1M2AA

Crystal structure at 1.5 angstroms resolution of the wild type thioredoxin-like [2fe-2s] ferredoxin from aquifex aeolicus
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
103
structure length
103
Chain Sequence
AEFKHVFVCVQDRPPGHPQGSCAQRGSREVFQAFMEKIQTDPQLFMTTVITPTGCMNACMMGPVVVVYPDGVWYGQVKPEDVDEIVEKHLKGGEPVERLVISK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High-resolution crystal structures of the wild type and Cys-55-->Ser and Cys-59-->Ser variants of the thioredoxin-like [2Fe-2S] ferredoxin from Aquifex aeolicus
pubmed doi rcsb
molecule keywords [2Fe-2S] ferredoxin
source organism Aquifex aeolicus
molecule tags Electron transport
total genus 34
structure length 103
sequence length 103
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01257 2Fe-2S_thioredx Thioredoxin-like [2Fe-2S] ferredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1m2aA00
1QK8A 2NTOA 3GRXA 3APQA 1F6MC 1XVWA 1F3BA 1N2AA 1EEJA 1OKTA 6GSUA 4TXVA 2PN8A 4GWRA 4CDOA 1PQNA 4GXZA 2D2ZA 3C73A 5CAXA 3VWXA 1JLWA 1W4VA 1ZL9A 2VLTA 1ILOA 1V9WA 5DQSA 1YY7A 1TOFA 1XPVA 4JEDA 5HQPA 4XS4B 4IP6A 3WT1A 2HRNA 4K9ZA 3BOAA 1KBNA 5D9TA 4X43A 5CO3A 3GKXA 3TKQA 3FZ9A 1DE2A 4IQAA 2JZRA 3KIJA 1Z5YE 4P3YB 4LA1A 2RLIA 3LXZA 3CYNA 3TGZA 2GQLA 1VF3A 1GRXA 1THOA 19GSA 3GX8A 1XWAA 3Q19A 4KDYA 1H75A 4L0UA 1GTBA 1TK5B 1Y6EA 4IJIA 2C1YA 1SL0B 4L8EA 3HA9A 2XC2A 3TJJA 2IMIA 2RUFA 3D21A 3GX0A 1A23A 3Q6OA 2PWJA 3G7JA 4XS6A 1ON4A 3FK8A 3LYPA 1XIYA 3IAM2 2FCHA 5IMFA 2PMTA 4IHUA 2E7PA 2GSQA 3KMOA 1YKAA 5EVOA 4KDUA 4MLYA 1YKCA 1V98A 2VL9A 5G2ZA 3LEFA 3HVXA 1VF2A 1YEXA 3MAKA 2YJHA 5JCWA 1G6WA 2OADA 1F2EA 3GSTA 4F9ZA 5ECNB 1GNWA 2PVQA 5JWOB 1ERTA 3P90A 3KJYA 5DALA 2KP1A 3PH9A 1GULA 2LJKA 1UN2A 3TJKA 2YANA 1ACVA 1A8YA 5CRHA 1MDIA 5IMZA 4JE1A 4TW5A 1X9WB 1TXXA 5IMDA 4EKZA 5ECOB 2YP6A 1FO5A 1FOVA 1EP7A 1VF4A 1TI1A 3C7MA 2IMDA 2C3QA 3VI7A 5KN1A 4ZL8A 2TIRA 1I9DA 5H5SA 2YWIA 1JZRA 2VM1A 2P31A 2I81A 4IJ3A 1QMVA 4O5RA 2NPBA 2H72A 3ERGA 2GZPA 4RI7A 4HQSA 5AIVA 1TRWA 1EWXA 1XWGA 4YAVA 2N5FA 3C71A 1HNBA 2MBTA 2CT6A 1PKZA 4QL9A 2WULA 2CAIA 5GSSA 4ZL9A 4X1UA 3F3RA 4KH7A 3DRNA 2GDRA 14GSA 1XXUA 2JU5A 1O8WA 1PN9A 1BG5A 5DJLA 3QMXA 3HKRA 3W8JA 4G19A 4I6XA 2YV9A 3TB2A 1ERVA 1MDKA 4MA9A 4MF6A 1J0FA 2H74A 2OE1A 1EOHA 4XS1A 1OE8A 3QAWA 1R5PA 2FWHA 1TJDA 1M9BA 4LMWA 1EGRA 4F2IA 2TRCP 2O85A 1JZDA 2PBJA 3F9UA 4TR1A 2B5EA 2H0GA 1K0OA 3F63A 1PL1A 2ON5A 2CVKA 4IVFA 4X0XA 4MH2A 3QAVA 5IOWA 1V2AA 5H5QA 3EVIA 1OE7A 1XBSA 2KP2A 16GSA 1A0RP 1GWCA 3H93A 2LEGA 2PGTA 2LKUA 1E6BA 3CSHA 5CYYA 4OO4A 3GTUB 2AV4A 4DSSA 1ABAA 1ERUA 1T3BA 4WEYA 3GA4A 2H1DA 3L0HA 4FYUA 1S3DA 3HD5A 2LJRA 4D73B 4GSTA 3GKKA 2Z9SA 1T7PB 2DJ2A 2V32A 2H0IA 2LRTA 3JCML 3TRQA 2YNXA 2GTUA 2N5AA 2LSTA 2YV7A 3H79A 5DQYA 2DJ3A 1A2LA 2AAWA 3Q74A 1GSSA 1ZCPA 2PERA 2FA8A 3DVXA 2I4AA 2IL3A 2CZ2A 2V6KA 1AXDA 1KTEA 3GKNA 2J23A 3M0FA 3HDCA 2C0FA 4MH3A 1YDKA 5IPHA 4TRXA 3WYWA 2B5YA 1K0DA 3HJMA 3M9JA 2K6VA 4KA0A 1DUGA 3BCKA 3VPTA 2HLSA 3F6DA 3AY8A 4OMVA 4NHZA 1O8XA 2IFQB 2L59A 5GAND 5JCUA 1U6TA 2H70A 3LORA 3GN3A 5EY6A 3ME8A 1PSQA 5E4WA 1SD9A 1WIKA 1SENA 2WGRA 3D22A 3ZVJA 4RQXA 3ERWA 4OFTA 2GSSA 3EU3A 2JZSA 4WBJA 2B7JA 1QUWA 1MD3A 2DLXA 5KN2A 3C1RA 2XPEA 3QR6A 5HR3A 2PU9C 3MSZA 4XHMA 4J56E 1TK8B 5B8BA 3TKSA 4OO5A 5IMCA 5J9BA 4ISDA 4XRDA 3OR5A 1EV9A 1MDJA 3PGTA 3F0IA 2B5XA 2F9SA 2L4CA 1Z7PA 2AUVA 2OACA 2CQ9A 3P7XA 2H0HA 3TDGA 3M9KA 2R4VA 3GUSA 1NHYA 4EXJA 5J41A 2WFCA 5JCGA 2LNSA 2OBIA 2HZEA 2E2MA 2GLRA 1K0CA 1ERWA 4RI6A 5LCZA 4IS0A 3ZRDA 2BMXA 1LJRA 3UMAA 5ECLB 4I5QA 5B8AA 3TUEA 4Q5FA 1NW2A 3ZL5A 1GTUA 1GSEA 1QXHA 2LQOA 2EIRA 2AJQB 4HOJA 4BPYA 5KEJA 4KE3A 2M46A 5EPFA 3MNGA 3DIEA 4POBA 2CA8A 2H6XA 2B3SA 1ZOFA 2DSAA 4K7OA 2G0FA 4AF2A 2FA4A 2IPAA 2NVLA 4ID0A 5HFKA 4DSRA 1T1VA 4TKYA 1ST9A 1GSUA 4HI7A 4OFMA 4MJBA 1DE1A 2VLVA 2IWTA 2B7KA 1Q98A 5GSTA 1GTAA 1XCCA 3FRCA 1KEBA 3KTBA 5IO2A 4EUYA 1GTIA 4KUNA 3BBYA 2LTKA 2XBQA 3UVTA 3EINA 1Y25A 5IOXA 5ID2A 2X8HA 1R5AA 4N0ZA 4EC0A 3IOSA 1ZGNA 2AYTA 5CNWA 1DBYA 3L9VA 3WT2A 3R2QA 2A4VA 1VGLA 2YJ7A 2FLSA 5INYA 3CTGA 4EVMA 2GQKA 5IM9A 3GL5A 1GNEA 1DSBA 1X5EA 4OD7A 4WETA 2YZUA 4WR5A 2E0QA 2HSHA 3VFIA 1O7UA 4PUFC 2GVPA 2RUEA 5IQYA 4K0NA 4XS4A 4NAXA 3ZIVA 2CX4A 2YZHA 4POMA 4POLA 1Z6MA 3F4RA 2FY6A 4Q5RA 1URMA 5F06A 1TW9A 2VL2A 1BJXA 2R6KA 3GIXA 3US3A 17GSA 2FWGA 4V2MA 1M2DA 2CZ3A 2RM5A 3G7IA 3KEBA 4K6XA 4GSSA 4L0WA 5JWRB 4V2NA 3A2VA 1U88A 4G9HA 1XFLA 5F05A 5H5RA 3G7YA 3IE3A 1XVQA 1FW1A 4KAEA 1TU8A 2K8SA 2R5GA 4PURA 1MTCA 1S3AA 4XIHA 1BX9A 2EIOA 1TRSA 3KD0A 1Q4JA 2CV4A 4TR0A 5ELAA 2HRFA 1GP1A 5DCHA 5KN0A 1SD8A 2MMZA 1WE0A 22GSA 2XBIA 1GLPA 1HNCA 5HR2A 1EP8A 1T00A 2ON7A 4PUAA 2AHEA 1GH2A 4DSQA 3D6IA 3LSZA 4J57E 2H8LA 5HR1A 3ZVJD 2R3XA 2I1UA 5HFGA 5C00A 2FUG2 4MPFA 3GKMA 1T4YA 3SWLA 2VCZA 3KH7A 2IMFA 3ZTLA 2VCXA 1R7HA 2R37A 2JACA 1F37A 3DYRA 5G31A 6GSTA 3HVSA 1NHOA 5G30A 3I43A 1G7OA 3HJPA 5ECHB 3L9UA 3VK9A 3TJFA 1U87A 1VRSD 1O73A 4JR4A 3FHKA 3UVHA 2C0DA 3WGEA 4TXOA 4HUAA 4I2UA 1HD2A 2JADA 2OJLA 3ZZXA 4BWQA 2VCTA 1PA3A 3P2AA 4BL7A 5DAKB 4HU7A 2KLXA 4PNFA 2C0GA 2FHEA 1G0TA 4FH8A 4IW9A 2DJKA 1M2BA 1S3CA 4K8MA 3TRPA 3O3TA 5D93A 4LL4B 5B7CA 4AJ6A 5D73A 2KUCA 2HXKA 2VD1A 1ZMAA 1OAZA 1B9XC 1PMTA 4WKWA 4HDEA 2DIZA 4JBBA 4MPGA 2XPDA 3IA1A 3TOUA 3VURA 1RW1A 3NOFA 1YQ1A 2VCWA 2VAFA 1WOUA 1WPIA 5ENUA 2FD3A 3RPNA 1AAZA 2H1AA 3D4TA 4MZWA 3TKPA 2HSYA 4PX1A 1RQMA 6GSVA 5CRGA 2QKEA 3W8SA 1YZXA 3BD2A 4ML6A 1PGTA 2GT6A 3DXBA 3K8NA 3F4TA 5GAPD 2MBSA 3VWWA 2C3TA 3FY7A 3I69A 2CVDA 2YN1A 1OC9B 2PUKC 3GTUA 5A5KA 3HJOA 2H73A 1K3OA 2V1MA 2L4QA 1XW6A 4FYBA 2J9HA 2K8VA 4EF0A 1PD21 3RDWA 2A2SA 4D73A 4LMVA 2ZUPA 3ZYWA 2LV3A 5ECMB 2DJ0A 3FR3A 4HU9A 1AQWA 4ZL7A 2X8GA 2ZCTA 3M8NA 1YF1A 4F82A 1YEPA 3M1GA 4AJ8A 4WXTA 3IRAA 3FZ5A 3GHAA 2A2RA 1I5GA 4PQIA 1O81A 3QFBC 4TR4A 4EE0A 4PQ1A 3HZ8A 1UA5A 2C80A 3EC3A 4IBPA 3FEUA 1M99A 5D9VA 4MF7A 5DJMA 2X99A 1SU9A 3H8QA 3IHQA 3L9SA 1MEKA 3CSJA 4PNGA 9GSSA 1WWJA 2V41A 4MF5A 3N9JA 1F9MA 4GF0A 4DVCA 2H75A 1F3AA 2LRCA 3EU4A 3TCOA 4V1Ap 7GSSA 8GSSA 2H66A 3ED3A 3VLNA 5F0GA 2H1BA 3KGKA 1A2JA 5D96A 5L71A 2OE3A 3MDKA 1TTZA 1NSWA 2IJYA 1GUMA 3ERFA 1OC3A 5ECIB 4GQFA 5G5FA 3ZLPA 1EZKA 2O8VB 5ECRB 2QSIA 2XHFA 4MJAA 5AIXA 1SJZA 4KSMA 5COHA 4MJEA 2L57A 2LRNA 4K1FA 1FVKA 3DVWA 3CRUA 3LJRA 3FR9A 4MJCA 1SYRA 3QOUA 1J9BA 4HJ2A 2N5BA 4IP1A 4QQ7A 3WGDA 3F3QA 5F8BA 4EO3A 4MDCA 4PQHA 1YF0A 4L5OA 3ZIJA 1GSYA 5DVBA 1EGOA 4JU5A 2WCIA 1XOBA 5G1KA 2HNLA 5J5NA 4GTUA 2MMAA 4TVEA 1GL8A 2YCDA 3CXGA 5KN3A 3UBLA 4V2LA 1A0FA 3GYKA 4HEA2 1O6JA 4J2FA 1HYUA 3QCPA 3LXTA 3APOA 1IYIA 1GUKA 1SJIA 1CQHA 3LFLA 5G5EA 4GQCA 1FG4A 1K0AA 3EMPA 5D9XA 1PX7A 4HZ2A 2DIYA 5ECPB 4YQVA 1WP0A 4MZCA 5IPGA 4XTSA 2RM6A 3O76A 4ZB9A 3VWVA 1CQGA 5AN1A 3APSA 4ML1A 3GH6A 2HFDA 4ZBAA 1ZYEA 2OE0A 4NV5A 4GCIA 3RPPA 3PINA 2DJJA 1R26A 3GSSA 4MP4A 2H19A 5FT3A 4ZB8A 1EOGA 3IAS2 3DWVA 4KW6A 2X64A 5A4WA 2CAQA 4HS1A 2C3NA 2VD0A 1FB6A 5HFIA 4IKHA 4DEJA 2ES7A 3E3EA 1Z9HA 4G2EA 3UBKA 1JLVA 4K2DA 3KM6A 1X0RA 4ZIJA 3ZFLA 3GMFA 1SJ6A 2B1LA 2O89A 1JFUA 3IPZA 2VCVA 2L5LA 2K9FA 4O92A 2KOKA 1ZYQB 4BWSA 4YQUA 2H01A 3W6GA 1SK0A 1XWBA 3HYPA 1AUCA 2YPMA 3UARA 3LG6A 3F6FA 1BAYA 5D9WA 3RHBA 4MABA 1NM3A 2C4JA 4I97A 4L5LA 3N5OA 3IR4A 4FO5A 1C72A 3IXRA 5FWGA 1USBA 4NHWA 4BVXA 5CRWA 4WR4A 1TKDB 3IV4A 4ZBDA 4PGTA 1K0NA 1T8EB 3CRTA 2H76A 3WD6A 2LQQA 2LS5A 2IN3A 4CHSA 5A4VA 5LD0A 3HZ4A 4ULXA 2O7KA 3M3MA 4F03A 2RIIA 2ZNMA 1WJKA 3F8UA 3ZMKA 3FR6A 2GQMA 3U5RE 1LU4A 3RBTA 2P5RA 3TJGA 5IIZA 4KGIA 3IDVA 5D8IA 2R2JA 3H1NA 5F07A 3MWHA 5J9CA 2DBCA 3HXSA 1QQ2A 2FNOA 1M0UA 4OFNA 4FYCA 1H4OA 2P5QA 2M80A 1B4QA 4F0CA 2F3MA 2DMMA 1RK4A 3TKSE 3QFAC 4Q5QA 2QGVA 1PKWA 4KB3A 4AJ7A 2OBKA 1X9SB 2DJ1A 4ECIA 1T4ZA 1ML6A 5DCGA 1M2AA 4POKA 3DD3A 5ECKB 6GSSA 2HYXA 3E9JB 3EWLA 1EEMA 4KSOA 3FW2A 1SKWB 1AW9A 3EURA 5J4UA 1TRVA 1TDIA 2VUPA 3TJBA 3UEMA 5EL8A 3NIVA 1TK0B 1X9MB 2V2GA 2MZCA 4KCAA 2OA7A 3GURA 20GSA 1TP9A 3TKRA 2FWFA 3Q18A 2YWNA 3FYGA 1K0BA 1TU7A 4N10A 4HJMA 2GS3A 4XRAA 2BTOT 2GSRA 3V1WA 3S9FA 1JZWA 2HZFA 4ZILA 2F51A 2MMNA 3GNJA 1HNAA 5DALB 4GLTA 1AQXA 5IO0A 2B1KA 3CBUA 2F8AA 4OWYA 3ZFBA 3RHCA 3VPQA 2HT9A 4Q5NA 3J7Yk 2C0EA 4LL1B 4ILFA 1G6YA 1BQ7A 4G10A 4ECCA 1FHEA 1Z7RA 4RQRA 3F4SA 4JR6A 2VOCA 4NPBA 5LNKe 3E0UA 3H4KA 3HY2A 4LLRA 3DMLA 4N30A 3LQ7A 3EE2A 1SK1A 4Z7XA 3BCIA 4IGJA 5DAKA 4TXOB 4HQZA 4WF4A 4V1Ag 1TI3A 5DBQA 2WZ9A 2NBSA 4ZXGA 4NWYA 3FZ4A 1K3YA 2H1GA 2L5OA 4ECJA 1XW9A 3GH9A 1QGVA 1OYJA 2GZYA 3BJ5A 1PRXA 3L78A 1B8XA 1ZZYA 2MYGA 2VO4A 1VF1A 1PX6A 1SKSB 2LUSA 4TN8A 1OKDA 4ECBA 1GSQA 1V57A 5ECQB 3A2WA 2WB9A 4E8EA 4BA7A 3O6TA 1HQOA 5IMAA 6GSYA 10GSA 4NV2A 5E59A 2PPTA 3GFKA 2JL4A 4TR1B 3I6AA 1R4WA 1PL2A 3WGXA 4AGSA 2FWEA 1EV4A 5IMVA 3KH9A 3EMXA 1OC9A 4N0VA 2MMOA 3IC4A 4YAPA 1G7EA 1FB0A 4XCSA 4QL7A 3CMIA 2VL3A 4DSSB 3ZMLA 5AGYA 2E2GA 3KMNA 2M72A 1GUHA 1XWCA 2VCQA 4MMMA 1SKRB 3TKSC 3D5JA 4K7NA 1SK2A 2JSYA 3HVVA 4IQ1A 1Z3EA 1M9AA 5A4UA 4KNDA 1GSDA 1U3AA 5CRDA 1W89A 3HHVA 1SL1B 2P0GA 3P8WA 2YOIA 2DC5A 2K18A 4JRRA 2HI7A 2NDOA 1SL2B 4IELA 2X8CA 4TR3A 1OC8A 2TRXA 1V40A 3IBHA 4N11A 5FHIA 4GRFA 1J08A 3ME7A 2AB6A 1V58A 2VM2A 3RAZA 2HE3A 4ZB6A 3IK7A 4MK3A 3D4MA 4WF5A 3C8EA 3CSIA 4BVYA 3A5WA 1GLQA 6GSWA 12GSA 2CX3A 2ALBA 5ABRA 3KXOA 4EL1A 1A24A 5GZZB 1LBKA 4CW9A 2IFQA 4GSNA 2F8FA 4KX4A 4NXIA 2GSTA 2H6YA 2YWMA 3ZITA 1AIUA 2I3YA 2LNTA 4PXOA 3VWUA 1A2MA 4IN0A 2I9HA 2GGTA 2WJUA 1B4PA 2BJXA 3I9V2 3L4NA 3A2XA 1M7TA 1SYXA 1AC1A 1XW5A 5JWQB 13GSA 4ZBBA 1X5CA 1UC7A 2FGXA 2IMKA 3DKSA 4H86A 1GSFA 3UL3A 3TRXA 2REMA 1BEDA 1THXA 2O87A 3QPMA 3KTLA 3DEXA 3D0ZA 2JZTA 3QAGA 3PR8A 4RUVA 5B6MA 4TOPA 3KZQA 3GL3A 3QDNA 6GSXA 1O85A 3DGQA 3C1SA 1KNGA 2WDUA 3CTFA 4EDZA 5ELGA 3A3TA 2H71A 1IYHA 4F0BA 4I8BA 2JSZA 2WS2A 1K0MA 1UVZA 1JZOA 3NZNA 2OKAA 3ZREA 18GSA 1FAAA 4YH2A 3U6VA 1QFNA 5C04A 2HZEB 1X5DA 1Z6NA 1OVNA 3TOTA 4I2TA 1WRYA 4KCEA 4MZBA 4OCFA 3LWAA 2DMLA 2H6ZA 4NMUA 2EC4A 2G2QA 5HR0A 1B48A 4WBRD 3GV1A 1XZOA 3UOMA 3SBCA 4YQMA 4O7HA 2VL2C 4MCUA 1MD4A 4K7IA 2GZZA 3KP9A 2IIYA 3LGCA 5B6NA 3QD9A 11GSA 5G1LA 3J7Yb 2EIQA 4FIWA 2GT5A 2PVOC 1WMJA 1A8LA 3UIWA 4KDXA 1XWKA 1BYEA 4ACSA 3EYTA 1E2YA 2VLUA 3G9BA 5AISA 1B9YC 1U3IA 4OCEA 1AQVA 2IMEA 2LJAA 1N8JA 4HZ4A 3FKFA 2QC7A 2L6CA 5CREA 3UJ1A 1YJ6A 3VI5A 2VIMA 2H30A 3HCZA 2V6OA 2L6DA 5DDLA 4E8HA 1TRUA 2C8UA 4O32A 3LYKA 1K3LA 2YWOA 1XOAA 4EDYA 3KP8A 5J3RA 3IK9A 3FZAA 2B6MA 2CVBA 2KHPA 5ID2B 5ECSA 4K0GA 1JHBA 3UAPA 3ISOA 3KCMA 1FVJA 4JZQA 2WRTA 5CP1A
