1M2RA

Crystal structure of 5,8-di-amino-1,4-di-hydroxy-anthraquinone/ck2 kinase complex
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
327
structure length
327
Chain Sequence
b'SKARVYADVNVLRPKEYWDYEALTVQWGEQDDYEVVRKVGRGKYSEVFEGINVNNNEKCIIKILKPVKKKKIKREIKILQNLCGGPNIVKLLDIVRDQHSKTPSLIFEYVNNTDFKVLYPTLTDYDIRYYIYELLKALDYCHSQGIMHRDVKPHNVMIDHELRKLRLIDWGLAEFYHPGKEYNVRVASRYFKGPELLVDLQDYDYSLDMWSLGCMFAGMIFRKEPFFYGHDNHDQLVKIAKVLGTDGLNVYLNKYRIELDPQLEALVGRHSRKPWLKFMNADNQHLVSPEAIDFLDKLLRYDHQERLTALEAMTHPYFQQVRAAENS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CASEIN kinase II, alpha chain
publication title Inhibition of protein kinase CK2 by anthraquinone-related compounds. A structural insight
pubmed doi rcsb
source organism Zea mays
molecule tags Transferase
total genus 108
structure length 327
sequence length 327
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2002-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1m2rA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1m2rA01
4OTQA 2C6LA 2GTMA 3MA3A 3E8DA 3K3JA 2IO6A 1GOLA 4LGGA 4X7QA 4XMOA 3VS7A 4AZEA 4HYIA 2W1ZA 3P1AA 3FL5A 4ITIA 4O91A 4D58A 3Q4TA 4ANLA 4FGRA 4JDHA 4CT2A 3A7FA 5BVWA 3NNUA 4O86A 2BDJA 1BLXA 4AF3A 4ZAUA 4KS7A 3NAXA 3FV8A 3PLSA 2ETKA 5L2QA 4JBVA 2NP8A 3GVUA 3H9RA 1XR1A 3P08A 5DH3A 1H8FA 5FEQA 2PYWA 1YHVA 2XK9A 4C4GA 2R3IA 1FBNA 2UV2A 4FKJA 4G6LA 2UZWE 2KTYA 2ITPA 5DMZA 3BE2A 4YJOA 4CVAA 2V62A 5DA3A 3RAHA 1XBAA 2XEZA 2VTNA 4BGHA 4ZSAA 5DFPA 4YU2A 4W4WA 4AOJA 3P7BA 3DAJA 4UB7A 2PSQA 3QZHA 4Q9ZA 4BI0A 3GC9A 2ZB0A 2GPHA 5HTBA 4BN1A 2ZDTA 3QQHA 3O96A 1J91A 4LOOA 3KXGA 3COKA 5I9YA 2OZOA 3NIEA 5HBJA 4FIFA 2WPAA 3A7IA 3E7OA 3LQ5A 3DK7A 4EH9A 1OKVA 2Y8OA 5AR2A 2Z2WA 4QMMA 4QYYA 4BR3A 4BZOA 4X6RA 2P33A 3V6SA 1GZ8A 3AT4A 2PWLA 2QODA 2X81A 5J9ZA 3KRLA 3KMUA 3NGAA 4V01A 5A3XA 4CRSA 3NCZA 4MXAA 2R9SA 3FMKA 5HX8A 2V7AA 5IDPA 1V1KA 5F95A 2OG8A 1ZMVA 2BRGA 2OFVA 2ONLC 2FSOX 3KXNA 3D2KA 1FPUA 4IX4A 4QTAA 3OXTA 3BWFA 3HL7A 4M68A 5CWZA 3W1FA 1P5EA 1APME 4EHZA 1OBGA 3BRBA 3R7UA 2WOTA 3FI8A 3UJGA 3EIDA 2PMIA 4PMMA 1WVWA 4GVJA 2BIKB 1MRUA 3AGLA 2OJFE 2YAAA 2YDJA 2R3JA 3MY1A 4YJUA 3AQVA 5EYMA 1F5QA 5CX9A 3ORZA 3C13A 5M09A 3QRTA 4FKSA 4K11A 4OW8A 4J8MA 4RG0A 1OIRA 3TTJA 3LZBA 3KRXA 4EH8A 3ENHA 4DT9A 4I5MA 1OL7A 4XRJA 2VTHA 5J79A 4YJSA 2BFXA 4FT9A 4D2SA 1ZOGA 1PMEA 4N0SA 3KXZA 5CEMA 3Q52A 1FVVA 