA 2DCLA 2XBPA 2JW4A 5C24A 1V3SA 2X1GA 4JI4F 4J9QA 2VYTA 1S49A 2F2VA 1YJWQ 5KG7A 1QVGP 1F2GA 3V6DB 5GMKj 1WHXA 4P71A 3EFRA 1YBTA 3OD2A 1TL4A 3ZTRA 1TKTB 2RUSA 4NXNJ 4LDYA 2OI2A 1PKTA 2B8PA 2IVFB 2VPYB 3V4MA 1LWEA 3V2UC 4OZNA 4WIQA 4O3PA 3E19A 3HPWA 2NYIA 2JZ2A 2KGTA 3M2VA 4D8KA 1SCJB 2YHTA 5J1PA 3MM5B 4I56A 4XU0A 3M9OB 4C98A 4F17A 1PILA 3QT8A 1VQLT 4WTOB 2MZRA 4NXMJ 4O4RA 1YHQS 2DXFA 3KXTA 1B0VA 1PIEA 3G6ET 2IC3A 2LQBA 4NLWA 3HKZD 2ZBQA 4DV7F 5IM0A 1R8PA 1U6ZA 2X1FA 2M0OA 3W5YA 1FRHA 4HACB 1HBMA 3IM9A 2GCXA 2YKNA 5ITHA 1CJUB 1URNA 4O3RA 2DZCA 1Y9OA 2UV8G 1MNDA 2N7YA 4FXVA 3HRSA 3RBDA 3RAXA 4RL1A 1GFCA 5I11A 3IGNA 1YWXA 1YJ9Q 4J91A 1SKRA 4LFAJ 3R1HA 4C92F 4PEOA 2YLCA 1NNDA 2Z30B 1UG1A 2WTFA 3B54A 2PO4A 1JLQB 3IWXA 4Y2KA 4LDUA 4FDFA 4L6V3 2AZ3A 2B6AA 2V2QA 1TR0A 1BKBA 2DL5A 2YNIA 3S01A 3R6OA 1QAJA 4OZJA 3I5CA 2WSEC 4LF4F 4O3OA 3G4SS 4LBIA 2EWNA 4M95A 3D28A 5FU7B 1F9FA 3RR6A 1PBUA 4HVVA 4CC7A 1GAOA 3A8OB 5M9OA 1PC4A 1J27A 4E6RA 2K2MA 3KWMA 1N52B 4GVBB 2ZE2B 1NH7A 3OBYA 2AP6A 1D0YA 3DMJB 2E6ZA 2AJ4A 5IT9U 2WSEE 2RIJA 2BW7A 4HA8A 1LXJA 1MV0B 3OVAA 4M7AA 4USJC 3OLBA 3V6KA 3GNFB 2DD4A 2K3XA 1HBUA 1VQSA 2EFIA 3K5OA 4Q8EA 3REBB 3TVYA 2MZJA 1SH2A 2LEPA 2DIGA 4ECQA 1ZM2A 3DXBA 4XK8E 3QRQA 5SUHA 2VFTA 3SZ2A 2MCNA 4WFZA 4J5YA 5HBMB 4R8UA 4RTWA 4ESRA 1HNIA 4DBFA 1X5TA 3NGRA 4AL6A 4GRSA 1UECA 2PFFB 1KTVA 3VV0A 2IDEA 3O8WA 1WI7A 2RI2A 3NNHA 2JEJA 5IV4A 5HQ8A 4FP9A 2D0NA 2GS8A 4L6V5 3HHDA 3K58A 3HRTA 3NOGA 3BREA 1WG5A 4C0GA 1HIYA 1VQ9S 1HQEB 1XNRF 1GXLA 3JB9F 1NJIR 5FDLA 2VG7A 3NCPA 3TI0A 1PJ7A 2E5LF 1RU2A 3O2IA 4PJNA 3P6YC 1PCAA 1RP5A 1YZ6A 5ETPA 2DY1A 1K76A 2UVRA 5KYYB 2QDYB 4KUIA 1M1HA 3J7A1 4HT7A 2GIRA 2P0KA 4I1TA 1RHUB 2FJBB 1JRIA 2JTEA 1G5VA 4DR2J 3VAGA 1IKYB 2BANB 1R77A 2BJ3A 4JI2J 1YLXA 1PSDA 5DO2A 4DR7J 1JLBB 1FRJA 1N0UA 3FC3A 1NK9A 1T05B 1I5OB 3T1HF 3V81B 3T5JA 4XTYA 4I2QA 4CLZA 3PMIA 5BR8J 3L42A 1KHVA 4NOYA 3HVTB 2YBVA 2FHDA 3IG1B 3UN2A 2CUYA 2CJAA 4KHMA 1TELA 4RJVA 3NMRA 1T9TA 2CXEA 5L1JA 5IH2A 5KFNA 2JMAA 4NRUA 2FPFA 4DEYA 3CCRS 3CPWP 3MAHA 4B9LA 4I69A 4ZDNA 1HD0A 5KFPA 3A12A 2QFIA 1CVJA 3B6BA 1VQ9A 4M78G 5DG8A 5ETRA 1AWOA 4DN9A 2AX0A 3NGDA 3C95A 2QLJB 2DNLA 3MMAB 3M1VB 1I51B 3TQ1A 4O4GB 2Y4XA 1FFSB 4ZN1A 2W4PA 1FKOA 4AXIA 3B8HA 4DV0J 1CPZA 3JSRA 3ZTOA 4Y92A 3KG1A 3UDCA 1HSQA 4EUVA 3M4YA 1Q78A 4DL7A 4ICLB 3CMAA 3DOMB 3OW2P 2R7TA 2L9NA 3UDVA 2KO1A 3CCJA 4GVLA 3HTRA 1WC6A 1UVLA 2FLLA 4WE1B 1E6GA 1VQLS 4DOWA 1X4HA 4FU6A 3AFGA 2FPEA 3WBZA 3LGNA 4BCAA 1JU5C 1SEMA 1SQGA 3Q2SC 3Q2TC 1QUVA 4CCHA 1M2VB 3F44A 4F4XA 3B4MA 4Y00A 3HZEA 2FY1A 3E2UA 2E1RA 1MNEA 3EVOA 1TKXB 2Z0GA 3CTRA 2RPNA 2HHWA 2UUBJ 1MG7A 1QMCA 1TMJA 3FZ2A 2DK3A 4C8LA 1K0SA 3PHEA 1KC8C 1WF1A 2GMHA 3NP5A 3JCMP 3VYHB 3C46A 2LQJA 1NYGA 1VQNT 3FNNA 8RUCA 4J9LA 3EPGA 4ZVGA 1CC8A 3ZFVA 1R0AB 2AF6A 1PKUA 2XMVA 5DDOC 2O01C 2BZYA 1AEYA 3IRWP 5LL6d 1RLQC 3L2RA 2PC6A 1QUPA 3EHQA 2IY5B 2A2CA 3DC2A 1S97A 3EGDA 2M9KA 1G2BA 1X0PA 4OB3B 2W9AA 3OS5A 2HBZB 4NZ0A 3TQEA 1XNQF 4ES2A 3LP0A 4A8SA 1ZSZB 2OMLA 2HVDA 3BSCA 2G2OA 4UC4A 1X6OA 2MLYA 3CXCR 3TU4K 1D3BA 4DR6J 4BB7A 5GANf 3CCMT 2QL9B 5BR8F 4ZP9A 4YN3B 4C97A 1KFSA 1RZMA 2IMOA 1D9FA 3CCSS 1VQ7S 3KHRA 3W5ZA 1K73T 2L3PA 2CQHA 3CO0P 2DVEA 4B17A 5GMEA 2G3RA 1VK3A 1TG0A 3WIVA 1EHWA 1KVIA 3B82A 3CMQA 1D0ZA 1I07A 4DSJA 3W9JA 2KZMA 3T3FA 4C6AA 2IYGA 2KE9A 4IUVA 4NLVA 2I0NA 1AHJB 3G82B 2AEFA 1YJ9A 1TL1B 3X1LB 2H48B 3K57A 4QQGA 4DMZA 1WD6A 2CWXA 2LX9A 4A8KA 1M9SA 2FC9A 1R3NA 4L59A 2ZNZA 1NHVA 4JJBA 1MN9A 4QIVA 5JVHQ 4LVNP 2E1PA 5KFWA 1B07A 2RI3A 3TVKA 4JZ4A 3K5MA 1RHQB 4A4EA 2MPXC 1SPKA 4DOZA 3T1YJ 3G6EQ 3DGPA 3VRYA 4CO3A 5ADZA 1HBNB 3AB2B 4WCIA 4AL5A 2DJQA 2E5LJ 1ZX6A 2BE2B 3W2WB 1S6OA 4ER8A 3R5GA 1YRUA 1IKXA 2Y8WA 2E5HA 5DZ7A 1SKWA 4YP3A 3M4GA 1L3TA 3BPSP 4GLMA 3MECA 4IQMA 4DSIA 4DV6F 4BE1A 2D3ZA 2DGSA 4W98A 1Z4UA 2E4HA 5EN1A 2V1RA 4F7UG 3T19A 5LXYA 4M77E 3NS7B 4IUUA 4PG4A 1WJ9A 1WHLA 3DLEA 4QW2A 3CIMA 1CULA 3M6WA 4NMXA 1RAEB 2J05A 2UUCJ 2ROTA 3BE3A 4DQSA 1BC6A 1FA0A 1MWQA 4KIAA 3FDSA 4F14A 2W0ZA 4I6AA 