chains in the Genus database with same CATH superfamily
1QK8A 2NTOA 3GRXA 3APQA 1F6MC 1XVWA 1F3BA 1N2AA 1EEJA 1OKTA 6GSUA 4TXVA 2PN8A 4GWRA 4CDOA 1PQNA 4GXZA 2D2ZA 3C73A 5CAXA 3VWXA 1JLWA 1W4VA 1ZL9A 2VLTA 1ILOA 1V9WA 5DQSA 1YY7A 1TOFA 1XPVA 4JEDA 5HQPA 4XS4B 4IP6A 3WT1A 2HRNA 4K9ZA 3BOAA 1KBNA 5D9TA 4X43A 5CO3A 3GKXA 3TKQA 2R0PA 3FZ9A 1DE2A 4IQAA 2JZRA 3KIJA 1Z5YE 4P3YB 4LA1A 2RLIA 3LXZA 3CYNA 3TGZA 2GQLA 1VF3A 1GRXA 1THOA 19GSA 3GX8A 1XWAA 3Q19A 4KDYA 1H75A 4L0UA 1GTBA 1TK5B 1Y6EA 4IJIA 2C1YA 1SL0B 4L8EA 3HA9A 2XC2A 3TJJA 2IMIA 2RUFA 3D21A 3GX0A 1A23A 3Q6OA 2PWJA 3G7JA 4XS6A 1ON4A 3FK8A 3LYPA 1XIYA 3IAM2 2FCHA 5IMFA 2PMTA 4IHUA 4Z2RA 2E7PA 2GSQA 3KMOA 1YKAA 5EVOA 4KDUA 4MLYA 1YKCA 1V98A 2VL9A 5G2ZA 3LEFA 3HVXA 1VF2A 1YEXA 3MAKA 2YJHA 5JCWA 1G6WA 2OADA 1F2EA 3GSTA 4F9ZA 5ECNB 1GNWA 2PVQA 5JWOB 1ERTA 3P90A 3KJYA 5DALA 2KP1A 3PH9A 1GULA 2LJKA 1UN2A 3TJKA 2YANA 1ACVA 1A8YA 4X4JA 5CRHA 4O5UA 1MDIA 5IMZA 4JE1A 4TW5A 1X9WB 1TXXA 5IMDA 4EKZA 5ECOB 1FOHA 2YP6A 1FO5A 1FOVA 1EP7A 1VF4A 1TI1A 3C7MA 2IMDA 2C3QA 3VI7A 5KN1A 4ZL8A 2TIRA 1I9DA 5H5SA 2YWIA 1JZRA 2VM1A 2P31A 2I81A 4IJ3A 1QMVA 4O5RA 2NPBA 2H72A 3ERGA 2GZPA 4A5PA 4RI7A 4HQSA 5AIVA 1TRWA 1EWXA 1XWGA 4YAVA 4BL7B 2N5FA 3C71A 1HNBA 2MBTA 2CT6A 1PKZA 4QL9A 2WULA 2CAIA 5GSSA 4ZL9A 4X1UA 3F3RA 4KH7A 1PN0A 3DRNA 2GDRA 14GSA 1XXUA 2JU5A 1O8WA 1PN9A 1BG5A 3QMXA 5DJLA 3HKRA 3W8JA 4G19A 4I6XA 2YV9A 3TB2A 1ERVA 1MDKA 4MA9A 4MF6A 1J0FA 2H74A 2OE1A 1EOHA 4XS1A 1OE8A 3QAWA 1R5PA 2FWHA 1TJDA 1M9BA 4LMWA 1EGRA 4F2IA 2TRCP 2O85A 1JZDA 2PBJA 3F9UA 4TR1A 2B5EA 2H0GA 1M3IA 1K0OA 3F63A 1PL1A 2ON5A 2CVKA 4IVFA 4X0XA 4MH2A 3QAVA 5IOWA 1V2AA 5H5QA 3EVIA 1OE7A 1XBSA 2KP2A 16GSA 1A0RP 1GWCA 3H93A 2LEGA 2PGTA 2LKUA 1E6BA 3CSHA 5CYYA 4OO4A 3GTUB 2AV4A 4DSSA 1ABAA 1ERUA 1T3BA 4WEYA 3GA4A 2H1DA 3L0HA 4FYUA 1S3DA 3HD5A 2LJRA 4D73B 4GSTA 3GKKA 2Z9SA 1T7PB 2DJ2A 2V32A 2H0IA 2LRTA 3JCML 3TRQA 2YNXA 2GTUA 2N5AA 3R3EA 2LSTA 2YV7A 3H79A 5DQYA 2DJ3A 1A2LA 2AAWA 3Q74A 1GSSA 1ZCPA 2PERA 2FA8A 3DVXA 2I4AA 2IL3A 2CZ2A 2V6KA 1AXDA 1KTEA 3GKNA 2J23A 3M0FA 3HDCA 2C0FA 4MH3A 2QA2A 1YDKA 5IPHA 4TRXA 3WYWA 2B5YA 1K0DA 3HJMA 3M9JA 2K6VA 4KA0A 1DUGA 3BCKA 3VPTA 4K5RA 2HLSA 3F6DA 4PTSA 3AY8A 4OMVA 4NHZA 1O8XA 2IFQB 2L59A 5GAND 5JCUA 1U6TA 2H70A 3LORA 3GN3A 3ME8A 5EY6A 1PSQA 5E4WA 1SD9A 1WIKA 1SENA 2WGRA 3D22A 3ZVJA 4RQXA 3ERWA 4OFTA 2GSSA 3EU3A 2JZSA 4WBJA 2B7JA 1QUWA 1MD3A 2DLXA 5KN2A 3C1RA 2XPEA 3QR6A 5HR3A 2PU9C 3MSZA 4XHMA 4J56E 1TK8B 5B8BA 3TKSA 4OO5A 5IMCA 5J9BA 4ISDA 4XRDA 3OR5A 1EV9A 1MDJA 3PGTA 3F0IA 2B5XA 2F9SA 2L4CA 1Z7PA 2AUVA 2OACA 2CQ9A 3P7XA 2H0HA 3TDGA 1XG8A 3M9KA 2R4VA 3GUSA 5BRTA 1NHYA 4EXJA 5J41A 2WFCA 5JCGA 2LNSA 2OBIA 5KOWA 2HZEA 2E2MA 2GLRA 1K0CA 1ERWA 4FQUA 4RI6A 5LCZA 4IS0A 3ZRDA 2BMXA 1LJRA 3UMAA 5ECLB 4I5QA 5B8AA 3TUEA 4Q5FA 1NW2A 4EIPA 3ZL5A 1GTUA 1GSEA 1QXHA 3MYDA 2LQOA 2EIRA 2AJQB 4HOJA 4BPYA 4G0IA 5KEJA 4KE3A 2DKHA 2M46A 5EPFA 3MNGA 4ICYA 3DIEA 4POBA 2CA8A 2H6XA 2B3SA 1ZOFA 2DSAA 4K7OA 2G0FA 4AF2A 2FA4A 2IPAA 2NVLA 4ID0A 5HFKA 4DSRA 1T1VA 4TKYA 1ST9A 1GSUA 4HI7A 4OFMA 4MJBA 1DE1A 2VLVA 2IWTA 2B7KA 1Q98A 5GSTA 1GTAA 1XCCA 3FRCA 1KEBA 3KTBA 5IO2A 4EUYA 1M3JA 1GTIA 4KUNA 3BBYA 2LTKA 2XBQA 3UVTA 3EINA 1Y25A 5IOXA 5ID2A 2X8HA 1R5AA 4N0ZA 4EC0A 3IOSA 1ZGNA 2AYTA 5CNWA 1DBYA 3L9VA 3WT2A 3R2QA 2A4VA 1VGLA 2YJ7A 1ZYPA 2FLSA 5INYA 3CTGA 4EVMA 2GQKA 5IM9A 3GL5A 1GNEA 1DSBA 4BVXB 1X5EA 4OD7A 4WETA 2YZUA 4WR5A 2E0QA 2HSHA 3VFIA 1O7UA 4PUFC 2GVPA 2RUEA 5IQYA 4K0NA 4XS4A 4Z2TA 4NAXA 3ZIVA 2CX4A 2YZHA 4POMA 4POLA 1Z6MA 3F4RA 2FY6A 4Q5RA 1URMA 5F06A 1TW9A 2VL2A 4MNNA 1BJXA 2UZ8A 2R6KA 3GIXA 3US3A 17GSA 2FWGA 4V2MA 1M2DA 2CZ3A 2RM5A 3G7IA 3KEBA 4K6XA 4GSSA 4L0WA 5JWRB 4V2NA 3A2VA 1U88A 4G9HA 2A4HA 1XFLA 5F05A 5H5RA 3G7YA 3IE3A 1XVQA 1FW1A 4KAEA 2QA1A 1TU8A 2K8SA 2R5GA 4PURA 1MTCA 1S3AA 4XIHA 1BX9A 2EIOA 1TRSA 3KD0A 1Q4JA 4KF9A 2CV4A 4TR0A 5ELAA 2HRFA 1GP1A 5DCHA 5KN0A 1SD8A 2MMZA 4O5QA 1WE0A 22GSA 2XBIA 1GLPA 1HNCA 5HR2A 1EP8A 1T00A 2ON7A 4PUAA 2AHEA 1GH2A 4DSQA 3D6IA 3LSZA 4J57E 2H8LA 5HR1A 3ZVJD 2R3XA 2I1UA 5HFGA 5C00A 2FUG2 4MPFA 3GKMA 1T4YA 3SWLA 2VCZA 3KH7A 2IMFA 3ZTLA 2VCXA 1R7HA 2R37A 2JACA 1F37A 3DYRA 5G31A 6GSTA 3HVSA 1NHOA 5G30A 3I43A 1G7OA 3HJPA 5ECHB 3L9UA 3VK9A 3TJFA 1U87A 1VRSD 1O73A 4JR4A 3FHKA 3UVHA 2C0DA 3WGEA 4BIKA 4TXOA 4HUAA 4I2UA 1HD2A 2JADA 2OJLA 3ZZXA 4BWQA 2VCTA 1PA3A 3P2AA 2A2PA 4BL7A 5DAKB 4HU7A 2KLXA 4PNFA 2C0GA 2FHEA 1G0TA 4FH8A 4IW9A 2DJKA 1M2BA 4HSCX 1S3CA 4K8MA 3TRPA 3O3TA 5D93A 4LL4B 5B7CA 4AJ6A 5D73A 2KUCA 2HXKA 2VD1A 1ZMAA 1OAZA 1B9XC 1PMTA 4WKWA 2X49A 4HDEA 2DIZA 4JBBA 4MPGA 2XPDA 3IA1A 3TOUA 3VURA 1RW1A 3NOFA 1YQ1A 2VCWA 2VAFA 1WOUA 1WPIA 5ENUA 2FD3A 3RPNA 1AAZA 2H1AA 3D4TA 4MZWA 3TKPA 2HSYA 4PX1A 1RQMA 6GSVA 5CRGA 2QKEA 3W8SA 2HSMA 1YZXA 3BD2A 4ML6A 1PGTA 2GT6A 3DXBA 3K8NA 3F4TA 5GAPD 2MBSA 3VWWA 2C3TA 3FY7A 3I69A 2CVDA 2YN1A 1OC9B 2PUKC 3GTUA 5A5KA 3HJOA 2H73A 1K3OA 2V1MA 2L4QA 3EPTA 1XW6A 4FYBA 2J9HA 2K8VA 4EF0A 1PD21 3RDWA 2A2SA 4D73A 4LMVA 2ZUPA 3ZYWA 2LV3A 5ECMB 2DJ0A 3FR3A 4HU9A 1AQWA 4ZL7A 2X8GA 2ZCTA 3M8NA 1YF1A 4F82A 1YEPA 4G0LA 3M1GA 4AJ8A 4WXTA 3IRAA 3FZ5A 3GHAA 4Z2UA 2A2RA 1I5GA 4PQIA 1O81A 3QFBC 4TR4A 4EE0A 4PQ1A 3HZ8A 1UA5A 2C80A 3EC3A 4IBPA 3FEUA 1M99A 5D9VA 4MF7A 5DJMA 2X99A 1SU9A 3H8QA 3IHQA 3L9SA 1MEKA 3CSJA 4PNGA 9GSSA 1WWJA 2V41A 4MF5A 3N9JA 1F9MA 4GF0A 4DVCA 2H75A 1F3AA 2LRCA 3EU4A 3CQFA 4BVYB 3TCOA 4V1Ap 7GSSA 8GSSA 2H66A 3ED3A 3VLNA 5F0GA 2H1BA 3KGKA 1A2JA 5D96A 3LW9A 5L71A 2OE3A 3MDKA 1TTZA 1NSWA 2IJYA 1GUMA 3ERFA 1OC3A 5ECIB 4GQFA 5G5FA 3ZLPA 1EZKA 2O8VB 5ECRB 2QSIA 2XHFA 4MJAA 5AIXA 1SJZA 4KSMA 5COHA 4MJEA 2L57A 4K1FA 2LRNA 1FVKA 3DVWA 3FMWA 3CRUA 4CY8A 3LJRA 3FR9A 4MJCA 1SYRA 3QOUA 1J9BA 4HJ2A 2N5BA 4IP1A 5BMUA 4QQ7A 3WGDA 3F3QA 5F8BA 4EO3A 4MDCA 4PQHA 1YF0A 4L5OA 3ZIJA 1GSYA 5DVBA 1EGOA 4JU5A 2R0GA 2WCIA 1XOBA 5G1KA 2HNLA 4USSA 5J5NA 4GTUA 2MMAA 4TVEA 1GL8A 2YCDA 3CXGA 5KN3A 3UBLA 4V2LA 1A0FA 3GYKA 4HEA2 1O6JA 4J2FA 1HYUA 3QCPA 3LXTA 3APOA 1IYIA 1GUKA 1SJIA 1CQHA 3LFLA 5G5EA 4GQCA 1FG4A 1K0AA 3EMPA 5D9XA 1PX7A 4HZ2A 2DIYA 5ECPB 4YQVA 1WP0A 4MZCA 5IPGA 4XTSA 2RM6A 3O76A 4ZB9A 3VWVA 1CQGA 5AN1A 3APSA 4ML1A 3GH6A 2HFDA 4ZBAA 1ZYEA 2OE0A 4NV5A 4GCIA 3RPPA 3PINA 2DJJA 1R26A 3GSSA 4MP4A 2H19A 5FT3A 4ZB8A 1EOGA 3IAS2 3DWVA 4KW6A 2X64A 5A4WA 2CAQA 4HS1A 2C3NA 2VD0A 1FB6A 5HFIA 4IKHA 4DEJA 2ES7A 3E3EA 1Z9HA 4G2EA 3UBKA 1JLVA 4K2DA 3KM6A 1X0RA 4ZIJA 3ZFLA 3GMFA 1SJ6A 2B1LA 2O89A 1JFUA 3IPZA 2VCVA 2L5LA 2K9FA 4O92A 2KOKA 1ZYQB 4BWSA 4YQUA 2H01A 3W6GA 1SK0A 1XWBA 3HYPA 1AUCA 2YPMA 3UARA 3LG6A 3F6FA 1BAYA 5D9WA 3RHBA 4MABA 1NM3A 2C4JA 4I97A 4L5LA 3N5OA 3IR4A 4FO5A 1C72A 3IXRA 5FWGA 3MIXA 1USBA 4NHWA 4BVXA 5CRWA 4WR4A 1TKDB 3IV4A 4ZBDA 4PGTA 1K0NA 1T8EB 3CRTA 2H76A 3WD6A 2LQQA 2LS5A 2IN3A 4CHSA 5A4VA 5LD0A 3HZ4A 4ULXA 2O7KA 3M3MA 4F03A 2RIIA 2ZNMA 1WJKA 3F8UA 3ZMKA 3FR6A 2GQMA 3U5RE 1LU4A 3RBTA 2P5RA 3TJGA 5IIZA 4KGIA 3PPUA 3IDVA 5D8IA 2R2JA 3H1NA 5F07A 3MWHA 5J9CA 2DBCA 3HXSA 1QQ2A 2FNOA 1M0UA 4YKFA 4OFNA 4FYCA 1H4OA 2P5QA 2M80A 1B4QA 4F0CA 2F3MA 2DMMA 1RK4A 3TKSE 3QFAC 4Q5QA 2QGVA 1PKWA 4KB3A 4AJ7A 2OBKA 1X9SB 1S3RA 2DJ1A 4ECIA 1T4ZA 1ML6A 5DCGA 1M2AA 4POKA 3DD3A 5ECKB 6GSSA 2HYXA 3E9JB 3EWLA 1EEMA 4KSOA 3FW2A 1SKWB 1AW9A 3EURA 5J4UA 1TRVA 1TDIA 2VUPA 3TJBA 3UEMA 5EL8A 3NIVA 1TK0B 1X9MB 2V2GA 2MZCA 4KCAA 2OA7A 3GURA 20GSA 1TP9A 3TKRA 2FWFA 3Q18A 2YWNA 3FYGA 1K0BA 1TU7A 4N10A 4HJMA 2GS3A 4XRAA 2BTOT 2GSRA 3V1WA 3S9FA 1JZWA 2HZFA 4ZILA 2F51A 2MMNA 3GNJA 1HNAA 5DALB 4GLTA 1AQXA 5IO0A 2B1KA 1ZYNA 3CBUA 2F8AA 4OWYA 3ZFBA 3RHCA 3VPQA 2HT9A 4Q5NA 3J7Yk 2C0EA 4LL1B 4ILFA 1G6YA 1BQ7A 4G10A 4ECCA 1FHEA 1Z7RA 4RQRA 1PFOA 3F4SA 4JR6A 2VOCA 4NPBA 5LNKe 3E0UA 3H4KA 3HY2A 4LLRA 3DMLA 4N30A 3LQ7A 3EE2A 1SK1A 4Z7XA 3BCIA 4IGJA 5DAKA 4TXOB 4HQZA 4WF4A 4V1Ag 1TI3A 4EIQA 5DBQA 4CY6A 2WZ9A 2NBSA 4ZXGA 4NWYA 3FZ4A 1K3YA 2H1GA 2L5OA 4ECJA 1XW9A 3GH9A 1QGVA 1OYJA 2GZYA 3BJ5A 1PRXA 3L78A 1B8XA 1ZZYA 2MYGA 2VO4A 1VF1A 1PX6A 1SKSB 2LUSA 4TN8A 1OKDA 4ECBA 1GSQA 1V57A 5ECQB 3A2WA 2WB9A 4E8EA 4BA7A 3O6TA 1HQOA 5IMAA 6GSYA 10GSA 4NV2A 5E59A 2PPTA 3GFKA 2JL4A 4TR1B 3I6AA 1R4WA 1PL2A 3WGXA 4AGSA 2FWEA 1EV4A 5IMVA 3KH9A 3EMXA 1OC9A 4N0VA 2MMOA 3IC4A 