1M1PA

P21 crystal structure of the tetraheme cytochrome c3 from shewanella oneidensis mr1
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
87
structure length
87
Chain Sequence
b'QKLSDFHAESGGCESCHKDGTPSADGAFEFAQCQSCHGKLSEMDAVHKPHDGNLVCADCHAVHDMNVGQKPTCESCHDDGRTSASVL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Small tetraheme cytochrome c
publication title Crystal structures at atomic resolution reveal the novel concept of 'electron-harvesting' as a role for the small tetraheme cytochrome c
pubmed doi rcsb
molecule tags Electron transport
total genus 20
structure length 87
sequence length 87
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2002-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14537 Cytochrom_c3_2 Cytochrome c3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1130.10 Mainly Alpha Orthogonal Bundle Flavocytochrome C3; Chain A, domain 2 Flavocytochrome C3; Chain A 1m1pA00
1FT5A 4L3ZA 1FT6A 4Q5BA 4Q5CA 2RDZA 3L1TA 1P2HA 2VR0A 1JNIA 2J7AA 4Q4UA 2OT4A 1QO8A 3TORA 3LG1A 1FS7A 4Q0TA 2K3VA 4WJYA 1LJ1A 2B7RA 1FS8A 1M1PA 1P2EA 1QDBA 2E80A 3MMOA 1M64A 3BNJA 4L38A 1QJDA 2B7SA 2E81A 3D1IA 4Q1OA 3SCEA 1E39A 1JRYA 3S7WA 3FO3A 2RF7A 3UU9A 1D4DA 3UBRA 1KSUA 1FS9A 3RKHA 3F29A 1JRZA 1JRXA 3LGQA 4L3XA 1D4CA 3OWMA 4L3YA 1M1RA 1Y0PA 2ZO5A 1M1QA 1Q9IA 1SP3A 3SXQA 3TTBA 1BVBA 4Q17A 3BNGA 3GM6A 1GU6A 3BNFA 1KSSA 1OAHA 1D4EA 3BNHA
chains in the Genus database with same CATH superfamily
1FT5A 4L3ZA 1FT6A 4Q5BA 4Q5CA 2RDZA 3L1TA 1P2HA 2VR0A 1JNIA 2J7AA 4Q4UA 2OT4A 1QO8A 3TORA 3LG1A 1FS7A 4Q0TA 2K3VA 4WJYA 1LJ1A 2B7RA 1FS8A 1M1PA 1P2EA 1QDBA 2E80A 3MMOA 1M64A 3BNJA 4L38A 1QJDA 2B7SA 2E81A 3D1IA 4Q1OA 3SCEA 1E39A 1JRYA 3S7WA 3FO3A 2RF7A 3UU9A 1D4DA 3UBRA 1KSUA 2CZSA 1FS9A 3RKHA 3F29A 1JRZA 1JRXA 3LGQA 4L3XA 1D4CA 3OWMA 4L3YA 1M1RA 1Y0PA 2ZO5A 1M1QA 1Q9IA 1SP3A 3SXQA 3TTBA 1BVBA 4Q17A 3BNGA 3GM6A 1GU6A 3BNFA 1KSSA 1OAHA 1D4EA 3BNHA
chains in the Genus database with same CATH topology
1FT5A 4L3ZA 1FT6A 4Q5BA 4Q5CA 2RDZA 3L1TA 1P2HA 2VR0A 1JNIA 2J7AA 4Q4UA 2OT4A 1QO8A 3TORA 3LG1A 1FS7A 4Q0TA 2K3VA 4WJYA 1LJ1A 2B7RA 1FS8A 1M1PA 1P2EA 1QDBA 2E80A 3MMOA 1M64A 3BNJA 4L38A 1QJDA 2B7SA 2E81A 3D1IA 4Q1OA 3SCEA 1E39A 1JRYA 3S7WA 3FO3A 2RF7A 3UU9A 1D4DA 3UBRA 1KSUA 1FS9A 3RKHA 3F29A 1JRZA 1JRXA 3LGQA 4L3XA 1D4CA 3OWMA 4L3YA 1M1RA 1Y0PA 2ZO5A 1M1QA 1Q9IA 