3IW6A 3NUXA 4F9WA 4KS8A 3QALE 1V0PA 1H1WA 3LIJA 4ANOA 3R9HA 2WMQA 5G1XA 1QMZA 2QNJA 1OPJA 4YC3A 3R1NA 3OCTA 5FUTA 4F0IA 3DBDA 3EN4A 4MTAA 1U4DA 4UMRA 3F2RA 1PYEA 3NYVA 3WIGA 4OBOA 4FICA 4OTPA 2NO3A 3FY0A 3HUBA 4C57A 5FWKK 5C1QB 5GZ8A 4FTTA 5J9LA 3DTCA 3QTRA 2JFLA 3EN9A 3ZUTA 2C6TA 4FT0A 4J8NA 3O8UA 4X2GA 4YJTA 4DTAA 3VF9A 3OTUA 2EVAA 4CTBA 3GI3A 2QU5A 4ZTMA 5IEYA 3R8ZA 3FY2A 4I6HA 4JX3A 3AC2A 4AA5A 5DOSA 1AQ1A 4RGJA 3JVRA 2Q0NA 1XHAA 2EWAA 3NDMA 3NW5A 3GEQA 2F2CB 2XKCA 4MBJA 3KGAA 4XG6A 4GU6A 4RMZA 2PY3A 1WBNA 3U9CA 2OH4A 2I0YA 4S2ZA 5AA8A 4CXAA 4F0FA 5AIRA 2ZV8A 4U5JA 3BQRA 5ACBC 4JS8A 2QURA 3Q9XA 4JG7A 4A9RA 4M7IA 4BZNA 4HVHA 2PUNA 3HX4A 3LFAA 2C5OA 5BNJA 3P7AA 3C0IA 3TNWA 4DEAA 4C02A 4CFXA 3BYUA 4Y83A 4I0SA 4HJOA 4CKRA 3UBDA 2GQSA 3WZJA 3ROYA 1CSNA 1OPLA 2Q83A 4KNBA 3EN6A 3OMVA 3D0EA 3BIZA 3NUPA 4P2KA 4NFNA 5FLFA 3QQLA 4L42A 4MD9E 3OG7A 3RPOA 4BCOA 3QUEA 4EOMA 2IVSA 3DXPA 2Z7SA 4NK9A 3IW5A 4DFZE 1IA8A 4HYUA 1QPJA 4ANSA 3AMBA 3UG1A 4BCHA 2HW6A 3NNXA 2YAKA 3BZ3A 4ZXTA 3O23A 3QD0A 5AM7A 4AZSA 1CKIA 3DJ5A 4IAIA 5AP6A 3NRMA 2VTQA 2BMCA 4YZNA 4C3RA 4FSRA 1FVRA 4JNWA 1UV5A 3VW6A 5DR2A 2O5KA 4F9YA 3P79A 2H96A 4Y46A 3TZ8A 4EK6A 4YJRA 3D94A 4QP9A 4EQCA 4BCIA 3R28A 4KUJA 4A4LA 1XH9A 2Y4IC 1WBTA 3D15A 2OH0E 2F7EE 5H9BA 4XG4A 3SDJA 4RVTA 1BKXA 5B2KA 1Q8YA 4TKSA 2CKOA 4MNEA 3PTGA 3EQIA 1R0PA 4I6FA 4RJ6A 5EYKA 3WE8A 2PU8A 2HIWA 1OIUA 3VUHA 3LXNA 4IADA 4NCTA 3OFMA 2QOOA 3V3VA 4ERWA 3NWWA 1P4OA 3BI6A 4EH6A 4YR8A 4FT7A 3UE4A 2GCDA 3NVKI 1JQHA 3LXKA 4NH1A 2AC3A 5TE0A 1VR2A 2HELA 4C61A 5IH4A 3PP0A 2RFDA 4BWKA 3FLZA 3EFKA 3FZTA 3EQHA 3EMGA 3R22A 4RFZA 3UQFA 2E9OA 5KHWA 2X8EA 3QUDA 5EK7A 4D5HA 4L3LA 3MVLA 3P78A 3PG1A 5HE3A 5LJJA 3QBNA 4OLIA 4NT4A 5AV0A 3FXZA 1YQJA 2Y0AA 2VTTA 4LRMA 4BYIA 2VWBA 2GS6A 3B8QA 1RW8A 3P9JA 4FEQA 3TKIA 4AOTA 3VUDA 4AFEA 1K9AA 4R8QA 3DZQA 3TNQB 5M4FA 4BWXA 5M08A 3MPAA 3LHJA 3DK3A 4RIXB 5IEXA 4NWMA 4U3YA 2QKWB 2WU7A 4JT3A 2GSFA 2XJ1A 4RWLA 3R2YA 4LRJA 4PL3A 3KQ7A 5HVJA 3VS0A 4R3CA 4EK4A 5AV1A 4YO4A 4HOKA 4LYNA 4MBLA 4PNIA 5E1EA 4CZTA 3N51A 4Z3VA 5LVOA 2YWVA 1YXUA 2GFSA 3POOA 4HGEA 4O6LA 3ZHPC 2RG6A 2BZKB 2PZPA 3PA5A 5D7VA 5IA3A 4IM3A 3TACA 4IXPA 3ZO3A 4O7TA 1ZARA 4FV5A 4I24A 4LV5A 3S1HA 1O6LA 4L8MA 2QU6A 3MDYA 3SOCA 4NM3A 5IQBA 4EC9A 3PY0A 4MWHA 5K3YA 4IB0A 4N6ZA 1PKGA 3IONA 5DLSA 4C4EA 5IQAA 4ACDA 5EQEA 4LL0A 2VNYA 4RJ3A 5GZ9A 4FG7A 5J1WA 