4Y2CA 3T6BA 2FZGB 1Y5IB 2HFOA 3EVMA 3E9FA 4CLLA 2GGPB 2EG2A 3NCRA 2KAFA 2OEMA 1NJIT 4FT4A 1NSKL 2PUKB 2LQWA 2HHQA 1PYOB 2XGPA 2F63A 5E3AA 4B3MJ 3DRRA 1U0SA 2ZBPA 5KFJA 4TU8A 3S3OA 2YX1A 4ES1A 1SIZA 1YQHA 4XIUA 1A0NB 4A0UA 4C8ZA 1YP5A 3IO1A 5DZ6A 3RDVA 1YJTA 2X35A 2Z2LA 3W2VA 1H98A 2X4XA 3KNAA 4IIMA 3THTA 3CCEA 2VWFA 3M5AA 3WVDB 2E3HA 1U4BA 2XHWA 1H74A 1FTRA 4F50A 4GY5A 4YR3A 2D8HA 3BKUA 1UJ5A 5KT3A 2GAHC 1NEGA 4PJLA 3H9NA 1KOHA 3IS9B 2YSQA 2B7CB 2YDLA 2W2OP 3RAQA 5A2QU 1YK9A 4OMFB 2RRBA 4YB7A 2FD2A 3N6MA 3DLGB 2HL3A 1WDDA 1RT1A 1APSA 1FI4A 2MKJA 3CDWA 5B0EA 2HZYA 2FG0A 1T94A 3C0CA 3T5HA 2AD9A 1HNWF 4EYIB 5KT4A 3OMGA 3D3BJ 1ZPVA 2Z8QA 2YUQA 3ISNC 1R6YA 2MLZA 3LPYA 4UUWA 1O6XA 3M2UA 4EI2A 1JJ2A 4KC5A 1H8KA 4BE2A 2F65A 5FIIA 1CJVA 3UN3A 2YNGA 4HEA9 3QIPB 1OSDA 5BYSA 1S1VB 2ZHOA 2LEAA 1NAQA 4F3OA 4I4BA 1M0SA 3FMBA 3WIUA 3K17A 3BDPA 2QC3A 5IS2A 2Y3YA 3MM6A 1UPMB 1QDUB 4X4VA 5CZVA 2CP2A 1NK6A 1HMVB 4PJOF 3QJ6A 4BY6B 5HP1A 3AOCA 5HLFB 1JQGA 2IMWP 2HNYB 1YJWT 4DFMA 2MZ1A 5CAIA 5HL7Q 1HYOA 3CD6T 1MWYA 4ANDA 2KJWA 3W9HA 2O67A 2ZJRQ 1UFWA 2VC0A 3ZTPA 2R57A 4KGVB 3FSXA 4PJMA 3TA1A 1OSCA 3L95X 1JMTA 3EZOA 2CH4W 2FJVA 3X20B 2KB2A 2RHSB 3PYGA 1VI7A 4M5LA 3P5TL 4C7QA 1FRMA 3D9BA 1PYTA 2NWMA 3EMTA 3MURP 4RUAA 4L5GA 4DWIA 3L4BC 4PPDA 3OYNA 1VC5A 5GMKh 2IVYA 3FBBA 1D0EA 1UVIA 1IQZA 3SDZA 1H38A 2WSCE 4WXOA 4IDKB 3OTCA 1TKTA 2GO8A 4JI8F 4PWDB 3CCVQ 3KLFB 1C1BA 4B9VA 3EYZA 3JCMc 1M2OA 3G82A 2BDPA 4M5MA 4CRIA 1S6QB 4E0DA 2DYBA 5I21A 3BN4A 1JLFA 4JJCA 4IH5A 4ED0A 4AL7A 1O5JA 1B34B 2CJYB 1KD1C 1U49A 4C92B 3PJWA 5CD4H 4USWA 3G7ZA 5K8OA 2KK4A 4BWJA 4ECSA 3SSSA 2PQWA 2KG0A 3I55S 3G6EA 1S6UA 3OHBA 4KO0B 2QSWA 3RR8A 2F8EX 3OTOJ 3HHLD 1H3ZA 1RYRA 4C2MA 2HQXA 2FHJA 1VQMT 1XC9A 1HARA 2JM8A 2OPSA 2YKNB 5GMKm 2CQ3A 2EKOA 4FPIA 1Q5YA 4FF3A 1YITS 1ZBTA 3UVJB 4C8MA 1X31C 2ZH8A 1MROB 2FUG9 5MLCV 2PEBA 3RRGA 1NK5A 3PGGA 1K44A 1NUEA 2HBYB 3KLEA 1M90T 2CQ2A 1YJNS 2JFKA 2IRUA 3UN5A 1VR6A 4DPUA 2BQRA 1FEEA 2C2NA 3OPKA 4X4TA 1BUXA 1HL6A 5D0HA 2C3OA 2XICA 4DF8A 3ZO7A 5M2UA 3EG9A 2VZ9A 3BPDA 4PUOA 1LQ9A 3UW1A 4X65J 2DXEA 1KS2A 1YJNT 4USVA 4WK1A 1TS9A 1VLOA 3A13A 1PYSB 1PG5B 2VA2A 2PDAA 4N76A 1T11A 2AZ1A 3PR4A 3PIPA 3I6PA 4M7AE 1NCLA 2AJFE 2V9WA 2LTOA 4X66J 2RF2B 1ZLMA 4G1QB 5CXTA 4IO9Q 1S7HA 2L3QA 2G0JA 4PR6A 1TKZA 3SCKE 3GIRA 2NUTB 5DQIA 4OJGA 4OYZA 2EW9A 1M8VA 3DLKA 3CD6S 2DHAA 5HBMA 5GANj 3MR5A 2QASA 2W4CA 3SB2A 3DYAB 1AW0A 3L09A 2CDQA 3H8ZA 3VZIA 3RG6A 1XMOF 5KFFA 2VFSA 2J8SA 3RAMA 5DQGA 1U1LA 1JJ2P 1NK0A 4LREA 1DLOB 4MDWA 1R6VA 3MEGB 4K5RA 1CSJA 4TYAA 3VGUA 1FMVA 3HHLC 1SL0A 2WVDA 2F1FA 4ZIVA 2FY8A 1HPZA 1VJWA 1RTIA 1U25A 1GXTA 1EX4A 2EYYA 2ZUGA 3O3LA 4NCGA 4I0WA 3KG4A 5LSOA 4JUZA 3OYCA 2EVZA 2C3MA 5KFXA 1XMQJ 1YI2T 2QJ3A 2V63A 4NLRA 2KRMA 4ED5A 4C8QG 4OYWA 3DB3A 3BN7A 3AD7C 1M1KU 2W7PA 4XPCA 2LDMA 2CADA 2DRMA 1WACA 1K9MC 2K2VA 3MAQA 4AT1B 2J6UA 1SJFA 2B9YA 3CCEQ 1RT4A 4YOEA 3QYYA 1JB0E 1PWTA 3MPVA 2EFGA 2AGPA 1U1NA 2X7IA 3EXCX 3G6ES 3C6TA 1JJHA 3IAM9 1UFFA 5HROB 1VQ7A 3BQ2A 1TWBA 3JCMe 3NHNA 2GQQA 1XQIA 4XDCA 1TMMA 2V9KA 1NK8A 3KLGA 1S0MA 1IJFB 4DFPA 7FDRA 3KLHB 4KJIA 4JDSA 2EJ9A 2VQEJ 1Q81R 2A1BA 3CJ5A 3IBWA 3PKMA 1RT7A 3HVTA 3PO4A 3VUZA 5A0LA 1R7IA 3ENQA 3KFVA 2RM4A 1DZ5A 4K2JA 3VZHA 4IR1A 4AFSC 2FRWA 2AJQA 2WB1D 5KT6A 3T5KA 1QAYA 3BBBA 3EFSA 3JTOA 2UUBF 4DR4J 4OHZA 4LF7J 3M8QB 3QIDA 2DGWA 3WDOA 2HAFA 1WPYA 2WBRA 3K5NA 2CZ1B 5GAEU 2CJKA 2QK0A 2ADCA 1S1XB 3CD7A 3KMSA 4X9DA 2LQNA 3DB4A 3CDEA 3J81U 1YIJS 3KHHA 3QDFA 4KKOB 1YRXA 2CDRB 2RKIA 3KK2B 3P8DA 4DUZF 4ZPVR 2YQ2A 1T9VA 3TR5A 2R3VA 4CTAB 4GMKA 3OHAA 4IUTA 2VC1A 1C4AA 3SV3A 5CCMA 1KONA 2F69A 2VICA 2HEKA 2DGUA 2ZZDA 3W60A 3GZ7A 3RJMB 3D0HE 4RNNA 1C1BB 4DX6A 1KOOA 5HJYA 1VDHA 1KC8T 4NCAA 3VQTA 5LJ3d 2DNUA 1NB2A 4DUYJ 1BI1A 1HJDA 3DI6A 1FCAA 2DL8A 4EBEA 1TL5A 2MQQA 3C4SA 4J9VA 2ZJQQ 2J9DA 4U7UD 1T8EA 1Q86C 1YJ7A 2RQKA 3MR3A 4OB1B 4WXWA 4FIBA 2NYHA 1F9HA 3BBCA 4E7ZA 1OY9A 4WKRA 1X6BA 2NCKL 2ZPGB 4Z89A 3CC7A 3MOJB 2CREA 1QP3A 3S1TA 1HBOA 4A8FA 2EYWA 3H20A 1S99A 3GIJA 1TL7B 