1M1GA

Crystal structure of aquifex aeolicus n-utilization substance g (nusg), space group p2(1)
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
240
structure length
240
Chain Sequence
LEKKWYALQVEPGKENEAKENLLKVLELEGLKDLVDEVIVPAEEKVVIRAQGKEKYRLSLKGNARDISVLGKKGVTTFRIENGEVKVVESVEGDTCVNAPPISKPGQKITCKENKTEAKIVLDNKIFPGYILIKAHMNDKLLMAIEKTPHVFRPVMVGGKPVPLKEEEVQNILNQIKRGVKPSKVEFEKGDQVRVIEGPFMNFTGTVEEVHPEKRKLTVMISIFGRMTPVELDFDQVEKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of transcription factor NusG in light of its nucleic acid- and protein-binding activities
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Transcription
molecule keywords Transcription antitermination protein nusG
total genus 46
structure length 240
sequence length 240
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2002-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00467 KOW KOW motif
A PF02357 NusG Transcription termination factor nusG
A PF07009 NusG_II NusG domain II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1m1gA03
2.60.320.10 Mainly Beta Sandwich mini-chromosome maintenance (MCM) complex, domain 2 N-utilization substance G protein NusG, insert domain 1m1gA02
3.30.70.940 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits NusG, N-terminal domain 1m1gA01
1XTDA 2KVQG 1M90C 3CCMA 1Q86U 1N8RC 1VQ5A 3CCJT 1S72T 1NJIU 1VQ4T 3I56T 3LD7A 1VQPT 1XNIA 3CD6A 1Q81C 1KQSS 1Q82U 3LGFA 3CC7T 2QEXA 3OW2S 2OTLA 5IT9E 1K73U 3G71A 2EIFA 1KC8U 4OBIA 3PIPA 1YJ9T 5J3BA 3G4ST 2MWPA 4ESNA 2L3RA 3HKSA 2JVVA 1YJ9A 1K73C 1QVGA 5FLXE 3J7AF 3LH0A 4QQDA 1VQMA 1YIJA 2XHCA 2LCLA 1VQ6T 1NJIC 1YHQA 3CD6T 3I56A 4ZN3A 1Q7YC 3A5ZB 1YIJT 1VQ6A 2LVMA 4CRIA 5J26A 3DB3A 3LGLA 1VQLA 2MI6A 1X6OA 1QVGS 2EXUA 1QVFS 3CC2A 3CMAA 1NZ8A 1KC8C 1SSFA 1EIFA 3CXCA 3DLLA 1UEBA 1M1KC 1VQ7A 1VQ9A 1K9MC 3G71T 1Q82C 3CCRT 4YTLA 1VQNA 3KBGA 1NZ9A 2QA4A 1VQKA 1N8RU 2IG0A 2OUGA 1Q86C 3CCJA 4RG2A 1M90U 3CCSA 1NPRA 3CC2T 2OTJA 1KD1C 3EWGA 2JOYA 3CXCS 5A2QE 3TREA 5DM7R 3CCST 3CCEA 3CCVA 2QA4T 1VQKT 1M1GA 3CPWA 1K8AU 2LQ8A 3ER0A 1YHQT 1Q7YU 3H7HB 1YJWT 1VQNT 3J80E 2KDSA 3CCQA 2JNGA 1VQOA 3I55A 3CMET 5HY6A 3CC4A 1QVFA 1YBYA 1VQ8A 3CMAT 1NPPA 3G4SA 3CMEA 3I55T 3CC4T 1W2BS 1VQOT 1JJ2S 2CKKA 3PIOA 3CCLT 3CCUA 1VQLT 2E6ZA 3G6EA 1K8AC 5IAYA 1YI2A 3OW2A 1VQPA 3OYYA 2KPPA 1Q81U 1BKBA 2G3RA 1YI2T 1S72A 1KQSA 1KHIA 3G6ET 1W2BA 1VQMT 1JJ2A 1KD1U 3CCUT 3CCMT 2DO3A 3CCLA 1RL2A 1YJNA 2OTJT 3P8BB 3JAME 2MWOA 4ZN1A 2JUFA 1VQ8T 1YITT 5LL6S 2K06A 3CPFA 1M1HA 4TVRA 3LPEA 3CCQT 3CPWS 2QEXT 3CC7A 2OTLT 1K9MU 1IZ6A 1YJWA 3CCRA 1M1KU 3J81E 1VQ4A 1VQ9T 1VQ7T 2E70A 4X34A 3CCVT 3CCET 5DLQE 3DB4A 1YITA 1VQ5T 3QQCD 1YJNT
chains in the Genus database with same CATH superfamily
4WU3A 3DLGA 2DR9A 2R8IA 3PW4A 2HNZB 2RUSA 3EGNA 4MMOA 4FT2A 1K9MR 2GVZB 3BGFA 2G2OA 2RDIA 2COLA 5HAOA 2JWNA 1C1AA 4M78G 5KFDA 2RS2A 3M54A 3CD6T 4BY6C 1NDKA 1T9XA 1S77D 4I67A 4LFCJ 3CJKB 1JKHA 1QVFS 3OR1B 4RW9B 2JTFA 3C15B 2V63A 4P2XA 1FWKA 1WNEA 3G6EQ 3HFVA 5GAN5 1YIJQ 4HHHA 2ADBA 3UDEA 2BKNA 2DGWA 2CH4W 2RJDA 2RQ4A 3JCMW 1FJGF 4D6WA 1KC8R 3D3BJ 4QIVA 3W7BA 4RTYA 3LP2A 5A2QE 3KDNA 4NLQA 2VQEJ 3A4TA 2AZSA 3TEEA 4QPXA 3BO4A 2EKHA 2G4BA 1DJ7B 4KC5A 5CABA 3MJXA 2HHUA 1T8EA 1YBYA 1HNXJ 4FYDA 1M8MA 2WSCE 2H48B 3H4DA 1HNVA 3DRPA 5GAN6 3PDNA 2WHOA 5C42B 2GMJA 2V4JB 4CH1A 2AYEA 4CLFA 2XTJP 5L1IA 1NK5A 3AA8A 3EMTA 5IT4A 3HZEA 3S3MA 2HIQA 3NCPA 4MT1A 4B02A 5LJ5h 2CIMA 2A08A 2UXDF 1OU8A 4C4WA 4CI0B 1CULB 1JRIA 3UATA 4K2XA 1YWPA 5GJWB 3JQKA 2LTOA 1T05B 5IV3A 3PYDA 2JX2A 4M4ZA 2LLZA 1W26A 1Y07A 2J8SA 2G13A 5DGBA 2DRKA 1WF2A 1N6QA 4DU8A 1U1QA 3SHWA 4KUIA 1GTEA 3CMAS 1KOOA 1X4CA 3RRKA 5HP1B 2O1PA 3CB4A 1RLPC 4ELUA 4ZPVR 3QPHA 3TJ9A 1OY8A 4OB2B 4QVZA 4OYMA 4WP9A 2RQWA 5K8PA 5SZTA 5D4OA 3N9UC 3I96A 5LMUF 4I1TA 1BI3A 3UPFA 1CEZA 1KJWA 3VS3A 5IHKA 2KG1A 2IDEA 4OB3B 3HX9A 4C8LA 3A3NB 4NCGA 2ZPGB 3PTAA 5E3CA 1SF9A 5HI7A 4DG1A 3TAMA 4FXVA 3OYYA 5KFEA 2PFFB 2COWA 3G86A 4QW9A 3HFZB 3GB0A 2IMWP 2N3OA 2DTJA 1RYRA 1UGSB 3ENQA 3EG9B 4OMNA 4BWMA 3GILA 2V50A 1P1TA 3DLBA 4J9NA 4K11A 4DFJA 2MJUA 4M75D 2HGNA 4IRCA 1X5OA 4USHA 4RUHA 3ENAA 1VRTB 1BUXA 2ZZTA 3EH2A 1LVKA 1FCAA 4MZPA 2JVRA 2NZ4A 2HQEA 1KS2A 2RNAA 1I0CA 2OX7A 3CCRQ 4FL6A 4M77D 3DFEA 1NLKL 1WC1A 1H641 2BJ7A 2K2MA 4Y2CA 3GQCA 2QMWA 1NPKA 2IBKA 3JTNA 2WB4A 1FFWB 3DLKA 3IRXA 3L2RA 3QRPA 1N5TA 1HWJA 4RTZA 1BC6A 3I35A 4GKKF 2YVSA 1S0OA 1JQGA 3QDRB 3RUXA 1HKAA 4KYZA 5DO2A 1U8RA 4EZ6A 1KQ1A 5KYYA 2L9WA 2P4RA 4R56A 3OJSA 2GTOA 4OZ3A 3X25B 4MMKA 5D4LA 2UZAA 4M5HA 2V4QA 4OZ0A 4OP0A 1SH0A 2KT5A 4KPCA 4LBIA 4I2PB 5GAN3 2DRAA 1FRHA 1JJ4A 3M2UA 4Y91A 3IXQA 3SQOP 2HPUA 8AT1B 2H54B 1HD0A 5IXFA 1N8RC 3PR5B 4I7FA 3MEUA 1C0UA 2EQUA 1OYEA 4ZP8A 1H72C 2AGQA 4X64F 2BRKA 1WC6A 2R3VA 1BCMA 4KPYA 2F9DA 2V4JA 4MYTA 2KI2A 1FKOA 2YKMA 2YQ0A 1QCNA 1KSWA 3HULA 4X4QA 2BYCA 3PKYA 1QWFA 1VBYA 2BTTA 2DCUB 3A8OB 3RBBB 3THTA 4EMDA 3M8ZA 4WK3A 3RW7A 1FI4A 1U0HB 3TX8A 1NJIT 1URRA 1HD1A 5JJBA 2BM0A 3BBBA 4M5NA 4DL6A 4ZVQB 2D9PA 1R27B 1AWJA 1EP4B 4A63B 4F7UA 3RUBL 5HO4A 4M5JA 2GHWA 1F60B 2A1BA 2R2UA 4WP3A 3IWXA 4C3LA 3K17A 2CVEA 1N8RT 