4U45A 4QP2A 3PPJA 1B39A 3OWJA 4JG6A 4O6EA 3RAWA 3Q5IA 4YNOA 1NW1A 3D5XA 4XBRA 4KIOA 3CS9A 3Q53A 5EG3A 4KB8A 2ITVA 2OO8X 3C4EA 4L3PA 4QYEA 3VJNA 4DFYA 2X1NA 3PA3A 2GDOA 4EYMA 2VTRA 4Q9SA 3UOLA 4O21A 3C4FA 3MTLA 4GFMA 4ACHA 5HE1A 1A9UA 4CFUA 4QMOA 5K4IA 3SG9A 3LMHA 5KUPA 3QWJA 4GG5A 2YIWA 3MV5A 5BUIA 3A8XA 3TM0A 1KOAA 5IISA 4RIYB 4NFMA 5IUIA 4WNOA 4O0TA 1M17A 4WHZA 2CKQA 4L43A 4PUZA 5D12A 1HOWA 5LVNA 4ZLOA 3FMJA 5CXHA 2XCHA 2XM8A 4RIWB 1KE9A 4L52A 3FC1X 3RM6A 4D2RA 3HRFA 2WQBA 3LCDA 1IAJA 4WRSA 5CU4A 5CAUA 2H9VA 5CAOA 3AD5A 3H0ZA 3OWLA 4BDFA 4S30A 3FQEA 3REPA 3ZO4A 1JSUA 4BBFA 2C0OA 2XEYA 4FL2A 3PY3A 4JAIA 4C4HA 4FIGA 4F6SA 4FKVA 1XO2B 2PE0A 3LQ3A 4JX7A 3EQGA 1J7IA 2W5BA 2QLQA 4FTKA 4JIAA 2A27A 3I7CA 3BHHA 3RK9A 4FG8A 3VS6A 1L8TA 5EHLA 3PJ1A 4G17A 5IA2A 5IH6A 2Z8CA 2QQ7A 3GCQA 3HMOA 3BGPA 2PVNA 2YM7A 3B2TA 4UALA 3QU0A 3PP1A 4XEYA 2UZEA 3LVPA 5IUGA 3QTUA 4MXZA 2J9MA 5ETIA 3DAKA 3OTVA 3UIXA 4JXFA 5J5SA 3RALA 4DYMA 3EQCA 3OROA 5EM8A 5F94A 5A4EA 5M51A 3UVPA 3NR9A 2B53A 3PY1A 4GUEA 2J90A 3FLWA 3IOKA 4G3GA 4YPSA 1KWPA 2EB2A 4G3CA 3RWPA 5FBOA 3OW3A 4Z16A 2OJJA 3PXYA 4QMSA 1TKIA 3PXKA 4O1PA 3PPZA 4IWQA 3FI2A 4X21A 4I1ZA 5H8GA 4AGCA 4ZTHA 3Q4ZA 3QLFA 4AGWA 4HPUE 3F3WA 4RVLA 4JOAA 5ANOA 2OU7A 3W2PA 1E1VA 2UW8A 2F49A 4MBIA 5CVHA 4IAYA 4IJ9A 4AOIA 3WF7A 3ZMMA 3NUSA 2BHHA 3FLSA 2WU6A 4CG8A 2GNHA 4FZDB 4L00A 4IB3A 4AA4A 4LV8A 1KV2A 2XKEA 5CI7A 5KZIA 4JAJA 2WD1A 1WAKA 5B2LA 1V0BA 4DC2A 4MCVA 4E4NA 5HG5A 5CS6A 4O7YA 4I92A 4LQMA 2CMWA 2GHMA 3PWYA 3R2BA 4ZTLA 3CJGA 2ZMDA 5AX3A 4BCJA 4UV0A 4ACCA 3H9OA 4S34A 2R0UA 1U59A 2IW9A 2YN8A 3UP2A 3FI4A 4JVGA 2C6IA 4EEVA 4IVBA 1S9IA 5HTIA 2W1EA 4DGGA 4GFOA 5TO8A 1H28A 5T3QA 2C3IB 3ZUUA 1PMNA 2WNTA 2YLFA 5JT2A 4EOKA 3D4QA 1K2PA 4E4XA 3KY2A 5AUZA 5HG7A 3BPRA 3N4VA 2JKQA 5A54A 5CU6A 3SXFA 4FNWA 3OXIA 4DT8A 4FSTA 2B54A 1VZOA 4FT5A 3ZFMA 1WBPA 2UVZA 2V5QA 1DM2A 4LI5A 3MY5A 3HNGA 4WO5A 5AAEA 4ZSJA 5DG5A 2ZVAA 2LAVA 3QKKA 3FC2A 4MHAA 3MJ1A 1UKIA 1QPEA 3SC1A 4LUEA 3CKWA 4HYHA 2X7OA 4U0IA 5EHOA 3UG2A 3C0GA 3QC9A 2WEVA 5K4JA 4EWQA 2QHNA 3FZRA 3Q96A 2YDKA 3KF7A 3IS5A 2WZJA 4BTMA 3SW7A 1YDTE 4CMUA 4IMYA 3UNJA 3SA0A 4F7JA 2CKPA 5D7AA 4Z7HA 1PJKA 3TUDA 3VIDA 4FVRA 3LFEA 4B6LA 3HV4A 4IWOA 5I9VA 2C6MA 3G0FA 3ZZWA 2G2HA 2VGOA 5BYYA 4O7WA 2W4OA 2WGJA 2Y7JA 3LLAA 1Q8ZA 2C47A 2YLEA 2EU9A 4H39A 2BRMA 2P4IA 4I3ZA 4WSYA 4EH3A 4F4PA 4YMJA 5L3AA 3OUNB 3PXZA 