4YKGA 4YAPA 1G7EA 1FB0A 4XCSA 4QL7A 3CMIA 2VL3A 4DSSB 3ZMLA 5AGYA 2E2GA 3KMNA 2M72A 1GUHA 1XWCA 2VCQA 4MMMA 1SKRB 3TKSC 3D5JA 4K7NA 1SK2A 2JSYA 5KOXA 3HVVA 4IQ1A 1Z3EA 1M9AA 5A4UA 3IC8A 4KNDA 4K2XA 1GSDA 1U3AA 5CRDA 1W89A 2DKIA 3HHVA 1SL1B 2P0GA 3P8WA 2YOIA 2DC5A 2K18A 4JRRA 2HI7A 2NDOA 1SL2B 2R0CA 4IELA 2HRAA 2X8CA 4TR3A 1OC8A 2TRXA 1V40A 3IBHA 4N11A 5FHIA 4GRFA 1J08A 3ME7A 2AB6A 1V58A 2VM2A 3RAZA 2HE3A 4ZB6A 3IK7A 4MK3A 3D4MA 4WF5A 3C8EA 3CSIA 4BVYA 3A5WA 1GLQA 6GSWA 2HRKA 12GSA 2CX3A 2ALBA 5ABRA 3KXOA 4EL1A 1A24A 4G0KA 5GZZB 1LBKA 4CW9A 2IFQA 4GSNA 2F8FA 4KX4A 4NXIA 2GSTA 2H6YA 2YWMA 3ZITA 1AIUA 2I3YA 2LNTA 4PXOA 3VWUA 1A2MA 4IN0A 2I9HA 2GGTA 2WJUA 1B4PA 2BJXA 3I9V2 3L4NA 3A2XA 1M7TA 1SYXA 1AC1A 1XW5A 5JWQB 13GSA 4ZBBA 1X5CA 1UC7A 2FGXA 2IMKA 3DKSA 4H86A 1GSFA 3UL3A 3TRXA 2REMA 1BEDA 1THXA 2O87A 3QPMA 3KTLA 3DEXA 2X4AA 3D0ZA 2JZTA 3QAGA 3PR8A 4RUVA 5B6MA 4TOPA 3KZQA 3GL3A 3QDNA 6GSXA 1O85A 3DGQA 3C1SA 1KNGA 2WDUA 3CTFA 4EDZA 5ELGA 3A3TA 2H71A 1IYHA 4F0BA 4I8BA 2JSZA 2WS2A 1K0MA 1UVZA 1JZOA 3NZNA 2OKAA 3ZREA 18GSA 1FAAA 4YH2A 3U6VA 4K5SA 1QFNA 5C04A 2HZEB 1X5DA 1Z6NA 1OVNA 3TOTA 4I2TA 1WRYA 4KCEA 4MZBA 4OCFA 3LWAA 2DMLA 2H6ZA 4NMUA 2EC4A 2G2QA 5HR0A 1B48A 4WBRD 3GV1A 1XZOA 3UOMA 3SBCA 4YQMA 4O7HA 2VL2C 4MCUA 1MD4A 4K7IA 2GZZA 3KP9A 2IIYA 3LGCA 5B6NA 3QD9A 11GSA 5G1LA 3J7Yb 2EIQA 4FIWA 2GT5A 2PVOC 1WMJA 1A8LA 3UIWA 4KDXA 1XWKA 1BYEA 4ACSA 3EYTA 1E2YA 2VLUA 3G9BA 5AISA 1B9YC 1U3IA 4OCEA 1AQVA 2IMEA 2LJAA 1N8JA 4HZ4A 3FKFA 2QC7A 2L6CA 5CREA 3UJ1A 1YJ6A 3VI5A 3HVNA 2VIMA 2H30A 3HCZA 2V6OA 2L6DA 5DDLA 4E8HA 1TRUA 2C8UA 3A5IA 4O32A 3LYKA 1K3LA 2YWOA 1XOAA 4EDYA 3KP8A 5J3RA 3IK9A 3FZAA 2B6MA 2CVBA 2KHPA 5ID2B 5ECSA 4K0GA 1JHBA 3UAPA 3ISOA 3KCMA 3IHGA 1FVJA 4JZQA 2WRTA 5CP1A
chains in the Genus database with same CATH topology
1QK8A 2NTOA 3GRXA 3APQA 1F6MC 1XVWA 1F3BA 1N2AA 1EEJA 1OKTA 6GSUA 4TXVA 2PN8A 4GWRA 4CDOA 1PQNA 4GXZA 2D2ZA 3C73A 5CAXA 3VWXA 1JLWA 1W4VA 1ZL9A 2VLTA 1ILOA 1V9WA 5DQSA 1YY7A 1TOFA 1XPVA 4JEDA 5HQPA 4XS4B 4IP6A 3WT1A 2HRNA 4K9ZA 3BOAA 1KBNA 5D9TA 4X43A 5CO3A 3GKXA 3TKQA 2R0PA 3FZ9A 1DE2A 4IQAA 2JZRA 3KIJA 1Z5YE 4P3YB 4LA1A 2RLIA 3LXZA 3CYNA 3TGZA 2GQLA 1VF3A 1GRXA 1THOA 19GSA 3GX8A 1XWAA 3Q19A 4KDYA 1H75A 4L0UA 1GTBA 1TK5B 1Y6EA 4IJIA 2C1YA 1SL0B 4L8EA 3HA9A 2XC2A 3TJJA 2IMIA 2RUFA 3D21A 3GX0A 1A23A 3Q6OA 2PWJA 3G7JA 4XS6A 1ON4A 3FK8A 3LYPA 1XIYA 3IAM2 2FCHA 5IMFA 2PMTA 4IHUA 4Z2RA 2E7PA 2GSQA 3KMOA 1YKAA 5EVOA 4KDUA 4MLYA 1YKCA 1V98A 2VL9A 5G2ZA 3LEFA 3HVXA 1VF2A 1YEXA 3MAKA 2YJHA 5JCWA 1G6WA 2OADA 1F2EA 3GSTA 4F9ZA 5ECNB 1GNWA 2PVQA 5JWOB 1ERTA 3P90A 3KJYA 5DALA 2KP1A 3PH9A 1GULA 2LJKA 1UN2A 3TJKA 2YANA 1ACVA 1A8YA 4X4JA 5CRHA 4O5UA 1MDIA 5IMZA 4JE1A 4TW5A 1X9WB 1TXXA 5IMDA 4EKZA 5ECOB 1FOHA 2YP6A 1FO5A 1FOVA 1EP7A 1VF4A 1TI1A 3C7MA 2IMDA 2C3QA 3VI7A 5KN1A 4ZL8A 2TIRA 1I9DA 5H5SA 2YWIA 1JZRA 2VM1A 2P31A 2I81A 4IJ3A 1QMVA 4O5RA 2NPBA 2H72A 3ERGA 2GZPA 4A5PA 4RI7A 4HQSA 5AIVA 1TRWA 1EWXA 1XWGA 4YAVA 4BL7B 2N5FA 3C71A 1HNBA 2MBTA 2CT6A 1PKZA 4QL9A 2WULA 2CAIA 5GSSA 4ZL9A 4X1UA 3F3RA 4KH7A 1PN0A 3DRNA 2GDRA 14GSA 1XXUA 2JU5A 1O8WA 1PN9A 1BG5A 3QMXA 5DJLA 3HKRA 3W8JA 4G19A 4I6XA 2YV9A 3TB2A 1ERVA 1MDKA 4MA9A 4MF6A 1J0FA 2H74A 2OE1A 1EOHA 4XS1A 1OE8A 3QAWA 1R5PA 2FWHA 1TJDA 1M9BA 4LMWA 1EGRA 4F2IA 2TRCP 2O85A 1JZDA 2PBJA 3F9UA 4TR1A 2B5EA 2H0GA 1K0OA 3F63A 1PL1A 2ON5A 2CVKA 4IVFA 4X0XA 4MH2A 3QAVA 5IOWA 1V2AA 5H5QA 3EVIA 1OE7A 1XBSA 2KP2A 16GSA 1A0RP 1GWCA 3H93A 2LEGA 2PGTA 2LKUA 1E6BA 3CSHA 5CYYA 4OO4A 3GTUB 2AV4A 4DSSA 1ABAA 1ERUA 1T3BA 4WEYA 3GA4A 2H1DA 3L0HA 4FYUA 1S3DA 3HD5A 2LJRA 4D73B 4GSTA 3GKKA 2Z9SA 1T7PB 2DJ2A 2V32A 2H0IA 2LRTA 3JCML 3TRQA 2YNXA 2GTUA 2N5AA 3R3EA 2LSTA 2YV7A 3H79A 5DQYA 2DJ3A 1A2LA 2AAWA 3Q74A 1GSSA 1ZCPA 2PERA 2FA8A 3DVXA 2I4AA 2IL3A 2CZ2A 2V6KA 1AXDA 1KTEA 3GKNA 2J23A 3M0FA 3HDCA 2C0FA 4MH3A 2QA2A 1YDKA 5IPHA 4TRXA 3WYWA 2B5YA 1K0DA 3HJMA 3M9JA 2K6VA 4KA0A 1DUGA 3BCKA 3VPTA 4K5RA 2HLSA 3F6DA 4PTSA 3AY8A 4OMVA 4NHZA 1O8XA 2IFQB 2L59A 5GAND 5JCUA 1U6TA 2H70A 3LORA 3GN3A 3ME8A 5EY6A 1PSQA 5E4WA 1SD9A 1WIKA 1SENA 2WGRA 3D22A 3ZVJA 4RQXA 3ERWA 4OFTA 2GSSA 3EU3A 2JZSA 4WBJA 2B7JA 1QUWA 1MD3A 2DLXA 5KN2A 3C1RA 2XPEA 3QR6A 5HR3A 2PU9C 3MSZA 4XHMA 4J56E 1TK8B 5B8BA 3TKSA 4OO5A 5IMCA 5J9BA 4ISDA 4XRDA 3OR5A 1EV9A 1MDJA 3PGTA 3F0IA 2B5XA 2F9SA 2L4CA 1Z7PA 2AUVA 2OACA 2CQ9A 3P7XA 2H0HA 3TDGA 3M9KA 2R4VA 3GUSA 5BRTA 1NHYA 4EXJA 5J41A 2WFCA 5JCGA 2LNSA 2OBIA 5KOWA 2HZEA 2E2MA 2GLRA 1K0CA 1ERWA 4FQUA 4RI6A 5LCZA 4IS0A 3ZRDA 2BMXA 1LJRA 3UMAA 5ECLB 4I5QA 5B8AA 3TUEA 4Q5FA 1NW2A 4EIPA 3ZL5A 1GTUA 1GSEA 1QXHA 3MYDA 2LQOA 2EIRA 2AJQB 4HOJA 4BPYA 4G0IA 5KEJA 4KE3A 2DKHA 2M46A 5EPFA 3MNGA 4ICYA 3DIEA 4POBA 2CA8A 2H6XA 2B3SA 1ZOFA 2DSAA 4K7OA 2G0FA 4AF2A 2FA4A 2IPAA 2NVLA 4ID0A 5HFKA 4DSRA 1T1VA 4TKYA 1ST9A 1GSUA 4HI7A 4OFMA 4MJBA 1DE1A 2VLVA 2IWTA 2B7KA 1Q98A 5GSTA 1GTAA 1XCCA 3FRCA 1KEBA 3KTBA 5IO2A 4EUYA 1GTIA 4KUNA 3BBYA 2LTKA 2XBQA 3UVTA 3EINA 1Y25A 5IOXA 5ID2A 2X8HA 1R5AA 4N0ZA 4EC0A 3IOSA 1ZGNA 2AYTA 5CNWA 1DBYA 3L9VA 3WT2A 3R2QA 2A4VA 1VGLA 2YJ7A 1ZYPA 2FLSA 5INYA 3CTGA 4EVMA 2GQKA 5IM9A 3GL5A 1GNEA 1DSBA 4BVXB 1X5EA 4OD7A 4WETA 2YZUA 4WR5A 2E0QA 2HSHA 3VFIA 1O7UA 4PUFC 2GVPA 2RUEA 5IQYA 4K0NA 4XS4A 4Z2TA 4NAXA 3ZIVA 2CX4A 2YZHA 4POMA 4POLA 1Z6MA 3F4RA 2FY6A 4Q5RA 1URMA 5F06A 1TW9A 2VL2A 4MNNA 1BJXA 2UZ8A 2R6KA 3GIXA 3US3A 17GSA 2FWGA 4V2MA 1M2DA 2CZ3A 2RM5A 3G7IA 3KEBA 4K6XA 4GSSA 4L0WA 5JWRB 4V2NA 3A2VA 1U88A 4G9HA 2A4HA 1XFLA 5F05A 5H5RA 3G7YA 3IE3A 1XVQA 1FW1A 4KAEA 2QA1A 1TU8A 2K8SA 2R5GA 4PURA 1MTCA 1S3AA 4XIHA 1BX9A 2EIOA 1TRSA 3KD0A 1Q4JA 4KF9A 2CV4A 4TR0A 5ELAA 2HRFA 1GP1A 5DCHA 5KN0A 1SD8A 2MMZA 4O5QA 1WE0A 22GSA 2XBIA 1GLPA 1HNCA 5HR2A 1EP8A 1T00A 2ON7A 4PUAA 2AHEA 1GH2A 4DSQA 3D6IA 3LSZA 4J57E 2H8LA 5HR1A 3ZVJD 2R3XA 2I1UA 5HFGA 5C00A 2FUG2 4MPFA 3GKMA 1T4YA 3SWLA 2VCZA 3KH7A 2IMFA 3ZTLA 2VCXA 1R7HA 2R37A 2JACA 1F37A 3DYRA 5G31A 6GSTA 3HVSA 1NHOA 5G30A 3I43A 1G7OA 3HJPA 5ECHB 3L9UA 3VK9A 3TJFA 1U87A 1VRSD 1O73A 4JR4A 3FHKA 3UVHA 2C0DA 3WGEA 4TXOA 4HUAA 4I2UA 1HD2A 2JADA 2OJLA 3ZZXA 4BWQA 2VCTA 1PA3A 3P2AA 2A2PA 4BL7A 5DAKB 4HU7A 2KLXA 4PNFA 2C0GA 2FHEA 1G0TA 4FH8A 4IW9A 2DJKA 1M2BA 1S3CA 4K8MA 3TRPA 3O3TA 5D93A 4LL4B 5B7CA 4AJ6A 5D73A 2KUCA 2HXKA 2VD1A 1ZMAA 1OAZA 1B9XC 1PMTA 4WKWA 2X49A 4HDEA 2DIZA 4JBBA 4MPGA 2XPDA 3IA1A 3TOUA 3VURA 1RW1A 3NOFA 1YQ1A 2VCWA 2VAFA 1WOUA 1WPIA 5ENUA 2FD3A 3RPNA 1AAZA 2H1AA 3D4TA 4MZWA 3TKPA 2HSYA 4PX1A 1RQMA 6GSVA 5CRGA 2QKEA 3W8SA 2HSMA 1YZXA 3BD2A 4ML6A 1PGTA 2GT6A 3DXBA 3K8NA 3F4TA 5GAPD 2MBSA 3VWWA 2C3TA 3FY7A 3I69A 2CVDA 2YN1A 1OC9B 2PUKC 3GTUA 5A5KA 3HJOA 2H73A 1K3OA 2V1MA 2L4QA 3EPTA 1XW6A 4FYBA 2J9HA 2K8VA 4EF0A 1PD21 3RDWA 2A2SA 4D73A 4LMVA 2ZUPA 3ZYWA 2LV3A 5ECMB 2DJ0A 3FR3A 4HU9A 1AQWA 4ZL7A 2X8GA 2ZCTA 3M8NA 1YF1A 4F82A 1YEPA 4G0LA 3M1GA 4AJ8A 4WXTA 3IRAA 3FZ5A 3GHAA 4Z2UA 2A2RA 1I5GA 4PQIA 1O81A 3QFBC 4TR4A 4EE0A 4PQ1A 3HZ8A 1UA5A 2C80A 3EC3A 4IBPA 3FEUA 1M99A 5D9VA 4MF7A 5DJMA 2X99A 1SU9A 3H8QA 3IHQA 3L9SA 1MEKA 3CSJA 4PNGA 9GSSA 1WWJA 2V41A 4MF5A 3N9JA 1F9MA 4GF0A 4DVCA 2H75A 1F3AA 2LRCA 3EU4A 4BVYB 3TCOA 4V1Ap 7GSSA 8GSSA 2H66A 3ED3A 3VLNA 5F0GA 2H1BA 3KGKA 1A2JA 5D96A 3LW9A 5L71A 2OE3A 3MDKA 1TTZA 1NSWA 2IJYA 1GUMA 3ERFA 1OC3A 5ECIB 4GQFA 5G5FA 3ZLPA 1EZKA 2O8VB 5ECRB 2QSIA 2XHFA 4MJAA 5AIXA 1SJZA 4KSMA 5COHA 4MJEA 2L57A 2LRNA 4K1FA 1FVKA 3DVWA 3FMWA 3CRUA 4CY8A 3LJRA 3FR9A 4MJCA 1SYRA 3QOUA 1J9BA 4HJ2A 2N5BA 4IP1A 5BMUA 4QQ7A 3WGDA 3F3QA 5F8BA 4EO3A 4MDCA 4PQHA 1YF0A 4L5OA 3ZIJA 1GSYA 5DVBA 1EGOA 4JU5A 2R0GA 2WCIA 1XOBA 5G1KA 2HNLA 4USSA 5J5NA 4GTUA 2MMAA 4TVEA 1GL8A 2YCDA 3CXGA 5KN3A 3UBLA 4V2LA 1A0FA 3GYKA 4HEA2 1O6JA 4J2FA 1HYUA 3QCPA 3LXTA 3APOA 1IYIA 1GUKA 1SJIA 1CQHA 3LFLA 5G5EA 4GQCA 1FG4A 1K0AA 3EMPA 5D9XA 1PX7A 4HZ2A 2DIYA 5ECPB 4YQVA 1WP0A 4MZCA 5IPGA 4XTSA 2RM6A 3O76A 4ZB9A 3VWVA 1CQGA 5AN1A 3APSA 4ML1A 3GH6A 2HFDA 4ZBAA 1ZYEA 2OE0A 4NV5A 4GCIA 3RPPA 3PINA 2DJJA 1R26A 3GSSA 4MP4A 2H19A 5FT3A 4ZB8A 1EOGA 3IAS2 3DWVA 4KW6A 2X64A 5A4WA 2CAQA 4HS1A 2C3NA 2VD0A 1FB6A 5HFIA 4IKHA 4DEJA 2ES7A 3E3EA 1Z9HA 4G2EA 3UBKA 1JLVA 4K2DA 3KM6A 1X0RA 4ZIJA 3ZFLA 3GMFA 1SJ6A 2B1LA 2O89A 1JFUA 3IPZA 2VCVA 2L5LA 2K9FA 4O92A 2KOKA 1ZYQB 4BWSA 4YQUA 2H01A 3W6GA 1SK0A 1XWBA 3HYPA 1AUCA 2YPMA 3UARA 3LG6A 3F6FA 1BAYA 5D9WA 3RHBA 4MABA 1NM3A 2C4JA 4I97A 4L5LA 3N5OA 3IR4A 4FO5A 1C72A 3IXRA 5FWGA 3MIXA 1USBA 4NHWA 4BVXA 5CRWA 4WR4A 1TKDB 3IV4A 4ZBDA 4PGTA 1K0NA 1T8EB 3CRTA 2H76A 3WD6A 2LQQA 2LS5A 2IN3A 4CHSA 5A4VA 5LD0A 3HZ4A 4ULXA 2O7KA 3M3MA 4F03A 2RIIA 2ZNMA 1WJKA 3F8UA 3ZMKA 3FR6A 2GQMA 3U5RE 1LU4A 3RBTA 2P5RA 3TJGA 5IIZA 4KGIA 3PPUA 3IDVA 5D8IA 2R2JA 3H1NA 5F07A 3MWHA 5J9CA 2DBCA 3HXSA 1QQ2A 2FNOA 1M0UA 4YKFA 4OFNA 4FYCA 1H4OA 2P5QA 2M80A 1B4QA 4F0CA 2F3MA 2DMMA 1RK4A 3TKSE 3QFAC 4Q5QA 2QGVA 1PKWA 4KB3A 4AJ7A 2OBKA 1X9SB 2DJ1A 4ECIA 1T4ZA 1ML6A 5DCGA 1M2AA 4POKA 3DD3A 5ECKB 6GSSA 2HYXA 3E9JB 3EWLA 1EEMA 4KSOA 3FW2A 1SKWB 1AW9A 3EURA 5J4UA 1TRVA 1TDIA 2VUPA 3TJBA 3UEMA 5EL8A 3NIVA 1TK0B 1X9MB 2V2GA 2MZCA 4KCAA 2OA7A 3GURA 20GSA 1TP9A 3TKRA 2FWFA 3Q18A 2YWNA 3FYGA 1K0BA 1TU7A 4N10A 4HJMA 2GS3A 4XRAA 2BTOT 2GSRA 3V1WA 3S9FA 1JZWA 2HZFA 4ZILA 2F51A 2MMNA 3GNJA 1HNAA 5DALB 4GLTA 1AQXA 5IO0A 2B1KA 1ZYNA 3CBUA 2F8AA 4OWYA 3ZFBA 3RHCA 3VPQA 