1M1PA

P21 crystal structure of the tetraheme cytochrome c3 from shewanella oneidensis mr1
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
87
structure length
87
Chain Sequence
QKLSDFHAESGGCESCHKDGTPSADGAFEFAQCQSCHGKLSEMDAVHKPHDGNLVCADCHAVHDMNVGQKPTCESCHDDGRTSASVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Small tetraheme cytochrome c
publication title Crystal structures at atomic resolution reveal the novel concept of 'electron-harvesting' as a role for the small tetraheme cytochrome c
pubmed doi rcsb
molecule tags Electron transport
total genus 20
structure length 87
sequence length 87
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2002-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14537 Cytochrom_c3_2 Cytochrome c3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1130.10 Mainly Alpha Orthogonal Bundle Flavocytochrome C3; Chain A, domain 2 Flavocytochrome C3; Chain A 1m1pA00
3OWMA 1FT5A 3F29A 1FS8A 2B7RA 3SXQA 4Q0TA 3LGQA 3S7WA 1LJ1A 1QO8A 4L3YA 1KSSA 1Y0PA 3LG1A 1M1PA 1FT6A 1D4CA 3MMOA 1D4DA 1JNIA 1D4EA 3BNJA 3TORA 1FS9A 1JRYA 2E81A 1OAHA 1P2EA 1BVBA 1M64A 2OT4A 3UBRA 1GU6A 1JRZA 3BNGA 1QJDA 4Q4UA 1M1RA 4L3XA 4Q5CA 3BNFA 2RF7A 1KSUA 3GM6A 4Q5BA 3FO3A 4Q17A 1P2HA 1FS7A 2K3VA 3L1TA 4WJYA 3RKHA 2VR0A 3TTBA 3BNHA 1Q9IA 1E39A 4L38A 1SP3A 2J7AA 3D1IA 2E80A 4L3ZA 1QDBA 2B7SA 2RDZA 2ZO5A 4Q1OA 1JRXA 3SCEA 1M1QA 3UU9A
chains in the Genus database with same CATH superfamily
3OWMA 1FT5A 3F29A 1FS8A 2B7RA 2CZSA 3SXQA 4Q0TA 3LGQA 3S7WA 1LJ1A 1QO8A 4L3YA 1KSSA 1Y0PA 3LG1A 1M1PA 1FT6A 1D4CA 3MMOA 1D4DA 1JNIA 1D4EA 3BNJA 3TORA 1FS9A 1JRYA 2E81A 1OAHA 1P2EA 1BVBA 1M64A 2OT4A 3UBRA 1GU6A 1JRZA 3BNGA 1QJDA 4Q4UA 1M1RA 4L3XA 4Q5CA 3BNFA 2RF7A 1KSUA 3GM6A 4Q5BA 3FO3A 4Q17A 1P2HA 1FS7A 2K3VA 3L1TA 4WJYA 3RKHA 2VR0A 3TTBA 3BNHA 1Q9IA 1E39A 4L38A 1SP3A 2J7AA 3D1IA 2E80A 4L3ZA 1QDBA 2B7SA 2RDZA 2ZO5A 4Q1OA 1JRXA 3SCEA 1M1QA 3UU9A
chains in the Genus database with same CATH topology
3OWMA 1FT5A 3F29A 1FS8A 2B7RA 3SXQA 4Q0TA 3LGQA 3S7WA 1LJ1A 1QO8A 4L3YA 1KSSA 1Y0PA 3LG1A 1M1PA 1FT6A 1D4CA 3MMOA 1D4DA 1JNIA 1D4EA 3BNJA 3TORA 1FS9A 1JRYA 2E81A 1OAHA 1P2EA 1BVBA 1M64A 2OT4A 3UBRA 1GU6A 1JRZA 3BNGA 1QJDA 4Q4UA 1M1RA 4L3XA 4Q5CA 3BNFA 2RF7A 1KSUA 3GM6A 4Q5BA 3FO3A 4Q17A 1P2HA 1FS7A 2K3VA 3L1TA 4WJYA 3RKHA 2VR0A 3TTBA 3BNHA 1Q9IA 1E39A 4L38A 1SP3A 2J7AA 