4F1TA 3AT2A 4CFWA 4R1VA 1MQ4A 3CTJA 2BRBA 2R3NA 4DITA 4EL9A 3QQJA 3QTXA 3UZRA 3PLAE 3ITZA 4I0TA 2YZLA 3AD6A 4AT3A 3KXHA 1WMKA 3COMA 4NZWB 5K0XA 4RLLA 1SNXA 3R30A 4NM0A 1CTPE 3FLYA 4XLVA 2HOGA 2W17A 2XK3A 1BUHA 5AM6A 4YP8A 1J1CA 2F7XE 3EYHA 3W2QA 1ZWSA 4C37A 4OAUC 4H3PA 3BYOA 1SVEA 3HV6A 2NNWB 4TY1A 5DN3A 4R7HA 1GZNA 1XWSA 2BAQA 4QMXA 3RHKA 5GZAA 3A8WA 1NT2A 4RIXA 3MVMA 4CFFA 5J87A 3FZ1A 4RX5A 5J7HA 4MXYA 3GENA 4DGLC 5FTGA 1UU7A 2B9FA 1PXNA 2BZHB 3DKGA 5D1JA 2YZAA 2QI8A 2WTKB 3FAAA 3ZS5A 4EUTA 4KD1A 5M4CA 1T45A 4OT6A 5ANGA 4ZLZA 1Q8WA 4G9RA 3TUCA 2GNGA 3VVHA 4QMTA 3I4BA 4BICA 4HCUA 4ASZA 2BZIB 4K2RA 2X8DA 3UPXA 4QYGA 3ZCLA 3HLLA 4EOQA 4CV8A 4I0RA 1ZYSA 1GJOA 2X2MA 4R7BA 2BVAA 4C3PA 3D7TB 2PVJA 3K2LA 3PIYA 4PY1A 4Q5EA 3ORMA 4G3FA 2PULA 3E3PA 3RCDA 4ANNA 4NSTA 3TDWA 3MSSA 3RPVA 5CXZA 4A4OA 4C59A 1OITA 2X7GA 3QGWA 4JL9A 2VV9A 4O0RA 1U5RA 3C51A 3QTZA 4F1MA 3TN8A 3VO3A 5A6NA 4RC2A 4MEDA 3SD0A 4AZTA 4FTUA 3R8PA 3WARA 5AV4A 2VUWA 1Y6BA 4LG4A 4M84A 4F7SA 4EONA 1WCCA 4ERKA 1WBSA 1KV1A 2BAJA 2WMSA 3V04A 2R2PA 4PPAA 3ERKA 2E2BA 4QP6A 3D2IA 4GRBA 3R73A 1P2AA 2ZM1A 4MD7E 3K5UA 4RIYA 3VHEA 1OL5A 3KC3A 5CF6A 2QC6A 1U5QA 3OY3A 4IE9A 4QP8A 4K77A 4HVGA 5T6KA 5IQGA 3ZM9A 4KBKA 4RIWA 1XQZA 4U43A 5CU0A 3O50A 3MA6A 2B9JA 4X0MA 4LUDA 1REJA 2I0EA 2ZM4A 5FG8A 3VBWA 4AW0A 3CPBA 4GJ3A 2ZAZA 5F4NA 2YIRA 4ONAA 1PF8A 4X3FA 3MPTA 2CHLA 4BRXA 4RJ7A 2QOLA 3HDNA 3UO4A 4HNIA 4A06A 4BIEA 4ITJA 1UWJA 1B38A 3E88A 4C4JA 1IR3A 4UN0C 1DAYA 4EKKA 5FM2A 3M11A 4FZ6A 5TKDA 5L6OA 5LQFA 3MTFA 4HCTA 4W8DA 2C69A 4WNPA 4BDEA 2CNQA 3F3ZA 4KBAA 4FEWA 3F66A 2OWBA 4OTFA 2XK4A 3CBLA 2VWUA 4BDCA 4A9YA 3NMUF 4R1YA 4BCFA 4FYOA 3KCFA 4KIQA 1YI3A 1JKKA 3QRUA 5DI1A 1YOLA 3FMNA 3QXOA 4IIRA 4X2KA 3F88A 5KBQA 4K1BA 5BUJA 4YJPA 1PXOA 4ZSGA 3QRIA 3PDTA 3MH2A 1YI6A 1ZZ2A 2QOBA 3G0EA 3QWKA 3RTPA 4QPAA 4S32A 2XNBA 4CFMA 5ITAA 5J7BA 2REIA 5FEEA 1KE7A 2R3MA 3QF9A 4IX3A 1ZY5A 3GUBA 4I4FA 4TNBA 1YI4A 1YRPA 5C4KA 5F1ZA 3PXQA 5M53A 4K33A 2JD5A 5BX0A 3KVWA 4BKYA 3BELA 4I5HA 3D14A 1W83A 3L8XA 5BVOA 5IA5A 4FSMA 5AV3A 3AD4A 3KXMA 5KMJA 3L9PA 4GH2A 5JZJA 2UZTA 1SVGA 4DGMA 4FC0A 3EL7A 4ZZOA 3PJ2A 4L46A 3ZSGA 4DLJA 3FPMA 5A4CA 2PPQA 4EJ7A 5GIOE 3C4CA 2WEIA 4ZJIA 2IZSA 3UGCA 3UIMA 3W8QA 3NYXA 3RPRA 1TQIA 1FGKA 3LKMA 2J6MA 3W55A 1R78A 3FKOA 4DEIA 4L3JA 3V5PA 2ITTA 4XS2A 4FTMA 4F0GA 4TZRA 5HORA 2CCHA 3RAIA 1R3CA 4FKUA 2VX0A 4DH8A 