2HT9A 4Q5NA 3J7Yk 2C0EA 4LL1B 4ILFA 1G6YA 1BQ7A 4G10A 4ECCA 1FHEA 1Z7RA 4RQRA 3F4SA 4JR6A 2VOCA 4NPBA 5LNKe 3E0UA 3H4KA 3HY2A 4LLRA 3DMLA 4N30A 3LQ7A 3EE2A 1SK1A 4Z7XA 3BCIA 4IGJA 5DAKA 4TXOB 4HQZA 4WF4A 4V1Ag 1TI3A 4EIQA 5DBQA 4CY6A 2WZ9A 2NBSA 4ZXGA 4NWYA 3FZ4A 1K3YA 2H1GA 2L5OA 4ECJA 1XW9A 3GH9A 1QGVA 1OYJA 2GZYA 3BJ5A 1PRXA 3L78A 1B8XA 1ZZYA 2MYGA 2VO4A 1VF1A 1PX6A 1SKSB 2LUSA 4TN8A 1OKDA 4ECBA 1GSQA 1V57A 5ECQB 3A2WA 2WB9A 4E8EA 4BA7A 3O6TA 1HQOA 5IMAA 6GSYA 10GSA 4NV2A 5E59A 2PPTA 3GFKA 2JL4A 4TR1B 3I6AA 1R4WA 1PL2A 3WGXA 4AGSA 2FWEA 1EV4A 5IMVA 3KH9A 3EMXA 1OC9A 4N0VA 2MMOA 3IC4A 4YKGA 4YAPA 1G7EA 1FB0A 4XCSA 4QL7A 3CMIA 2VL3A 4DSSB 3ZMLA 5AGYA 2E2GA 3KMNA 2M72A 1GUHA 1XWCA 2VCQA 4MMMA 1SKRB 3TKSC 3D5JA 4K7NA 1SK2A 2JSYA 5KOXA 3HVVA 4IQ1A 1Z3EA 1M9AA 5A4UA 3IC8A 4KNDA 4K2XA 1GSDA 1U3AA 5CRDA 1W89A 2DKIA 3HHVA 1SL1B 2P0GA 3P8WA 2YOIA 2DC5A 2K18A 4JRRA 2HI7A 2NDOA 1SL2B 2R0CA 4IELA 2HRAA 2X8CA 4TR3A 1OC8A 2TRXA 1V40A 3IBHA 4N11A 5FHIA 4GRFA 1J08A 3ME7A 2AB6A 1V58A 2VM2A 3RAZA 2HE3A 4ZB6A 3IK7A 4MK3A 3D4MA 4WF5A 3C8EA 3CSIA 4BVYA 3A5WA 1GLQA 6GSWA 2HRKA 12GSA 2CX3A 2ALBA 5ABRA 3KXOA 4EL1A 1A24A 4G0KA 5GZZB 1LBKA 4CW9A 2IFQA 4GSNA 2F8FA 4KX4A 4NXIA 2GSTA 2H6YA 2YWMA 3ZITA 1AIUA 2I3YA 2LNTA 4PXOA 3VWUA 1A2MA 4IN0A 2I9HA 2GGTA 2WJUA 1B4PA 2BJXA 3I9V2 3L4NA 3A2XA 1M7TA 1SYXA 1AC1A 1XW5A 5JWQB 13GSA 4ZBBA 1X5CA 1UC7A 2FGXA 2IMKA 3DKSA 4H86A 1GSFA 3UL3A 3TRXA 2REMA 1BEDA 1THXA 2O87A 3QPMA 3KTLA 3DEXA 2X4AA 3D0ZA 2JZTA 3QAGA 3PR8A 4RUVA 5B6MA 4TOPA 3KZQA 3GL3A 3QDNA 6GSXA 1O85A 3DGQA 3C1SA 1KNGA 2WDUA 3CTFA 4EDZA 5ELGA 3A3TA 2H71A 1IYHA 4F0BA 4I8BA 2JSZA 2WS2A 1K0MA 1UVZA 1JZOA 3NZNA 2OKAA 3ZREA 18GSA 1FAAA 4YH2A 3U6VA 4K5SA 1QFNA 5C04A 2HZEB 1X5DA 1Z6NA 1OVNA 3TOTA 4I2TA 1WRYA 4KCEA 4MZBA 4OCFA 3LWAA 2DMLA 2H6ZA 4NMUA 2EC4A 2G2QA 5HR0A 1B48A 4WBRD 3GV1A 1XZOA 3UOMA 3SBCA 4YQMA 4O7HA 2VL2C 4MCUA 1MD4A 4K7IA 2GZZA 3KP9A 2IIYA 3LGCA 5B6NA 3QD9A 11GSA 5G1LA 3J7Yb 2EIQA 4FIWA 2GT5A 2PVOC 1WMJA 1A8LA 3UIWA 4KDXA 1XWKA 1BYEA 4ACSA 3EYTA 1E2YA 2VLUA 3G9BA 5AISA 1B9YC 1U3IA 4OCEA 1AQVA 2IMEA 2LJAA 1N8JA 4HZ4A 3FKFA 2QC7A 2L6CA 5CREA 3UJ1A 1YJ6A 3VI5A 2VIMA 2H30A 3HCZA 2V6OA 2L6DA 5DDLA 4E8HA 1TRUA 2C8UA 3A5IA 4O32A 3LYKA 1K3LA 2YWOA 1XOAA 4EDYA 3KP8A 5J3RA 3IK9A 3FZAA 2B6MA 2CVBA 2KHPA 5ID2B 5ECSA 4K0GA 1JHBA 3UAPA 3ISOA 3KCMA 3IHGA 1FVJA 4JZQA 2WRTA 5CP1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QK8 A;  2NTO A;  3GRX A;  3APQ A;  1F6M C;  1XVW A;  1F3B A;  1N2A A;  1EEJ A;  1OKT A;  6GSU A;  4TXV A;  2PN8 A;  4GWR A;  4CDO A;  1PQN A;  4GXZ A;  2D2Z A;  3C73 A;  5CAX A;  3VWX A;  1JLW A;  1W4V A;  1ZL9 A;  2VLT A;  1ILO A;  1V9W A;  5DQS A;  1YY7 A;  1TOF A;  1XPV A;  4JED A;  5HQP A;  4XS4 B;  4IP6 A;  3WT1 A;  2HRN A;  4K9Z A;  3BOA A;  1KBN A;  5D9T A;  4X43 A;  5CO3 A;  3GKX A;  3TKQ A;  3FZ9 A;  1DE2 A;  4IQA A;  2JZR A;  3KIJ A;  1Z5Y E;  4P3Y B;  4LA1 A;  2RLI A;  3LXZ A;  3CYN A;  3TGZ A;  2GQL A;  1VF3 A;  1GRX A;  1THO A;  19GS A;  3GX8 A;  1XWA A;  3Q19 A;  4KDY A;  1H75 A;  4L0U A;  1GTB A;  1TK5 B;  1Y6E A;  4IJI A;  2C1Y A;  1SL0 B;  4L8E A;  3HA9 A;  2XC2 A;  3TJJ A;  2IMI A;  2RUF A;  3D21 A;  3GX0 A;  1A23 A;  3Q6O A;  2PWJ A;  3G7J A;  4XS6 A;  1ON4 A;  3FK8 A;  3LYP A;  1XIY A;  3IAM 2;  2FCH A;  5IMF A;  2PMT A;  4IHU A;  2E7P A;  2GSQ A;  3KMO A;  1YKA A;  5EVO A;  4KDU A;  4MLY A;  1YKC A;  1V98 A;  2VL9 A;  5G2Z A;  3LEF A;  3HVX A;  1VF2 A;  1YEX A;  3MAK A;  2YJH A;  5JCW A;  1G6W A;  2OAD A;  1F2E A;  3GST A;  4F9Z A;  5ECN B;  1GNW A;  2PVQ A;  5JWO B;  1ERT A;  3P90 A;  3KJY A;  5DAL A;  2KP1 A;  3PH9 A;  1GUL A;  2LJK A;  1UN2 A;  3TJK A;  2YAN A;  1ACV A;  1A8Y A;  5CRH A;  1MDI A;  5IMZ A;  4JE1 A;  4TW5 A;  1X9W B;  1TXX A;  5IMD A;  4EKZ A;  5ECO B;  2YP6 A;  1FO5 A;  1FOV A;  1EP7 A;  1VF4 A;  1TI1 A;  3C7M A;  2IMD A;  2C3Q A;  3VI7 A;  5KN1 A;  4ZL8 A;  2TIR A;  1I9D A;  5H5S A;  2YWI A;  1JZR A;  2VM1 A;  2P31 A;  2I81 A;  4IJ3 A;  1QMV A;  4O5R A;  2NPB A;  2H72 A;  3ERG A;  2GZP A;  4RI7 A;  4HQS A;  5AIV A;  1TRW A;  1EWX A;  1XWG A;  4YAV A;  2N5F A;  3C71 A;  1HNB A;  2MBT A;  2CT6 A;  1PKZ A;  4QL9 A;  2WUL A;  2CAI A;  5GSS A;  4ZL9 A;  4X1U A;  3F3R A;  4KH7 A;  3DRN A;  2GDR A;  14GS A;  1XXU A;  2JU5 A;  1O8W A;  1PN9 A;  1BG5 A;  5DJL A;  3QMX A;  3HKR A;  3W8J A;  4G19 A;  4I6X A;  2YV9 A;  3TB2 A;  1ERV A;  1MDK A;  4MA9 A;  4MF6 A;  1J0F A;  2H74 A;  2OE1 A;  1EOH A;  4XS1 A;  1OE8 A;  3QAW A;  1R5P A;  2FWH A;  1TJD A;  1M9B A;  4LMW A;  1EGR A;  4F2I A;  2TRC P;  2O85 A;  1JZD A;  2PBJ A;  3F9U A;  4TR1 A;  2B5E A;  2H0G A;  1K0O A;  3F63 A;  1PL1 A;  2ON5 A;  2CVK A;  4IVF A;  4X0X A;  4MH2 A;  3QAV A;  5IOW A;  1V2A A;  5H5Q A;  3EVI A;  1OE7 A;  1XBS A;  2KP2 A;  16GS A;  1A0R P;  1GWC A;  3H93 A;  2LEG A;  2PGT A;  2LKU A;  1E6B A;  3CSH A;  5CYY A;  4OO4 A;  3GTU B;  2AV4 A;  4DSS A;  1ABA A;  1ERU A;  1T3B A;  4WEY A;  3GA4 A;  2H1D A;  3L0H A;  4FYU A;  1S3D A;  3HD5 A;  2LJR A;  4D73 B;  4GST A;  3GKK A;  2Z9S A;  1T7P B;  2DJ2 A;  2V32 A;  2H0I A;  2LRT A;  3JCM L;  3TRQ A;  2YNX A;  2GTU A;  2N5A A;  2LST A;  2YV7 A;  3H79 A;  5DQY A;  2DJ3 A;  1A2L A;  2AAW A;  3Q74 A;  1GSS A;  1ZCP A;  2PER A;  2FA8 A;  3DVX A;  2I4A A;  2IL3 A;  2CZ2 A;  2V6K A;  1AXD A;  1KTE A;  3GKN A;  2J23 A;  3M0F A;  3HDC A;  2C0F A;  4MH3 A;  1YDK A;  5IPH A;  4TRX A;  3WYW A;  2B5Y A;  1K0D A;  3HJM A;  3M9J A;  2K6V A;  4KA0 A;  1DUG A;  3BCK A;  3VPT A;  2HLS A;  3F6D A;  3AY8 A;  4OMV A;  4NHZ A;  1O8X A;  2IFQ B;  2L59 A;  5GAN D;  5JCU A;  1U6T A;  2H70 A;  3LOR A;  3GN3 A;  5EY6 A;  3ME8 A;  1PSQ A;  5E4W A;  1SD9 A;  1WIK A;  1SEN A;  2WGR A;  3D22 A;  3ZVJ A;  4RQX A;  3ERW A;  4OFT A;  2GSS A;  3EU3 A;  2JZS A;  4WBJ A;  2B7J A;  1QUW A;  1MD3 A;  2DLX A;  5KN2 A;  3C1R A;  2XPE A;  3QR6 A;  5HR3 A;  2PU9 C;  3MSZ A;  4XHM A;  4J56 E;  1TK8 B;  5B8B A;  3TKS A;  4OO5 A;  5IMC A;  5J9B A;  4ISD A;  4XRD A;  3OR5 A;  1EV9 A;  1MDJ A;  3PGT A;  3F0I A;  2B5X A;  2F9S A;  2L4C A;  1Z7P A;  2AUV A;  2OAC A;  2CQ9 A;  3P7X A;  2H0H A;  3TDG A;  3M9K A;  2R4V A;  3GUS A;  1NHY A;  4EXJ A;  5J41 A;  2WFC A;  5JCG A;  2LNS A;  2OBI A;  2HZE A;  2E2M A;  2GLR A;  1K0C A;  1ERW A;  4RI6 A;  5LCZ A;  4IS0 A;  3ZRD A;  2BMX A;  1LJR A;  3UMA A;  5ECL B;  4I5Q A;  5B8A A;  3TUE A;  4Q5F A;  1NW2 A;  3ZL5 A;  1GTU A;  1GSE A;  1QXH A;  2LQO A;  2EIR A;  2AJQ B;  4HOJ A;  4BPY A;  5KEJ A;  4KE3 A;  2M46 A;  5EPF A;  3MNG A;  3DIE A;  4POB A;  2CA8 A;  2H6X A;  2B3S A;  1ZOF A;  2DSA A;  4K7O A;  2G0F A;  4AF2 A;  2FA4 A;  2IPA A;  2NVL A;  4ID0 A;  5HFK A;  4DSR A;  1T1V A;  4TKY A;  1ST9 A;  1GSU A;  4HI7 A;  4OFM A;  4MJB A;  1DE1 A;  2VLV A;  2IWT A;  2B7K A;  1Q98 A;  5GST A;  1GTA A;  1XCC A;  3FRC A;  1KEB A;  3KTB A;  5IO2 A;  4EUY A;  1GTI A;  4KUN A;  3BBY A;  2LTK A;  2XBQ A;  3UVT A;  3EIN A;  1Y25 A;  5IOX A;  5ID2 A;  2X8H A;  1R5A A;  4N0Z A;  4EC0 A;  3IOS A;  1ZGN A;  2AYT A;  5CNW A;  1DBY A;  3L9V A;  3WT2 A;  3R2Q A;  2A4V A;  1VGL A;  2YJ7 A;  2FLS A;  5INY A;  3CTG A;  4EVM A;  2GQK A;  5IM9 A;  3GL5 A;  1GNE A;  1DSB A;  1X5E A;  4OD7 A;  4WET A;  2YZU A;  4WR5 A;  2E0Q A;  2HSH A;  3VFI A;  1O7U A;  4PUF C;  2GVP A;  2RUE A;  5IQY A;  4K0N A;  4XS4 A;  4NAX A;  3ZIV A;  2CX4 A;  2YZH A;  4POM A;  4POL A;  1Z6M A;  3F4R A;  2FY6 A;  4Q5R A;  1URM A;  5F06 A;  1TW9 A;  2VL2 A;  1BJX A;  2R6K A;  3GIX A;  3US3 A;  17GS A;  2FWG A;  4V2M A;  1M2D A;  2CZ3 A;  2RM5 A;  3G7I A;  3KEB A;  4K6X A;  4GSS A;  4L0W A;  5JWR B;  4V2N A;  3A2V A;  1U88 A;  4G9H A;  1XFL A;  5F05 A;  5H5R A;  3G7Y A;  3IE3 A;  1XVQ A;  1FW1 A;  4KAE A;  1TU8 A;  2K8S A;  2R5G A;  4PUR A;  1MTC A;  1S3A A;  4XIH A;  1BX9 A;  2EIO A;  1TRS A;  3KD0 A;  1Q4J A;  2CV4 A;  4TR0 A;  5ELA A;  2HRF A;  1GP1 A;  5DCH A;  5KN0 A;  1SD8 A;  2MMZ A;  1WE0 A;  22GS A;  2XBI A;  1GLP A;  1HNC A;  5HR2 A;  1EP8 A;  1T00 A;  2ON7 A;  4PUA A;  2AHE A;  1GH2 A;  4DSQ A;  3D6I A;  3LSZ A;  4J57 E;  2H8L A;  5HR1 A;  3ZVJ D;  2R3X A;  2I1U A;  5HFG A;  5C00 A;  2FUG 2;  4MPF A;  3GKM A;  1T4Y A;  3SWL A;  2VCZ A;  3KH7 A;  2IMF A;  3ZTL A;  2VCX A;  1R7H A;  2R37 A;  2JAC A;  1F37 A;  3DYR A;  5G31 A;  6GST A;  3HVS A;  1NHO A;  5G30 A;  3I43 A;  1G7O A;  3HJP A;  5ECH B;  3L9U A;  3VK9 A;  3TJF A;  1U87 A;  1VRS D;  1O73 A;  4JR4 A;  3FHK A;  3UVH A;  2C0D A;  3WGE A;  4TXO A;  4HUA A;  4I2U A;  1HD2 A;  2JAD A;  2OJL A;  3ZZX A;  4BWQ A;  2VCT A;  1PA3 A;  3P2A A;  4BL7 A;  5DAK B;  4HU7 A;  2KLX A;  4PNF A;  2C0G A;  2FHE A;  1G0T A;  4FH8 A;  4IW9 A;  2DJK A;  1M2B A;  1S3C A;  4K8M A;  3TRP A;  3O3T A;  5D93 A;  4LL4 B;  5B7C A;  4AJ6 A;  5D73 A;  2KUC A;  2HXK A;  2VD1 A;  1ZMA A;  1OAZ A;  1B9X C;  1PMT A;  4WKW A;  4HDE A;  2DIZ A;  4JBB A;  4MPG A;  2XPD A;  3IA1 A;  3TOU A;  3VUR A;  1RW1 A;  3NOF A;  1YQ1 A;  2VCW A;  2VAF A;  1WOU A;  1WPI A;  5ENU A;  2FD3 A;  3RPN A;  1AAZ A;  2H1A A;  3D4T A;  4MZW A;  3TKP A;  2HSY A;  4PX1 A;  1RQM A;  6GSV A;  5CRG A;  2QKE A;  3W8S A;  1YZX A;  3BD2 A;  4ML6 A;  1PGT A;  2GT6 A;  3DXB A;  3K8N A;  3F4T A;  5GAP D;  2MBS A;  3VWW A;  2C3T A;  3FY7 A;  