2DIGA 3C46A 2R7RA 1S57A 1YZ7A 2B7CB 3OQ5A 1UETA 5U47A 1OPLA 3MAAA 5LJ3h 4ILLA 2KM8B 2V8IA 2GO9A 4DV6J 1YJNT 3JTPA 2NPIA 5ITHA 5B0DA 2PI4A 1XNRJ 3O3LA 1QAXA 2VGNA 5AXKA 4JI1F 3H25A 2CJBA 4XK8C 3HVRA 1KTVA 2RT3A 2F2XA 1AWOA 2UVRA 2CP7A 3AQPA 4XU3A 2A3LA 3OL7A 2QGFB 1G2BA 3HSZA 5HN0A 2EPIA 2QG9B 4BWJA 2DILA 1NJIC 3I4PA 4X4PA 3C2PA 1YITS 1VK8A 3D0IE 2C0TA 3IAS9 1N88A 5GAMf 4CC2A 3DDNA 3VAFA 3GMGA 4L6V5 3E01B 1NJYA 1DBDA 3NMZC 4GKJJ 3DGVA 1YTYA 4U9RA 4BDYA 2V67A 3LP2B 4TY9A 2YWKA 3W2VB 4FBTA 3EG1A 2KEAA 3MHYA 5HATA 3ILJA 4PG8A 3QO9B 3GFXA 4ZJLA 3NMRA 2D69A 2R9LA 2KG0A 2PFDA 4HDHA 5GAOn 5AJ3F 5ETTA 1FKPA 5C24A 5HK0A 2CQDA 2L48A 1CQNA 1Q78A 3KLVA 3HP6A 3HVAA 2KVQE 2FYXA 3W1YC 2ZNYA 3HXMA 1WFWA 4B6MA 4FIBA 2KXCA 5ETOA 4OLOA 1HMVA 1OS5A 3L1AA 3PG9A 1VBXA 3PX4A 1OJ4A 2NR0A 4GO7X 4DEZA 3HMJG 2VVKA 2QMUB 1I8FA 1YCSB 4BLGA 5LSLA 5MLCV 3W8PA 1VQPT 1JJ2P 1LW2B 3K89A 5GAOp 2B3TB 2QEXQ 3ELHA 4RNNA 2HAXA 4ID5B 3DRRB 1XQIA 4O5VA 3LW5E 2EI5A 1HQ2A 3P3DA 4PJOA 5FU6C 4PABA 4M5KA 4C2MA 3VAKA 3FUYA 3CXCA 3IA0A 2FGOA 3J7ZT 3OBYA 2QI2A 5CIUA 3AJ1A 2L9NA 3TUIC 2ZAEA 3CC2T 1HQUA 3OUYA 4P5NA 5GAOl 4YR3A 4LDXA 4I4BA 3J81U 1AW0A 4R55A 3VQSA 3D3CJ 1WC5A 4DUZJ 5D7UA 1T11A 1X9WA 2RH3A 1YI2S 2C06A 2QQRA 2QQSA 2BRLA 2KROA 5BR8J 3RNJA 1ZH5A 3N6NA 4EIKA 3SV3A 2DYIA 1O8BA 4JI4J 1G5VA 2UP1A 2O31A 4ECYA 2FY8A 2F8HA 1OX8A 5D0EA 3RR7A 4ITSA 3PY8A 1NZAA 3D66A 1RKIA 4F17A 5KFCA 3CCLS 3W65A 4NLOA 2VASA 1RYSA 3NMAA 2KTQA 2F2VA 4NXNJ 4ZPCA 1UDLA 3VALA 2XO7A 2UUAJ 3UT1A 3W2VA 1J2VA 3ILOA 2A36A 2MGZB 4LF8F 2HFSA 1EJ7L 2MQLA 4DV4F 1Q81C 4IUVA 3I56S 2ZVIA 5AXNA 2DTHA 2QL9B 4MDXA 5KE3A 2DNNA 5KFOA 2XI9A 3VUBA 3QXEB 1F2HA 5KT2A 3EPGA 5CQXA 4UZBA 1FMKA 5FU7B 3OSPA 1TSFA 3ZZYA 2VDHA 1HI1A 1UAWA 1RLCL 2CP5A 1AXQA 3UQSA 4F7UF 1YBUA 4O23A 5AE2A 3KK2B 3M32A 2L9DA 2M8HA 3BGUA 2Y1RI 1OO0B 4RTWA 2J9CA 3ITHA 2XGQA 4C5GA 2RKIB 3LPYA 4QJVA 2DXUA 1CS4B 3PKMA 4LF7F 2MIOA 3CEDA 2RQVA 2J9DA 2W0ZA 2R57A 2CJ9A 1MHNA 2AJ2A 2XGPA 1N33F 2GAGC 2EQIA 4A54A 2EPDA 4ZVPB 4DPOA 2DY1A 3R1HA 1UGPB 2QL7B 1GXLA 2JLEA 1HNWF 1JBMA 4PJLA 1XN9A 1TVRB 4H4OB 1Q8IA 1YZ6A 4LSLA 4OYAA 2PMZD 2FC9A 1T9TA 2ZPIB 3JYTA 3DU5A 4HHUA 1LJOA 3EFSA 5I3QA 1VFJA 2IDLA 3G4SQ 2KZZA 4QKUA 2ZH8A 3J81j 4RBTA 3VF0B 1VJWA 2M2BA 3ZZ0A 2VOPA 1W25A 2LA6A 2BX6A 2WVEA 2IVFB 4V19J 4J9EA 2IYIA 4ELVA 3QSIA 3LWLA 4IUTA 4TQSA 4RW6B 4J9DA 4YDXA 3KUGA 1JIHA 5B0GA 2DCLA 1NLOC 3HHLB 2ZHOA 1MROA 2BV3A 5GAEI 5HQLA 1FFSB 4N41A 2DERA 4XO0A 3VGVA 2LDIA 4DL5A 2HD0A 3GSIA 5M9OA 4Y6IA 5KCHA 2DJWA 2VHGA 2RUGA 4OZJA 1VQKA 4USJC 3R2DJ 4KE5A 1N6AA 3G8SA 4ZP7A 2KAFA 3K5LA 2DXFA 2C22A 1UA1A 3UFCX 4ZLJA 4M77C 3KHLA 4HKQA 1OIAA 3G82B 3M2VB 4JJDA 2VH7A 3Q24A 4LUDA 2I5JB 1CC8A 1Y11A 5A8WB 2LP4A 1N32J 2CRLA 4N8NA 4KV8B 1U7LA 3FZ2A 3ZZRA 3TOQA 3LYIA 3G2XA 2RD1A 3UD3P 1R7IA 2YWGA 1HWIA 5KYYB 1PM3A 4M5DA 5J2PB 5GAEU 2L2PA 3IP0A 4OFZA 1AWXA 5T14A 2LT1A 2HBPA 1S97A 2Q1LA 2GMLA 3BQ0A 3TVZA 3GV5B 5C25A 4IO1A 1BB9A 4IIOA 1X5SA 5A8WA 2DR5A 2FDNA 2FLLA 1ZOTA 2RPNA 4FZVA 3TAQA 5IT9E 1VYTA 4NPOA 2EIFA 4C0BA 1TUCA 3P8HA 3BB5A 1VYAA 3UWNA 3Q23A 3RAQA 5GANh 1XNRF 2L3SA 1OWXA 2BJ1A 4R5PB 2FPHX 2H3JA 3A5ZB 3LP1A 3A8LB 4ANDA 2A18A 2LKZA 4ZLLA 1WDXA 2QX0A 2LU1A 2FPDA 5D0HA 2UU9J 1CPZA 3TUZC 4C8QD 2R8GA 4JLGA 2VU5A 2VUBA 3S1TA 2LQKA 1FRIA 3WVDB 5A0YA 1BGXT 2LJ1A 2W25A 3HI9A 4PEOA 4O44B 1SUQA 1CKBA 1UHCA 4GVBB 1PCXA 4HYKA 3ASKA 1FD8A 5F3TA 1HLWA 2E3HA 2EG2A 2RI3A 2R8KA 2KRSA 4C3KA 4E98A 1VC0A 2DA9A 4F0KA 1XMQF 4OHZA 1GCQC 4I2QB 3G6ET 4ZGJB 5IFMA 1MLAA 4F14A 2HRTA 3CJRA 4DV2F 4FXDA 3MI7X 3OB9A 2XMVA 4K8RA 4CCHA 2CG4A 1DZ5A 1OPKA 4JV5F 4GLKA 1R6YA 3CPWS 1PKUA 2P9EA 3QIPA 3CCVT 3QJYA 2DHSA 2D7SA 2FYKA 4NYZA 3RR6A 1IKYB 3MEEA 4XTXA 2QIFA 1WHHA 1REGX 1UPMB 3FCWA 1HNZJ 3LD7A 1OYDA 2GQQA 3M57A 4OZ2A 2EYXA 2XLJA 2EKYA 4RUGA 1YJNS 4R0JA 2M70A 4HI1A 2HVIA 1G3OA 3OBWA 2CUYA 2QN6B 2CZVC 4RL1A 3WZ0A 2Y3YA 1WHLA 1YIJT 2MZTA 2AF6A 4IH5A 1WDTA 3CC7Q 4RNFA 3M4YA 2O01E 1MG7A 3O1LA 4DLGA 1KIKA 1S5ZA 2H8HA 2WSFE 4M7AF 2ZVSA 5A0YB 2NUPB 1YBTA 4HR2A 1RACB 1BWVA 3DGPB 4JI3J 3F73A 4F7UE 4FF1A 3CJ0A 3HKZD 2IRYA 2E4HA 2H9ZA 1FNOA 1X6BA 1IREB 1VQ8A 5ETSA 1PO6A 1VUBA 1LFWA 3I5AA 2LP5A 2FJVA 1F9HA 2EJGA 3VS2A 4JBCA 4PJOD 4DUZF 1UFLA 1LWXA 4PJNA 5LSOA 2IIMA 2DNRA 2EGAA 3I9QA 2DO3A 4A53A 4CDIA 1V29B 1OSCA 2F3JA 1VRQC 5IS2A 4GC7A 1FERA 2J6FA 2EJFA 4AT1B 3SDEB 1F5AA 4K4SA 2PD1A 5M2RA 2QDLA 2ASJA 3H2UB 2L3PA 5KT3A 3RKXA 1KD1R 4M7AE 5HBMA 3MUMP 1TQLA 2PVDB 1M5SA 1XMBA 2YKMB 1RHKB 2PMHA 1S72S 2NLUA 2E1MC 3LGHA 2D3ZA 3LX7A 4QW8A 1ZM4A 4N8OA 1TKZA 1U02A 4RBVA 4KIAA 2KN4A 1FEHA 2GGPA 1EHWA 4EMKC 5KH6A 4XAXB 2XCAA 1N36F 4IFYA 2JN0A 2ROPA 2V2ZA 3LOUA 2BANB 4ZPDA 4DPYA 2YNFB 2OPSA 3JCMQ 3H5SA 1UVKA 4YB6A 3FK4A 1SL0A 2RB6A 4PJOC 3PIOQ 3KJFB 2OTJA 4NEZA 4A4GA 4NXMJ 1PSDA 5AXMA 3M8QA 3LALA 3ET6B 3QZ7A 2J7WA 1XMQJ 3J80E 4IQMA 3CT9A 1QVFA 2CQCA 2Z2MA 5FD1A 4NS5A 1S48A 1TL1A 1Y0MA 2KKHA 3P49B 2QMXA 3M0PA 4NLUA 1HFEL 2W9CB 2ZM6J 2JNJA 2B86A 2FHKA 5CZVA 4DZ6A 3EXYA 2K3YA 4Y28C 5CYQB 1VQ8T 1SL1A 2YBVA 2AK5A 2C3OA 1NK8A 5DM6Q 4CH7A 3BPSP 1E6HA 1AYEA 3D1HA 3T3FA 2JFKA 2DR6A 2DD5A 2HHHF 2D9OA 1JK9B 2YWEA 2GC8A 3QZ9B 3PMTA 4CO4A 