2ROGA 3CIZA 2B5JA 2H5IB 4IR9A 5KFEA 3EHRA 1AZSA 1U1SA 4C92D 3GU0A 4Z02A 3D0GE 1H7WA 1QVFS 1ROFA 3KKFA 5JXSA 1Q8LA 3BGRB 4EEYA 3V8JA 1CEZA 1DTQB 3I9V9 4LSNB 4F25A 3PEHA 4DV4F 2HAXA 3IC1A 3QKJA 1E6VB 1UZHA 2P2CB 3HHLB 3NL0A 2DNOA 4X62F 4ZS6A 5I42A 1OX8A 5FU6C 3AXKA 5IC6B 4OX7A 1UEKA 4EO8A 2HIQA 5J2MB 2HWHA 2KY9A 1PC0A 4OV6A 5A8RB 4W90B 4QQBA 4ELVA 3W8PA 2YXYA 1OX9A 1Y7PA 3ME9A 3HT3A 4DUYF 3A3PB 2KJVA 2D9TA 5KYNA 2F9JA 1I94F 1E7OA 2A28A 3FDRA 4EMGA 3FEYB 1AB8A 1NJIC 3SQGB 2ECZA 3FGVA 2AU0A 3OFGA 1P6TA 2ED1A 3UO0A 5IN1A 4M75F 3DU6A 2HFUA 2QX0A 3D6HB 5HVGA 4ZHRB 3O8VA 2L3MA 5A8WA 3T6JA 2BUNA 3HK2A 1SL2A 2HBRB 1VQ5S 2XS7A 2OLWA 3RBBB 1BWEA 3RTVA 4YY3J 2YKQA 1W7WA 2WCXA 3PZPA 5DLFA 4B3TF 4AG1C 4LN2A 3G87A 4A4JA 3RNJA 3POTB 4UY85 1UWAA 2HQDA 3THVA 1S48A 1ICEB 3FBCA 8AT1B 4ZOSA 1MMNA 1S4FA 2OTJA 3HRUA 1H73A 5BYRA 3I0RB 2COLA 4DBHA 3MECB 3R5DA 2FQQB 3SEOA 3ZNUA 3GV7B 4BDPA 3HSZA 4F02A 4LMZA 3BR9A 2NZCA 5KYXA 1DBDA 2IJRA 4F3MA 2CT4A 1FESA 2GW8A 4RTYA 2DJWA 4A4GA 2V0NA 4WBFA 5GAMe 2FYKA 4FBUA 1FXXA 1FRLA 4K4YA 2CH4A 4Z8AA 2FHKA 1W2BP 1OPKA 1NKBA 3CCLA 1JKHA 3C6TB 4H54A 3AY0A 3PW0A 1BMQB 3EX7B 4E7HA 3EUNA 2C2EA 1S10A 2OHDA 4J83A 3KLGB 1N54B 2D41A 3PKYA 1KLMB 2E64A 4M7AG 2GGPA 2DGOA 1WOOA 2UUCF 2AGQA 2MYSA 1QSSA 2JLFA 2LP4A 2AWZA 2B0GA 4ZVFA 2DL4A 1YITQ 2AJ1A 3MAAA 2IA6A 1RHRB 1RACB 2HRYA 1BBZA 2POKA 3QO9A 3X25B 3CJ2A 1UPPA 2RQWA 4C0HA 2W1BA 3I0SB 5EC7A 4USIA 2H3JA 1HBUB 3PX0A 3GPAA 4K0KF 4BBYA 4IOCQ 4WFAQ 4OF1A 1UFKA 4NL3A 2X9HA 3SXLA 4J90A 4JI0J 4J8OA 1RL2A 1RHKB 4LR8A 1EFNA 2WACA 1MMGA 4LDWA 2QTXA 1VQKQ 4OYMA 2W7OA 2J6TA 3I55A 4HT8A 1QAIA 1XERA 3MCAB 2BZ2A 3RW7A 2XTJP 2D1XA 2HSEB 4JI7J 5CCLA 1P1TA 2XMKA 3WC2A 4M77A 3M53A 3LOUA 2ROEA 1URRA 2G6FX 2YUNA 4CC3A 2KN4A 1NK4A 1VQPT 1WHVA 2XMAA 4LUBA 5CVIA 3DN9A 2DM1A 4ECYA 4KTQA 2CA9A 2VG5A 4TU7A 3DLLQ 3WC0A 3U23A 2ZH2A 4WJBA 1GTHA 2BX6A 2XLIA 4C9DA 4XTXA 2MZTA 2P6TA 3GFYA 4KV8A 4ECWA 4AUKA 5KYUB 3BJYA 1FVQA 1R43A 2UXBF 2P5VA 3GOXA 4E7JA 5L8RE 1SG5A 5GMDA 3PNWC 4DR1J 1RTHB 2YH1A 2IM1A 1VQLQ 5FJ4A 2R7VA 4M1KA 4R55A 3GIIA 3ENAA 3OJUA 4CYUA 1ZYQA 4MIBA 3FFIA 4OYIA 2A3LA 4X9CA 5E2QA 3UFCX 4UZBA 1S1UB 1SH0A 3OSSC 5HMWA 3M32A 1AVZC 4YR0A 2BOAA 3PIPQ 3X28B 3UI3A 2KQWA 2WK4A 3KMQA 5EX0A 4FKYA 1Q5VA 2VOOA 1B0TA 1VQ6S 2R42A 3RESA 4JS4A 1S6PA 3PO5A 2HK2A 2DFUA 4P74A 4URQU 1SHFA 1JLAA 4JJDA 1IR2A 5B0CA 5C5JA 2HEQA 1G3OA 4QJVA 3TA2A 1RGVA 3HVWA 1OJ4A 4P2SA 4IFYB 4U7UK 3PACA 2KFNA 2PN6A 2E9ZA 1GK8A 3FJPA 2HQCA 2KI2A 4ORZA 4YS2A 2WW4A 2YX4A 3AHPA 2ZDOA 1NBEB 1NDKA 1R8BA 2FHOB 4M78D 3QQCD 1NDPA 4R0JA 2Q6CA 1SJ1A 3LGMA 4L74A 4B3OA 1NEBA 4XDDA 1HHTP 4C5IA 2YKMA 3PVQA 2VF3A 1G6BA 5KOWA 5GJWB 2COZA 5GADU 1U8WA 2RRNA 1BGXT 1CG2A 2OH2A 5CQGA 3TAQA 3R5BA 3A8EA 5A0YB 2LFVA 5FD1A 1FJGJ 4ZP6A 2VASA 3HFKA 4A54A 3L1AA 4C8QC 1GQEA 4F3QA 2DTHA 2F8MA 3S8SA 5GVQA 5DG9A 4JI6F 2J8AA 3IR7B 4F0MA 2P6SA 1MU2A 5J2QA 1WOSA 2J7UA 2M16A 1O51A 2ZPFB 1N5QA 4TY8B 2EYZA 3QGPA 1X01A 1X6GA 2W2QP 1ZSZC 2KM8B 3OW2A 3BBFA 1YJUA 3NTKA 1MV3A 2QSFA 2W8KA 3VVUA 2R5MA 1BLUA 4FZVA 5L38A 5LJ3Y 2YPYA 2V67A 2QQBA 1B3TA 1RWVB 2ABYA 5LJ3g 3PMTA 3QT6A 2QN6B 4OMMA 5IXBA 3QZ7A 2WW8A 3M7VA 3INZA 5GAN8 2KG1A 1SKUB 2GAGC 3Q24A 1JBMA 1T3SA 3IRXA 3MFHA 2DH9A 3FC9A 3L7OA 4NYZA 1EETB 4ZPWR 1QSLA 1C0UB 1G1XA 1T02A 2E1MC 3CJ4A 3BSAA 3QSIA 1VS3A 2UXCF 3I87A 1IGUA 4WK3A 3ZZTA 2FO0A 2OX7A 2XG8A 2OPPB 1AA1B 2WOMB 4U7CA 5KFKA 2Z56B 2VGMA 3K8VA 4C5EA 1FMKA 2DE0X 3BKFA 3CJ3A 3QO9B 1RT5A 2IM2A 1EQMA 5KFIA 3GYNA 4C0ZA 3CF5Q 3PXGa 3VWSA 3FJ2A 3QG1A 2HS3A 1S12A 1S9GB 4MKVA 2ZWOA 4PQAA 1CLFA 1TKZB 4N4IA 3RIRA 3H59A 4B3SJ 5T7LB 3CSKA 1RJJA 2OPQA 5GAMh 4DPTA 2A10A 2B56A 2JDJA 2ACYA 2RQRA 3BYRA 1KD1T 2EGEA 3G6YA 2Q43A 4F7UE 1NJWA 2JOYA 5K9FA 2CQGA 5CR2A 4OHXA 5I2SA 3DDKA 4PZVA 4XU3A 3CJ0A 5FLXE 5E3CA 3J81E 1SJ4P 3JTPA 3M0PA 3O6QA 3IN5A 3KUEA 5HY6A 3NGUA 5AYFA 3ILIA 2C0IA 1ZBXA 4Z7CA 4IRDA 4YUDA 4ANEA 2ALYB 3NGSA 1RBLA 4DL4A 1PO6A 4WFNQ 4PL6A 2YQ1A 3HZGA 1E6YA 2ATCB 1WQWA 4E47A 3I82A 4FW1A 3BO4A 3UD5A 1SB6A 1CULB 3K0JA 4LXCA 4ZA1A 2BV3A 