1SP3A 3SXQA 3TTBA 1BVBA 4Q17A 3BNGA 3GM6A 1GU6A 3BNFA 1KSSA 1OAHA 1D4EA 3BNHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FT5 A;  4L3Z A;  1FT6 A;  4Q5B A;  4Q5C A;  2RDZ A;  3L1T A;  1P2H A;  2VR0 A;  1JNI A;  2J7A A;  4Q4U A;  2OT4 A;  1QO8 A;  3TOR A;  3LG1 A;  1FS7 A;  4Q0T A;  2K3V A;  4WJY A;  1LJ1 A;  2B7R A;  1FS8 A;  1M1P A;  1P2E A;  1QDB A;  2E80 A;  3MMO A;  1M64 A;  3BNJ A;  4L38 A;  1QJD A;  2B7S A;  2E81 A;  3D1I A;  4Q1O A;  3SCE A;  1E39 A;  1JRY A;  3S7W A;  3FO3 A;  2RF7 A;  3UU9 A;  1D4D A;  3UBR A;  1KSU A;  1FS9 A;  3RKH A;  3F29 A;  1JRZ A;  1JRX A;  3LGQ A;  4L3X A;  1D4C A;  3OWM A;  4L3Y A;  1M1R A;  1Y0P A;  2ZO5 A;  1M1Q A;  1Q9I A;  1SP3 A;  3SXQ A;  3TTB A;  1BVB A;  4Q17 A;  3BNG A;  3GM6 A;  1GU6 A;  3BNF A;  1KSS A;  1OAH A;  1D4E A;  3BNH A; 
#chains in the Genus database with same CATH topology
 1FT5 A;  4L3Z A;  1FT6 A;  4Q5B A;  4Q5C A;  2RDZ A;  3L1T A;  1P2H A;  2VR0 A;  1JNI A;  2J7A A;  4Q4U A;  2OT4 A;  1QO8 A;  3TOR A;  3LG1 A;  1FS7 A;  4Q0T A;  2K3V A;  4WJY A;  1LJ1 A;  2B7R A;  1FS8 A;  1M1P A;  1P2E A;  1QDB A;  2E80 A;  3MMO A;  1M64 A;  3BNJ A;  4L38 A;  1QJD A;  2B7S A;  2E81 A;  3D1I A;  4Q1O A;  3SCE A;  1E39 A;  1JRY A;  3S7W A;  3FO3 A;  2RF7 A;  3UU9 A;  1D4D A;  3UBR A;  1KSU A;  2CZS A;  1FS9 A;  3RKH A;  3F29 A;  1JRZ A;  1JRX A;  3LGQ A;  4L3X A;  1D4C A;  3OWM A;  4L3Y A;  1M1R A;  1Y0P A;  2ZO5 A;  1M1Q A;  1Q9I A;  1SP3 A;  3SXQ A;  3TTB A;  1BVB A;  4Q17 A;  3BNG A;  3GM6 A;  1GU6 A;  3BNF A;  1KSS A;  1OAH A;  1D4E A;  3BNH A; 
#chains in the Genus database with same CATH homology
 1FT5 A;  4L3Z A;  1FT6 A;  4Q5B A;  4Q5C A;  2RDZ A;  3L1T A;  1P2H A;  2VR0 A;  1JNI A;  2J7A A;  4Q4U A;  2OT4 A;  1QO8 A;  3TOR A;  3LG1 A;  1FS7 A;  4Q0T A;  2K3V A;  4WJY A;  1LJ1 A;  2B7R A;  1FS8 A;  1M1P A;  1P2E A;  1QDB A;  2E80 A;  3MMO A;  1M64 A;  3BNJ A;  4L38 A;  1QJD A;  2B7S A;  2E81 A;  3D1I A;  4Q1O A;  3SCE A;  1E39 A;  1JRY A;  3S7W A;  3FO3 A;  2RF7 A;  3UU9 A;  1D4D A;  3UBR A;  1KSU A;  1FS9 A;  3RKH A;  3F29 A;  1JRZ A;  1JRX A;  3LGQ A;  4L3X A;  1D4C A;  3OWM A;  4L3Y A;  1M1R A;  1Y0P A;  2ZO5 A;  1M1Q A;  1Q9I A;  1SP3 A;  3SXQ A;  3TTB A;  1BVB A;  4Q17 A;  3BNG A;  3GM6 A;  1GU6 A;  3BNF A;  1KSS A;  1OAH A;  1D4E A;  3BNH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...