2MZSA 4A8MP 3D7SB 1QKWA 4AE5A 1GT8A 3MEGA 4X4NA 4P72A 2EYQA 3TQEA 4JI2F 2VPXB 4ZITA 4XIUA 3LH0A 1WHWA 1QY7A 1KQ2A 1VQ6T 1I5OB 4FP9A 1SPBP 1T94A 2QA2A 4HA8A 2LMIA 1WG1A 3DYAA 2YWHA 4YS2A 4M7DG 5BR8F 4CNZA 3G1JA 1LEOA 2RQMA 3JSYA 5JVHQ 1ZSZC 3OL9A 3VVUA 2R5AA 4DWIA 4ZA1A 4Y00A 2HHQA 3BR9A 2OTLS 4I7FB 2V2QA 5AXLA 4IRDA 1DLOA 3RBEA 4UUWA 4PCQA 1HQEA 3MWBA 4UC4A 2HNYA 1BI2A 1LK7A 2DNOA 3EG0A 5KFHA 2R7OA 3N5FA 4CT9A 7AT1B 5A0GA 1N0UA 2E64A 5L9XA 3CNQP 2H1YA 3LW5C 4U7UK 1W2BA 2KJVA 1FK9A 1PYSB 1HBOB 4C48A 2FRYA 1M5OC 2FVSA 4L3NA 1KVJA 4N5SA 2A2DA 2DXDA 3JCMg 3VV0A 1QTMA 4L5GA 3WVEB 4X66J 2Z2ZA 1PJ7A 3MM5B 4AG2C 5ETKA 4J6YA 3BPDA 3PV8A 4FYVB 3UA6A 3LWMA 4KHMA 2VPYB 5D77A 4GVLA 3HT3A 3BE3A 2VBZA 2N7YA 3OSVA 3PIPA 3UCGA 4Q0BA 4AFFA 1A9NB 3MAQA 2K2VA 5EG2A 2ZDPA 4II1A 3CCMQ 1VQKQ 1RT6A 3IR7B 4RW4B 2OPPB 4QIGA 2AGPA 1CJUB 4K50A 2JS0A 5A0DA 4J8OA 2MQ8A 2MGZA 4N4IA 1VQ9Q 3L2WA 4M78F 5CYMA 2R2RA 2ENMA 2M7SA 2AU0A 2FZCB 1HNIA 4FPIA 4NA3A 3KLEA 2BQUA 5ETQA 1UTIA 2CQ1A 3RW6A 3VJPA 1N56A 1Q53A 4DA4A 2CUBA 4X65F 2O5DA 1CG2A 4RLEA 2W01A 4PKCC 3G4SA 1N8RR 3M7VA 4B9UA 4DR4F 2XYHB 1VHIA 4LUBA 3H40A 1YI2A 1EB0A 1X01A 5K14A 2CAJA 3L95X 4LDWA 3J7A1 1VQMT 1LWFB 2U2FA 3LUYA 4LDYA 2JXBA 1O6XA 2NWMA 1HYSB 1ITPA 4J9OA 3OS2A 2VFVA 3QWYA 1LWCB 4ECUA 1QCOA 3MTKA 1MV0B 2CZ7B 1KBRA 2V8HA 4X34A 2KSSA 4WF2A 1I07A 2D8JA 2YXLA 4RU9A 4X4TA 3V4IA 2FVCA 4QQ6A 2P0PA 4G1IA 5KYUB 3DOLA 1WHYA 2D1CA 2RIJA 3TA2A 4OBIA 2XNRA 5E0OA 4P2FA 5F0WA 4DPTA 1YJWQ 2CPDA 2FY1A 2PT0A 3QUIA 4ID5A 2K3IA 2Y0SD 3DLKB 1OOTA 1Y96B 3M05A 3N6MA 2RK1A 3MPDA 4OVAA 5IC4B 5I21A 1CBKA 4ANCA 4OV6A 3CIMA 4C8KA 4WTYA 3TZWA 1SRLA 1U26A 4C8QC 3M1VA 3EGXB 4DV7F 3VS6A 3GFYA 3F56A 2UVVA 1S10A 1WKLA 3U1LA 2PEBA 2FVUA 5G4DA 3CC4A 1RGVA 1U8SA 2GO8A 3F41A 4DI6A 3AODA 4N0AC 2WACA 1FE4A 3ZBDA 4DJBA 3J7YI 1GFDA 4NX9A 3OYJA 3EFOB 3MZIA 2DETA 1RU1A 4ZIVA 2Y1LB 1Z2ZA 2WB1D 1QCFA 5CVIA 1K8AR 5GVQA 4DFKA 2HKQB 2VC8A 5LMNJ 4JI5F 1NM7A 5DLGA 5J1NA 2BANA 4NL5A 3UO0A 1M90C 4BE1A 2MZJA 3K58A 2HVZA 1L3VA 2HDAA 1OPIA 2B43A 1T03A 2RF2B 2DL5A 3EM1A 2CKWA 1TKZB 1AZSA 5LJ3Y 2DR8A 1NEGA 3X3UA 3VAGA 3OTOJ 4YN3B 1TUWA 2BJ9A 2I0XA 1RI9A 2EK6A 3C6TA 3MMJA 3NOGA 2KK4A 3QWPA 4BI3A 3CMAA 1ZYQA 5FWCA 2DRMA 1M4ZA 1J3TA 1B7FA 5HCKA 2XS2A 1NKEA 2EC0A 3M8PA 2G0IA 3Q22A 1E6VA 3IBFB 4OJ1A 4JV0A 4OJ3A 3KJVB 4C8QG 2ROTA 1T3NA 4AL6A 4PAAA 1REVB 3EGZA 3PX6A 3RB6A 4LF9J 1JJ2S 5DRKA 2NLWA 4HVWA 2LQ9A 2I2YA 2HQCA 3FMWA 2VFTA 2IVMA 2BE2B 4C8YA 4G65A 2B4VA 5I3UA 3HCXA 1SUQB 5IXUA 2K06A 4CP5A 3H6ZA 1BQMA 2RF2A 4IRKA 1S1WA 2UUBF 3I5BA 2VF3A 3MMBA 3FBBA 3GCWP 2GF7A 3L2ZA 3OHAA 2ZM6F 2G0CA 4HH0A 4ZCMA 4V19X 4OZLA 2PZ1A 4DXLA 2CNNB 2NZCA 3VV2B 1Y10A 1S72T 1RT7A 3MECB 1ZZNA 3DHWC 1UGVA 1B3QA 2J9DE 5JVGQ 2VG7A 3BKTA 2PVOB 1K73U 1ZETA 3KLHA 3VRZA 3W5ZA 2M16A 2V8DA 2QFIA 1WHJA 1JLAA 4ZVUB 1MU2B 3NBPB 2FUG9 4U96A 2OFHX 2HHHJ 3X28B 4JYAJ 3D4JA 2LCLA 4KH1B 4ZVGA 1CQMA 4ZN3A 1ZQ1A 1VQ6A 2LQBA 2Q79A 2QTWA 1GXTA 9RUBA 1KHCA 5I3UB 1M30A 1IKYA 3UD5A 4A8KA 3K5MA 4NI2A 4R8UA 3GLXA 1UJ4A 5GAHU 3HT0A 3V7SA 3C15A 3NP5A 2BM1A 4OX7A 4DR7J 3MURP 3GR1A 1MWZA 4X4SA 3W5YA 5KFWA 4LSNB 2SXLA 2DK2A 3K8WA 1D0YA 3PJXA 3ZXWA 4DSFA 2R42A 1UB4A 3MM6B 3MEVA 5KFFA 3H5XA 1M27C 4JV1A 2KPPA 2QO3A 2F2WA 2O3DA 4GY5A 1VDHA 9ATCB 2LRQA 4DUTA 1NG2A 1YQHA 4ZPAA 4BY6B 3X20B 2DFUA 3CMAQ 5DS7A 2HEQA 2XS7A 1HHTP 3TA0A 1RBLA 1IBLJ 3OPKA 3R6GB 3TR5A 5HQ8A 2V2KA 1PBUA 1B7TA 1Z2LA 3CMQA 1JMTA 4OL8A 1V5VA 2XQCA 2RH2A 2GA7A 3OYIA 1BQXA 1SIZA 2RVJA 3IN5A 4K4WA 4CC4B 2R7SA 2ZBPA 3EZ5A 3JB9H 3TWZA 2HNIA 1FX4A 3K5OA 1VQ5Q 4YQWA 2F4FA 3GOXA 3NGUA 2GVDA 3NHNA 1UEKA 1X6OA 2KM8C 2FVPA 3BGOP 4K4TA 3OYAA 3HSJA 5K9FA 2UXDJ 1WXUA 2VG5B 3VZHA 1FNXH 4DN9A 1RAHB 1VQOQ 1GMUA 1S76D 3GPLA 5DZ6A 4BCAA 1WJSA 4ECTA 2AGOA 4WK1A 4EK2A 4M75F 1P1LA 2GNKA 4ZVTB 3ZZUA 2BVZA 4DU7A 5LJ3g 3MXHP 2OIHA 4OHYA 2C3MA 1OV3A 3G6XA 4JJNK 1VQPA 1L5UA 3L7UA 3C8YA 4RZRA 1C1BB 4MK7A 1TK0A 2JLFA 2QTXA 1U47A 1VQNQ 1RKJA 2LDMA 4LQ9A 3HRSA 2RKIA 3JCMc 4IG3A 3D6HB 1N9RA 2P6SA 2KXDA 1HW9A 2H5EA 2DGXA 1RI0A 3BGRA 4ZNXA 2IRUA 1BYMA 4J9LA 4X84A 5KYUA 3BDEA 3LP0B 3CIZA 3N28A 1HBUB 4EU0A 3WIVA 1F2GA 2J6SA 1X7VA 1RSCA 3VAJA 5LL6d 1JLFA 4OQJA 5AE3A 5E41A 4DQQA 1K73C 3MR3A 4OMFG 4PYAA 3R6NA 2Y0BB 1YIJA 3DXSX 3QRQA 3P96A 2HGMA 1X4BA 1AD5A 3UDCA 2V68A 1FRXA 2IVYA 4DLEA 3Q1JA 4CQ1A 1DY3A 1WYXA 2VYTA 1AWWA 4RG2A 1H7XA 4RWXA 1VLOA 1DTQA 5H9EK 1T3LA 3GIMA 1YFNA 3JCMJ 1X9MA 4M8LA 5HKCA 1U1LA 2VOOA 4KUDK 2I6WA 2MPXC 2KHDA 3SDZA 4DV7J 4E7KA 1TOVA 1LOJA 1OI1A 2HMAA 2M4MA 3KXDA 3V81B 1QUVA 2V69A 1S72A 3FJPA 4FU6A 3NWGA 2RI2A 2WVDA 1QP3A 4M75A 1U25A 1NM2A 1B34A 2HAIA 3TEGA 2O88A 2X3GA 5FDLB 2ABLA 2VG7B 2OTLT 1YJ9Q 3F0NA 4DEYA 2W9AA 3MMAB 2DBMA 2E1AA 4O0NA 4GKKJ 1MMNA 2LQNA 1QW1A 5D3GA 5LMNF 3CC4Q 1WJRA 4ES1A 2Y90A 2XEXA 2OTLQ 4E8UA 2F1LA 5GMKj 1VYUA 4CWBA 2K8GA 4QCLA 3T41A 3G7ZA 2EWHA 3OW2P 1HIYA 1QUPA 4TU9A 3NNHA 1T02A 2EC2A 5CD4A 2ZD1A 1ZBJA 2DEIA 1IBMF 2JW4A 1IHVA 3UW1A 2E10A 4LD9K 1QM9A 4L72B 2KGTA 4IG3B 3MMCA 2OUGA 2K7JA 3C66A 3EGDA 1NPRA 3MM6A 1KD1C 2ZPEB 3OHBA 3PVXA 2B5JB 4WTOB 3JSRA 1CKAA 2DKOB 2K2PA 3M53A 5CZXA 4KRTA 3QFWA 1UMJA 3HM9A 4B3OB 3DKDA 2YRCA 