3I69 A;  2CVD A;  2YN1 A;  1OC9 B;  2PUK C;  3GTU A;  5A5K A;  3HJO A;  2H73 A;  1K3O A;  2V1M A;  2L4Q A;  1XW6 A;  4FYB A;  2J9H A;  2K8V A;  4EF0 A;  1PD2 1;  3RDW A;  2A2S A;  4D73 A;  4LMV A;  2ZUP A;  3ZYW A;  2LV3 A;  5ECM B;  2DJ0 A;  3FR3 A;  4HU9 A;  1AQW A;  4ZL7 A;  2X8G A;  2ZCT A;  3M8N A;  1YF1 A;  4F82 A;  1YEP A;  3M1G A;  4AJ8 A;  4WXT A;  3IRA A;  3FZ5 A;  3GHA A;  2A2R A;  1I5G A;  4PQI A;  1O81 A;  3QFB C;  4TR4 A;  4EE0 A;  4PQ1 A;  3HZ8 A;  1UA5 A;  2C80 A;  3EC3 A;  4IBP A;  3FEU A;  1M99 A;  5D9V A;  4MF7 A;  5DJM A;  2X99 A;  1SU9 A;  3H8Q A;  3IHQ A;  3L9S A;  1MEK A;  3CSJ A;  4PNG A;  9GSS A;  1WWJ A;  2V41 A;  4MF5 A;  3N9J A;  1F9M A;  4GF0 A;  4DVC A;  2H75 A;  1F3A A;  2LRC A;  3EU4 A;  3TCO A;  4V1A p;  7GSS A;  8GSS A;  2H66 A;  3ED3 A;  3VLN A;  5F0G A;  2H1B A;  3KGK A;  1A2J A;  5D96 A;  5L71 A;  2OE3 A;  3MDK A;  1TTZ A;  1NSW A;  2IJY A;  1GUM A;  3ERF A;  1OC3 A;  5ECI B;  4GQF A;  5G5F A;  3ZLP A;  1EZK A;  2O8V B;  5ECR B;  2QSI A;  2XHF A;  4MJA A;  5AIX A;  1SJZ A;  4KSM A;  5COH A;  4MJE A;  2L57 A;  2LRN A;  4K1F A;  1FVK A;  3DVW A;  3CRU A;  3LJR A;  3FR9 A;  4MJC A;  1SYR A;  3QOU A;  1J9B A;  4HJ2 A;  2N5B A;  4IP1 A;  4QQ7 A;  3WGD A;  3F3Q A;  5F8B A;  4EO3 A;  4MDC A;  4PQH A;  1YF0 A;  4L5O A;  3ZIJ A;  1GSY A;  5DVB A;  1EGO A;  4JU5 A;  2WCI A;  1XOB A;  5G1K A;  2HNL A;  5J5N A;  4GTU A;  2MMA A;  4TVE A;  1GL8 A;  2YCD A;  3CXG A;  5KN3 A;  3UBL A;  4V2L A;  1A0F A;  3GYK A;  4HEA 2;  1O6J A;  4J2F A;  1HYU A;  3QCP A;  3LXT A;  3APO A;  1IYI A;  1GUK A;  1SJI A;  1CQH A;  3LFL A;  5G5E A;  4GQC A;  1FG4 A;  1K0A A;  3EMP A;  5D9X A;  1PX7 A;  4HZ2 A;  2DIY A;  5ECP B;  4YQV A;  1WP0 A;  4MZC A;  5IPG A;  4XTS A;  2RM6 A;  3O76 A;  4ZB9 A;  3VWV A;  1CQG A;  5AN1 A;  3APS A;  4ML1 A;  3GH6 A;  2HFD A;  4ZBA A;  1ZYE A;  2OE0 A;  4NV5 A;  4GCI A;  3RPP A;  3PIN A;  2DJJ A;  1R26 A;  3GSS A;  4MP4 A;  2H19 A;  5FT3 A;  4ZB8 A;  1EOG A;  3IAS 2;  3DWV A;  4KW6 A;  2X64 A;  5A4W A;  2CAQ A;  4HS1 A;  2C3N A;  2VD0 A;  1FB6 A;  5HFI A;  4IKH A;  4DEJ A;  2ES7 A;  3E3E A;  1Z9H A;  4G2E A;  3UBK A;  1JLV A;  4K2D A;  3KM6 A;  1X0R A;  4ZIJ A;  3ZFL A;  3GMF A;  1SJ6 A;  2B1L A;  2O89 A;  1JFU A;  3IPZ A;  2VCV A;  2L5L A;  2K9F A;  4O92 A;  2KOK A;  1ZYQ B;  4BWS A;  4YQU A;  2H01 A;  3W6G A;  1SK0 A;  1XWB A;  3HYP A;  1AUC A;  2YPM A;  3UAR A;  3LG6 A;  3F6F A;  1BAY A;  5D9W A;  3RHB A;  4MAB A;  1NM3 A;  2C4J A;  4I97 A;  4L5L A;  3N5O A;  3IR4 A;  4FO5 A;  1C72 A;  3IXR A;  5FWG A;  1USB A;  4NHW A;  4BVX A;  5CRW A;  4WR4 A;  1TKD B;  3IV4 A;  4ZBD A;  4PGT A;  1K0N A;  1T8E B;  3CRT A;  2H76 A;  3WD6 A;  2LQQ A;  2LS5 A;  2IN3 A;  4CHS A;  5A4V A;  5LD0 A;  3HZ4 A;  4ULX A;  2O7K A;  3M3M A;  4F03 A;  2RII A;  2ZNM A;  1WJK A;  3F8U A;  3ZMK A;  3FR6 A;  2GQM A;  3U5R E;  1LU4 A;  3RBT A;  2P5R A;  3TJG A;  5IIZ A;  4KGI A;  3IDV A;  5D8I A;  2R2J A;  3H1N A;  5F07 A;  3MWH A;  5J9C A;  2DBC A;  3HXS A;  1QQ2 A;  2FNO A;  1M0U A;  4OFN A;  4FYC A;  1H4O A;  2P5Q A;  2M80 A;  1B4Q A;  4F0C A;  2F3M A;  2DMM A;  1RK4 A;  3TKS E;  3QFA C;  4Q5Q A;  2QGV A;  1PKW A;  4KB3 A;  4AJ7 A;  2OBK A;  1X9S B;  2DJ1 A;  4ECI A;  1T4Z A;  1ML6 A;  5DCG A;  1M2A A;  4POK A;  3DD3 A;  5ECK B;  6GSS A;  2HYX A;  3E9J B;  3EWL A;  1EEM A;  4KSO A;  3FW2 A;  1SKW B;  1AW9 A;  3EUR A;  5J4U A;  1TRV A;  1TDI A;  2VUP A;  3TJB A;  3UEM A;  5EL8 A;  3NIV A;  1TK0 B;  1X9M B;  2V2G A;  2MZC A;  4KCA A;  2OA7 A;  3GUR A;  20GS A;  1TP9 A;  3TKR A;  2FWF A;  3Q18 A;  2YWN A;  3FYG A;  1K0B A;  1TU7 A;  4N10 A;  4HJM A;  2GS3 A;  4XRA A;  2BTO T;  2GSR A;  3V1W A;  3S9F A;  1JZW A;  2HZF A;  4ZIL A;  2F51 A;  2MMN A;  3GNJ A;  1HNA A;  5DAL B;  4GLT A;  1AQX A;  5IO0 A;  2B1K A;  3CBU A;  2F8A A;  4OWY A;  3ZFB A;  3RHC A;  3VPQ A;  2HT9 A;  4Q5N A;  3J7Y k;  2C0E A;  4LL1 B;  4ILF A;  1G6Y A;  1BQ7 A;  4G10 A;  4ECC A;  1FHE A;  1Z7R A;  4RQR A;  3F4S A;  4JR6 A;  2VOC A;  4NPB A;  5LNK e;  3E0U A;  3H4K A;  3HY2 A;  4LLR A;  3DML A;  4N30 A;  3LQ7 A;  3EE2 A;  1SK1 A;  4Z7X A;  3BCI A;  4IGJ A;  5DAK A;  4TXO B;  4HQZ A;  4WF4 A;  4V1A g;  1TI3 A;  5DBQ A;  2WZ9 A;  2NBS A;  4ZXG A;  4NWY A;  3FZ4 A;  1K3Y A;  2H1G A;  2L5O A;  4ECJ A;  1XW9 A;  3GH9 A;  1QGV A;  1OYJ A;  2GZY A;  3BJ5 A;  1PRX A;  3L78 A;  1B8X A;  1ZZY A;  2MYG A;  2VO4 A;  1VF1 A;  1PX6 A;  1SKS B;  2LUS A;  4TN8 A;  1OKD A;  4ECB A;  1GSQ A;  1V57 A;  5ECQ B;  3A2W A;  2WB9 A;  4E8E A;  4BA7 A;  3O6T A;  1HQO A;  5IMA A;  6GSY A;  10GS A;  4NV2 A;  5E59 A;  2PPT A;  3GFK A;  2JL4 A;  4TR1 B;  3I6A A;  1R4W A;  1PL2 A;  3WGX A;  4AGS A;  2FWE A;  1EV4 A;  5IMV A;  3KH9 A;  3EMX A;  1OC9 A;  4N0V A;  2MMO A;  3IC4 A;  4YAP A;  1G7E A;  1FB0 A;  4XCS A;  4QL7 A;  3CMI A;  2VL3 A;  4DSS B;  3ZML A;  5AGY A;  2E2G A;  3KMN A;  2M72 A;  1GUH A;  1XWC A;  2VCQ A;  4MMM A;  1SKR B;  3TKS C;  3D5J A;  4K7N A;  1SK2 A;  2JSY A;  3HVV A;  4IQ1 A;  1Z3E A;  1M9A A;  5A4U A;  4KND A;  1GSD A;  1U3A A;  5CRD A;  1W89 A;  3HHV A;  1SL1 B;  2P0G A;  3P8W A;  2YOI A;  2DC5 A;  2K18 A;  4JRR A;  2HI7 A;  2NDO A;  1SL2 B;  4IEL A;  2X8C A;  4TR3 A;  1OC8 A;  2TRX A;  1V40 A;  3IBH A;  4N11 A;  5FHI A;  4GRF A;  1J08 A;  3ME7 A;  2AB6 A;  1V58 A;  2VM2 A;  3RAZ A;  2HE3 A;  4ZB6 A;  3IK7 A;  4MK3 A;  3D4M A;  4WF5 A;  3C8E A;  3CSI A;  4BVY A;  3A5W A;  1GLQ A;  6GSW A;  12GS A;  2CX3 A;  2ALB A;  5ABR A;  3KXO A;  4EL1 A;  1A24 A;  5GZZ B;  1LBK A;  4CW9 A;  2IFQ A;  4GSN A;  2F8F A;  4KX4 A;  4NXI A;  2GST A;  2H6Y A;  2YWM A;  3ZIT A;  1AIU A;  2I3Y A;  2LNT A;  4PXO A;  3VWU A;  1A2M A;  4IN0 A;  2I9H A;  2GGT A;  2WJU A;  1B4P A;  2BJX A;  3I9V 2;  3L4N A;  3A2X A;  1M7T A;  1SYX A;  1AC1 A;  1XW5 A;  5JWQ B;  13GS A;  4ZBB A;  1X5C A;  1UC7 A;  2FGX A;  2IMK A;  3DKS A;  4H86 A;  1GSF A;  3UL3 A;  3TRX A;  2REM A;  1BED A;  1THX A;  2O87 A;  3QPM A;  3KTL A;  3DEX A;  3D0Z A;  2JZT A;  3QAG A;  3PR8 A;  4RUV A;  5B6M A;  4TOP A;  3KZQ A;  3GL3 A;  3QDN A;  6GSX A;  1O85 A;  3DGQ A;  3C1S A;  1KNG A;  2WDU A;  3CTF A;  4EDZ A;  5ELG A;  3A3T A;  2H71 A;  1IYH A;  4F0B A;  4I8B A;  2JSZ A;  2WS2 A;  1K0M A;  1UVZ A;  1JZO A;  3NZN A;  2OKA A;  3ZRE A;  18GS A;  1FAA A;  4YH2 A;  3U6V A;  1QFN A;  5C04 A;  2HZE B;  1X5D A;  1Z6N A;  1OVN A;  3TOT A;  4I2T A;  1WRY A;  4KCE A;  4MZB A;  4OCF A;  3LWA A;  2DML A;  2H6Z A;  4NMU A;  2EC4 A;  2G2Q A;  5HR0 A;  1B48 A;  4WBR D;  3GV1 A;  1XZO A;  3UOM A;  3SBC A;  4YQM A;  4O7H A;  2VL2 C;  4MCU A;  1MD4 A;  4K7I A;  2GZZ A;  3KP9 A;  2IIY A;  3LGC A;  5B6N A;  3QD9 A;  11GS A;  5G1L A;  3J7Y b;  2EIQ A;  4FIW A;  2GT5 A;  2PVO C;  1WMJ A;  1A8L A;  3UIW A;  4KDX A;  1XWK A;  1BYE A;  4ACS A;  3EYT A;  1E2Y A;  2VLU A;  3G9B A;  5AIS A;  1B9Y C;  1U3I A;  4OCE A;  1AQV A;  2IME A;  2LJA A;  1N8J A;  4HZ4 A;  3FKF A;  2QC7 A;  2L6C A;  5CRE A;  3UJ1 A;  1YJ6 A;  3VI5 A;  2VIM A;  2H30 A;  3HCZ A;  2V6O A;  2L6D A;  5DDL A;  4E8H A;  1TRU A;  2C8U A;  4O32 A;  3LYK A;  1K3L A;  2YWO A;  1XOA A;  4EDY A;  3KP8 A;  5J3R A;  3IK9 A;  3FZA A;  2B6M A;  2CVB A;  2KHP A;  5ID2 B;  5ECS A;  4K0G A;  1JHB A;  3UAP A;  3ISO A;  3KCM A;  1FVJ A;  4JZQ A;  2WRT A;  5CP1 A; 
#chains in the Genus database with same CATH topology
 1QK8 A;  2NTO A;  3GRX A;  3APQ A;  1F6M C;  1XVW A;  1F3B A;  1N2A A;  1EEJ A;  1OKT A;  6GSU A;  4TXV A;  2PN8 A;  4GWR A;  4CDO A;  1PQN A;  4GXZ A;  2D2Z A;  3C73 A;  5CAX A;  3VWX A;  1JLW A;  1W4V A;  1ZL9 A;  2VLT A;  1ILO A;  1V9W A;  5DQS A;  1YY7 A;  1TOF A;  1XPV A;  4JED A;  5HQP A;  4XS4 B;  4IP6 A;  3WT1 A;  2HRN A;  4K9Z A;  3BOA A;  1KBN A;  5D9T A;  4X43 A;  5CO3 A;  3GKX A;  3TKQ A;  2R0P A;  3FZ9 A;  1DE2 A;  4IQA A;  2JZR A;  3KIJ A;  1Z5Y E;  4P3Y B;  4LA1 A;  2RLI A;  3LXZ A;  3CYN A;  3TGZ A;  2GQL A;  1VF3 A;  1GRX A;  1THO A;  19GS A;  3GX8 A;  1XWA A;  3Q19 A;  4KDY A;  1H75 A;  4L0U A;  1GTB A;  1TK5 B;  1Y6E A;  4IJI A;  2C1Y A;  1SL0 B;  4L8E A;  3HA9 A;  2XC2 A;  3TJJ A;  2IMI A;  2RUF A;  3D21 A;  3GX0 A;  1A23 A;  3Q6O A;  2PWJ A;  3G7J A;  4XS6 A;  1ON4 A;  3FK8 A;  3LYP A;  1XIY A;  3IAM 2;  2FCH A;  5IMF A;  2PMT A;  4IHU A;  4Z2R A;  2E7P A;  2GSQ A;  3KMO A;  1YKA A;  5EVO A;  4KDU A;  4MLY A;  1YKC A;  1V98 A;  2VL9 A;  5G2Z A;  3LEF A;  3HVX A;  1VF2 A;  1YEX A;  3MAK A;  2YJH A;  5JCW A;  1G6W A;  2OAD A;  1F2E A;  3GST A;  4F9Z A;  5ECN B;  1GNW A;  2PVQ A;  5JWO B;  1ERT A;  3P90 A;  3KJY A;  5DAL A;  2KP1 A;  3PH9 A;  1GUL A;  2LJK A;  1UN2 A;  3TJK A;  2YAN A;  1ACV A;  1A8Y A;  4X4J A;  5CRH A;  4O5U A;  1MDI A;  5IMZ A;  4JE1 A;  4TW5 A;  1X9W B;  1TXX A;  5IMD A;  4EKZ A;  5ECO B;  1FOH A;  2YP6 A;  1FO5 A;  1FOV A;  1EP7 A;  1VF4 A;  1TI1 A;  3C7M A;  2IMD A;  2C3Q A;  3VI7 A;  5KN1 A;  4ZL8 A;  2TIR A;  1I9D A;  5H5S A;  2YWI A;  1JZR A;  2VM1 A;  2P31 A;  2I81 A;  4IJ3 A;  1QMV A;  4O5R A;  2NPB A;  2H72 A;  3ERG A;  2GZP A;  4A5P A;  4RI7 A;  4HQS A;  5AIV A;  1TRW A;  1EWX A;  1XWG A;  4YAV A;  4BL7 B;  2N5F A;  3C71 A;  1HNB A;  2MBT A;  2CT6 A;  1PKZ A;  4QL9 A;  2WUL A;  2CAI A;  5GSS A;  4ZL9 A;  4X1U A;  