4BC7A 4JI1F 4XTVA 4XAKA 2B6AB 1ACMB 4IKFA 3CJ8A 5CIUA 4ELZC 1ZHIA 1O8BA 3MD3A 3MP8A 1N5YA 1OZ2A 2V4QA 3DFEA 4QIEA 2JL9A 5GADI 4DR1F 1ZM9A 1X4DA 2QZ8A 1RKJA 2CYYA 3HF5A 1PCXA 4FSXA 4HR2A 2KT8A 1RHJB 4FCYA 2QE5A 3KTQA 4CLFA 3IFEA 4OYOA 4X2BA 1IXDA 3FJ5A 2Q6BA 4HTJA 1WHKA 3NRBA 2EAYA 4O0IA 1MW7A 4RWXA 2BJEA 4J9SA 2ZH1A 2XDPA 4J7CA 5ETMA 3W63A 1H6KX 4C8NA 3RR7A 4J6XA 5GMKe 1B7TA 2XZTB 1U06A 3LP1A 4LF9F 4JLIA 2CFXA 3FVYA 3FZBA 5GAOn 2ZWPA 1YIJT 2O3DA 1N6QA 5HAOA 1MHNA 1UVJA 1VQNS 4MT1A 4U8VA 3J80Y 1NYFA 5KYWA 4Q8FA 1Q81U 3W1YC 2HHTA 5EG2A 2QAZA 3A5ZB 2BUDA 4WCEQ 1B4SA 1PNJA 2IVMA 4IIOA 5CD4A 2RHYA 2KI7A 4F4AA 3TARA 2PI5A 1FT8A 2DTIA 1WG1A 3OR1A 4Q5WA 3TUPA 1RUSA 1LWFB 3ICLA 1HKAA 3M6UA 2YUPA 3S6WA 2DY9A 3MXHP 5GAN2 3MI7X 2JVVA 1VA7A 2XMUA 3AJ2A 3G9CA 3JSCA 5B7WA 1HQUA 1OQ3A 2NUPA 5KCHA 1M1KT 3M56A 2AJ0A 2JMCA 5E7OB 2Z57B 4NCBA 4Y2MA 4ETXA 2R7WA 3M0SA 1K73U 1JLCA 2CJXB 3TJAA 1Q1KA 2CGHA 1M5SA 2DBKA 3LW5E 1M5OC 5J1EB 4OJHA 5DY9A 1VQ6T 1FNXH 1PC5A 3MDFA 3MCSA 2BE9B 4TLRA 2OELA 1Z1ZA 2R8IA 3CMEA 2DEIA 4UUXA 2VVKA 1YGYA 2DR5A 2WVCA 1SH3A 2CNOB 4J9GA 2C2OB 2RVJA 4PFOA 3LW5C 4KR0B 2I6WA 1YITA 2FVQA 1ZA2B 1FF2A 1SKSA 7AT1B 1IHWA 4TYBA 2MQPA 4KB7A 3LWHA 1VHFA 2SEMA 4LF5J 4I6WA 1YJ9S 2XI3A 3DOLA 3OXFA 3JXOA 3OS0A 2QIFA 1QKXA 2W10A 3PJXA 1LXNA 3IXQA 4WP9A 2ZGWA 2RDDA 5DQHA 2VH7A 1I94J 1KK7A 1KHWA 4OB0B 5J39A 1HWKA 3TUJC 1VBYA 2J6FA 4LSNA 1A7GE 3D6TB 2I5JA 1UZDA 3M6XA 2QEXT 2ZCFB 1XMOJ 2ZKUA 3QZ8A 3BO2A 2GCFA 3CC2T 2OAWA 1RTDB 4FSSA 5KFHA 3IGVA 2IAJB 4C11A 1KC8R 3TRGA 2AHJB 3DOMA 3VKIA 2DB1A 3D54A 4ERDA 2OFGX 4R25A 1F6TA 4CC4B 2IJFA 1TH7A 3D68A 4ID5B 2LDIA 5GANg 1JXOA 3P49B 2HFZA 2XSFA 1DQ9A 3EICA 1WHGA 1GMVA 5C25A 2LKZA 4KYZA 5DDPC 1YBUA 4DL2A 4ES3A 5LJ3e 4ZHRA 2P9EA 2XG8D 3FB9A 3ZNJ1 3PVXA 1TQLA 4X66F 2YNFA 2GNKA 4M63A 3NLCA 5CKDA 2RJFA 3GBQA 1OI1A 3UDEA 3KNGA 3POTA 2RT3A 3PNIA 3CBMA 1X60A 3RUXA 4LNPA 2V94A 1LWXA 2AKLA 2ZOGA 1M4ZA 2OPSB 3C14A 1U24A 1WA7A 3FCVA 2ZVSA 2JJ9A 1NPRA 3HJVA 2IFXA 3EGDB 3KJVA 1MROA 2QQAA 1OV3A 2ZOFA 1T3OA 1XNQJ 2K1RB 3IAS9 4HHUA 4KQZA 4PABA 2Y90A 3LP0B 1KNZA 2J06A 1VYTA 4ZVQB 5GANd 3CCLT 5ETOA 5IT4A 4M5NA 1I8FA 2VU5A 1F1BB 1R31A 2DPPB 3ISZA 4RNHA 2UVUA 4PJJA 3P8BB 2K6DA 1N5YB 3SCLE 1VIFA 4P6QA 2EQMA 3D0IE 3WX8A 1KBRA 5GAHI 1N27A 3CCJT 2PUOB 4JRPA 5ETVA 4NWBA 2L2PA 2F3JA 3T9ZA 3HI9A 4IFVB 5A2QY 4DZDA 5HN0A 5C7PA 2YTCA 1UKUA 3G71S 1KD1U 2VOPA 5KTQA 1NSQA 2JVOA 2LECA 3KJFB 3FSYA 4NLUA 2KYMA 1N32F 1RCOB 3HHTB 3ITHA 3QLHB 2VONA 3M6VA 5GAN5 4AXJA 2GX8A 1RTZA 2ZBIA 5IWAF 2X3WD 4J6WA 5LJ3j 1TL1A 2W4DA 4N41A 2W2NP 1G83A 4RTUA 4E8UA 4DV0F 3PW4A 1JQQA 4Z37A 1FE0A 1VC6A 1CJKB 2MKYA 2AHOB 2ZKTA 4FW2A 3CCLQ 2VQEF 2VBWA 1SVDA 4YHHJ 3G86A 3Q22A 3ZBDA 1U3OA 2E9RX 2D9OA 4ZMMA 3MCOA 3CCRA 3JTNA 2QFJA 3PE0A 3IP0A 1XIQA 2GBQA 4ILLA 3A1YG 2C3YA 3D5MA 3U7JA 4KT0C 4EDUA 2R58A 1UCNA 2JNJA 3OYBA 3N6NA 4M5KA 1N5SA 3EDQB 2E1HA 2XZWA 4DR4F 3BGFA 3VCDA 3HX9A 3DDIA 1S72T 1WDXA 2DHXA 1VYVA 3SIPB 2DNRA 2N3OA 3PIOQ 4K11A 2CNNB 3W61A 1Q95G 4LSZB 3E1SA 2ZOMA 4LSLA 4NLSA 4BWMA 5A2QE 3FQLA 4KV8B 2AZVA 3SSQA 4P2FA 1SSHA 3G8QA 3W64A 4GKJJ 4EIKA 1X5PA 1WKLA 4V19X 2HLTA 2JUFA 5IZHA 2LC4A 2W9CB 4LDXA 5J1EA 3HT0A 3JQKA 1B7FA 3SSRA 1SJ3P 2DVJA 3BM7A 1BI0A 4LR7A 4IOBA 4PG5A 2KFYA 2HQ3A 1WLPB 1JXLA 2BQ3A 2CPYA 2HMIA 3SBMA 1VQ4T 2DIUA 1TKDA 1PJ6A 3I56S 2XDBA 3NG8A 2DTJA 1WXBA 3LAMA 3W3SA 3FEZA 2EK1A 2GFUA 4DV7J 2M51A 4NLQA 3CPFA 2DXBA 5KFCA 5LSRA 4JI7F 4QPXA 4LDVA 4JI6J 2JS2A 3NFCA 2F2WA 1FNMA 3CJKB 4JBCA 4FYWB 5H9FJ 3D6MB 1D1BA 4CNYA 4X64J 3VF0B 2HHPA 2HG4A 2MQ8A 1VQ8A 1S1WB 3OY9A 1KJWA 4M77D 4YDDB 4LQ3A 4RBUA 2DXDA 3PX4A 2QA2A 3HDSA 4JUVA 1CJTA 1Q8IA 3ILLA 4IFYA 2KMTA 4DLEA 5KG0A 1FYNA 5I2MA 1G3TA 1FRKA 4KKOA 4DR3F 4KPYA 1JXEA 2ZZNA 1BY9A 1Z2LA 2IRYA 1RTDA 1K8AC 2DJZA 2BACA 2O31A 2BRLA 2DO3A 1RAOA 1LK7A 2X51A 3SCIE 2JRSA 2CQ4A 5E3PA 5IT0A 5L9NA 2A7YA 4A48A 4CNZA 1Z2ZA 3KLIA 4ID5A 2P4RA 3ZZPA 3LGFA 3DM2B 3HFOA 3CBOA 1S1TB 2EQUA 2XMJA 4PJOC 3QWYA 4RW6B 3LH5A 1KSWA 4BACA 3JYTA 3MCNA 1VBKA 4DQIA 1BYMA 4B02A 1K8AT 3GYXB 