1X4FA 1KN6A 2MZQA 4JJBA 3R7SB 3NNAA 2O67A 3R97A 1KHIA 3RAXA 4C8QF 3E01A 2QLFB 2BZ8A 3KLFB 2JUFA 3FRNA 1RAIB 4FNHA 4KKOA 5J39A 2VDIA 3A8GB 1U1SA 1S4FA 2QASA 3J81E 1VQ7T 1M5PC 1JXLA 3PT9A 2XZTB 2HQHA 3PGGA 1H3ZA 3DOKA 3J7AN 2C2OB 3SSQA 2HS4A 4M75E 3VS7A 4C0DB 4LFAJ 4IUPA 3FFIA 3CXCR 4ECRA 1YP5A 2QLWA 2CFXA 2RD5C 1S1VA 1PG5B 2HSPA 4M7DA 1T05A 5J2MB 2G6FX 4RX6A 1K1SA 1VQ9A 4LRCA 3IGNA 2W9BB 1IRXA 3BF4A 2GQCA 4WYLA 3PM9A 5J1PA 3EGVA 3PR4A 1GMVA 1LXJA 4NE9C 4E0DA 3CCWA 4XTTA 3JSMA 4USTA 2WBMA 2ZC4A 2IM2A 5BJRA 3A3PB 3L09A 4LRBA 3JCMf 1TG0A 4YY3J 5ECAA 5DG7A 3TNVA 1BQMB 4WZQA 3NAIA 5FLXU 1XK8A 5C24B 5CCMA 4DSEA 4V1Ak 5ETNA 4M7AB 3KUFA 1NHKL 1NRKA 5F8IA 1EX4A 2ABYA 4PJJA 1S1TB 3C16B 2LQ5A 3GZ7A 3OTOF 2CP3A 4ED8A 2GIRA 4DR6J 2MLXA 5IQQA 3SEMA 4BI4A 3SQGB 3L42A 2K4YA 4NLPA 3OVSA 1DHMA 2D8HA 3BBFA 4FPRA 1RQ0A 1UW4A 3OV7A 3G4ST 3HKSA 1CC7A 2RAQA 4A4JA 1PYTA 1W4SA 5FLXE 3GJQB 3QYGB 3PRBA 2ZEJA 5EUHA 1VS3A 2KRRA 1LW0B 2W8KA 4Z37A 1S12A 2BA9A 2XI3A 2B9YA 5D0RA 4CO5A 1XTZA 3AOCA 1NCLA 4M5GA 4KO0B 3T1HJ 2DY9A 2XD0A 5E3QA 1S6OA 2DD4A 2ZWOA 3AY0A 5BYSA 2CP6A 2DHXA 5CKEA 4ENOA 3IWNC 3KHHA 4HXJA 5H9FK 2YUQA 2MSTA 2ZH6A 5F8NA 4CZCA 2AKKA 5GAOq 2OAUA 3H20A 4H4MA 2R7QA 4R5PA 2OPPA 3US5A 1Q86R 2X3DA 3EH1A 2XM3A 1JO8A 1XIQA 3GJSB 4UY8T 2EQJA 1B7YB 2GNCA 4JYAF 1TL5A 2XG8A 4DQPA 3CC7A 2DGUA 4B3MJ 3L3CA 2C28A 4EEYA 3AOBA 3Q2TC 2MKCA 1FDAA 1ZPVA 3C6TB 2XO6A 4JRQA 1HPZB 3IWLA 2YNIB 2DH9A 1D1AA 2VC0A 3GONA 2QA4Q 4AYBD 2KT3A 3TVKA 2QV6A 3WBZA 1RTJA 3OD2A 1S1XA 4NMLA 3SSSA 1GTHA 1RAJA 1UJ5A 4PQUB 3A8HB 2FC8A 4XU0A 2BQRA 4Q44A 1FEEA 4JRKA 3I32A 1Q86T 4L6V3 5CKBA 4O3NA 2RB7A 3MAHA 3HD2A 3JCMP 1WLPB 1SV5B 2QYCA 2JS2A 3D68A 3FJ5A 4J7IA 1PRLC 1WI6A 2E6NA 5F9NA 2HFNA 1IGQA 4DQRA 4ED5A 3HHLC 1VIXA 4TYBA 1NJXA 1VQ4Q 3D0HE 5GMKe 2KB2A 1JJ2A 3D1OA 2FHOB 1IJFB 5KFLA 1DURA 2DNYA 5FDLA 4PG5A 4IR9A 2GFFA 2YH0A 3BKUA 1HL6A 2V8PA 2YRVA 2ZPFB 5C2GA 1RT6B 1S0MA 3I0SB 3P45B 1M0SA 4J9RA 4QWBA 1C1BA 1MMGA 2JM9A 3BN7A 1BK2A 5B0AA 4DOVA 1WPYA 2AP6A 4F26A 4HCZA 2CREA 2RHXA 4FXWA 5J3BA 2FHJA 4PJMA 4JS4A 2JDJA 1FT8A 1FWLA 1HJDA 3EYZA 4DR2F 1S6PA 4EMGA 3EVMA 1K9MT 2CYZB 3SCJE 1JLFB 4I69A 1TKXA 4ED7A 4LT6A 2OI3A 3SIPB 1IM4A 3CCTA 5JUMA 1JXMA 1JLBA 2CSQA 4WZMA 2KDOA 1GBRA 1IO6A 4X1VA 1HYSA 2ZNZA 2VFSA 2E29A 3HFKA 3S3NA 4QVCA 4F4WA 2ADCA 2WZ1A 3L2VA 1HI0P 4NRUA 2HBWA 2CH4A 3TUJC 4CLLA 4QWCA 2LQWA 3U02A 1S6QB 4M78B 2P84A 2MQNA 2N4CA 3G6EA 1SC4B 5A8RA 3BSNA 5IT9Y 2V2VA 3I0SA 4QT7A 5J2QB 2JJ9A 2BE9B 4Q8EA 5GAN8 2YSQA 2K1RA 5CCAA 4JI2J 1K9AA 2E7XA 2P2CB 2ZKTA 1YJWA 3FLGA 4J37A 2V1RA 2E5QA 1M90T 4I6WA 4J9HA 1CJUA 2WTFA 5AYFA 2B51A 2YNIA 3FC9A 3T6BA 1N32F 3NOCA 2HHTA 4MMLA 3EZUA 4P71A 3O2IA 1QSLA 5KG2A 1NE8A 2DLPA 3M0UA 3EX7B 5ETPA 2EXUA 1UZHA 2AJ1A 5KG4A 1GL5A 2LT4A 1SH2A 2BXJA 1WSRA 5E3RA 3CDUA 3PX0A 5A8KB 3BO2A 2GIQA 2PE8A 4QBUA 5KFSA 5LT5A 3OUYB 2BUDA 2CSIA 1HXDA 4EMKB 4DBHA 3E8OA 1IWGA 1SC1B 3ZFJA 4M7DD 1DFDA 4ILRA 3FMBA 3CCQA 1P9QC 2YKOA 4H4MB 3DRPB 3CCZA 2YPZA 2M8DB 3SFUA 3W2WB 3H0FA 3HD1A 2M88A 2UXCJ 4Z89A 2ZBCA 1IKXA 3FCVA 4MKBA 4Z88A 2R7VA 3UVJB 2A37A 1HWLA 3UN5A 3MUTP 2R4FA 2RQTA 4ZGEB 4M95A 2XMUA 4Q5VA 3OL6A 4D3GA 1LW2A 4ZS6A 4MTPA 1AUSL 1EQ0A 5GANj 2E5IA 2DH7A 1YITA 1TFWA 2XS5A 1IXKA 2HL5C 3CPWP 2AWZA 2V4RA 2FHMA 4EYHB 1S59A 3VGUA 3TX0A 4F3QA 2POKA 4ECQA 4W4MA 4URSA 2HWHA 4OMLA 2GJ2A 2Z2YB 3IAM9 1DQ8A 1LOUA 4QWDA 3NXZA 4AQYJ 4ED3A 4RW7B 1Q82C 4PFOA 3OL8A 3QLHB 3MD1A 2JC0A 3UNGC 5HQMA 1RT3B 2JOYA 5HK3A 1HNZF 4KGKA 5LXYA 2J6OA 2AD9A 3AAWB 3SCKE 4OYBA 2WONA 1JNRB 5KYXB 4YB5A 3UVJA 3TARA 4J9KA 5IT9U 2FVQA 3MMBB 2E12A 5HY6A 6AT1B 2N82B 4DL7A 2JFDA 1T3OA 4J7FA 3E19A 2AJ0A 1JXOA 2M51A 3PYGA 2W2QP 3PJ9A 2H4WB 2LDYA 4DOWA 2MOXA 2JEFA 5FJ4A 3M6XA 2NQPA 3CPFA 3DM2B 2BKOA 5C2CA 3IM8A 5B0CA 3DRRA 5HVHA 1N48A 2XLIA 3CULA 2HBZB 1SJFA 4LR9A 1UZDA 5J2MA 3KUEA 1N5YA 3DI6B 1VC6A 1R8PA 2NUTA 1VQ4T 3C19A 3CC7T 2QEXA 3QIDA 2LEAA 1F3FA 2HHVA 4E7SA 1CSKA 3EICA 2DVIA 2EJ9A 4C8ZA 2ASYA 1OY6A 3VKIA 3RZAA 3OSSC 4M7DE 3ZNJ1 3OYKA 4BDPA 1GCPA 2OD4A 3MCAB 4DQ2A 2G1DA 4MH8A 2CWXA 1H98A 4J9UE 3M30B 4DBQA 2O4XA 5FIIA 1X60A 2F8MA 1RHMB 5CAAA 3MR7A 3A8IA 3MM8A 3MEEB 4D3HA 4M77F 1SJ3P 2E1CA 2ZBIA 2A0FB 2KYZA 4RUAA 2OP5A 1K8AU 2Y4XA 2KT8A 2ZE2B 5GAMe 4B9XA 3NY0A 1K73T 3V6DB 1EZZB 1S1UA 3CMEA 3D1QA 4ZTJA 4NA2A 3ONQA 4A4HA 4CLZA 4OI0A 4F4XA 1QVFR 4DMZA 2B5JA 1R0CB 3FSIA 5DY9A 5EN1A 3C12A 1R0AA 5J2QA 3C4SA 3M6VA 3NFCA 4MZTA 1H8KA 4TU7A 2E5JA 4C5IA 5ADZA 1TU0B 1V3RA 3PNIA 3IMQJ 4B3TJ 1NUEA 4Y34A 4A0TA 5A76A 1AUDA 4PNOA 4ZVEA 4MK9A 1XTDA 2VJVA 3A1YG 3TJ8A 2XDBA 4OLPA 4ZKAA 2YUNA 3ENWA 2RSQA 4F2RA 1X5PA 2F65A 1RTJB 1S99A 3R3TA 4ZIWA 2ALZA 1KSPA 2MWPA 2VBWA 2AW0A 4KQZA 4OX6A 2DO4A 3PVQA 1VQ6S 4C8NA 4FT4A 4NLTA 4RJVA 1IXDA 4JOUA 5GMEA 4WXWA 2HZYA 1V76A 4O3OA 3SWNB 2KRMA 4IUUA 2DH8A 2W7OA 4PPZA 4B3SF 1U1KA 4P7TA 1D3WA 1KKHA 4WYWA 4GC6A 1FX2A 4KTQA 3R5JB 5CYMB 3KBGA 2WSEE 2PA8D 2YDLA 1HHSA 4ZHRB 1X75C 2ACYA 2HLUA 3QJPA 5HP1A 4JJCA 2MQOA 1P27B 1M1FA 3M0QA 1KK7A 5GAN7 3KHGA 4RTUA 3DOLB 2IC3A 2ZJQQ 4PUOB 1RBAA 4E6RA 2LCCA 2KFYA 2AYMA 2DX1A 2XI2A 1PYOB 4JB8B 4PL6A 3OTDA 2X51A 4UF4A 1H2UX 3IRWP 2CPEA 2D0QB 1U2CA 