3F3R A;  4KH7 A;  1PN0 A;  3DRN A;  2GDR A;  14GS A;  1XXU A;  2JU5 A;  1O8W A;  1PN9 A;  1BG5 A;  3QMX A;  5DJL A;  3HKR A;  3W8J A;  4G19 A;  4I6X A;  2YV9 A;  3TB2 A;  1ERV A;  1MDK A;  4MA9 A;  4MF6 A;  1J0F A;  2H74 A;  2OE1 A;  1EOH A;  4XS1 A;  1OE8 A;  3QAW A;  1R5P A;  2FWH A;  1TJD A;  1M9B A;  4LMW A;  1EGR A;  4F2I A;  2TRC P;  2O85 A;  1JZD A;  2PBJ A;  3F9U A;  4TR1 A;  2B5E A;  2H0G A;  1M3I A;  1K0O A;  3F63 A;  1PL1 A;  2ON5 A;  2CVK A;  4IVF A;  4X0X A;  4MH2 A;  3QAV A;  5IOW A;  1V2A A;  5H5Q A;  3EVI A;  1OE7 A;  1XBS A;  2KP2 A;  16GS A;  1A0R P;  1GWC A;  3H93 A;  2LEG A;  2PGT A;  2LKU A;  1E6B A;  3CSH A;  5CYY A;  4OO4 A;  3GTU B;  2AV4 A;  4DSS A;  1ABA A;  1ERU A;  1T3B A;  4WEY A;  3GA4 A;  2H1D A;  3L0H A;  4FYU A;  1S3D A;  3HD5 A;  2LJR A;  4D73 B;  4GST A;  3GKK A;  2Z9S A;  1T7P B;  2DJ2 A;  2V32 A;  2H0I A;  2LRT A;  3JCM L;  3TRQ A;  2YNX A;  2GTU A;  2N5A A;  3R3E A;  2LST A;  2YV7 A;  3H79 A;  5DQY A;  2DJ3 A;  1A2L A;  2AAW A;  3Q74 A;  1GSS A;  1ZCP A;  2PER A;  2FA8 A;  3DVX A;  2I4A A;  2IL3 A;  2CZ2 A;  2V6K A;  1AXD A;  1KTE A;  3GKN A;  2J23 A;  3M0F A;  3HDC A;  2C0F A;  4MH3 A;  2QA2 A;  1YDK A;  5IPH A;  4TRX A;  3WYW A;  2B5Y A;  1K0D A;  3HJM A;  3M9J A;  2K6V A;  4KA0 A;  1DUG A;  3BCK A;  3VPT A;  4K5R A;  2HLS A;  3F6D A;  4PTS A;  3AY8 A;  4OMV A;  4NHZ A;  1O8X A;  2IFQ B;  2L59 A;  5GAN D;  5JCU A;  1U6T A;  2H70 A;  3LOR A;  3GN3 A;  3ME8 A;  5EY6 A;  1PSQ A;  5E4W A;  1SD9 A;  1WIK A;  1SEN A;  2WGR A;  3D22 A;  3ZVJ A;  4RQX A;  3ERW A;  4OFT A;  2GSS A;  3EU3 A;  2JZS A;  4WBJ A;  2B7J A;  1QUW A;  1MD3 A;  2DLX A;  5KN2 A;  3C1R A;  2XPE A;  3QR6 A;  5HR3 A;  2PU9 C;  3MSZ A;  4XHM A;  4J56 E;  1TK8 B;  5B8B A;  3TKS A;  4OO5 A;  5IMC A;  5J9B A;  4ISD A;  4XRD A;  3OR5 A;  1EV9 A;  1MDJ A;  3PGT A;  3F0I A;  2B5X A;  2F9S A;  2L4C A;  1Z7P A;  2AUV A;  2OAC A;  2CQ9 A;  3P7X A;  2H0H A;  3TDG A;  1XG8 A;  3M9K A;  2R4V A;  3GUS A;  5BRT A;  1NHY A;  4EXJ A;  5J41 A;  2WFC A;  5JCG A;  2LNS A;  2OBI A;  5KOW A;  2HZE A;  2E2M A;  2GLR A;  1K0C A;  1ERW A;  4FQU A;  4RI6 A;  5LCZ A;  4IS0 A;  3ZRD A;  2BMX A;  1LJR A;  3UMA A;  5ECL B;  4I5Q A;  5B8A A;  3TUE A;  4Q5F A;  1NW2 A;  4EIP A;  3ZL5 A;  1GTU A;  1GSE A;  1QXH A;  3MYD A;  2LQO A;  2EIR A;  2AJQ B;  4HOJ A;  4BPY A;  4G0I A;  5KEJ A;  4KE3 A;  2DKH A;  2M46 A;  5EPF A;  3MNG A;  4ICY A;  3DIE A;  4POB A;  2CA8 A;  2H6X A;  2B3S A;  1ZOF A;  2DSA A;  4K7O A;  2G0F A;  4AF2 A;  2FA4 A;  2IPA A;  2NVL A;  4ID0 A;  5HFK A;  4DSR A;  1T1V A;  4TKY A;  1ST9 A;  1GSU A;  4HI7 A;  4OFM A;  4MJB A;  1DE1 A;  2VLV A;  2IWT A;  2B7K A;  1Q98 A;  5GST A;  1GTA A;  1XCC A;  3FRC A;  1KEB A;  3KTB A;  5IO2 A;  4EUY A;  1M3J A;  1GTI A;  4KUN A;  3BBY A;  2LTK A;  2XBQ A;  3UVT A;  3EIN A;  1Y25 A;  5IOX A;  5ID2 A;  2X8H A;  1R5A A;  4N0Z A;  4EC0 A;  3IOS A;  1ZGN A;  2AYT A;  5CNW A;  1DBY A;  3L9V A;  3WT2 A;  3R2Q A;  2A4V A;  1VGL A;  2YJ7 A;  1ZYP A;  2FLS A;  5INY A;  3CTG A;  4EVM A;  2GQK A;  5IM9 A;  3GL5 A;  1GNE A;  1DSB A;  4BVX B;  1X5E A;  4OD7 A;  4WET A;  2YZU A;  4WR5 A;  2E0Q A;  2HSH A;  3VFI A;  1O7U A;  4PUF C;  2GVP A;  2RUE A;  5IQY A;  4K0N A;  4XS4 A;  4Z2T A;  4NAX A;  3ZIV A;  2CX4 A;  2YZH A;  4POM A;  4POL A;  1Z6M A;  3F4R A;  2FY6 A;  4Q5R A;  1URM A;  5F06 A;  1TW9 A;  2VL2 A;  4MNN A;  1BJX A;  2UZ8 A;  2R6K A;  3GIX A;  3US3 A;  17GS A;  2FWG A;  4V2M A;  1M2D A;  2CZ3 A;  2RM5 A;  3G7I A;  3KEB A;  4K6X A;  4GSS A;  4L0W A;  5JWR B;  4V2N A;  3A2V A;  1U88 A;  4G9H A;  2A4H A;  1XFL A;  5F05 A;  5H5R A;  3G7Y A;  3IE3 A;  1XVQ A;  1FW1 A;  4KAE A;  2QA1 A;  1TU8 A;  2K8S A;  2R5G A;  4PUR A;  1MTC A;  1S3A A;  4XIH A;  1BX9 A;  2EIO A;  1TRS A;  3KD0 A;  1Q4J A;  4KF9 A;  2CV4 A;  4TR0 A;  5ELA A;  2HRF A;  1GP1 A;  5DCH A;  5KN0 A;  1SD8 A;  2MMZ A;  4O5Q A;  1WE0 A;  22GS A;  2XBI A;  1GLP A;  1HNC A;  5HR2 A;  1EP8 A;  1T00 A;  2ON7 A;  4PUA A;  2AHE A;  1GH2 A;  4DSQ A;  3D6I A;  3LSZ A;  4J57 E;  2H8L A;  5HR1 A;  3ZVJ D;  2R3X A;  2I1U A;  5HFG A;  5C00 A;  2FUG 2;  4MPF A;  3GKM A;  1T4Y A;  3SWL A;  2VCZ A;  3KH7 A;  2IMF A;  3ZTL A;  2VCX A;  1R7H A;  2R37 A;  2JAC A;  1F37 A;  3DYR A;  5G31 A;  6GST A;  3HVS A;  1NHO A;  5G30 A;  3I43 A;  1G7O A;  3HJP A;  5ECH B;  3L9U A;  3VK9 A;  3TJF A;  1U87 A;  1VRS D;  1O73 A;  4JR4 A;  3FHK A;  3UVH A;  2C0D A;  3WGE A;  4BIK A;  4TXO A;  4HUA A;  4I2U A;  1HD2 A;  2JAD A;  2OJL A;  3ZZX A;  4BWQ A;  2VCT A;  1PA3 A;  3P2A A;  2A2P A;  4BL7 A;  5DAK B;  4HU7 A;  2KLX A;  4PNF A;  2C0G A;  2FHE A;  1G0T A;  4FH8 A;  4IW9 A;  2DJK A;  1M2B A;  4HSC X;  1S3C A;  4K8M A;  3TRP A;  3O3T A;  5D93 A;  4LL4 B;  5B7C A;  4AJ6 A;  5D73 A;  2KUC A;  2HXK A;  2VD1 A;  1ZMA A;  1OAZ A;  1B9X C;  1PMT A;  4WKW A;  2X49 A;  4HDE A;  2DIZ A;  4JBB A;  4MPG A;  2XPD A;  3IA1 A;  3TOU A;  3VUR A;  1RW1 A;  3NOF A;  1YQ1 A;  2VCW A;  2VAF A;  1WOU A;  1WPI A;  5ENU A;  2FD3 A;  3RPN A;  1AAZ A;  2H1A A;  3D4T A;  4MZW A;  3TKP A;  2HSY A;  4PX1 A;  1RQM A;  6GSV A;  5CRG A;  2QKE A;  3W8S A;  2HSM A;  1YZX A;  3BD2 A;  4ML6 A;  1PGT A;  2GT6 A;  3DXB A;  3K8N A;  3F4T A;  5GAP D;  2MBS A;  3VWW A;  2C3T A;  3FY7 A;  3I69 A;  2CVD A;  2YN1 A;  1OC9 B;  2PUK C;  3GTU A;  5A5K A;  3HJO A;  2H73 A;  1K3O A;  2V1M A;  2L4Q A;  3EPT A;  1XW6 A;  4FYB A;  2J9H A;  2K8V A;  4EF0 A;  1PD2 1;  3RDW A;  2A2S A;  4D73 A;  4LMV A;  2ZUP A;  3ZYW A;  2LV3 A;  5ECM B;  2DJ0 A;  3FR3 A;  4HU9 A;  1AQW A;  4ZL7 A;  2X8G A;  2ZCT A;  3M8N A;  1YF1 A;  4F82 A;  1YEP A;  4G0L A;  3M1G A;  4AJ8 A;  4WXT A;  3IRA A;  3FZ5 A;  3GHA A;  4Z2U A;  2A2R A;  1I5G A;  4PQI A;  1O81 A;  3QFB C;  4TR4 A;  4EE0 A;  4PQ1 A;  3HZ8 A;  1UA5 A;  2C80 A;  3EC3 A;  4IBP A;  3FEU A;  1M99 A;  5D9V A;  4MF7 A;  5DJM A;  2X99 A;  1SU9 A;  3H8Q A;  3IHQ A;  3L9S A;  1MEK A;  3CSJ A;  4PNG A;  9GSS A;  1WWJ A;  2V41 A;  4MF5 A;  3N9J A;  1F9M A;  4GF0 A;  4DVC A;  2H75 A;  1F3A A;  2LRC A;  3EU4 A;  3CQF A;  4BVY B;  3TCO A;  4V1A p;  7GSS A;  8GSS A;  2H66 A;  3ED3 A;  3VLN A;  5F0G A;  2H1B A;  3KGK A;  1A2J A;  5D96 A;  3LW9 A;  5L71 A;  2OE3 A;  3MDK A;  1TTZ A;  1NSW A;  2IJY A;  1GUM A;  3ERF A;  1OC3 A;  5ECI B;  4GQF A;  5G5F A;  3ZLP A;  1EZK A;  2O8V B;  5ECR B;  2QSI A;  2XHF A;  4MJA A;  5AIX A;  1SJZ A;  4KSM A;  5COH A;  4MJE A;  2L57 A;  4K1F A;  2LRN A;  1FVK A;  3DVW A;  3FMW A;  3CRU A;  4CY8 A;  3LJR A;  3FR9 A;  4MJC A;  1SYR A;  3QOU A;  1J9B A;  4HJ2 A;  2N5B A;  4IP1 A;  5BMU A;  4QQ7 A;  3WGD A;  3F3Q A;  5F8B A;  4EO3 A;  4MDC A;  4PQH A;  1YF0 A;  4L5O A;  3ZIJ A;  1GSY A;  5DVB A;  1EGO A;  4JU5 A;  2R0G A;  2WCI A;  1XOB A;  5G1K A;  2HNL A;  4USS A;  5J5N A;  4GTU A;  2MMA A;  4TVE A;  1GL8 A;  2YCD A;  3CXG A;  5KN3 A;  3UBL A;  4V2L A;  1A0F A;  3GYK A;  4HEA 2;  1O6J A;  4J2F A;  1HYU A;  3QCP A;  3LXT A;  3APO A;  1IYI A;  1GUK A;  1SJI A;  1CQH A;  3LFL A;  5G5E A;  4GQC A;  1FG4 A;  1K0A A;  3EMP A;  5D9X A;  1PX7 A;  4HZ2 A;  2DIY A;  5ECP B;  4YQV A;  1WP0 A;  4MZC A;  5IPG A;  4XTS A;  2RM6 A;  3O76 A;  4ZB9 A;  3VWV A;  1CQG A;  5AN1 A;  3APS A;  4ML1 A;  3GH6 A;  2HFD A;  4ZBA A;  1ZYE A;  2OE0 A;  4NV5 A;  4GCI A;  3RPP A;  3PIN A;  2DJJ A;  1R26 A;  3GSS A;  4MP4 A;  2H19 A;  5FT3 A;  4ZB8 A;  1EOG A;  3IAS 2;  3DWV A;  4KW6 A;  2X64 A;  5A4W A;  2CAQ A;  4HS1 A;  2C3N A;  2VD0 A;  1FB6 A;  5HFI A;  4IKH A;  4DEJ A;  2ES7 A;  3E3E A;  1Z9H A;  4G2E A;  3UBK A;  1JLV A;  4K2D A;  3KM6 A;  1X0R A;  4ZIJ A;  3ZFL A;  3GMF A;  1SJ6 A;  2B1L A;  2O89 A;  1JFU A;  3IPZ A;  2VCV A;  2L5L A;  2K9F A;  4O92 A;  2KOK A;  1ZYQ B;  4BWS A;  4YQU A;  2H01 A;  3W6G A;  1SK0 A;  1XWB A;  3HYP A;  1AUC A;  2YPM A;  3UAR A;  3LG6 A;  3F6F A;  1BAY A;  5D9W A;  3RHB A;  4MAB A;  1NM3 A;  2C4J A;  4I97 A;  4L5L A;  3N5O A;  3IR4 A;  4FO5 A;  1C72 A;  3IXR A;  5FWG A;  3MIX A;  1USB A;  4NHW A;  4BVX A;  5CRW A;  4WR4 A;  1TKD B;  3IV4 A;  4ZBD A;  4PGT A;  1K0N A;  1T8E B;  3CRT A;  2H76 A;  3WD6 A;  2LQQ A;  2LS5 A;  2IN3 A;  4CHS A;  5A4V A;  5LD0 A;  3HZ4 A;  4ULX A;  2O7K A;  3M3M A;  4F03 A;  2RII A;  2ZNM A;  1WJK A;  3F8U A;  3ZMK A;  3FR6 A;  2GQM A;  3U5R E;  1LU4 A;  3RBT A;  2P5R A;  3TJG A;  5IIZ A;  4KGI A;  3PPU A;  3IDV A;  5D8I A;  2R2J A;  3H1N A;  5F07 A;  3MWH A;  5J9C A;  2DBC A;  3HXS A;  1QQ2 A;  2FNO A;  1M0U A;  4YKF A;  4OFN A;  4FYC A;  1H4O A;  2P5Q A;  2M80 A;  1B4Q A;  4F0C A;  2F3M A;  2DMM A;  1RK4 A;  3TKS E;  3QFA C;  4Q5Q A;  2QGV A;  1PKW A;  4KB3 A;  4AJ7 A;  2OBK A;  1X9S B;  1S3R A;  2DJ1 A;  4ECI A;  1T4Z A;  1ML6 A;  5DCG A;  1M2A A;  4POK A;  3DD3 A;  5ECK B;  6GSS A;  2HYX A;  3E9J B;  3EWL A;  1EEM A;  4KSO A;  3FW2 A;  1SKW B;  1AW9 A;  3EUR A;  5J4U A;  1TRV A;  1TDI A;  2VUP A;  3TJB A;  3UEM A;  5EL8 A;  3NIV A;  1TK0 B;  1X9M B;  2V2G A;  2MZC A;  4KCA A;  2OA7 A;  3GUR A;  20GS A;  1TP9 A;  3TKR A;  2FWF A;  3Q18 A;  2YWN A;  3FYG A;  1K0B A;  1TU7 A;  4N10 A;  4HJM A;  2GS3 A;  4XRA A;  2BTO T;  2GSR A;  3V1W A;  3S9F A;  1JZW A;  2HZF A;  4ZIL A;  2F51 A;  2MMN A;  3GNJ A;  1HNA A;  5DAL B;  4GLT A;  1AQX