1PY5A 3E5AA 4I20A 4YJQA 5AP7A 4KKGA 4ASXA 2RL5A 3HP2A 3I5NA 5HVKA 4DH7A 3LCKA 4FOBA 4USDA 5E92A 3BQCA 2C30A 4AT5A 1TQMA 2JIVA 4PDPA 4AWIA 4F9CA 3ATSA 3T3UA 4QTEA 4U79A 4OTWA 5CAPA 3FLQA 4Y5HA 5JK3A 4Y73A 3QD2B 2EUFB 4FIJA 3RGFA 3VF8A 3Q4CA 3LCSA 3V5LA 3MB7A 3KULB 4AGUA 4Z7GA 2VWVA 5BVDA 3U4WA 3ZC6A 2HWOA 4BCMA 4JG8A 1OMWA 5B0XA 3ACJA 4YHJA 4IFGA 3LM5A 4UWYA 4ACMA 3NS9A 2R3HA 4GIHA 4X3FC 2V0DA 3AMAA 1OL6A 2C5XA 5DR6A 4ZY6A 2UW4A 3AC5A 3OP5A 4IEBA 5CT7A 5HGIA 1R0EA 4TRLA 5AR8A 5HD4A 2PVFA 4TWPA 3EH9A 4MVFA 4H3BA 3JY9A 1U46A 4XG8A 4XP0A 4DFXE 4FT3A 3ZBFA 4O7ZA 2YJRA 5HG8A 3DXQA 3H9FA 2ZDUA 1OIQA 4LRKA 3A61A 2W1FA 3EKNA 4I5PA 2VTLA 1OVEA 4AW1A 1CKJA 3OY1A 1BL6A 4U41A 3FL4A 5H8EA 3LQ8A 4PRJA 5I9WA 3UMWA 5JH6A 1W0XC 2J5FA 4J96A 3VW8A 3OEFX 1YWVA 5HESA 5EW8A 2XNNA 4M67A 1YVJA 1MRVA 3Q4UA 1Y6AA 4ACGA 3QCXA 2QOQA 2OK1A 1PXJA 1DS5A 3A62A 3MJ2A 3DFAA 3P86A 4OTIA 4XRLA 3D7ZA 3ZRLA 4USFA 2VWIA 4P4CA 1GZKA 1H26A 1H4LA 5IG1A 3T9TA 2XIKA 3C4WA 3CJFA 2PZIA 3F7WA 5M57A 3ALNA 2I0VA 2KULA 2PUUA 3C50A 3FE3A 3FKNA 3NPCA 3POZA 4WG4A 4FIIA 4YHFA 3C5UA 5IA1A 3O8TA 4DH3A 3F69A 3ORKA 4KSPA 4DGNA 5DT0A 5AADA 5FEDA 1WVXA 3R9OA 4EOIA 3OOMA 2UZVA 4D9UA 3VNTA 2C0TA 4GT5A 3WF6A 3L9MA 3P23A 1BMKA 1M52A 2UZDA 1W82A 2WTJA 4HGSA 4IC7A 4BB4A 2WIHA 4MX9A 5C01A 5EI8A 1ZXEA 2X6EA 3QTWA 4M13A 5ANDA 2G1TA 2J0LA 4Z9LA 4FV2A 5EM7A 4U3ZA 2XUUA 3G51A 4W9XA 3TNIA 5EYCA 2VWZA 4ZJJA 3VS5A 3U6IA 2NPQA 2EB3A 3IOPA 5LVPA 4QO9A 2IZTA 2YM3A 3EYGA 1ZMWA 4N4SA 4EC8A 5J1VA 2IJMA 2Y4PA 3F3VA 3ORNA 3II5A 5E1SA 4R77A 3ZLYA 3FHRA 1P14A 4IB5A 2GTNA 1BL7A 2R4BA 2QR7A 5CF8A 4DFBA 2O2UA 3NSZA 5I5ZA 5JFVA 2QOIA 4B8MA 1H1RA 5H2UA 1Y8GA 1YXXA 2CGUA 4YBKA 4JBPA 3IW4A 3RINA 4YZ9A 3DQXA 3V5JA 3SGCA 4EQMA 4N6YA 2W4JA 3OF0A 5JRQA 4FEVA 3DA6A 3NNWA 2ZV9A 3Q2JA 1UNGA 1YWRA 3UODA 4OTDA 2OGVA 4BHNA 5LCJA 5IQIA 1OM1A 1YW2A 5KKRB 1XJDA 3GNIB 4M0YA 2PMNX 4GSBA 3DS6A 5EI6A 4YLJA 5CVGA 4IB1A 1ERKA 2O64A 4DN5A 4FKPA 3L1SA 1GAGA 4RVKA 2J5EA 3A7GA 1PHKA 3G6HA 4U40A 5EYDA 5IA0A 3ZDIA 2HXLA 1ZOEA 2FA2A 3KK9A 3AC3A 3OCSA 5FXSA 3SQQA 4J99A 3Q5ZA 4GFGA 3TIZA 4AP7A 4B8LA 1LP4A 3GCUA 5HU9A 1CDKA 1OUYA 5AUWA 5GIPE 3R0TA 3EQPA 1E9HA 3G2FA 4FL1A 3GQIA 2ZOQA 1OUKA 2XYUA 2YCQA 3DY7A 4ZS4A 2X39A 5LMKA 5D10A 5HNGA 3KU2A 3UZPA 1KSWA 3PSBA 5EH0A 4EYJA 3OVVA 1G3NA 3T3VA 4AG8A 3IGOA 4E7WA 2HCKA 2UUEA 4M3QA 4Q5HA 2QLUA 2X4FA 3IDPA 5CNNA 3E87A 5FDXA 3CXWA 