1XMOF 4I56A 3I6PA 2VIHA 1DRZA 1XR5A 3I56Q 3URGA 2M5YA 3FSYA 1C6VX 4OHVA 4W90B 4M75B 2DEQA 4WIQA 4FN5A 3MM7B 5C25B 1VQ4A 3CCET 4F7UG 1DTTB 3NTHA 4F7VA 3FEOA 1A0OB 3I56T 1XNIA 4ED0A 2XWXA 3OW2S 4J9CA 2HIYA 2YUOA 2MHEA 3KNGA 1W2BR 2XSFA 2YWWA 4XDDA 1G4CA 4M77B 3N5BA 3O6QA 3ULRB 4J83A 2I5JA 3OLAA 4URGA 2VICA 4DV1F 3B6BA 4I2PA 1M1KT 1Y00A 5HJYA 5GAGI 5B7WA 4DSIA 1G6BA 2DVJA 4PK4A 2DAQA 1NJIR 2DHAA 3CD6S 1GBQA 2IRXA 2X3XD 1GMWA 5MAOA 1T3SA 2ZZNA 1Q5VA 3EAEA 4IIMA 3H0HA 2YQ2A 1RAOA 3IR5B 4LBPA 3RDVA 2YX7A 4NOHA 2COYA 2K7AA 2B6AB 3HDSA 1NK7A 1Y71A 3NGKA 1MROB 5DDQC 5M2UA 5GMKi 4J6XA 1NPPA 1H3DA 3CC4T 3PEJA 3NKYA 1YRXA 2ZDOA 4FCYA 4J5YA 2OFGX 4P2MA 5KFGA 5G0RB 3KG1A 1NXIA 5AT1B 2XMMA 3GJTB 4A4FA 3DU6A 4ESRA 1Q82R 2HNYB 4BE2A 4N4HA 4OMOA 2OHDA 5KG7A 2IM1A 4TQRA 4DR2J 1Y4ZB 4J9PA 3OYFA 4JUVA 3HHDA 3HRUA 1DLOB 4M77G 3VS1A 5DG9A 4USMA 3HHLA 3EHQA 5HVFA 2OTLA 4IFVB 2Q66A 1S1UB 1U1MA 4PKDB 3G87A 2DPJA 1K1ZA 5E33A 3OYEA 1VQMA 2GFAA 4DUYJ 4DV3F 4Y3CA 5GMDA 2XICA 1TELA 4E7LA 1AFJA 2GS8A 4FW2A 3DB3A 2VG6A 3AJ2A 3OS1A 3HSGA 4N47A 1SKWA 1EIFA 1UEBA 3IBWA 1VQ7A 2DZCA 3M9MB 1YHQQ 2MLYA 1TUGB 5CH7B 2EYYA 1HBMA 1GX5A 3NS6A 3PXGa 1P6TA 1ZM3A 3CCEA 2FJEB 2SEMA 2ROEA 2QRRA 3EJMA 1EX8A 1XMOJ 3CCJS 3BZQA 3WX8A 1VQ4S 4QIFA 4F4ZA 3IS9A 1S6UA 4N76A 1R77A 3M8YA 2AHOB 5KYWB 3P6YC 3JB9G 1UJYA 3PRVA 1N34J 2NSBA 1T0HA 4ELZC 4ILMA 3OJUA 2D3OR 2CG8A 4RCCA 2XSJA 1RLQC 1G3WA 1YJNA 4OJHA 4C8OA 4F04B 4C0OC 3WHIA 4Q45A 2CPYA 2M0YA 3RESA 1VQ5S 1RU2A 2APOA 4C0GA 1TP7A 2VXFA 2LXFA 2YQ3A 5LJ5j 1RB0A 3MHXA 4V2SA 2CZ0B 3R2CJ 3MPVA 4G1PA 1PC0A 1KONA 2DB1A 2WOMA 1UEUA 4FYWB 3ILLA 2C2RA 3QYHB 1YWOA 1OY9A 1KWMA 4C92F 2EKNA 2CJQA 5L1KA 2MI6A 1RT3A 2W8LA 3M56A 3HJFA 3W8GA 2P8IA 4F16A 1SC6A 1VQNA 2AEJA 4HCCA 3T5LA 1HWUA 4ZVRB 3R5BA 1TAQA 2FLPA 5CO7A 4DF8A 3R7NB 5FRMA 1PKTA 4KJIA 2DL7A 3OTCA 2MYSA 1UA0A 1FTRA 4LF5F 3QPIA 2RMOA 4GKJF 3M5AA 1KHVA 4C97A 1VQ9S 2H5JB 5DLOA 1M5HA 1E7OA 1V6HA 1BBZA 3FRYA 3X26B 2DO0A 3H41A 1FJEB 2LCWA 4M1KA 2JM8A 2OLWA 4DFPA 3CJKA 2DEUA 2YLBA 3LWHA 1U6BA 4ZVSB 2OH2A 1YDLA 2KI7A 2UVUA 3VHQA 5CD4H 3CCVS 4QPTA 5K20B 4DL0C 3O8VA 1XBWA 3AXMA 3OFEA 4WE1A 4MKVA 1VJQA 2ZD1B 1VQ5A 4KY3A 4F8RA 2B9EA 4E7IA 3EUNA 4L76A 1FYNA 4M5IA 4A8QA 1OQ6A 3MMCB 2ZJRQ 2KYBA 4P9SA 2OSQA 2F4VJ 4O3RA 2AZ1A 3GCXP 3T5HA 3BBCA 4O3PA 3PO5A 1HBUA 4ZLNA 1M5KC 1IBKF 1QAJA 2UUBJ 3GP8A 1QAIA 5A0LA 3ZL7C 4NZ6A 2OPRB 3CD0A 3CCUS 4OZNA 3O8WA 1XOVA 3UR3C 3THKA 2K3BA 4CH0S 1RUWA 4F3OA 3TSWA 2QE5A 4RW4A 1ZUKA 1RDRA 1Q7YU 3BSOA 1SSHA 2RS8A 1FD2A 1QVGR 5FWBA 3G8QA 5GJVB 1SVDA 2IMOA 3TU4K 1PRMC 2MAMA 2XMFA 2FPFA 1T7PA 2IFXA 4HH1A 2OTJT 2AKWB 3FNNA 2MWOA 1Q7YR 1WGSA 1R0BG 3ZEHA 4KHPF 2OGUA 3EFOA 2EYWA 3OR2B 4JI4F 3KWMA 2BJDA 1RA6A 2FGCA 3BH6B 2VQFJ 3LGNA 3R5GA 3PACA 5A8KA 2COZA 4W92B 4FM4B 1S0VA 3MOJB 1OEBA 1ELOA 1ACMB 3M2VA 1WQWA 4KRWA 4BB7A 2GCXA 1NK6A 3RIRA 4HDGA 3JQJA 1BE4A 1BMQB 1U1PA 2DNPA 2RJCA 2OEJA 3TAMB 2XYGB 4B9SA 2RHZA 1VQLA 2UUAF 2MEWA 4L73A 3UCUP 1BI0A 2C0OA 1RWKB 3EGWB 4EO8A 4Q2MA 4PLLA 4NCGB 3OYBA 2LXIA 3CGIA 1BD6A 3KUHA 1FX7A 4D8KA 5HMZA 2GCFA 2HQIA 2MLZA 4WFZA 3RERA 4C0FA 5L9NA 4KGZB 4RW8B 4PXDA 3BYPA 4LFCF 2DRBA 1LFPA 2K9GA 5LXRA 4PFPA 3FGVA 3JB9J 3ZZTA 4IUQA 2ZH4A 4HKEA 4ATOA 4HHJA 1K47A 5J1EB 4NZ7A 1ZLMA 1PIEA 1QTNB 4DSKA 2JEIA 4OX9J 2RHIA 3CCQS 3CBPA 4KV8A 1LCKA 3WDOA 2CYYA 3CCLA 4K4YA 3Q83A 3VS5A 4LBHA 1RL2A 2KYMA 5KG5A 3JSBA 4J7CA 1OU9A 3HSDA 3CCRA 3EXCX 5HMYA 4NXMF 4BC7A 1WEXA 5A2QU 2F4VF 2E66A 1OZ2A 2X4XA 4BHQA 4FSXA 3LF0A 2NXCA 4ZCKA 2XY6A 3M4XA 2ZZMA 2EFOA 4X9CA 3OTBA 2CPIA 4WJBA 1JQQA 3CDEA 3QMQA 3W62A 1UUEA 5KFTA 1MUZA 5B0EA 1NAQA 1U5SA 4A0UA 2E1RA 1KD1T 5CAIA 3VAMA 2PTKA 4KHRA 1YSJA 1QVGS 2W2MP 4RU2A 1RADB 3GLJA 2HHPA 2PO4A 3BFMA 1UPPA 3MFIA 3TP2A 1EKRA 3OYMA 2DGTA 2AIRB 2HK3A 3S7RA 2MQPA 2KT2A 4WCEQ 3OBIA 3RMQA 4RW8A 4FS2A 1WACA 1ZA2B 5CXTA 4PG7A 1V5IB 3ZZZA 2HFUA 3V8LA 1WG4A 3X24B 3M59A 2EFPA 2A7YA 1ZBXA 3MM8B 2PIIA 2EFIA 2MJNA 3EVWA 3REBB 3DOMB 1GFCA 3NS5A 5B0FA 4ER8A 5F9LA 1R89A 2G3RA 3GFHA 1OSDA 3D67A 2CQ0A 3LAKA 3RBXA 1G3YA 4NL3A 5JMNA 2OKQA 2XMTA 4DV1J 3FKBA 3UWTA 4RTVA 1JX4A 1H73A 3M8PB 2HS3A 3H9NA 1X69A 4HCKA 2M52A 2LU2A 2J7IA 2KZMA 3GYGA 4QIWD 3U23A 1X2QA 1FVSA 2DT9A 3HHNB 2XK0A 4OB0B 4DDFA 2GQIA 5CYQA 1FMWA 2BABA 3QYYA 2HHWA 2L08A 2CZ9A 4QQDA 2EQMA 2M0GB 2GTJA 3F44A 4UZCA 1RTIA 1GNKA 2A2CA 2DIVA 2YHTA 4CC3A 4WFXA 1ZSZA 4QU6A 1RHJB 1UP1A 3L4BC 1TFYA 2XZWA 2C2ZB 4N77A 1T9VA 2CADA 5D78A 5IV4A 1R0AB 4HACA 3SCLE 3K5NA 1PILA 3PYFA 1UFWA 2Y1JA 1RJJA 3T9ZA 1JLQB 1FE0A 2OO4A 4HEA9 1B99A 3M8SA 3POTB 2CUDA 2A28A 1LXNA 2RHSB 2Z2LA 1D0EA 1S1NA 1LW0A 2NUTB 1JKHB 3GIIA 1TL7A 3DOKB 5F8JA 4XK8E 5CYJA 4UT4A 2VA2A 1BLUA 2W9CA 2BJ3A 2YKNB 2PU9B 3I9ZA 2VJUA 2PGCA 4AXIA 2J9EA 1Q1KA 2F5TX 3MKDA 1LWEA 1UWAA 2LYVA 4X65J 3NGTA 3RAMA 3MPUB 4M5MA 3MEDA 1N6QB 1ZM9A 1QAYA 1YJ9A 5I2SA 1MMAA 2CDTA 3JCMh 1X0FA 2MKYA 3W61A 2OEMA 4O44A 2DRDA 2PC6A 3NEKA 4B9LA 1FFGB 3D6TB 4K0KJ 1O9SA 2ZHBA 5HBMB 3HP9A 2FLNA 4DR1F 1NZ8A 1KLMB 1J5OB 4IFYB 5GMKh 2RQCA 2ZH2A 2O66A 2IPOB 3OFGA 1NYFA 5D8HB 4X64J 3H5UA 2CJAA 2IG0A 4MZMA 2V8JA 5KT7A 4OYXA 3W2WA 3DLGB 4NYPA 4K5RA 3GV7B 3KLFA 2BZYA 2HURA 3MR6A 