4F4KA 4UY8T 3HCXA 1R89A 5KFUA 1KVJA 4NI2B 1DJ0A 5E41A 3QUIA 4URGA 3ETOA 1RXOB 2A36A 1TZ0A 3UWTA 2AKKA 4NYOA 4GVBA 2HGNA 4NLYA 3GFXA 3CMAS 2MWOA 3ENWA 1YJNA 1F3VA 3SWNC 1WG4A 4A4KA 3V8KA 1VIOA 1RT2A 3GYGA 3KOAA 3H2VE 1BHNA 2HVZA 3T1AA 2XYGB 2BIVA 2MTLA 3CPWA 2FZCB 2VKRA 4J9RA 3C16B 1N34J 2XM3A 5B0BA 1RWKB 1WI8A 2D3UA 4RTXA 3PW2A 3HSJA 4FVMA 3M2RA 2VG6B 3JCMV 1ZH5A 2DF6A 3MKDA 4CO4A 2KNBB 4X4UA 2VJVA 2MKHA 2MKSA 1GFWB 3KG0A 3EAEA 2FVPA 1IR0A 1SBRA 3CMAQ 3LO3A 2JZ5A 4G1IA 2VXFA 4QIFA 2LXFA 5GJVB 1FKAF 4XU2A 1N33J 3MTJA 1ZM3A 3OS2A 1X2QA 2V8KA 4L75A 3REAB 5CYQA 2RS8A 4C0FA 3BYPA 4JB8B 4KBIA 3KDNA 2VXEA 2BJDA 2B8QA 4P2MA 2LMIA 2VFRA 4K4UA 1VGYA 3CMET 3RB4A 4QWCA 1NH8A 4JP8A 3K5LA 1K73C 3E01A 1KQKA 5EWEA 1S9GA 4UTGA 3OL8A 3EG1A 2X3XD 1TVRA 1IKWB 3W5XA 2X4JA 2LT4A 4RUCA 2BTTA 2UUTA 3I5SA 2OPQB 1ITPA 1WSVA 3W66A 1JLEB 4N56A 2GA7A 5LJ5d 4K4SA 4JV2A 2DXTA 4JV5J 1SV5B 3VYGA 2LJ3A 3CCRT 3P96A 1KFDA 2N82B 1CQMA 2Y1IA 3CULA 2VDHA 1FWKA 1KN6A 5F0UA 4EFAC 1VQ5A 2LVMA 4C5GA 2FIUA 2EVRA 1JNZB 1M1KR 2PD1A 1B3QA 3JS9A 4O3NA 2CPFA 4JI1J 4B9SA 3C66A 4ECTA 2L89A 1HFEL 3F70A 5FW9A 1OU8A 1M90R 1WHJA 2VGNA 3CCUA 4J9CA 4OHWA 2R2RA 3LALA 1MN7A 3CC2A 5LJ5Y 1KR4A 3IBCB 4FS2A 5IT9Y 1QJHA 4OI1A 1IGQA 4DV1F 4B9NA 2ZH4A 1QVGR 3RBEA 2V8VA 2AIRB 3CT9A 5HK3A 3I9QA 4IKAA 3EPIA 5CYJA 2NXUA 1IBLJ 5D6XA 5JVGQ 2GFAA 3HULA 2PTKA 1NJYA 4FL6A 3EG9B 3O1LA 2FB7A 1TV6B 1VQMQ 1RWWB 2KT1A 1X4BA 1SQEA 1RB0A 2VV5A 1FXRA 1N6AA 1REVB 2QMWA 3LYIA 4HCCA 4OFZA 1FDBA 1SRLA 2YWGA 2N3LA 1AD5A 3OSNA 1P9YA 4MFBA 2ILYA 1QWFA 3IR5B 5DLGA 2EYXA 2OD4A 2K06A 4IOAQ 2KVIA 1XTZA 2CPJA 3HM9A 1M2VA 4OHVA 2VJUA 4LF8F 3LP2A 5KG1A 3HO1A 3VS4A 1N33F 1TKXA 3JCMW 2G13A 2DISA 5CZXA 3C3LA 1FDAA 3CCUS 3M0TA 2JFDA 3CCWA 2NXNA 1VRTB 1OQ6A 4K5SA 2Y8YA 4O5VA 1T03A 4DCPB 4ED2A 3KLVA 4JOUA 2CG4A 3KHGA 2GO9A 4NA1A 4HH1A 1S72A 1DLOA 3MEGA 1WJRA 2NSBA 1WF2A 4L3NA 2ZC4A 4OVAA 2KYBA 2KRBA 1JIHA 1VQ4Q 5K8PA 2XB2D 3GSIA 4WYWA 1Q82C 4ZP7A 3QGHA 3EG0A 3OW2R 1QLYA 2EGAA 1UEUA 1WKJA 2ZD1B 1XN9A 4IG3B 4PYDA 4RW6A 2QL7B 3UR3C 3D66A 2BKOA 1VQ8Q 1BE4A 1ZS6A 4NI2A 1IHVA 2D6FA 3NBPA 1U1PA 4A46A 3M58A 1RI9A 4M7DB 3N28A 3N79A 3MR6A 3I55Q 1XR6A 2CPEA 3CPWS 3MM8B 1U1OA 4F16A 4A8OA 3CQTA 4ZPDA 4DPXA 3FFIB 2Y0SD 1YJWS 2QV6A 1GCQC 3U27A 2BJ8A 1YITT 4H4MA 1LWEB 2CRLA 4MKAA 4OYAA 2BMBA 1HI8A 4MMKA 2VUBA 1PJ5A 4FYVB 3EG3A 3VGSA 2RMOA 1CKBA 1NLKL 1QM9A 2VG6A 3TZYA 4CT8A 4BY6C 3A8LB 1UDLA 3TAPA 4DSEA 1VQ6A 2KEAA 2W9BB 3GPLA 1RTJB 2AMCB 1U09A 1YN8A 4EMKB 1RT3A 1CJUA 2O9SA 4M78C 2RB7A 1U6BA 1S1XA 1R8AA 2YQ0A 1VLYA 5K14A 4QU7A 4JI4J 4OMQA 4PJOD 4LF5F 2CQIA 1VQ7Q 1FRXA 1TAUA 2I2LA 4DX8H 5DM7R 1Q86R 2PFDA 1K0VA 4CTAA 2MJNA 4NX9A 4B3OB 2MQNA 1JLQA 3RMSA 2FYXA 4M94A 1RAIB 4M78E 4IUFA 1OMSA 1REGX 3GV8B 2KKHA 1LNQA 3RBXA 2EI5A 2RSQA 3TA0A 5EWFA 3BY7A 5KFZA 1LVKA 1LJOA 2BBEA 1X4CA 2MZQA 3U1MA 4J7FA 3TWZA 5DM7Q 1TVRB 3VS3A 1LFWA 4FYDA 1FK9B 3S3NA 5IFMA 1RCXB 2E65A 3OL6A 4NEZA 2UXDF 1Y10A 2XC9A 4UW2A 1T95A 3R6LB 1OEBA 4M78A 2ZE2A 9ATCB 4ZVUB 3TZWA 4CM2A 4IG0B 3H5SA 3AOBA 2N7CA 3TEGA 1N8RT 1SV5A 3SWNA 1SC3B 1LPLA 4MK8A 3RERA 3M4XA 2E7XA 2M0GB 3OYIA 4PJOE 1VQPA 3C8YA 1WC5A 2MSTA 1VYUA 2XULA 3OTEA 5F41A 4DA4A 1BU1A 1LWCB 3NNAA 2H1YA 4E7LA 2R8JA 4BDZA 3JAME 1DARA 3N5FA 3PYDA 3CPWR 2FHMA 2SRCA 3BGOP 3OR2B 4JLGA 2BZ8A 1ZPWX 2MHEA 3TCJA 3AAWB 2GIFA 1A6LA 1HBOB 2IIHA 4Q45A 3QXEB 2CPZA 2C0OA 1F0XA 2YKOA 3VUBA 4BHQA 1SQFA 2RQVA 2DTOA 2W2PP 5HVHA 4F04B 2K1RA 3CDAA 1BQNA 4YMEA 2B4VA 1OOTA 2XKOC 2EJFA 4ZJOA 2KVQG 4F36A 3JCMh 4LFCF 3R8YA 3LD7A 1H92A 3EZ5A 2ZH9A 2YUOA 1WJSA 3QPHA 5LJ5h 2E1AA 4MAKA 4EGLA 3M55A 1Y0MA 4YB6A 4DDFA 2RB6A 3A3OB 1RU1A 3RMQA 4DV3F 5L8RC 2ZH3A 1M3CA 3KK3B 3DHXA 1M30A 4XAXB 1C1CA 5L1LA 1GXUA 5KFRA 3OSPA 1AT1B 3WHIA 5KYYA 1T05A 3MEWA 1YI2Q 2XO6A 3MHYA 3QHSA 5M2RA 3GJRB 1AZEA 3QBCA 1X0FA 4BDYA 1BI3A 4PLIA 4Y91A 4OMOA 1GFDA 4NL5A 9RUBA 2YH0A 3AA8A 4A8WA 1CJVB 2XWYA 1JJ4A 2W01A 3Q83A 2XNRA 3QIPA 3K8WA 2XD0A 3MMBA 1FHTA 2GHPA 1VHIA 3R2CJ 1JLBA 4UOHA 2M0YA 2JLEA 2QQRA 1QE1B 3A8IA 3HHNB 4F8RA 1A9NB 2EFOA 