3W2OA 5HLNA 5HNIX 1O6YA 1UU3A 3A2CA 1YOJA 2OZAB 3CY3A 3DOGA 5B2MA 3CQEA 2GS2A 2C1AA 1M2QA 2VTOA 3KMMA 5HG9A 3W2SA 3ZYAA 2HYYA 4ZP5A 3F61A 3VRYA 1E1XA 4I21A 3TUBA 4APPA 1KE8A 3TZ7A 3V8WA 5AP1A 3CGOA 4FKIA 4WIHA 2B7AA 1F3MC 5DVRA 4I94A 5C8NA 4IJPA 4HGTA 1QL6A 1Z5MA 5I9UA 4BC6A 3ZM4A 1OL1A 3L8PA 4O96A 4H3QA 5KE0A 3E93A 4D4SA 5JKGA 3RZBA 3KVXA 3KXXA 3A4PA 5DNRA 4CKJA 3ZC5A 5HI2A 3TCPA 2VTSA 4FG9A 4AE9A 4KWPA 3G9NA 4O84A 5CEOA 2WQNA 1RQQA 5AUUA 4DEBA 5AP5A 4XBUA 4BZDA 3F3TA 3QD4A 4XJ0A 3ULIA 4DFUA 3EN5A 4TN6A 4GK2A 3QYWA 4X2JA 3UNKA 1PKDA 4M8TA 2QOCA 3ZRKA 4R3RA 1JWHA 2WXVA 5AFVA 1ND4A 5FGKA 3Q6UA 3CQUA 3JS2A 2B52A 4I22A 1URCA 4YTCA 1I09A 5EOBA 5CALA 3QKMA 4WNKA 4CFNA 3ATTA 2ITZA 2GHGA 5A46A 1YXSA 4WSQA 2O8YA 1H27A 2QO2A 2RGPA 4FKRA 4IACA 3HMNA 2R3RA 5TF9A 4IX5A 1M2RA 3KULA 4MD8E 4ZLYA 4CG9A 3C0HA 3M2WA 5L2SA 2WTWA 4B99A 5GJFA 1MP8A 4XUFA 2X8IA 2HW7A 3OD6X 3E8EA 5IKWA 4F64A 4OBQA 3SOAA 4U7ZA 5BMMA 2Q0BA 4GT4A 3QTIA 4OGRA 4DLIA 4EOSA 1VYZA 3U6HA 4NM7A 2GNIA 5L8JA 3RWQA 2GQGA 2ITQA 4WNMA 2UW6A 4EHGA 2OF2A 5AAFA 3ANQA 1OECA 3Q60A 4EQUA 3B8RA 3QC4A 4BIDA 3RJCA 3R8LA 3AGMA 1Q61A 5A4LA 4QPSA 2A4LA 3HYHA 4E5WA 3P0MA 3U51A 3VAPA 4NW5A 3WZKA 4IVAA 4D4RA 2IN6A 4UMUA 4UY9A 4K8AA 2CN5A 1W84A 1FVTA 4FK6A 5AR3A 4YSMA 4PTCA 2WQMA 3PVGA 3D5WA 4ALWA 5BYLA 4IVCA 4ZMEA 3IO7A 4V0GB 4DTBA 4L9IA 4XOZA 4WKQA 5HQ0A 4J97A 5LMKC 1H01A 4JQ8A 5IQFA 4ANBA 3I1AA 2VO7A 2YM6A 4ZTNA 2XNPA 4JBOA 2EXCX 4CRLA 2Z02A 2JDVA 3QZIA 4NYEA 4S31A 4F6UA 2PZ5A 3L8SA 4FV7A 4BCNA 4GJ2A 2JFMA 2X9EA 4XOYA 2ITXA 3DCVA 4O0YA 1HCLA 4IDTA 3IDBA 2BIYA 2XH5A 4I93A 5DGZA 5EOLA 3OZ6A 5EM6A 3VS4A 2BFYA 3CIKA 5CNOA 1Z57A 3SV0A 3PRIA 4MQ2A 3JYAA 3UC3A 5CASA 4RX8A 3ZEPA 5E8ZA 1Q41A 2WMXA 3FSFA 4UXLA 3R1QA 5HIBA 4RWJA 2FVDA 5K0KA 4H58A 4D1SA 3QAME 2E9VA 3V51A 4YC6A 3TJDA 3F9NA 4FZ7A 4E4LA 4AT4A 4KINA 2FO0A 3FLNC 4YUQA 2P2HA 4M15A 4M97A 2HY81 4BHZA 5IZFA 1YHWA 3QHRA 2O3PA 4E26A 4R5SA 4P90A 3TEIA 2HENA 2RG5A 2OKRA 5KMOA 1KOBA 3QTQA 3ENMA 4RC4A 3TZ9A 5A4TA 2WELA 1XH5A 4PTEA 4RVMA 3AMYA 3FDNA 2W5HA 3F5GA 1URWA 4UMTA 2VWXA 4II5A 5JMSA 3L9NA 4J53A 3TJCA 1A48A 3ALOA 4KRCA 3KRWA 3ZLWA 3I60A 3IQ7A 2SRCA 3R7EA 2LGCA 4DFLA 4WBOA 5LOHA 5A6OA 2R3QA 3R7YA 4AA0A 4HYSA 1H24A 4YTHA 1UKHA 3AOXA 4BTJA 3GCPA 3QCYA 2C5VA 4FSNA 4OAVB 4PDYA 3TDVA 4TTHB 4U9AA 5ETCA 2WO6A 5HO8A 2W1IA 2YJSA 3EQBA 3WYYA 4M69B 4NCTC 4WOVA 5CSXA 5AR5A 4C62A 