A;  5IO0 A;  2B1K A;  1ZYN A;  3CBU A;  2F8A A;  4OWY A;  3ZFB A;  3RHC A;  3VPQ A;  2HT9 A;  4Q5N A;  3J7Y k;  2C0E A;  4LL1 B;  4ILF A;  1G6Y A;  1BQ7 A;  4G10 A;  4ECC A;  1FHE A;  1Z7R A;  4RQR A;  1PFO A;  3F4S A;  4JR6 A;  2VOC A;  4NPB A;  5LNK e;  3E0U A;  3H4K A;  3HY2 A;  4LLR A;  3DML A;  4N30 A;  3LQ7 A;  3EE2 A;  1SK1 A;  4Z7X A;  3BCI A;  4IGJ A;  5DAK A;  4TXO B;  4HQZ A;  4WF4 A;  4V1A g;  1TI3 A;  4EIQ A;  5DBQ A;  4CY6 A;  2WZ9 A;  2NBS A;  4ZXG A;  4NWY A;  3FZ4 A;  1K3Y A;  2H1G A;  2L5O A;  4ECJ A;  1XW9 A;  3GH9 A;  1QGV A;  1OYJ A;  2GZY A;  3BJ5 A;  1PRX A;  3L78 A;  1B8X A;  1ZZY A;  2MYG A;  2VO4 A;  1VF1 A;  1PX6 A;  1SKS B;  2LUS A;  4TN8 A;  1OKD A;  4ECB A;  1GSQ A;  1V57 A;  5ECQ B;  3A2W A;  2WB9 A;  4E8E A;  4BA7 A;  3O6T A;  1HQO A;  5IMA A;  6GSY A;  10GS A;  4NV2 A;  5E59 A;  2PPT A;  3GFK A;  2JL4 A;  4TR1 B;  3I6A A;  1R4W A;  1PL2 A;  3WGX A;  4AGS A;  2FWE A;  1EV4 A;  5IMV A;  3KH9 A;  3EMX A;  1OC9 A;  4N0V A;  2MMO A;  3IC4 A;  4YKG A;  4YAP A;  1G7E A;  1FB0 A;  4XCS A;  4QL7 A;  3CMI A;  2VL3 A;  4DSS B;  3ZML A;  5AGY A;  2E2G A;  3KMN A;  2M72 A;  1GUH A;  1XWC A;  2VCQ A;  4MMM A;  1SKR B;  3TKS C;  3D5J A;  4K7N A;  1SK2 A;  2JSY A;  5KOX A;  3HVV A;  4IQ1 A;  1Z3E A;  1M9A A;  5A4U A;  3IC8 A;  4KND A;  4K2X A;  1GSD A;  1U3A A;  5CRD A;  1W89 A;  2DKI A;  3HHV A;  1SL1 B;  2P0G A;  3P8W A;  2YOI A;  2DC5 A;  2K18 A;  4JRR A;  2HI7 A;  2NDO A;  1SL2 B;  2R0C A;  4IEL A;  2HRA A;  2X8C A;  4TR3 A;  1OC8 A;  2TRX A;  1V40 A;  3IBH A;  4N11 A;  5FHI A;  4GRF A;  1J08 A;  3ME7 A;  2AB6 A;  1V58 A;  2VM2 A;  3RAZ A;  2HE3 A;  4ZB6 A;  3IK7 A;  4MK3 A;  3D4M A;  4WF5 A;  3C8E A;  3CSI A;  4BVY A;  3A5W A;  1GLQ A;  6GSW A;  2HRK A;  12GS A;  2CX3 A;  2ALB A;  5ABR A;  3KXO A;  4EL1 A;  1A24 A;  4G0K A;  5GZZ B;  1LBK A;  4CW9 A;  2IFQ A;  4GSN A;  2F8F A;  4KX4 A;  4NXI A;  2GST A;  2H6Y A;  2YWM A;  3ZIT A;  1AIU A;  2I3Y A;  2LNT A;  4PXO A;  3VWU A;  1A2M A;  4IN0 A;  2I9H A;  2GGT A;  2WJU A;  1B4P A;  2BJX A;  3I9V 2;  3L4N A;  3A2X A;  1M7T A;  1SYX A;  1AC1 A;  1XW5 A;  5JWQ B;  13GS A;  4ZBB A;  1X5C A;  1UC7 A;  2FGX A;  2IMK A;  3DKS A;  4H86 A;  1GSF A;  3UL3 A;  3TRX A;  2REM A;  1BED A;  1THX A;  2O87 A;  3QPM A;  3KTL A;  3DEX A;  2X4A A;  3D0Z A;  2JZT A;  3QAG A;  3PR8 A;  4RUV A;  5B6M A;  4TOP A;  3KZQ A;  3GL3 A;  3QDN A;  6GSX A;  1O85 A;  3DGQ A;  3C1S A;  1KNG A;  2WDU A;  3CTF A;  4EDZ A;  5ELG A;  3A3T A;  2H71 A;  1IYH A;  4F0B A;  4I8B A;  2JSZ A;  2WS2 A;  1K0M A;  1UVZ A;  1JZO A;  3NZN A;  2OKA A;  3ZRE A;  18GS A;  1FAA A;  4YH2 A;  3U6V A;  4K5S A;  1QFN A;  5C04 A;  2HZE B;  1X5D A;  1Z6N A;  1OVN A;  3TOT A;  4I2T A;  1WRY A;  4KCE A;  4MZB A;  4OCF A;  3LWA A;  2DML A;  2H6Z A;  4NMU A;  2EC4 A;  2G2Q A;  5HR0 A;  1B48 A;  4WBR D;  3GV1 A;  1XZO A;  3UOM A;  3SBC A;  4YQM A;  4O7H A;  2VL2 C;  4MCU A;  1MD4 A;  4K7I A;  2GZZ A;  3KP9 A;  2IIY A;  3LGC A;  5B6N A;  3QD9 A;  11GS A;  5G1L A;  3J7Y b;  2EIQ A;  4FIW A;  2GT5 A;  2PVO C;  1WMJ A;  1A8L A;  3UIW A;  4KDX A;  1XWK A;  1BYE A;  4ACS A;  3EYT A;  1E2Y A;  2VLU A;  3G9B A;  5AIS A;  1B9Y C;  1U3I A;  4OCE A;  1AQV A;  2IME A;  2LJA A;  1N8J A;  4HZ4 A;  3FKF A;  2QC7 A;  2L6C A;  5CRE A;  3UJ1 A;  1YJ6 A;  3VI5 A;  3HVN A;  2VIM A;  2H30 A;  3HCZ A;  2V6O A;  2L6D A;  5DDL A;  4E8H A;  1TRU A;  2C8U A;  3A5I A;  4O32 A;  3LYK A;  1K3L A;  2YWO A;  1XOA A;  4EDY A;  3KP8 A;  5J3R A;  3IK9 A;  3FZA A;  2B6M A;  2CVB A;  2KHP A;  5ID2 B;  5ECS A;  4K0G A;  1JHB A;  3UAP A;  3ISO A;  3KCM A;  3IHG A;  1FVJ A;  4JZQ A;  2WRT A;  5CP1 A; 
#chains in the Genus database with same CATH homology
 1QK8 A;  2NTO A;  3GRX A;  3APQ A;  1F6M C;  1XVW A;  1F3B A;  1N2A A;  1EEJ A;  1OKT A;  6GSU A;  4TXV A;  2PN8 A;  4GWR A;  4CDO A;  1PQN A;  4GXZ A;  2D2Z A;  3C73 A;  5CAX A;  3VWX A;  1JLW A;  1W4V A;  1ZL9 A;  2VLT A;  1ILO A;  1V9W A;  5DQS A;  1YY7 A;  1TOF A;  1XPV A;  4JED A;  5HQP A;  4XS4 B;  4IP6 A;  3WT1 A;  2HRN A;  4K9Z A;  3BOA A;  1KBN A;  5D9T A;  4X43 A;  5CO3 A;  3GKX A;  3TKQ A;  2R0P A;  3FZ9 A;  1DE2 A;  4IQA A;  2JZR A;  3KIJ A;  1Z5Y E;  4P3Y B;  4LA1 A;  2RLI A;  3LXZ A;  3CYN A;  3TGZ A;  2GQL A;  1VF3 A;  1GRX A;  1THO A;  19GS A;  3GX8 A;  1XWA A;  3Q19 A;  4KDY A;  1H75 A;  4L0U A;  1GTB A;  1TK5 B;  1Y6E A;  4IJI A;  2C1Y A;  1SL0 B;  4L8E A;  3HA9 A;  2XC2 A;  3TJJ A;  2IMI A;  2RUF A;  3D21 A;  3GX0 A;  1A23 A;  3Q6O A;  2PWJ A;  3G7J A;  4XS6 A;  1ON4 A;  3FK8 A;  3LYP A;  1XIY A;  3IAM 2;  2FCH A;  5IMF A;  2PMT A;  4IHU A;  4Z2R A;  2E7P A;  2GSQ A;  3KMO A;  1YKA A;  5EVO A;  4KDU A;  4MLY A;  1YKC A;  1V98 A;  2VL9 A;  5G2Z A;  3LEF A;  3HVX A;  1VF2 A;  1YEX A;  3MAK A;  2YJH A;  5JCW A;  1G6W A;  2OAD A;  1F2E A;  3GST A;  4F9Z A;  5ECN B;  1GNW A;  2PVQ A;  5JWO B;  1ERT A;  3P90 A;  3KJY A;  5DAL A;  2KP1 A;  3PH9 A;  1GUL A;  2LJK A;  1UN2 A;  3TJK A;  2YAN A;  1ACV A;  1A8Y A;  4X4J A;  5CRH A;  4O5U A;  1MDI A;  5IMZ A;  4JE1 A;  4TW5 A;  1X9W B;  1TXX A;  5IMD A;  4EKZ A;  5ECO B;  1FOH A;  2YP6 A;  1FO5 A;  1FOV A;  1EP7 A;  1VF4 A;  1TI1 A;  3C7M A;  2IMD A;  2C3Q A;  3VI7 A;  5KN1 A;  4ZL8 A;  2TIR A;  1I9D A;  5H5S A;  2YWI A;  1JZR A;  2VM1 A;  2P31 A;  2I81 A;  4IJ3 A;  1QMV A;  4O5R A;  2NPB A;  2H72 A;  3ERG A;  2GZP A;  4A5P A;  4RI7 A;  4HQS A;  5AIV A;  1TRW A;  1EWX A;  1XWG A;  4YAV A;  4BL7 B;  2N5F A;  3C71 A;  1HNB A;  2MBT A;  2CT6 A;  1PKZ A;  4QL9 A;  2WUL A;  2CAI A;  5GSS A;  4ZL9 A;  4X1U A;  3F3R A;  4KH7 A;  1PN0 A;  3DRN A;  2GDR A;  14GS A;  1XXU A;  2JU5 A;  1O8W A;  1PN9 A;  1BG5 A;  3QMX A;  5DJL A;  3HKR A;  3W8J A;  4G19 A;  4I6X A;  2YV9 A;  3TB2 A;  1ERV A;  1MDK A;  4MA9 A;  4MF6 A;  1J0F A;  2H74 A;  2OE1 A;  1EOH A;  4XS1 A;  1OE8 A;  3QAW A;  1R5P A;  2FWH A;  1TJD A;  1M9B A;  4LMW A;  1EGR A;  4F2I A;  2TRC P;  2O85 A;  1JZD A;  2PBJ A;  3F9U A;  4TR1 A;  2B5E A;  2H0G A;  1K0O A;  3F63 A;  1PL1 A;  2ON5 A;  2CVK A;  4IVF A;  4X0X A;  4MH2 A;  3QAV A;  5IOW A;  1V2A A;  5H5Q A;  3EVI A;  1OE7 A;  1XBS A;  2KP2 A;  16GS A;  1A0R P;  1GWC A;  3H93 A;  2LEG A;  2PGT A;  2LKU A;  1E6B A;  3CSH A;  5CYY A;  4OO4 A;  3GTU B;  2AV4 A;  4DSS A;  1ABA A;  1ERU A;  1T3B A;  4WEY A;  3GA4 A;  2H1D A;  3L0H A;  4FYU A;  1S3D A;  3HD5 A;  2LJR A;  4D73 B;  4GST A;  3GKK A;  2Z9S A;  1T7P B;  2DJ2 A;  2V32 A;  2H0I A;  2LRT A;  3JCM L;  3TRQ A;  2YNX A;  2GTU A;  2N5A A;  3R3E A;  2LST A;  2YV7 A;  3H79 A;  5DQY A;  2DJ3 A;  1A2L A;  2AAW A;  3Q74 A;  1GSS A;  1ZCP A;  2PER A;  2FA8 A;  3DVX A;  2I4A A;  2IL3 A;  2CZ2 A;  2V6K A;  1AXD A;  1KTE A;  3GKN A;  2J23 A;  3M0F A;  3HDC A;  2C0F A;  4MH3 A;  2QA2 A;  1YDK A;  5IPH A;  4TRX A;  3WYW A;  2B5Y A;  1K0D A;  3HJM A;  3M9J A;  2K6V A;  4KA0 A;  1DUG A;  3BCK A;  3VPT A;  4K5R A;  2HLS A;  3F6D A;  4PTS A;  3AY8 A;  4OMV A;  4NHZ A;  1O8X A;  2IFQ B;  2L59 A;  5GAN D;  5JCU A;  1U6T A;  2H70 A;  3LOR A;  3GN3 A;  3ME8 A;  5EY6 A;  1PSQ A;  5E4W A;  1SD9 A;  1WIK A;  1SEN A;  2WGR A;  3D22 A;  3ZVJ A;  4RQX A;  3ERW A;  4OFT A;  2GSS A;  3EU3 A;  2JZS A;  4WBJ A;  2B7J A;  1QUW A;  1MD3 A;  2DLX A;  5KN2 A;  3C1R A;  2XPE A;  3QR6 A;  5HR3 A;  2PU9 C;  3MSZ A;  4XHM A;  4J56 E;  1TK8 B;  5B8B A;  3TKS A;  4OO5 A;  5IMC A;  5J9B A;  4ISD A;  4XRD A;  3OR5 A;  1EV9 A;  1MDJ A;  3PGT A;  3F0I A;  2B5X A;  2F9S A;  2L4C A;  1Z7P A;  2AUV A;  2OAC A;  2CQ9 A;  3P7X A;  2H0H A;  3TDG A;  3M9K A;  2R4V A;  3GUS A;  5BRT A;  1NHY A;  4EXJ A;  5J41 A;  2WFC A;  5JCG A;  2LNS A;  2OBI A;  5KOW A;  2HZE A;  2E2M A;  2GLR A;  1K0C A;  1ERW A;  4FQU A;  4RI6 A;  5LCZ A;  4IS0 A;  3ZRD A;  2BMX A;  1LJR A;  3UMA A;  5ECL B;  4I5Q A;  5B8A A;  3TUE A;  4Q5F A;  1NW2 A;  4EIP A;  3ZL5 A;  1GTU A;  1GSE A;  1QXH A;  3MYD A;  2LQO A;  2EIR A;  2AJQ B;  4HOJ A;  4BPY A;  4G0I A;  5KEJ A;  4KE3 A;  2DKH A;  2M46 A;  5EPF A;  3MNG A;  4ICY A;  3DIE A;  4POB A;  2CA8 A;  2H6X A;  2B3S A;  1ZOF A;  2DSA A;  4K7O A;  2G0F A;  4AF2 A;  2FA4 A;  2IPA A;  2NVL A;  4ID0 A;  5HFK A;  4DSR A;  1T1V A;  4TKY A;  1ST9 A;  1GSU A;  4HI7 A;  4OFM A;  4MJB A;  1DE1 A;  2VLV A;  2IWT A;  2B7K A;  1Q98 A;  5GST A;  1GTA A;  1XCC A;  3FRC A;  1KEB A;  3KTB A;  5IO2 A;  4EUY A;  1GTI A;  4KUN A;  3BBY A;  2LTK A;  2XBQ A;  3UVT A;  3EIN A;  1Y25 A;  5IOX A;  5ID2 A;  2X8H A;  1R5A A;  4N0Z A;  4EC0 A;  3IOS A;  1ZGN A;  2AYT A;  5CNW A;  1DBY A;  3L9V A;  3WT2 A;  3R2Q A;  2A4V A;  1VGL A;  2YJ7 A;  1ZYP A;  2FLS A;  5INY A;  3CTG A;  4EVM A;  2GQK A;  5IM9 A;  3GL5 A;  1GNE A;  1DSB A;  4BVX B;  1X5E A;  4OD7 A;  4WET A;  2YZU A;  4WR5 A;  2E0Q A;  2HSH A;  3VFI A;  1O7U A;  4PUF C;  2GVP A;  2RUE A;  5IQY A;  4K0N A;  4XS4 A;  4Z2T A;  4NAX A;  3ZIV A;  2CX4 A;  2YZH A;  4POM A;  4POL A;  1Z6M A;  3F4R A;  2FY6 A;  4Q5R A;  1URM A;  5F06 A;  1TW9 A;  2VL2 A;  4MNN A;  1BJX A;  2UZ8 A;  2R6K A;  3GIX A;  3US3 A;  17GS A;  2FWG A;  4V2M A;  1M2D A;  2CZ3 A;  2RM5 A;  3G7I A;  3KEB A;  4K6X A;  4GSS A;  4L0W A;  5JWR B;  4V2N A;  3A2V A;  1U88 A;  4G9H A;  2A4H A;  1XFL A;  5F05 A;  5H5R A;  3G7Y A;  3IE3 A;  