3HVTB 4J6WA 4L3KA 2MTLA 1FDDA 3FSXA 2R2TA 5CKDA 1PD1A 3HTRA 4DPUA 1FJCA 2MMPA 1JJCB 2NYHA 2HQFA 4LMZA 1M1KR 4BDZA 2WVFA 1QDUB 4JI6J 3PYEA 5I11A 5RUBA 4ECSA 3A3OB 4LF2A 4TNOA 2E44A 2Y8WA 4OHWA 2HYIB 5KFBA 4C0HA 3VS4A 4M75C 5GAMg 3DB4A 3EHRA 4QQBA 2Q6BA 5KFVA 1Q7YT 2KBTA 2CQGA 1G1XA 3ME9A 3HL8A 4IFVA 1VQ8Q 4FW1A 1YHQS 1GMWD 3CUNA 2M9UA 2CZ4A 4ESNA 4F7UB 1WNLA 3D9BA 4EZ9A 3Q8YA 2MKSA 3M58A 4GBQA 3NGRA 3CCJQ 5L39A 1KNZA 3I0RA 1UG1A 1D0ZA 1Y5LB 1ZSZB 3KMQA 1PHTA 1NMEB 3KFVA 1FRJA 2N7CA 4W98A 2RQKA 5GMKl 3AD7C 2BE7D 1KQSP 1S9GB 2OI2A 4KBMB 1NK4A 2KNBB 2CS7A 3UI3A 2LC4A 4FF4A 3JCMV 4I2QA 3SV4A 1NH7A 4B08A 3DN9A 4IH6A 5LJ3f 2BDPA 2Z8QA 4IQXA 1VQOA 4Z8AA 3EGDB 4PG6A 1R8BA 1FXDA 1DAXA 2FHJD 1XR7A 2AMCB 3NRBA 2OEKA 1RWOB 4R0KA 1NJWA 1CJKA 3PNWC 3P8BB 3VAIA 3P5TL 1H2VZ 4OX9F 3T1HF 4E47A 2IBOA 1RUSA 2RHUA 1WXBA 3D6FB 2LX9A 5C7PA 5F8LA 2PDAA 2J8AA 4M77A 4AQYF 4DSLA 4X4UA 1IQZA 2XMJA 3ZZOA 2XU8A 4ZVHA 2CGHA 1WHVA 4B3RJ 3HHTB 1FNMA 2RDDA 2JEJA 1FDNA 2DHGA 2EBPA 1YJ9T 2KYXA 3FBCA 3PTWA 2PNIA 2J0SD 1QVGA 1VYVA 1NNDA 1SI9A 4DOZA 3OYHA 2XULA 3DOMA 3Q89A 4Y2IA 4P52A 3FEZA 2GZOA 4ZJOA 3IG1A 1L3KA 2ZOFA 3SD4A 2UUTA 5A6PA 3CJQA 2RRBA 1M1KC 1S72Q 3NCRA 4WFBQ 4YB7A 1U45A 4NL2A 4L59A 2K3KA 1SV5A 3IFEA 3GU0A 3RRGA 3UA7A 5GAMj 4A48A 1IGUA 2ZPHB 2QZ8A 2QLXA 3K8VA 1SJ1A 3V2UC 1JXEA 2CQIA 3BS9A 3H7HB 2Z0WA 2CPFA 4PWUA 3THPA 2C0IA 2HEKA 2DD8S 2E65A 3RU0A 5IM0A 2A3JA 2EK1A 2R7WA 1W2IA 4LJMA 3I55S 5L1JA 3BJYA 3V5RA 5KFRA 5HK4A 3JV3A 3FRZA 1X43A 2CNOB 3CW2C 3DNCA 3QFHA 5DLFA 4O0IA 3QIIA 3CCLQ 3MCMA 2HZAA 2C3PA 1JLCA 3ET6A 3KLGB 1T9UA 3QJLA 3CCQT 3DDIA 2W2OP 1V3SA 1M1KU 2VFRA 5D4PA 3CE8A 3WC0A 2XG8D 3BDLA 1VQMQ 2VUGA 5ETMA 4AFZC 2RK2A 4RTXA 1SL2A 2VA3A 3G82A 1MMDA 4JUZA 1JJ2R 4Z2XA 2L0AA 1F3VA 2I9SA 4XTYA 2CJXB 2ZBQA 1DJ0A 1UGRB 3Q2SC 4AL5A 2GHVC 2RN8A 2RHYA 1X4DA 4LRFA 1CLFA 2WSCC 4NXNF 4DCJB 4K59A 1KP6A 4USUA 2NXUA 5KCOA 3BV8A 1C2PA 3I0RB 4LF8J 2B8AA 1Y3KA 1N4LA 5CKFA 4KGMA 3CCSS 1PD0A 5KFQA 4KBIA 2JZ2A 3HPWA 3SB2A 1Y5NB 1QE1A 1H74A 3CXCS 3M9OB 4HVZA 2D3O1 2QA1A 5DQHA 1URNA 3JCMe 1HSQA 4AD6A 4U8YA 4AL7A 4FSSA 3E9GA 1U1NA 4RUBA 4QIEA 2B9WA 5KG3A 1D3BB 4Q43A 1FJ7A 3AA9A 2HVDA 2CKKA 4A8WA 3Q8UA 3MCOA 3OR2A 4E7JA 3J7Z5 1K4US 3I5RA 2OD6A 4IH7A 2EFGA 3HHEA 2XLKA 4DL2A 1RHUB 4ED6A 2DL4A 3T5KA 1AEYA 4CRJA 1O75A 2V34A 2VBYA 1YN8A 3PMIA 1Q79A 4WE1B 4ZOSA 3VS0A 4PJOG 1TL4A 3SWNC 3GFZA 2KY9A 4QYZK 5IT0A 1GXUA 2CNKB 4NLRA 3B4MA 2DGSA 3V6JA 2FLOA 2K3XA 3RKWA 1NDPA 3BSAA 3H0PA 2QJ3A 4Y28E 2IAJA 3OXFA 1FXRA 3NGDA 5F41A 3PRDA 1GEHA 3FIFA 1VC5A 2YPYA 1SKUB 3DLEB 1WA7A 2LVMA 5HROA 2BIVA 2HLTA 1FXLA 1MMLA 3OXLA 1S1TA 1WORA 3D6MB 4LF6F 3T1YF 3MEKA 2CJKA 3CCSA 1ZPWX 5LM7E 4DR1J 5DDOC 1R31A 1ZUYA 4RWWA 5KFNA 2MKKA 1RWWB 2KDSA 1QP2A 2ROLA 4NASA 1FDBA 2I0NA 2KR3A 3CD6Q 1U0SA 2KU7A 5CR2A 1N5ZA 2EGEA 2NXNA 2J05A 4EMHA 2GW8A 3CO0P 2X1FA 3ICLA 4PR6A 3DKMA 1RWPB 4C0DC 4DV4J 3KJVA 4E2FB 2WOMB 4AG1C 2YQ1A 4PG4A 1K9MU 3TANA 5KFJA 2ZOGA 4ELYC 3QQCD 3VWSA 3NL0A 4DCPB 4N7TA 4YFUA 1AFIA 2V8KA 2G9OA 2CP2A 2ASLA 5I42A 4B17A 3MPWA 2MZ1A 5KOXA 1SC3B 5CHCB 1EFNA 3AB4B 1TL7B 1RTZA 3GTYX 3LH2S 2R5MA 2UXCF 5K8OA 1T95A 1UL3A 1FJGJ 1NHVA 1HK9A 5F8MA 2BBEA 1W6XA 4UUXA 1WQ7A 3UNYA 1ZAXA 4JPBW 1PC4A 3LO3A 5GMKa 1NSAA 3RGIA 3AD8C 3DCAA 3U7JA 1JLQA 3MD3A 2V1QA 3HO1A 3CCRT 3NTIA 4YTLA 1Y7XA 3SDEA 3N6LA 1N33J 4FF3A 4LXCA 3W63A 5GANd 1D0XA 4DS5A 2AX0A 4EI2A 3M2RB 1I1JA 2FL7A 1VQKT 2RDJA 4C92B 1WC3A 1HNWJ 5IH2A 2LEPA 2J6KA 2QFJA 3CMET 3T19A 5IOLA 2IY5B 2OTJQ 1FKPB 3PIOA 1WOOA 3GIKA 1OPZA 1YVFA 1BQNB 2FZGB 2MQMA 3OY9A 2F1FA 5KYXA 2YY3A 1ABOA 2E7VA 3KG4A 3TVTA 2DBBA 3META 4KH0B 2DEJA 2YLCA 3GR0A 3MEWA 1YI2Q 5KT6A 2YNHA 5EWGA 4NLYA 1Y5IB 1VQ5T 1M3AA 3QT6A 3QATA 2ZWPA 1W7WA 1LWCA 2MY7A 4C6AA 2LMJA 2D6FA 4MK8A 2ZH3A 2GHPA 2I8EA 2CZ1B 1NH8A 1VQSA 1FWZA 1IKXB 2E9RX 1WTFA 3UDLA 3I5SA 4OYWA 1NB2A 1IJEB 1MNDA 1QE1B 2W7AA 3RB4A 3CSKA 5GAN4 1EP4A 3B8HA 4UOCA 2B8PA 1U1RA 2JOQA 2DL3A 4HL9A 1TL3B 3W9HA 1MWQA 4XPEA 2IJNA 3LGMA 1IR2A 3W66A 1OZ3A 4KSEB 2AQ4A 3L7OA 7FDRA 2MCNA 3CBOA 1WG5A 4ZJQA 4DR7F 3FDSA 1V1CA 3FDRA 5IAYA 2AEMA 1FF2A 2K5LA 4ZLPA 3K0JA 4F36A 3QZ5B 4CO1A 5HANA 5DZ7A 2R58A 1VQYA 1WWHA 3KTQA 2YX1A 3OFHA 4Z02A 2BJ8A 4EYIB 3VAHA 4GVBA 4IOAQ 6FDRA 5A2QY 2EBEA 5LJ3d 2W4DA 3FQLA 3RRHA 2HL3A 3CCJT 5K14B 3VUZA 3CD6A 2ZUGA 4CLPA 2CVIA 1LQ9A 2H51B 2DJZA 3LP0A 1DQ9A 2XMAA 2MPUA 2HQ3A 2W7PA 1R3NA 2DISA 1Z9QA 4RO0A 5KG6A 1YLXA 1YCYA 4RG8A 5D15A 4LE9A 1F0XA 4LF5J 1U48A 1MW7A 3G4SS 3H90A 2W2NP 3KFWX 2FB0A 2D9TA 1M8VA 4ATNA 5CQYA 4B3TF 4DL3A 4PLIA 3QGHA 3TA1A 1IHWA 3UN2A 2CT4A 2JLGA 3JTOA 1XR6A 2E5GA 4M63A 5LJ5d 4J9FA 4XDCA 3JB9D 1N27A 2DKGA 2MKHA 2D1XA 2WVCA 1O51A 3R5DA 2XMKA 4TY8B 4DR5J 3V6HA 4CLKA 4LN2A 3KLGA 4ED1A 1TVRA 4CM2A 2PQWA 4PXCA 2GQVA 4B9MA 5I4MA 3IBCB 4USIA 2BJEA 1XERA 4WFNQ 1F9EB 2L3QA 4E7HA 5LL6S 3OYNA 1V3ZA 1X4EA 4YP3A 4ZVFA 1B70B 3PE0A 1EKSA 3IC1A 1N5SA 5T41A 3QKJA 4DCOB 5FROA 7FD1A 1S6PB 2XCPA 1WC0A 3DYAB 2JH3A 4TXSA 2C2DA 2FHDA 4RTTA 2BEFA 4ZPTR 1UHFA 3GP9A 3ZTOA 3FBEA 3KHRA 3UD4P 1RT1B 1CJVA 2HQXA 1G3TA 1WUUA 2KXHA 3W60A 3VGSA 2CQBA 4IG0A 3VYHB 1ZAVA 1QWEA 4KGXB 2HWIA 2Q3PA 4M7AG 1HPZA 1KRPA 1RP5A 