3D1IA 2E80A 4L3ZA 1QDBA 2B7SA 2RDZA 2ZO5A 4Q1OA 1JRXA 3SCEA 1M1QA 3UU9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OWM A;  1FT5 A;  3F29 A;  1FS8 A;  2B7R A;  3SXQ A;  4Q0T A;  3LGQ A;  3S7W A;  1LJ1 A;  1QO8 A;  4L3Y A;  1KSS A;  1Y0P A;  3LG1 A;  1M1P A;  1FT6 A;  1D4C A;  3MMO A;  1D4D A;  1JNI A;  1D4E A;  3BNJ A;  3TOR A;  1FS9 A;  1JRY A;  2E81 A;  1OAH A;  1P2E A;  1BVB A;  1M64 A;  2OT4 A;  3UBR A;  1GU6 A;  1JRZ A;  3BNG A;  1QJD A;  4Q4U A;  1M1R A;  4L3X A;  4Q5C A;  3BNF A;  2RF7 A;  1KSU A;  3GM6 A;  4Q5B A;  3FO3 A;  4Q17 A;  1P2H A;  1FS7 A;  2K3V A;  3L1T A;  4WJY A;  3RKH A;  2VR0 A;  3TTB A;  3BNH A;  1Q9I A;  1E39 A;  4L38 A;  1SP3 A;  2J7A A;  3D1I A;  2E80 A;  4L3Z A;  1QDB A;  2B7S A;  2RDZ A;  2ZO5 A;  4Q1O A;  1JRX A;  3SCE A;  1M1Q A;  3UU9 A; 
#chains in the Genus database with same CATH topology
 3OWM A;  1FT5 A;  3F29 A;  1FS8 A;  2B7R A;  2CZS A;  3SXQ A;  4Q0T A;  3LGQ A;  3S7W A;  1LJ1 A;  1QO8 A;  4L3Y A;  1KSS A;  1Y0P A;  3LG1 A;  1M1P A;  1FT6 A;  1D4C A;  3MMO A;  1D4D A;  1JNI A;  1D4E A;  3BNJ A;  3TOR A;  1FS9 A;  1JRY A;  2E81 A;  1OAH A;  1P2E A;  1BVB A;  1M64 A;  2OT4 A;  3UBR A;  1GU6 A;  1JRZ A;  3BNG A;  1QJD A;  4Q4U A;  1M1R A;  4L3X A;  4Q5C A;  3BNF A;  2RF7 A;  1KSU A;  3GM6 A;  4Q5B A;  3FO3 A;  4Q17 A;  1P2H A;  1FS7 A;  2K3V A;  3L1T A;  4WJY A;  3RKH A;  2VR0 A;  3TTB A;  3BNH A;  1Q9I A;  1E39 A;  4L38 A;  1SP3 A;  2J7A A;  3D1I A;  2E80 A;  4L3Z A;  1QDB A;  2B7S A;  2RDZ A;  2ZO5 A;  4Q1O A;  1JRX A;  3SCE A;  1M1Q A;  3UU9 A; 
#chains in the Genus database with same CATH homology
 3OWM A;  1FT5 A;  3F29 A;  1FS8 A;  2B7R A;  3SXQ A;  4Q0T A;  3LGQ A;  3S7W A;  1LJ1 A;  1QO8 A;  4L3Y A;  1KSS A;  1Y0P A;  3LG1 A;  1M1P A;  1FT6 A;  1D4C A;  3MMO A;  1D4D A;  1JNI A;  1D4E A;  3BNJ A;  3TOR A;  1FS9 A;  1JRY A;  2E81 A;  1OAH A;  1P2E A;  1BVB A;  1M64 A;  2OT4 A;  3UBR A;  1GU6 A;  1JRZ A;  3BNG A;  1QJD A;  4Q4U A;  1M1R A;  4L3X A;  4Q5C A;  3BNF A;  2RF7 A;  1KSU A;  3GM6 A;  4Q5B A;  3FO3 A;  4Q17 A;  1P2H A;  1FS7 A;  2K3V A;  3L1T A;  4WJY A;  3RKH A;  2VR0 A;  3TTB A;  3BNH A;  1Q9I A;  1E39 A;  4L38 A;  1SP3 A;  2J7A A;  3D1I A;  2E80 A;  4L3Z A;  1QDB A;  2B7S A;  2RDZ A;  2ZO5 A;  4Q1O A;  1JRX A;  3SCE A;  1M1Q A;  3UU9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...