4E5AX 4X6QC 1Q5KA 4PTGA 3QHWA 5DPVA 4QMZA 5JGAA 3DBQA 2UVYA 4ZZNA 2RFNA 2ACXA 2QO9A 4BYJA 4GKHA 5KCVA 2Y6MA 4GIIA 4KSQA 4U97A 1BYGA 3E92A 4PMSA 3D5VA 2BTSA 3ELJA 4P5QA 4IQ6A 3HV7A 4QPMA 4TNDA 3SLSA 5CANA 2AC5A 3NCGA 2VTMA 2JDRA 3KN5A 2XIXA 4TYGA 3WF5A 2XNGA 4UYNA 4FE2A 3NIZA 3KK8A 1FINA 4BBEA 4DEDA 5AAGA 5HZNA 4EZ7A 4WG5A 3VULA 4UMQA 4BL1A 1GIIA 3UC4A 3NUNA 1PXKA 4GS6A 4E5BA 3DK6A 2PE2A 1OKWA 2QR8A 5HE2A 4AQCA 1MRYA 3R71A 5HKMA 3PXFA 2BCJA 3QXPA 2P55A 4Y8DA 4F1OA 5BQ0A 1VJYA 2PMLX 4YZMA 3WYXA 4AZFA 1X8BA 4BTFA 3LFBA 2VN9A 5M4UA 5KHXA 2JDSA 3Q9YA 4YZCA 4A4XA 4R3PA 4RA5A 2J4ZA 3GQLA 2F4JA 2HWPA 3PSDA 4QYFA 4XCUA 3SHEA 1JKTA 2G9XA 4RT7A 4TXCA 4LMUA 4V05A 4C35A 4F9AA 2OZAA 4UYAA 3ZUVA 2ETRA 3KCKA 5EDRA 2YITA 2ITUA 3BU6A 3ODYX 5IF1A 2XA4A 3BCEA 3ANRA 4QMVA 3SVVA 2UW3A 5ANKA 5ANJA 3KF4A 4PWNA 5CEKA 2J2IB 3AT3A 2C6DA 4AACA 3U54A 5JSMA 2G01A 4HGLA 2JAMA 5L6PA 3HV3A 4G5PA 4ZZMA 4R6VA 4KA3A 2ITOA 3I81A 3F2AA 2WMTA 3FMHA 4G1WA 4WG3A 3WI6A 3QD3A 4D5KA 1AGWA 2JGZA 4FSQA 4RBLA 3QCQA 4Y95A 4ZS0A 3Q9ZA 4FA2A 2VRXA 3KEXA 2C5YA 5E8UA 4XH6A 4OTRA 5CEPA 3AC8A 1Q8TA 3OBGA 5IU2A 1P4FA 5E91A 3RKBA 4U6RA 3VBYA 2C6OA 2E9PA 4AAAA 4AFJA 4L6QA 3Q6WA 3W10A 3JY0A 4EBVA 4QQTA 1XH7A 3OWKA 4PQNA 5CY3A 2QVSE 4FNYA 4XP2A 4D2WA 4NTTA 4O7SA 3R1YA 1ZMUA 4FMQA 2GMXA 3BBWA 3O7LD 4J98A 5HOAA 4ZTQA 3EZVA 2HZ4A 4GYIA 2C5NA 3WF9A 1U54B 2XRUA 5E7RA 3GB2A 3FXWA 4U81A 5IMXA 1IRKA 1PRYA 2WB8A 3LCTA 5FTOA 2YM4A 2CLXA 3EFLA 4EOPA 1XH8A 3HA6A 4I6BA 2VO0A 3IK3A 3D83A 4O82A 2JEDA 1Q62A 4XG3A 2VGPA 5I9XA 2YIXA 3NX8A 4D1XA 4D28A 4PL5A 5HE0A 1MQBA 4J52A 4Q2AA 4AW2A 4F09A 3HDMA 4L68A 5DEYA 2IW8A 2PK9A 2CGWA 2WMWA 4DGOA 3CR0A 3HMIA 4ANQA 2WQEA 4WA9A 4PL4A 5A4QA 3QYZA 4D0WA 2ZJWA 3G9LX 2FSMX 5LMAA 2Z7QA 3I6UA 5BVNA 3DB6A 2PUIA 2Y9QA 2WHBA 2Z60A 2ZYBA 5AP4A 3E64A 4FSUA 3ZZEA 3ZONA 4GMYA 3Q2MA 5HBHA 1H07A 3MBLA 4PV0A 4HCVA 4QNYA 3QZFA 2XIRA 5LARA 4EH7A 4V0GA 2UZOA 5AA9A 4EH5A 5T68A 4E73A 3PWDA 2VTJA 4CMOA 4MAOA 2ERZE 3FBVA 2XBJA 3OC1A 3P4KA 1JSTA 3OBJA 3ZXZA 4BDDA 2HZ0A 3M1SA 2PZRA 3R7IA 4GT3A 4G6NA 4FYNA 4H1MA 4RJ8A 4BCGA 5JFSA 4O0UA 4RA4A 3N9XA 1KUTA 3FJQE 2J0KA 3KKVA 4OBPA 3R8VA 2W99B 4GW8A 4IFCA 3B2WA 4O7RA 1ZRZA 2AYPA 3DAEA 3C4ZA 3DKFA 4NKAA 5DEWA 3WIKA 3DU8A 4ASDA 4DEGA 2B0QA 2QKRA 4CEGA 3MN3A 3WF8A 4C0TA 5CAQA 2GNJA 3EHAA 4FEUA 3UYSA 5LXMA 3ZEWA 4RZVA 3VS3A 3GXLA 4GKIA 3HA8A 3FYKX 3N4TA 2OJGA 4M14A 