3ZZPA 4FNIA 4GLMA 4U95A 1A0NB 3KJNB 5L38A 2QLBB 4Y2MA 2LX7A 1U3OA 3CCST 3OMGA 2DR7A 2QA4T 2HVEA 4RMOA 4DV5F 2G1HA 1TZ0A 2EW9A 4EBDA 1H38A 4OMQA 3TI0A 1EETB 1RAFB 4H4OA 4CLYA 1QSSA 1ZUUA 5B08A 2J06A 2E1PA 1ZTWA 4MIAA 1BQNA 1NK9A 2WK4A 4C92G 2DVEA 2AZ3A 1VQ7Q 4MFBB 4IUFA 1WSVA 1VQOS 1UGQB 2UVWA 1MU2A 3NBPA 3NGPA 3CCUT 3H4BA 4JI1J 4EDUA 4WIIA 2XB2D 3QO9A 4JZ4A 4LIRA 4UOFA 4ETXA 5GANg 1EARA 1J5EJ 5KFZA 5EDWA 1RK8A 4I64A 2IIHA 2BMBA 3O44A 1RWXB 4DBFA 1QSYA 4HCBA 2J7UA 3B78A 5L8RE 1YJUA 3P4UB 2OMLA 5KYNA 1IKWB 2RJEA 1VQKS 2JMCA 1B64A 2DZ9A 1YITQ 2EW3A 4OGCA 2EYZA 2BOPA 2VZ9A 4P10A 3JB9F 4UY85 2JZ5A 3M2RA 1IQTA 5KG0A 1IKVA 2CQ3A 4QVDA 1AHJB 5AJ3J 4CYUA 2RU3A 2VPZB 3GWCA 4RW7A 4ZHRA 2LEBA 5IZHA 3K59A 1LK5A 2RRAA 1D9DA 2BW7A 2E1HA 4FVMA 3ER0A 1S9EB 2FJBB 1IBMJ 1RTHB 2Z58B 3MEDB 3J81Y 2NUZA 3W9IA 1SRMA 1VOMA 3EVOA 2QSFA 4M7AA 1M2VB 1JB0C 1Y9OA 2ALYB 3CCMT 1X9SA 2QGGA 4NI2B 4R8UB 3RB3A 3DGPA 2XHWA 1UFFA 2U1AA 2AYGA 3KNAA 4J90A 2CPJA 1YKWA 5M2PA 2C42A 1D9FA 2YX4A 2ED0A 3O5ZA 1GCQA 4RW9A 3T1YJ 1IBCB 5LMUJ 3KK3B 4OYOA 1RTIB 3G8TA 1RT7B 2VB6A 2L8DA 3CWJA 1KC8U 3OYCA 3MM9A 3TZZA 4NYOA 4IYQA 2DYBA 3I56A 1WHMA 1HD3A 2Z57B 4C7QA 4ECVA 4HI2A 3E51A 3JB9k 4BD3A 1F1BB 2M0OA 3V8KA 4NLVA 4F0HA 3KK1B 1S7HA 1RAEB 3QNWB 1PGZA 4TN2A 3CO9A 3SSRA 1Q86C 3C0CA 4B9VA 3EWGA 2UV8G 3CJ2A 2XSJB 4ERDA 4ECWA 4NCBA 1N54B 3DLEA 4OMMA 1G83A 3CPWA 2BW2A 3E9FA 5K5MA 2GVZA 3NNCA 2OSRA 2JNGA 1JLGA 3JSCA 2DNLA 4X66F 4M7AD 4MFBA 4NMXA 5L1LA 1VQLT 2QT7A 3CF5Q 1VIOA 2D3UA 1J5EF 1FVQA 3Q8PB 2HHXA 4C92C 2EG1A 4M5LA 4Y2KA 3ETOA 4TKTA 2ECZA 3JAME 4ZCLA 3VTIA 3TVYA 1MWYA 2FRWA 5DETA 5EWEA 2PA3A 2G2ZA 1VIFA 1I81A 3RKYA 4GMKA 2DE0X 4TVAB 1NKCA 2V9WA 4OMFB 3PFEA 3OYGA 4JI0J 3UF4A 4J9QA 3A8KA 3JAMU 2LECA 1VQ7S 1PSEA 4WXOA 2IJFA 3TAPA 3G9CA 2NUPA 4FBUA 2M3DA 2YNGA 2AJFE 2RJZA 2DGOA 3INZA 1KQSS 3LP1B 3PCOB 4P73A 3QJJA 3J7YU 1H0HB 3EPIA 1JNZB 2CPHA 1QD1A 5KE2A 4X4OA 2JTMA 1RTDB 1JLEA 2QXFA 3B4DA 2CT3A 2VKNA 3D5MA 3BEGB 1T03B 1ZBTA 2VFUA 3CCMS 1IR1A 3ZC4A 4LRAA 1VA7A 3MM9B 3DLLA 2BQ3A 1YJ7A 2P4TA 1RHRB 1R8CA 4OYPA 1SQFA 2J0XA 2B4PA 8RUCA 3CBMA 1HHQA 2MZRA 3CPWR 3J80Y 4OYZA 3QT8A 2WW4A 1Q16B 4ALZA 2WSFC 3MMAA 3THVA 4U8VA 3SFGA 1WHKA 3C3LA 2GIFA 1T0JA 1K0SA 3DRSA 2AT1B 1KC8T 1KVIA 3BGLA 3DRXA 1RI7A 3QSUA 1B0PA 3TO8A 4XU1A 2FB7A 1SXLA 2AJQA 3OYDA 3N01A 2D74B 3R1LA 1M2VA 1Q95G 3EGXA 2CWKA 2EVZA 3A8EA 1NB7A 3I31A 1VMBA 5D6GA 1LPLA 1C1CB 4BACA 1FKAF 1VISA 2G2YA 2DM1A 2L5QA 3EE3A 2YH1A 4K0KF 4ZCIA 3REAB 3AOAA 2PN6A 1NU4A 1NDCA 3QO3A 3KLIB 4HTJA 4OJGA 3MM5A 1WEYA 2DL8A 4PXBA 2K5FA 1AZEA 2E9ZA 1Y96A 2RHQB 4LR8A 4LF4J 5EHHA 3V4MA 1LNXA 1UFKA 4F4AA 2K79A 2X1BA 4HT7A 4O4RA 4A8OA 4ID8A 3QG1A 2ILZA 2BUNA 2X3WD 2ZKUA 2PUKB 1C0UB 4DF4A 1IR0A 4CLSA 3OW2R 1SG5A 4BUGA 3ENVA 8ATCB 1UVNA 4HT9A 1U4BA 3MP1A 2DIQA 3HHLD 2K57A 3W3SA 3ISZA 1UCNA 1XC9A 5LJ5e 4OIXA 2V8GA 5E2QA 4LFBJ 3CCVA 1OX9A 1QLYA 2HAFA 4M77E 1V9OA 1VQNT 5IHIA 2I1RA 3K5PA 4KULA 1TMMA 4DG1B 4F3MA 1TR0A 4M5DB 1NKBA 4K7QA 1KDNA 1X6GA 3SWNA 2E6ZA 2MKIA 3VU3C 5G0RA 2BACA 2DGVA 4DV5J 1TTHB 4IKFA 4KT0E 1KQSA 1YG0A 4L74A 4BBYA 1G7CB 4QWEA 4M7DF 3ITHB 5H1SV 4MYUA 1XNQJ 6FD1A 4F02A 1EIYB 1Q8BA 2QAZA 3BN4A 4C11A 2HKEA 5LJ3e 2WSEC 4QWAA 3GJRB 3EDRB 3ZTRA 3W5XA 2ZPBB 3CC7S 1T9YA 2XDPA 2WVBA 1KEKA 1W2BP 3FC3A 1F6TA 2E5LF 2IM3A 3VGTA 4ZP9A 1PKSA 4ZDNA 3RG6A 4LSLB 1WKKA 4I6AA 3RBZA 4JI8F 2B0GA 3E2UA 4DX6A 4F0MA 3V6DA 3AFGA 4RKUC 2QC3A 2JTEA 1N0VC 3PW7A 5IWAJ 4MIBA 4DSJA 3TUPA 4OI1A 2DBKA 3A8JA 3M9QA 4JZ3A 3HFNA 1X27A 4A8FA 2K6DA 3TREA 4DS4A 4BS2A 1RWNB 3E2EA 3TEHB 5CA5A 1M1GA 4MJKA 4C8QB 1RHQB 4PQAA 3S3OA 1RCXB 2CNLB 2HKNA 3RB0A 2OJ3A 2F5KA 1GFWB 3BQ1A 3BKFA 1OQ3A 4K4XA 1CVJA 1OQKA 4LDVA 4J9VA 2NUUG 1E6YA 3P8DA 3V8JA 1VQ8S 5BXIA 1K44A 5CKHA 3H42A 5IQ6A 1D8ZA 4KFBB 2B4OA 1PAUB 3DLMA 2EWNA 3EDQB 4TY8A 3C16A 3V7CA 1Q82T 2VG5A 1VQPQ 3K7RA 3O5TB 1UVJA 3FBFA 2X4YA 3TRGA 5IN1A 3LQVA 3JAMY 4CLTA 2RA2A 3F70A 3IM9A 3OXGA 3S6EA 2JEGA 4BC9A 3J7AF 4MIWA 1M9SA 5F8HA 2YKQA 3J80U 2LVWA 4NLXA 4FS1A 4C5HA 5J2NB 5J26A 4KR0B 1UVLA 3OMCA 2CDQA 4EBCA 3ZFVA 4GO5X 1U8WA 3Q8SB 4IKAA 2Y8YA 4M7DB 4A8XA 2UXBF 2RQUA 4HLBA 4C98A 4IDKA 4DN0A 3PZPA 3CDBA 2W9BA 3PIPQ 3V6KA 1NYGA 4I0WA 1AZSB 1BY9A 2VBXA 3CC2S 1IBLF 2KRBA 2GQ2A 3GPAA 3PHTA 4UQTA 2YNFA 1U49A 2QK0A 3NPFA 2BE2A 2IJRA 4EPCA 3FB9A 1Q81U 1JLAB 1N52B 1PCAA 2ZHAA 1YI2T 4C92A 4B9NA 2DXTA 1KD1U 2NSCA 3UCZP 1KOHA 5K8MA 4PJOB 1WJQA 4F4KA 2V5HG 1REVA 2G0JA 2OPSB 1U2RA 2YRDA 1IM6A 3GIJA 2A6OA 4Z7CA 2E70A 3SQGA 2FQQB 3A98A 2PI5A 1JEGA 2MSSA 5I2MA 1GRIA 2ILYA 3BY7A 1R8HA 2VG6B 2YKAA 1T9WA 2HFVA 1MV3A 1QJHA 2O4XB 1KQFB 4G1QA 2ZJPQ 1LKZA 2BKDN 1D1UA 1QVFP 2JVOA 2YKNA 4DR3F 3CCVQ 4LF7J 3LLRA 5CK9A 3PFOA 2F63A 3CTRA 1YGYA 3DLJA 3NLCA 1RTHA 2OPQB 2B56A 1RZMA 4AFSC 2EFNA 4YR0A 3MAAB 3DI6A 3SI8A 5F0UA 3R9LA 1U2FA 2M9KA 4FYYB 1X4GA 2VONA 3KK1A 1MN9A 1NLPC 4IOCQ 3C14A 1SHFA 2Y9HA 4PXEA 2YNHB 1WEZA 2FJDB 1IKVB 3FZBA 5I22A 4XPCA 1BIAA 1HW8A 5LOQA 2QA4G 1UWBB 1UVIA 3EG3A 4LVNP 5C5JA 3RYLA 1WOPA 4U7CA 1FKOB 1SQEA 4OGEA 1D3BA 2LJ0A 4PZVA 3K2YA 3SMZA 3MO8A 2XZDB 2XYPB 5GAHI 4CLUA 3CJ4A 4O4GB 3FJ2A 3AB2B 2W4CA 1WI8A 4CTAB 1IKWA 3AHUA 1GX6A 4JRPA 