2AYEA 3TZXA 1JX4A 1BXNA 4I2QB 3GCWP 4ECRA 3D4JA 3GB0A 1YX2A 5HI7A 1KVKA 2J7IA 5HLFA 1OQKA 2C3PA 2ZM6J 2IM0A 1K8AU 2DK2A 3ZXWA 2LQ9A 1KQ2A 3ER0A 3WX4A 4ED1A 4F2SA 2ZZMA 3I35A 2JT4A 5DJBA 2PVDB 1U48A 3H4BA 3KJNB 3C6UB 3DRXA 4DEZA 1IRXA 4P73A 1JXVA 2OEKA 2FVSA 1HHQA 1F9EB 1TUDA 1BK2A 3FK4A 1JLGB 4DPYA 3TEEA 4YHHF 1TUVA 4PLLA 3FCWA 2KXHA 1I4K1 1IUJA 2IJNA 3OFFA 2LXUA 2VPZB 2YKPA 4C5HA 4ICLA 5HMYA 4ZLJA 3M1VA 1T0JA 1K1SA 1U6FA 3R7SB 1I1GA 5IWAJ 5ETTA 1S9EB 2OTJS 2GMJA 1O9SA 3BQ0A 2VBXA 2OPRB 3KK1B 1W26A 3JB9J 2GVDA 1OWXA 2CZVC 5JMNA 4ETZA 1G7CB 3KUHA 4DG1A 4ITSA 3CCMS 2IDLA 3FMWA 4LIRA 2BM0A 1VQOQ 5BXIA 5ETKA 1L3UA 4ZVPB 3RYLA 1YWPA 1VJQA 2U1AA 3BO3A 4NE9C 3QDRB 2XWXA 1X5SA 4EMKC 4X4OA 1ZQ1A 3QGGA 3CCQS 4G1PA 4DR5J 3RU0A 3PW5A 1IBKJ 3H5XA 2NLUA 1YBYA 3LUYA 1FD2A 2ADBA 4DHVA 3T5LA 1CJTB 2F4VF 5B0GA 2KDOA 5A8KB 4DQRA 5LJ3f 6FDRA 5GAGI 3THKA 2AKWB 2COWA 4UOFA 4RUHA 4M7AD 5AJ3F 1D8ZA 3BSNA 1VYAA 5LOQA 1NG2A 4Y6IA 1NDCA 5KG2A 3J7AN 1UL3A 4KSEB 1RAJA 4Q44A 3LWMA 1IWGA 1Y96B 4C0DB 1H0HB 3KLIB 4MDXA 2ASLA 3DOKB 2QLWA 4WFXA 5I22A 1NHUA 1S1TA 1HNZF 4RW4B 1UA0A 1DRZA 2VC8A 5C24B 1Y3JA 3PR5B 1XOVA 2J6KA 3R6GB 3D3CJ 3VAHA 2HHHF 2MQLA 2CQDA 2JXBA 1FFWB 3Q8VA 1YIJA 1IREB 5K8MA 4H4KA 1JLCB 4R5PA 3QYHB 3SWNB 1RTHA 2MI6A 4ECVA 3RW6A 4ZGEB 4GBQA 2GTJA 3M8WA 3D6FB 3CGIA 2OAUA 1ZZFA 4K4WA 4CYUB 2RHIA 3LX7A 3CCJQ 2ZHBA 2ED0A 3LA0A 1G8XA 1YG0A 4Q0BB 5IQ6A 4GO7X 1WXTA 4ED4A 4ZCMA 3HPOA 2DGVA 2HWIA 4LF9J 2LNHB 3MM5A 3DRYA 4QYZK 3EE3A 1QQJA 2KROA 5FU7C 1Y71A 1W2BS 1UHFA 2YKAA 4DCJB 1NJZA 3NTHA 2DR8A 3TX0A 2ZAEA 2ZH6A 1Y7XA 3Q8PB 5L39A 5D3GA 2KM8C 4QPTA 2Z2YB 2WSCC 1KQSS 2K3BA 2BRKA 3DU5A 2ZJPQ 4BI8B 4USKA 4HDGA 5GMKi 2GFFA 4M75B 1RWUA 2X4YA 4TQRA 4HDHA 4JPBW 2ABLA 4QCLA 3H90A 4RTTA 2MPUA 1U2RA 3E8OA 3NMZC 2GGRA 2DMOA 3ZL7C 3EGNA 4MK7A 2LZ6B 3M57A 3PTAA 3CC4S 3RKYA 3HKWA 2OUGA 4V2SA 3CUNA 3M9QA 2GNCA 3EXYA 5I3UB 3CCRQ 3CMEQ 3DLEB 1NK7A 1N8RC 2DILA 1HBMB 2E5IA 5AE2A 4CIOA 1G3WA 1UVNA 3OYHA 1JK9B 2I1RA 4F67A 2OGUA 3TUIC 3DLJA 4EK2A 1S5ZA 4OYXA 1JEGA 5KT2A 1FTCA 3HD1A 2ACMA 1R8OB 5J2NB 4X84A 1N34F 4F0KA 1YSJA 4R0EA 4LRDA 3TZZA 3BDUA 2HBQB 1RWOB 4M7DG 1SUQB 2GZOA 3CD6Q 2V4JA 1TOVA 3D1HA 2XS2A 1UJ0A 5LMNF 3OYJA 1M5KC 3ET6B 1FJCA 3RB6A 2VL1A 1VQKS 4YEAA 4M5DA 2DHSA 5D77A 4RU2A 2UVWA 1FJ7A 1VOMA 3RGIA 5DDRC 4AMCA 3QSUA 1KTQA 5DETA 4ED7A 3KLHA 1YZ7A 3OYYA 2LU2A 1TU0B 5GMKa 1S77D 1NO8A 5GANh 3VS1A 1EP4A 3ZTSA 1Q7LB 1YHQA 2HHSA 1EB0A 4PPZA 4B3TJ 2XHCA 2CP5A 3DMJA 2MHNA 4VUBA 4EMHA 3BKTA 3AH6A 3RRKA 3MF5A 1NM2A 4NASA 3UF4A 5HVFA 1W6XA 4L73A 1I5LA 3LLRA 3GJSB 2QLXA 1DAXA 2LCSA 3TYTA 3CCTA 1TUWA 2DPJA 4MKYA 4B3RJ 3W2VB 4M75D 4OZ2A 2DX1A 3QRRA 5EGYA 4MMOA 2OSRA 2WRMA 1X4EA 3ZEHA 2HBWA 4CRJA 3CCVT 1WWHA 3G2XA 3IA0A 3H0FA 4GO5X 3Q8SB 3ILJA 1Q53A 3BW1A 1C0UA 1RAAB 4DI6A 4XTTA 4M75C 2XSJB 2Y4YA 4OMFG 1K8AR 3I56A 1HI1A 2VB6A 4FNHA 5LM7E 2DKOB 4P5NA 5A6WA 5F3TA 3E9GA 3QZ9B 2PMHA 5E5NA 4J6YA 4CH7A 2X1AA 3T41A 2R7OA 1KLNA 2KR3A 1F60B 1SI9A 3VGTA 4M75E 1X7VA 1VQ7T 3GF5A 3DRSB 3LP2B 2GHVC 4EWTA 1J5EF 2YRVA 3Q8UA 5F8HA 4DL3A 3NEKA 2Z4PA 4ZGJB 5H9FK 1IN0A 2M52A 2J0SD 2NXJA 1X75C 2DR6A 2R8GA 1KQFB 1NPKA 2DBBA 2QA4S 2E6NA 3JQMA 3LGHA 3PW7A 4HVUA 1IWAA 3GNGA 5JJBA 2O9VA 4DR6F 3MM6B 4CLTA 5D6WA 1EIFA 2YT6A 2YWWA 2LMJA 4KULA 3THPA 4GC6A 5CH7B 3EM1A 4OL8A 2F4FA 4V19J 1RABB 1SRMA 5GAN7 2B5JB 1D1UA 1WHMA 1Y5NB 2UUWA 1ZUKA 1FEHA 2H5JB 1FO1A 3H40A 2CZ4A 3QYGB 2LNVA 4KAIA 3TANA 3NS5A 4QW9A 2ZD1A 4JI3F 2C28A 4YY3F 3NKYA 3V4IB 1MMDA 1FKOB 2E9TA 4LSLB 1DJ7B 1KQ1A 2V50A 4MTPA 2R7QA 3AJDA 1KG1A 4TVAB 3MR7A 2OJ2A 3RKWA 4DPOA 1Q86T 3CXCP 1LOJA 4WKYA 3MMAA 2C0TA 3D7SB 5FLXY 1H2VZ 2RK1A 4DJBA 5I42B 2XK0A 5GAHU 4RKUE 3I9ZA 4WE1A 3Q8RB 3M30B 4USTA 2QL5B 2RRAA 4IURA 2WB4A 2NZ4A 4GKKJ 4A53A 1NEEA 1UVKA 4CP5A 1UA1A 1B34A 3LWIA 5D0RA 5GAOr 5CQXA 4PWDA 2D1CA 2DA9A 3SYZA 4QZVB 1VIEA 1QCFA 2HPUA 5LL6S 3G4SA 3FSIA 3ULHA 4ZCIA 4HVZA 4KFBA 4PXEA 1K73R 2OTLS 1N88A 3V7RA 1OIAA 1U1QA 5D15A 3JB9G 3CC4A 1ZBJA 1K1QA 2I38A 3VVTA 1Y3KA 4U9RA 2DNNA 1FXLA 3J7AF 3VALA 1YWOA 