1XVQ A;  1FW1 A;  4KAE A;  2QA1 A;  1TU8 A;  2K8S A;  2R5G A;  4PUR A;  1MTC A;  1S3A A;  4XIH A;  1BX9 A;  2EIO A;  1TRS A;  3KD0 A;  1Q4J A;  4KF9 A;  2CV4 A;  4TR0 A;  5ELA A;  2HRF A;  1GP1 A;  5DCH A;  5KN0 A;  1SD8 A;  2MMZ A;  4O5Q A;  1WE0 A;  22GS A;  2XBI A;  1GLP A;  1HNC A;  5HR2 A;  1EP8 A;  1T00 A;  2ON7 A;  4PUA A;  2AHE A;  1GH2 A;  4DSQ A;  3D6I A;  3LSZ A;  4J57 E;  2H8L A;  5HR1 A;  3ZVJ D;  2R3X A;  2I1U A;  5HFG A;  5C00 A;  2FUG 2;  4MPF A;  3GKM A;  1T4Y A;  3SWL A;  2VCZ A;  3KH7 A;  2IMF A;  3ZTL A;  2VCX A;  1R7H A;  2R37 A;  2JAC A;  1F37 A;  3DYR A;  5G31 A;  6GST A;  3HVS A;  1NHO A;  5G30 A;  3I43 A;  1G7O A;  3HJP A;  5ECH B;  3L9U A;  3VK9 A;  3TJF A;  1U87 A;  1VRS D;  1O73 A;  4JR4 A;  3FHK A;  3UVH A;  2C0D A;  3WGE A;  4TXO A;  4HUA A;  4I2U A;  1HD2 A;  2JAD A;  2OJL A;  3ZZX A;  4BWQ A;  2VCT A;  1PA3 A;  3P2A A;  2A2P A;  4BL7 A;  5DAK B;  4HU7 A;  2KLX A;  4PNF A;  2C0G A;  2FHE A;  1G0T A;  4FH8 A;  4IW9 A;  2DJK A;  1M2B A;  1S3C A;  4K8M A;  3TRP A;  3O3T A;  5D93 A;  4LL4 B;  5B7C A;  4AJ6 A;  5D73 A;  2KUC A;  2HXK A;  2VD1 A;  1ZMA A;  1OAZ A;  1B9X C;  1PMT A;  4WKW A;  2X49 A;  4HDE A;  2DIZ A;  4JBB A;  4MPG A;  2XPD A;  3IA1 A;  3TOU A;  3VUR A;  1RW1 A;  3NOF A;  1YQ1 A;  2VCW A;  2VAF A;  1WOU A;  1WPI A;  5ENU A;  2FD3 A;  3RPN A;  1AAZ A;  2H1A A;  3D4T A;  4MZW A;  3TKP A;  2HSY A;  4PX1 A;  1RQM A;  6GSV A;  5CRG A;  2QKE A;  3W8S A;  2HSM A;  1YZX A;  3BD2 A;  4ML6 A;  1PGT A;  2GT6 A;  3DXB A;  3K8N A;  3F4T A;  5GAP D;  2MBS A;  3VWW A;  2C3T A;  3FY7 A;  3I69 A;  2CVD A;  2YN1 A;  1OC9 B;  2PUK C;  3GTU A;  5A5K A;  3HJO A;  2H73 A;  1K3O A;  2V1M A;  2L4Q A;  3EPT A;  1XW6 A;  4FYB A;  2J9H A;  2K8V A;  4EF0 A;  1PD2 1;  3RDW A;  2A2S A;  4D73 A;  4LMV A;  2ZUP A;  3ZYW A;  2LV3 A;  5ECM B;  2DJ0 A;  3FR3 A;  4HU9 A;  1AQW A;  4ZL7 A;  2X8G A;  2ZCT A;  3M8N A;  1YF1 A;  4F82 A;  1YEP A;  4G0L A;  3M1G A;  4AJ8 A;  4WXT A;  3IRA A;  3FZ5 A;  3GHA A;  4Z2U A;  2A2R A;  1I5G A;  4PQI A;  1O81 A;  3QFB C;  4TR4 A;  4EE0 A;  4PQ1 A;  3HZ8 A;  1UA5 A;  2C80 A;  3EC3 A;  4IBP A;  3FEU A;  1M99 A;  5D9V A;  4MF7 A;  5DJM A;  2X99 A;  1SU9 A;  3H8Q A;  3IHQ A;  3L9S A;  1MEK A;  3CSJ A;  4PNG A;  9GSS A;  1WWJ A;  2V41 A;  4MF5 A;  3N9J A;  1F9M A;  4GF0 A;  4DVC A;  2H75 A;  1F3A A;  2LRC A;  3EU4 A;  4BVY B;  3TCO A;  4V1A p;  7GSS A;  8GSS A;  2H66 A;  3ED3 A;  3VLN A;  5F0G A;  2H1B A;  3KGK A;  1A2J A;  5D96 A;  3LW9 A;  5L71 A;  2OE3 A;  3MDK A;  1TTZ A;  1NSW A;  2IJY A;  1GUM A;  3ERF A;  1OC3 A;  5ECI B;  4GQF A;  5G5F A;  3ZLP A;  1EZK A;  2O8V B;  5ECR B;  2QSI A;  2XHF A;  4MJA A;  5AIX A;  1SJZ A;  4KSM A;  5COH A;  4MJE A;  2L57 A;  2LRN A;  4K1F A;  1FVK A;  3DVW A;  3FMW A;  3CRU A;  4CY8 A;  3LJR A;  3FR9 A;  4MJC A;  1SYR A;  3QOU A;  1J9B A;  4HJ2 A;  2N5B A;  4IP1 A;  5BMU A;  4QQ7 A;  3WGD A;  3F3Q A;  5F8B A;  4EO3 A;  4MDC A;  4PQH A;  1YF0 A;  4L5O A;  3ZIJ A;  1GSY A;  5DVB A;  1EGO A;  4JU5 A;  2R0G A;  2WCI A;  1XOB A;  5G1K A;  2HNL A;  4USS A;  5J5N A;  4GTU A;  2MMA A;  4TVE A;  1GL8 A;  2YCD A;  3CXG A;  5KN3 A;  3UBL A;  4V2L A;  1A0F A;  3GYK A;  4HEA 2;  1O6J A;  4J2F A;  1HYU A;  3QCP A;  3LXT A;  3APO A;  1IYI A;  1GUK A;  1SJI A;  1CQH A;  3LFL A;  5G5E A;  4GQC A;  1FG4 A;  1K0A A;  3EMP A;  5D9X A;  1PX7 A;  4HZ2 A;  2DIY A;  5ECP B;  4YQV A;  1WP0 A;  4MZC A;  5IPG A;  4XTS A;  2RM6 A;  3O76 A;  4ZB9 A;  3VWV A;  1CQG A;  5AN1 A;  3APS A;  4ML1 A;  3GH6 A;  2HFD A;  4ZBA A;  1ZYE A;  2OE0 A;  4NV5 A;  4GCI A;  3RPP A;  3PIN A;  2DJJ A;  1R26 A;  3GSS A;  4MP4 A;  2H19 A;  5FT3 A;  4ZB8 A;  1EOG A;  3IAS 2;  3DWV A;  4KW6 A;  2X64 A;  5A4W A;  2CAQ A;  4HS1 A;  2C3N A;  2VD0 A;  1FB6 A;  5HFI A;  4IKH A;  4DEJ A;  2ES7 A;  3E3E A;  1Z9H A;  4G2E A;  3UBK A;  1JLV A;  4K2D A;  3KM6 A;  1X0R A;  4ZIJ A;  3ZFL A;  3GMF A;  1SJ6 A;  2B1L A;  2O89 A;  1JFU A;  3IPZ A;  2VCV A;  2L5L A;  2K9F A;  4O92 A;  2KOK A;  1ZYQ B;  4BWS A;  4YQU A;  2H01 A;  3W6G A;  1SK0 A;  1XWB A;  3HYP A;  1AUC A;  2YPM A;  3UAR A;  3LG6 A;  3F6F A;  1BAY A;  5D9W A;  3RHB A;  4MAB A;  1NM3 A;  2C4J A;  4I97 A;  4L5L A;  3N5O A;  3IR4 A;  4FO5 A;  1C72 A;  3IXR A;  5FWG A;  3MIX A;  1USB A;  4NHW A;  4BVX A;  5CRW A;  4WR4 A;  1TKD B;  3IV4 A;  4ZBD A;  4PGT A;  1K0N A;  1T8E B;  3CRT A;  2H76 A;  3WD6 A;  2LQQ A;  2LS5 A;  2IN3 A;  4CHS A;  5A4V A;  5LD0 A;  3HZ4 A;  4ULX A;  2O7K A;  3M3M A;  4F03 A;  2RII A;  2ZNM A;  1WJK A;  3F8U A;  3ZMK A;  3FR6 A;  2GQM A;  3U5R E;  1LU4 A;  3RBT A;  2P5R A;  3TJG A;  5IIZ A;  4KGI A;  3PPU A;  3IDV A;  5D8I A;  2R2J A;  3H1N A;  5F07 A;  3MWH A;  5J9C A;  2DBC A;  3HXS A;  1QQ2 A;  2FNO A;  1M0U A;  4YKF A;  4OFN A;  4FYC A;  1H4O A;  2P5Q A;  2M80 A;  1B4Q A;  4F0C A;  2F3M A;  2DMM A;  1RK4 A;  3TKS E;  3QFA C;  4Q5Q A;  2QGV A;  1PKW A;  4KB3 A;  4AJ7 A;  2OBK A;  1X9S B;  2DJ1 A;  4ECI A;  1T4Z A;  1ML6 A;  5DCG A;  1M2A A;  4POK A;  3DD3 A;  5ECK B;  6GSS A;  2HYX A;  3E9J B;  3EWL A;  1EEM A;  4KSO A;  3FW2 A;  1SKW B;  1AW9 A;  3EUR A;  5J4U A;  1TRV A;  1TDI A;  2VUP A;  3TJB A;  3UEM A;  5EL8 A;  3NIV A;  1TK0 B;  1X9M B;  2V2G A;  2MZC A;  4KCA A;  2OA7 A;  3GUR A;  20GS A;  1TP9 A;  3TKR A;  2FWF A;  3Q18 A;  2YWN A;  3FYG A;  1K0B A;  1TU7 A;  4N10 A;  4HJM A;  2GS3 A;  4XRA A;  2BTO T;  2GSR A;  3V1W A;  3S9F A;  1JZW A;  2HZF A;  4ZIL A;  2F51 A;  2MMN A;  3GNJ A;  1HNA A;  5DAL B;  4GLT A;  1AQX A;  5IO0 A;  2B1K A;  1ZYN A;  3CBU A;  2F8A A;  4OWY A;  3ZFB A;  3RHC A;  3VPQ A;  2HT9 A;  4Q5N A;  3J7Y k;  2C0E A;  4LL1 B;  4ILF A;  1G6Y A;  1BQ7 A;  4G10 A;  4ECC A;  1FHE A;  1Z7R A;  4RQR A;  3F4S A;  4JR6 A;  2VOC A;  4NPB A;  5LNK e;  3E0U A;  3H4K A;  3HY2 A;  4LLR A;  3DML A;  4N30 A;  3LQ7 A;  3EE2 A;  1SK1 A;  4Z7X A;  3BCI A;  4IGJ A;  5DAK A;  4TXO B;  4HQZ A;  4WF4 A;  4V1A g;  1TI3 A;  4EIQ A;  5DBQ A;  4CY6 A;  2WZ9 A;  2NBS A;  4ZXG A;  4NWY A;  3FZ4 A;  1K3Y A;  2H1G A;  2L5O A;  4ECJ A;  1XW9 A;  3GH9 A;  1QGV A;  1OYJ A;  2GZY A;  3BJ5 A;  1PRX A;  3L78 A;  1B8X A;  1ZZY A;  2MYG A;  2VO4 A;  1VF1 A;  1PX6 A;  1SKS B;  2LUS A;  4TN8 A;  1OKD A;  4ECB A;  1GSQ A;  1V57 A;  5ECQ B;  3A2W A;  2WB9 A;  4E8E A;  4BA7 A;  3O6T A;  1HQO A;  5IMA A;  6GSY A;  10GS A;  4NV2 A;  5E59 A;  2PPT A;  3GFK A;  2JL4 A;  4TR1 B;  3I6A A;  1R4W A;  1PL2 A;  3WGX A;  4AGS A;  2FWE A;  1EV4 A;  5IMV A;  3KH9 A;  3EMX A;  1OC9 A;  4N0V A;  2MMO A;  3IC4 A;  4YKG A;  4YAP A;  1G7E A;  1FB0 A;  4XCS A;  4QL7 A;  3CMI A;  2VL3 A;  4DSS B;  3ZML A;  5AGY A;  2E2G A;  3KMN A;  2M72 A;  1GUH A;  1XWC A;  2VCQ A;  4MMM A;  1SKR B;  3TKS C;  3D5J A;  4K7N A;  1SK2 A;  2JSY A;  5KOX A;  3HVV A;  4IQ1 A;  1Z3E A;  1M9A A;  5A4U A;  3IC8 A;  4KND A;  4K2X A;  1GSD A;  1U3A A;  5CRD A;  1W89 A;  2DKI A;  3HHV A;  1SL1 B;  2P0G A;  3P8W A;  2YOI A;  2DC5 A;  2K18 A;  4JRR A;  2HI7 A;  2NDO A;  1SL2 B;  2R0C A;  4IEL A;  2HRA A;  2X8C A;  4TR3 A;  1OC8 A;  2TRX A;  1V40 A;  3IBH A;  4N11 A;  5FHI A;  4GRF A;  1J08 A;  3ME7 A;  2AB6 A;  1V58 A;  2VM2 A;  3RAZ A;  2HE3 A;  4ZB6 A;  3IK7 A;  4MK3 A;  3D4M A;  4WF5 A;  3C8E A;  3CSI A;  4BVY A;  3A5W A;  1GLQ A;  6GSW A;  2HRK A;  12GS A;  2CX3 A;  2ALB A;  5ABR A;  3KXO A;  4EL1 A;  1A24 A;  4G0K A;  5GZZ B;  1LBK A;  4CW9 A;  2IFQ A;  4GSN A;  2F8F A;  4KX4 A;  4NXI A;  2GST A;  2H6Y A;  2YWM A;  3ZIT A;  1AIU A;  2I3Y A;  2LNT A;  4PXO A;  3VWU A;  1A2M A;  4IN0 A;  2I9H A;  2GGT A;  2WJU A;  1B4P A;  2BJX A;  3I9V 2;  3L4N A;  3A2X A;  1M7T A;  1SYX A;  1AC1 A;  1XW5 A;  5JWQ B;  13GS A;  4ZBB A;  1X5C A;  1UC7 A;  2FGX A;  2IMK A;  3DKS A;  4H86 A;  1GSF A;  3UL3 A;  3TRX A;  2REM A;  1BED A;  1THX A;  2O87 A;  3QPM A;  3KTL A;  3DEX A;  2X4A A;  3D0Z A;  2JZT A;  3QAG A;  3PR8 A;  4RUV A;  5B6M A;  4TOP A;  3KZQ A;  3GL3 A;  3QDN A;  6GSX A;  1O85 A;  3DGQ A;  3C1S A;  1KNG A;  2WDU A;  3CTF A;  4EDZ A;  5ELG A;  3A3T A;  2H71 A;  1IYH A;  4F0B A;  4I8B A;  2JSZ A;  2WS2 A;  1K0M A;  1UVZ A;  1JZO A;  3NZN A;  2OKA A;  3ZRE A;  18GS A;  1FAA A;  4YH2 A;  3U6V A;  4K5S A;  1QFN A;  5C04 A;  2HZE B;  1X5D A;  1Z6N A;  1OVN A;  3TOT A;  4I2T A;  1WRY A;  4KCE A;  4MZB A;  4OCF A;  3LWA A;  2DML A;  2H6Z A;  4NMU A;  2EC4 A;  2G2Q A;  5HR0 A;  1B48 A;  4WBR D;  3GV1 A;  1XZO A;  3UOM A;  3SBC A;  4YQM A;  4O7H A;  2VL2 C;  4MCU A;  1MD4 A;  4K7I A;  2GZZ A;  3KP9 A;  2IIY A;  3LGC A;  5B6N A;  3QD9 A;  11GS A;  5G1L A;  3J7Y b;  2EIQ A;  4FIW A;  2GT5 A;  2PVO C;  1WMJ A;  1A8L A;  3UIW A;  4KDX A;  1XWK A;  1BYE A;  4ACS A;  3EYT A;  1E2Y A;  2VLU A;  3G9B A;  5AIS A;  1B9Y C;  1U3I A;  4OCE A;  1AQV A;  2IME A;  2LJA A;  1N8J A;  4HZ4 A;  3FKF A;  2QC7 A;  2L6C A;  5CRE A;  3UJ1 A;  1YJ6 A;  3VI5 A;  2VIM A;  2H30 A;  3HCZ A;  2V6O A;  2L6D A;  5DDL A;  4E8H A;  1TRU A;  2C8U A;  3A5I A;  4O32 A;  3LYK A;  1K3L A;  2YWO A;  1XOA A;  4EDY A;  3KP8 A;  5J3R A;  3IK9 A;  3FZA A;  2B6M A;  2CVB A;  2KHP A;  5ID2 B;  5ECS A;  4K0G A;  1JHB A;  3UAP A;  3ISO A;  3KCM A;  3IHG A;  1FVJ A;  4JZQ A;  2WRT A;  5CP1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...