1MGQA 3IQLA 1VGYA 4TLRA 2D41A 4P7VA 1OULA 4KKOB 2C2MB 3QLHA 1FRKA 3Q8RB 3NS7B 3K57A 4YHHJ 2DXCA 3LAMA 5KFPA 3BREA 4C8QE 5KAKA 1N34F 2C1EB 2L3MA 5DJBA 5J2NA 4M7DC 2XDDA 1HARA 4LF4F 3M0RA 4AFQC 1SB6A 1WC4A 1TK8A 3ZTQA 2HSEB 2CQ2A 3CC2A 3LANA 4Q8FA 3QBYA 1TXQA 1CJTA 1B0VA 3BM7A 3TJAA 1IWAA 4R25A 3M2UB 4LFAF 2EKOA 4O3QA 4OV1A 3MGJA 4PJOF 1S9EA 4DPWA 4H4KA 2H3EB 3T1AA 2XBPA 3CJ5A 1KFZA 2DK3A 4ED4A 4X62F 1WTBA 3B54A 3ZTPA 2X4JA 3D28A 2WCXA 4LDUA 3OLBA 3H2VE 1ZA1B 2FJAB 1BWEA 2LNHB 5J1EA 1H92A 3MP6A 1BKBA 1I3OB 2ACMA 5DQGA 2YWFA 4LIWA 2LQJA 1QQJA 1KG1A 4Y65A 2QEXT 2H65B 4MKAA 1X31C 1YJRA 4XTUA 3ISND 1SJ4P 2F8EX 2QDYB 3JCMd 2UU9F 4XTVA 1YRUA 5KYWA 1WXTA 4LVOP 2NCKL 2OELA 3GV8B 1C1CA 1S79A 3I5CA 1WF1A 3GNGA 1M5VC 3D2WA 3KJQB 3OSNA 1C0TA 1X5TA 3IO1A 3CCEQ 1D9AA 3CC4S 2CQHA 3KG0A 5GAN2 3GF5A 1YWXA 3L9ZA 4C11B 2A6MA 4YEAA 1WELA 4JP8A 2DGQA 2PSZA 5HLFA 3KOAA 2MYFA 3AQOA 3ETMA 3M8WA 1ZAWA 2W2PP 2IAJB 5HJXA 2ZH7A 4DV2J 3C6UB 4LUEA 3QSYB 1Q8LA 4J9SA 5J2PA 2GBQA 2KMTA 2MB0B 2HZCA 1DARA 1DQAA 1K0VA 4FDFA 4B3RF 3N0VA 3TQ7P 3SBMA 4JI7J 1I6JA 2ATLA 4U6PA 4F25A 2LFVA 3CJSA 1HWKA 1HQEB 4TLQA 2QQBA 4DZDA 4PFZA 3G6ES 2AKLA 5C0MA 3QBCA 4AFUC 1S49A 3CD5A 2DTIA 3VZIA 1Z4UA 2Y4YA 2K1RB 4DBRA 4C8MA 4JS5A 1FESA 3MPYA 1IBKJ 2MKJA 4DL4A 1Q81T 2VGMA 1YJWS 1M1HA 2DNMA 1D1BA 4RNHA 2XKOC 3S6WA 3EG9A 1AVZC 3DMJA 1CJVB 1RWMB 1UWBA 1VQ9T 3BGRB 1K8AT 1JJHA 3PJWA 1ARKA 1S0NA 1TKDA 1B4SA 2BZ2A 3MDFA 4P74A 1RE1B 1CULA 1C0MA 3IRXB 1C4CA 2OPRA 5T7LA 3H98A 3H5YA 3JS9A 4ICLB 1VRTA 1AB8A 5GANf 2LA4A 1HBOA 2QA4S 2YT6A 4X9DA 2BZXA 1NSQA 3RR8A 3M8QB 2OPQA 5E3AA 4ZGDB 4CRIA 4ZVOB 3QRRA 3PW2A 2EAYA 4ZK7M 5C6SA 3OFFA 4YY3F 2WRMA 3AXKA 2H5IB 4TU8A 4J5OA 1YJNQ 4J9MA 3R6OA 3ZO7A 1NZ9A 4X62J 3CJ3A 1TS9A 2FEIA 1XNQF 1RAGB 4USKA 2R7XA 5KFAA 4DV6F 4EFAC 4OX8A 2NPFA 4PWDA 2NREA 2XWYA 5CCLA 2JJ4D 1RT5A 2O9SA 3KMSA 3HVTA 3BO3A 3I82A 3I87A 1I4K1 3DDKA 4ORZA 2LCSA 1RCOB 3CXCP 1J27A 1HNVB 3FEXB 2HGLA 3KXTA 5GAMh 2QQ9A 3PO4A 1RAAB 1VK3A 1K8AC 1M2OA 1SKRA 3OT9A 2E5LJ 3Q86A 4X4VA 2CZ6B 2ZH5A 4HVVA 1J5OA 2HFOA 3TQ1A 2FZKB 2UUWA 2HBYB 3A13A 4G3IA 4NLGA 1Q7LB 2KVIA 3EZOA 4E7ZA 2HNZA 2LXUA 4BE0A 1B3TA 2HHSA 3OA6A 3DM2A 5EX3A 2KT1A 1U24A 4P75A 2SRCA 5ETVA 2KXFA 1RTDA 4NOYA 3Q0AA 3KDOA 1B07A 3CCMA 1Q86U 1HBNB 5HL7Q 1Y3JA 3TZYA 2PUOB 1NSPA 4DX7A 4WWSA 1S7IA 2DNUA 2UUCF 4WCIA 1ICEB 2Z0GA 2MY8A 4K4VA 2NYIA 4C0ZA 4A4KA 2PVGB 3AH6A 1FO1A 2HMIA 2DITA 2XHCA 3IG1B 3N4WA 2C2NA 5FU7C 3WIUA 1Q7YC 2R7TA 1N5VA 1JLEB 2GAHC 3OTEA 4KGVB 3HPOA 1W1FA 2VC1A 1R6VA 1CJTB 3QZ8A 2VODA 1HYOA 4LSZB 1Y0HA 5I3PA 1BI1A 2OJ2A 4Q5WA 3MCNA 4USVA 3HK2A 2YNGB 4DUYF 2ED1A 1EQMA 1KQGB 5KFIA 3JSMB 2EQKA 2X1AA 5HVGA 3JB9I 2N4DA 2XY7A 2J0QD 3I55A 1RXOB 3NWRA 2R8HA 3SEOA 1I5LA 2ZUAA 5GAMd 4XAKA 3HKWA 5EWFA 5KG1A 2HRYA 2FVRA 1YJTA 1L3TA 3FQKA 2JL9A 2Z30B 2XC9A 4CTAA 3T5JA 4RNOA 1VBZA 2CJYB 1P9YA 2DPIA 4L75A 1UTAA 4A8SA 2L89A 4P6QA 1RT2A 4C8QA 3X1LB 5ETLA 3T9NA 1K1QA 2RE1A 2MXYA 2LJ3A 3LGFA 2P0QA 1YRTA 4KAIA 1PNJA 3SFMA 2ZFHA 2RM4A 2IYGA 1S4EA 2UXBJ 2BR0A 2FJWA 1AA1B 3BQ2A 2KO1A 4C9DA 4PRFA 4C92E 5GADI 3DC2A 1B0TA 2HNDA 2DXBA 4KB7A 5FU6B 5IXBA 1NK0A 1TV6B 4YHHF 5HMXA 1LWEB 2OTJS 1VQMS 2ZZDA 1CSJA 1GQEA 1X2KA 1LV5A 1HMVB 4UTGA 2QEXS 1M90U 4NEYA 3TW0A 2L41A 4ELTA 4OI3A 3PEHA 1U0HA 3HRTA 1NHUA 2GGRA 2HS0A 2J6UA 2KFNA 1U6ZA 4WFYA 1KLNA 2FTRA 1VQPS 4QYRA 4C92D 4J91A 4LNPA 1ZTTA 2HG4A 2WBRA 1S9FA 4IG0B 1UEVA 3DLLQ 1N9SA 1VBKA 3V4IB 5SUHA 3QGIA 2HMIB 4QR2A 4WFAQ 4DR3J 1K73R 1MN7A 3CJTA 3N79A 3CJ8A 1ROFA 3DMJB 3LPEA 2HBRB 5LSRA 1JLBB 4X2BA 1KFDA 2QYZA 2CQPA 4Z7YA 3T6JA 2UUCJ 1U1TA 1RWVB 4RNMA 4QZVB 2HRUA 4AMCA 3OS0A 1FRLA 1ZSGA 5D6XA 3JRZA 4J9IA 3HLUA 1GXIE 4D8DA 1D09B 5B0BA 2F9JA 4QU7A 1KLMA 2MMYA 3M1VB 3EG2A 4HT8A 5DGAA 1SJRA 1WJ9A 4HTIA 3G71S 1YHQA 1RISA 2B6AA 1U1OA 1Q8KA 5F8GA 1TK5A 4M94A 3KK3A 2J0WA 3KLEB 4PWWA 4WU2A 1UKUA 4RR5A 2VL1A 2C2KB 4M75G 4QYZJ 3QIPB 1YNZA 4CM0A 1KQSR 2VD3A 3DLHA 2YKPA 4WP8A 4CNYA 2RNEA 3CCUQ 1RBOB 2DF6A 1QMCA 1ZZFA 1C4AA 1UECA 4OMPA 1EETA 1X4HA 3BDPA 1PBAA 4B9WA 2RU9A 1C0TB 2D0NA 3CMAT 3FEYB 2Z4PA 2R7UA 2KJWA 4OI6A 4HT5A 1KHWA 4KT0C 4AUKA 5KTQA 1I1GA 1RA7A 4DFMA 3E1SA 1WHXA 3GG1A 1M3CA 4M7AC 3U1NA 3M8RA 1SJQA 5HROB 1JXVA 4DHVA 1S6QA 4FKXA 2YXYA 2E41A 2HCKA 4CO2A 2X1GA 1P92A 1R8AA 4OHXA 2IA6A 2VV5A 2Z56B 4HACB 1ZX6A 4WPAA 4ZMMA 4A4EA 1T0TV 3BSCA 3ZNUA 5K8NA 2B7BB 3WX4A 4J9GA 4ES3A 1R8OB 2AZVA 4JI6F 3D0GE 3QGGA 1ABQA 2GVDB 2VQFF 3HF5A 1K0TA 4CT8A 5IM0B 2GX8A 4OYIA 2K7KA 4S0MA 2GJFA 3AHPA 1NDLA 5EGYA 1HR0F 1JU5C 4QQGA 1MNEA 4IO9Q 4JI5J 3AD9C 2K5IA 1Z1ZA 3CD7A 3RTVA 4B9TA 5BYRA 2ATCB 2HWTA 3HJVA 1PJ5A 3KKFA 1E6GA 2WAQD 4QOTA 4LR7A 2KH9A 4IURA 1HI8A 5KFYA 3PW0A 4LREA 1Q4RA 3UDVA 1W2BS 1VRUB 1IUJA 3M32B 1TUDA 1FRMA 4URQU 5D6WA 3L7PA 2NUHA 1P8GA 2F40A 5BYQA 1YJ9S 4GRSA 3DXBA 4ZN1A 4LD6A 1AZGB 1CS4A 1QVPA 2EBGA 1G3SA 3OS5A 2CP0A 3JYTB 5A8RB 3CQTA 2Y1IA 4ANJA 4QR0A 4JRIA 1VCTA 1DTQB 3VR1A 1U09A 5KFMA 1O0PA 4N0AA 2PEHA 4WKYA 1TV6A 3ULHA 2QYGA 2DNKA 1Q0NA 4G6VB 1ZS6A 3H2LA 4RW6A 1SKSA 2JVVA 4DEXA 2KRNA 3L2UA 3VCDA 4I6YA 1JLCB 3LTOA 4F50A 5GMKm 2WW8A 1UE9A 1M3BA 2JSXA 4JV5J 2MQQA 1APSA 3VQTA 4C3MA 3G71Q 1VR6A 1NEBA