5F8GA 3BH6B 2KSSA 4AFZC 4I68A 5CKFA 5IV3A 2RQTA 5G4DA 3H0IA 1W2BR 4UQGA 1EZZB 3HHEA 3G8TA 3OFHA 4LBHA 4DCOB 5I3UA 2RD1A 3AXMA 3GTYX 4FVCA 1KQGB 2EC0A 3I0RA 1R0AA 1G2EA 4H4OA 3EZUA 3PX6A 1N5VA 1HW8A 1Q8KA 2CUDA 1M90C 4EO6A 3RKXA 1HWLA 2DO4A 3LF0A 2RU3A 1VRUB 1V1CA 2YX7A 1ZOTA 1LWFA 1QWEA 2BZXA 2FVUA 4Q43A 3OYKA 1RBAA 5DG7A 3GFHA 5FWBA 2A3JA 1SF9A 4QWDA 2CSIA 1R8CA 2V8PA 1SUQA 1LW2A 5IXUA 2EKYA 1BQMB 3J7YU 2JEFA 2UP1A 4JV0A 2HMAA 1WC4A 3L2QA 3PEJA 1UMJA 4CI0C 2IPOB 3F41A 3N4WA 1LOUA 1V5IB 3OYLA 2DERA 5IAYA 1LW0A 2HQFA 4RLEA 4DV2F 4RTZA 3LAKA 1BI2A 1J5EJ 3EH2A 5AXKA 4F7UF 2FJAB 2WONB 4PJOB 4CLSA 4EBCA 2B4OA 3GONA 2K9GA 2W25A 3N6LA 1PRMC 2EKNA 1VQ9T 2MAMA 2WSFE 1X27A 2X3DA 4ELYC 5E33A 2RK2A 3ZC4A 4AD6A 1GBQA 2ZUAA 4USMA 2AYBA 2NXCA 1Y5LB 3T1YF 1YTYA 1IR1A 1T0HA 3C19A 3H5YA 3M2VB 2WSFC 2BE2A 3H0PA 2L0AA 2GQIA 2QQSA 2ZPBB 5EWGA 2B43A 4BE0A 4HACA 3CC4T 3GMGA 5KG4A 2H4WB 3JSBA 3EH1A 3D1QA 2DNYA 3TOQA 5IC4B 3FUYA 2FEIA 4QIWD 5LJ5j 2ZBRA 1ELOA 2AQ4A 2MY8A 2EKHA 3IQLA 4TKTA 3CCQA 2AEMA 3M9NB 5DGAA 2NREA 3GQCA 1D3WA 4G3IA 5J1NA 1HPZB 1IKXB 5LJ3h 4NXNF 5GMKl 5ETNA 5B08A 2GTOA 5THWA 1WNEA 5CABA 4LF7F 1C1CB 4BC9A 6FD1A 4ESNA 3DRSA 2CPDA 3HFVA 1H3DA 2HHHJ 4RW9B 2KXDA 2HWTA 4DEXA 2JEIA 4G65A 5F9NA 1OPZA 2XO7A 5HROA 2F2XA 3PFOA 2ATLA 1QD1A 4QYRA 1G3SA 4ZVHA 1YDLA 1WSRA 3PRBA 4LF4J 1VQNQ 4CZCA 2XLKA 1HYSA 4N0AA 2K8GA 3PT9A 3P4UB 1RE1B 2BVZA 5AJ3J 3PM9A 5D78A 4DV5F 2FLNA 4Y2AA 3DGVA 2AZSA 1CC7A 2F5GA 4JRQA 3TUZC 1VBXA 3TQ7P 1C1AA 1NE8A 1MMLA 1SIWB 4RW7A 3TAMA 4MJKA 3DLMA 2RKIB 3OYMA 3AOAA 2V1QA 2DD8S 2A6MA 4CC2A 2KTQA 1OYDA 3KJVB 2HKQB 2Q66A 1EKSA 4QVZA 2HFSA 3L7UA 3TP2A 3EGXA 1X4GA 2DRDA 4R8UB 1K9MU 1KIKA 2NSCA 4ED6A 1LK5A 1C0TB 4Y3CA 4ELTA 1SSFA 2BQUA 2HHVA 2JTMA 2VD3A 2MWPA 1D9AA 3B78A 3IS9A 1S9EA 1VQ8T 2MOXA 1ZAWA 5EX3A 2WVFA 5FDLB 3MMCA 2HQHA 2DHHA 2APOA 3GR0A 1I0CA 2W2MP 3DNCA 4LIWA 3DLGA 1WQ7A 1VQ8S 4CM0A 1FE4A 3DI6B 4OGEA 4C92G 3M2UB 4RPFA 2LQKA 4II1A 1TUCA 2R7SA 4MFBB 4LQ9A 3K5PA 4X34A 3JSYA 1Y4ZB 3M59A 4J9FA 2B9WA 4GC7A 3JCMd 4HT5A 1CS4A 2XY6A 1AFJA 5GAOq 2XMTA 3DKDA 2K4YA 2G0CA 4RBVA 3H98A 1X4FA 4WIIA 4JRIA 5KFGA 1QCOA 2XYHB 4PXDA 2YNGB 1WZOA 1S1VA 4AFQC 5HQMA 2HLUA 1AXQA 4QIGA 2ERRA 4M7DC 4U6PA 3J80U 1UEBA 4A4FA 2G2YA 5C2CA 1B64A 3MM9A 3JV3A 1UGSB 3LTOA 4J9HA 1YBAA 4AE5A 1RDRA 4KHRA 4LRBA 3LGLA 4DU7A 2QA4T 1H641 4RW8B 2AYMA 2M9UA 3UQSA 5D8HB 3OL7A 4OX9J 2CUBA 5DGBA 2L08A 2LRQA 4M7DE 5CAAA 2DGQA 4GKJF 2PVOB 2LT1A 2RH3A 3R97A 3PFSA 2V68A 2ZPHB 1BCMA 5KAKA 4B9MA 2EJGA 3BQ1A 4DQ2A 3MZIA 3QT7A 2LJ0A 2VA3A 1TFYA 1IVZA 4O4GA 3IWLA 3T1HJ 3IRXB 5H1SV 1B7YB 2I0XA 4E7IA 2OI3A 5J2MA 5C42A 2KHDA 5D4PA 2M7SA 3TSZA 1N56A 3C12A 3JCMg 3CJRA 2RA2A 4ECUA 1D8YA 4D6WA 5BYQA 2R7UA 2AEJA 4J9NA 4P10A 4Q5VA 1LW0B 2B3TB 2XY7A 2DNKA 1IBKF 4J9IA 2DH8A 2BJ9A 1NPPA 2O4XB 2D3OR 1N32J 1XTDA 1CSKA 2LXIA 4JI8J 2DETA 4P52A 2UU9J 2CIMA 3QJJA 4Q0BA 3MPYA 1ZZNA 1KDNA 1EJ7L 2AW0A 1NU4A 5T41A 5A8WB 1WFWA 1S0OA 1RWPB 1GL5A 4WU3A 1XBWA 3TW0A 2HD0A 2CQCA 4C4WA 1OZ3A 2EBEA 1S6QA 2DRKA 4X62J 3RB3A 2ASYA 5AE1A 7FD1A 2FRYA 2DRBA 2HQIA 2HK3A 3OQ5A 3UCUP 1IXKA 3NWGA 1F5BA 1M5HA 4C92A 2ESWA 5K5MA 3I5RA 1N9SA 3ISND 4K8RA 3ILOA 3HSDA 1WDTA 3KHLA 3J7Z5 3Q8YA 4KO0A 1TK5A 3QWXX 4MMLA 1PSEA 1AZGB 3CJSA 3L2ZA 4LUDA 1K0TA 5K8NA 3H4DA 4Y34A 3BR8A 1IM4A 1SC4B 3A98A 3AT1B 2V6AA 4W4MA 2MMYA 4LUEA 4CH0S 4C0OC 1V3RA 2IG0A 3M8SA 3W65A 3QATA 4WFBQ 1IO6A 3PYFA 1H2UX 2JC0A 1YCYA 2ZPIB 1QTNB 3HP9A 3JCMJ 2PT0A 4LF6J 3TO8A 1P92A 4ANJA 1GMWA 3W62A 1D3BB 4Q2MA 4C8YA 3OQ2A 2JOQA 5LJ5e 4J9PA 5J2PB 2U2FA 2M2BA 3VAMA 2ZPEB 4OQJA 3ET6A 1TL3A 3CMAT 1V9OA 3EVWA 4P75A 1YRTA 2UXBJ 1YJVA 2VBZA 2DGTA 4RG2A 1DY3A 4PKCC 3PG9A 4BS2A 3SD4A 2PSZA 1GXIE 2VBYA 2J9EA 5B0DA 1LWCA 3PIOA 2EFQA 1WKKA 3LQVA 3O5TB 1YI2S 2FVCA 2NUTA 1HI0P 3ELHA 3R5AA 5F3ZA 2J76E 3S3MA 2QA4Q 1TUGB 2RO0A 3DLKB 1NJIU 2C3UA 4UOCA 4I64A 4TXSA 3DYAA 2JVRA 2KT2A 2HKEA 3ZZZA 2DO0A 4A4HA 4HT9A 2FLOA 2MEWA 5H9EJ 2E5KA 1UJ6A 3UWNA 3G4SQ 1U8RA 2E12A 3OUYB 2J0WA 5GAOp 3OTBA 4JJNK 3I4PA 4QW8A 4OBIA 4XQ3A 3EJMA 1FJEB 3DGPB 3BZQA 4M77F 3GCXP 1BQNB 1V6HA 3K59A 2MXYA 3NNCA 5IM0B 4BUGA 2QEXA 2LEBA 1SXLA 4JZ3A 4DV3J 4WZMA 4DX7A 1KEKA 4OI3A 1N6QB 3MTKA 2HVIA 3MP1A 1OPLA 2J5AA 1XK8A 3MPDA 3BH7B 5ETQA 5B0AA 2JNGA 1NZ8A 1FWLA 1S72S 4OLPA 3HMJG 1X9WA 1HBNA 1UHCA 4N8OA 3CEYA 4K50A 2KYZA 1X69A 1RTIB 3I31A 1GRIA 1UEVA 1Q4RA 1N4LA 4ZCLA 4PK4A 1M1KC 3H2LA 3URGA 4RCCA 1CS4B 1LKZA 1O0PA 4MIAA 4IQXA 4KT0E 4B08A 2L8DA 4C8KA 2EXUA 4Y0FA 1KQSP 2K79A 4RUGA 4ATNA 3K7RA 3B4DA 3N01A 5D4LA 2MB0B 4O6JA 5LJ5f 2E29A 4OJ3A 2Y1LB 2CQ1A 2R2SA 4Z88A 5CYMB 2C2KB 5KFDA 4O44A 3TEHB 4J9DA 3OW2S 1MGQA 2HQEA 2VFVA 3DDNA 4EU0A 1J5OB 1HNXF 4N0AC 2O88A 3HVRA 3FCHA 5KFBA 2QG9B 3GV5B 3ZZOA 2LQ8A 1AWWA 2O5DA 1PD1A 2CVIA 1E6HA 2BA9A 4PG8A 2OP5A 4R0KA 2NPFA 2EGCA 3VV2B 5DS7A 1N36F 2MF2A 2YRCA 4ME7A 2NS1B 3I5BA 2D0QB 1UJ4A 2J7KA 1HNIB 3KK2A 4CLWA 1B70B 4DU8A 1JLGA 2Y9HA 3GFZA 1UGRB 2CS7A 2BE7D 2E5GA 4X4SA 4MZTA 2EBGA 5LMUF 2CSQA 4C3LA 4ZJLA 1HWJA 3RZAA 4ATOA 2XEXA 2JM9A 3CB4A 3VHQA 4ID8A 2GV1A 3VS6A 2E3IA 4M5IA 4A63B 2KXFA 3Q1JA 3PHTA 2CYZB 5HJXA 2UXCJ 4LD6A 2WHOA 2YKMB 4FBTA 2UVVA 1N8RR 3ZTQA 1ABQA 5ETSA 1X2KA 3I55T 2VIHA 2F40A 3TVZA 1IKYA 2BANA 3QWUA 1SC1B 1ZAVA 3Q0AA 2C2MB 4TY8A 2DCUB 5CQYA 1Q82R 3V81A 3LPEA 4LRFA 1X4AA 3CCJS 1H7XA 2OKQA 3QO3A 2HNYA 3FKBA 1VQPS 1RSCA 3UPUA 3MGJA 4ZGDB 4ZP8A 3CWJA 1V76A 3HVAA 4JV5F 2HRUA 4RG8A 1T03B 3MUVP 4NOHA 2FZKB 2V2VA 3CDBA 3HFZB 2IBOA 3VS7A 1IQTA 1FMWA 1ULRA 4FF1A 1CBKA 2HBPA 3ZFJA 4E98A 2RS2A 4FXWA 2FJDB 4JRKA 1UJYA 4A8XA 4F4ZA 4P9SA 1H2TZ 3W9IA 4JI2F 3LH2S 4OX6A 2HYIB 3A8HB 1VQOA 3KBGA 1HW9A 1IKVA 4OIXA 4CLPA 2IYIA 2DYIA 2RN8A 1VRUA 5KFYA 2PMWA 2CWKA 3OBIA 2M3DA 2A6OA 2O1PA 1FFGB 4RW4A 2HVEA 3CMES 2VKNA 5LJ5g 2LJ1A 1LW2B 1RT6B 2ROPA 4KH0B 3CC4Q 2HZVA 1HA1A 4RUBA 1DTQA 1GMUA 2HFVA 4OMPA 2HZAA 1Y11A 2VPXB 1RLDA 4OI6A 1E6VA 2F1LA 4RBTA 4OJ1A 2E70A 4M77C 5H9EK 3MP6A 2HNDA 4FNIA 1XQHA 2KT5A 3CCUQ 5KG5A 4M7DA 3G1JA 4J5OA 3TVTA 2FGOA 3AQOA 1DURA 3L9ZA 2DIVA 1W25A 4WPAA 4LF8J 3KDOA 2WOMA 2HKNA 4I6YA 2J6OA 4EZ6A 2Q1LA 1XMBA 1JLFB 4IYQA 2CQBA 2KZZA 4MIWA 1UUEA 4I67A 2C1EB 3JQJA 3OB9A 1FX7A 2ROLA 3BV8A 3GJTB 1T3LA 2FL7A 4B3SF 4QT7A 4DSLA 4E7SA 3RBZA 2KBTA 4KGXB 1QVGS 1M3AA 3OVBA 1VQKA 3CCSQ 3L2WA 4TY9A 3E3XA 3S7RA 3UCGA 4ENOA 4M7AF 4KHPJ 1QKWA 3L2UA 3DKMA 3CNQP 1YIJQ 1KQSA 4OZ5A 4ZPTR 3V6JA 3SFMA 1YJWA 1GT8A 2V8DA 2R7RA 2QEXS 5KCOA 5HO4A 2RNEA 1UE9A 1FNOA 3CCQT 5IHIA 1K4US 3MUMP 3VAKA 1E6YB 1H72C 2C2ZB 1R0CB 5KYXB 4OX9F 1UWBB 1NKCA 2QQ9A 2JSXA 2FJXA 1WJQA 2HS4A 1G3YA 1WORA 4NRTA 1S0VA 4U67Q 3HXMA 2VKZG 1WC0A 4HL9A 4ZPBA 5IQQA 5IXFA 3R5JB 2B9EA 3CVKA 4ELUA 1KHIA 2E41A 4M5HA 1RI0A 4P72A 2LDYA 3GG0A 4KGKA 3H6ZA 1S9FA 3DCAA 1RI7A 4BLGA 4C3KA 3NGTA 3NAHA 3SI8A 3KFWX 2R4FA 3MJXA 2CNKB 3KYLA 2GQVA 2CDTA 1NMEB 4N47A 1JJ2R 2RQUA 4DPWA 4O44B 4TVRA 2V8GA 1VQ4A 1KC8U 1J5OA 3I0SA 2HFNA 1NM7A 2NR0A 4DSKA 4FXDA 4X64F 2EFNA 2RJDA 2K5LA 3OTDA 4A8QA 2LA4A 4OX8A 4DL0C 4PFPA 4TU9A 3LP1B 2HGMA 4UZCA 4HHHA 3TAMB 3GG1A 4OYBA 4WTYA 3FRNA 2KHCA 2M8DB 4KPCA 1OY8A 3G4ST 4DBRA 2LA6A 4OI4A 2GIQA 2ILZA 5I3QA 4ZN3A 5LMUJ 1I6JA 1M1FA 3JCMb 2CQPA 4O3QA 3M9MB 2YQ3A 4WU2A 2XDDA 2LU1A 3R7BB 2GMLA 5IT9E 5KE3A 4I2PA 3QJPA 1LCKA 3KJQB 2M8HA 2K2PA 2MKIA 2K5IA 5HCKA 4HXJA 4EMDA 1C0TA 1OO0B 1HNVB 4CI0B 4K4VA 3QMQA 1WXUA 5CCAA 1L3KA 3GP8A 2EC2A 2LYVA 3P45B 4E7KA 2DITA 2XSJA 3CE8A 2H54B 1VQOS 1LNXA 2OMOA 3CCES 3QRPA 2QGFB 3E51A 2F8HA 4NCGB 4UQTA 2CP7A 1S79A 1N9RA 2HRTA 3GLJA 2DEQA 3FEOA 1FKPB 1GX6A 2JWNA 4YDXA 1QVFP 2D74B 2D9PA 1DQ8A 5FWCA 5M2PA 3MEEB 4PFZA 4FF2A 3JSMB 1UW9A 1TK8A 3Q8QB 5HATA 1HQUB 3IM8A 2PVGB 2CQ0A 1T9WA 3NS6A 4M78F 3EG2A 1KWMA 5KG6A 5F8MA 4PAAA 3V7CA 1WF0A 3UR0A 1RT4B 2A2DA 3AB4B 1VQ5Q 3M8RA 3DRPB 2QTVA 2MY7A 2QO3A 5AXLA 1RAHB 2B4UA 3Q23A 3MM9B 4LFAF 4R56A 4KY3A 4CDIA 3CC7Q 4N7TA 5C2GA 2UUAF 4ILMA 4OZ1A 2Y0BB 1RT7B 3EDRB 1HWIA 3EWGA 1FX4A 1JLAB 4K4ZA 3FQKA 2K7KA 2WVEA 2MGZA 4F0HA 3QNWB 2FPHX 3C2PA 3CD6A 3C16A 4LFBF 2OTLA 4X4QA 3VQSA 4N4GA 2JS0A 3DLBA 2L9WA 2G1HA 1T0TV 2EFVA 4Y2IA 2KU7A 4AFUC 3V4IA 3M8QA 2C06A 4QVDA 1U45A 1BB9A 1QY7A