3CGFA 5IQEA 4TYIA 3FEGA 3AC1A 5I3OA 3R6XA 4AGDA 5HIDA 3OWPA 3KB7A 4E6DA 4FSYA 3QQFA 2VAGA 4PMTA 2B9IA 5AR7A 4C4FA 4E8AA 2W5AA 4JRNA 3UOKA 5JFWA 4BWPA 4CZUA 3NYOA 1ZYDA 3Q04A 3VBTA 2J0MB 2OBJA 2GNFA 2H6DA 4EHVA 3SW4A 2XYNA 4FSZA 4M0ZA 1Q3DA 3EB0A 2C3JA 4IBMA 1LPUA 4WRGA 5HICA 4K6ZA 2P3GX 5E8WA 2QONA 5LCKA 4GYGA 2JDOA 4I23A 3UTOA 2XF0A 2CPKE 4L45A 4BCKA 2B4SB 2Y4IB 3QFVA 1NVRA 3KA0A 2JIIA 1CM8A 3ZU7A 4L53A 3QUPA 3FUPA 2C6EA 3CY2A 4J7BA 2QOFA 3DNEA 1WBVA 3PVUA 3RBWA 3BHTA 1J3HA 5B7VA 4B9DA 4FV6A 3DLZA 1IAHA 3T9IA 5L2IA 1JVPP 3HKOA 3BWJA 3CCNA 1YHSA 4FV3A 4MH7A 1S9JA 4XNEA 4A7CA 4O83A 4JLCA 4FBXA 3WILA 3COIA 2JLDA 2J51A 4RFYA 3S2PA 2PVMA 2HZNA 4JI9A 3E7VA 5H8BA 5D9HA 2PHKA 4FNZA 5AP3A 3DXNA 3OEZA 4D2PA 4BTKA 3GU6A 2UW0A 5AEPA 2EXMA 3DFCB 2B55A 4FV1A 4C3FA 3LFQA 2ITNA 3PIZA 3A7HA 2WTDA 3HGKA 1ZYJA 2XK7A 4LL5A 4RJ5A 3MFUA 3VS1A 3VUKA 4EZ3A 1AD5A 5CENA 1LR4A 4QMYA 4AZWA 2R3PA 4FX3A 1DI8A 3MB6A 3VWAA 3VUTA 3LW0A 4DG3E 3SXSA 4DINA 5EDPA 1I44A 3JR1A 1HCKA 1PXPA 3BYSA 1PXMA 2VX1A 2JC6A 3DBEA 4ZSEA 5M44A 5G6VA 3RPSA 5GJGA 1SMHA 3O51A 4EK8A 4C36A 1PMVA 4NTSA 2ZV7A 3FZOA 2BZJA 4C2WA 3DQWA 4HZSA 2JKMA 5FXRA 5DRBA 5L2WA 4QMUA 4D4VA 5GINE 4E4MA 1JPAA 3EQRA 4PPCA 4ZTSA 5HD7A 3THBA 4E93A 3A99A 4GV1A 4NKSA 3QQKA 3KRJA 2ZMCA 3MFSA 3HRBA 3D5UA 5HX6A 3ID6C 3DDQA 3PJCA 5IPJA 2E9NA 2W96B 2XKDA 3ORIA 4QMQA 1REKA 4EK3A 2X0GA 3CKXA 3OHTA 5FD2A 5AP2A 2ONLA 3UO5A 4LMNA 3PPKA 5JZNA 4C38A 1TQPA 3HMPA 4BIBA 3K3IA 5LVMA 3ORLA 5C03A 4MWIA 2J7TA 3DBFA 3HECA 3RCJA 3UVQA 4EH4A 1T46A 5L8LA 4IZ5A 1ZY4A 4B7TA 2QD9A 4FNXA 3ZLXA 3E8CA 2IVUA 1A06A 3LXLA 3M42A 3L8VA 2PVYA 4IAFA 2VWWA 4O38A 4XG9A 4DCAA 3NW6A 5IQDA 2R7IA 5BVFA 2CGXA 3C9WA 5CSHA 5DT4A 5AR4A 4E6AA 4FTLA 2XKFA 3IPHA 3ZTXA 4CMTA 2B1PA 3MI9A 4QQJA 3MS9A 4MKCA 3GU5A 3O7LB 4YNEA 3RP9A 4EKLA 1WFCA 4Y72A 5DBXA 3GOKA 4BDBA 4BKZA 4R78A 1NVQA 3R02A 1VYWA 4FTJA 5EKOA 5CZHA 5JGBA 3CD8A 4DG0E 4FEXA 4Y5QA 4P7EA 3RM7A 1U54A 2IW6A 3RI1A 3G6GA 4GL9A 4K0YA 2OLCA 2GFCA 3PRFA 3OS3A 4JDKA 4QYHA 3DV3A 4FF8A 4D1ZA 1WZYA 4N70A 3UOHA 1OKYA 2VTAA 4F08A 4RSSA 2HY0A 3KL8A 1SYKA 2BRNA 4CCUA 4JDJA 4IDVA 3R1SA 4O2ZA 2R64A 4FKGA 5E8SA 1Q24A 3ACKA 2QO7A 3H4JA 4L67A 4MK0A 3WZEA 5KO1A 1G8SA 5HEZA 1BI7A 1Q97A 2W0JA 3BHUA 4QD6A 4G16A 1M7QA 2VNWA 5E8VA 4CT1A 2WIPA 2OW3A 3H3CA 4KKEA 4YGAA 3CLYA 4RRVA 4F7NA 3EQDA 5DT3A 3NEWA 5BVKA 4HVDA 2IG7A 3PSCA 3Q32A 4FOCA 2W1HA 1SNUA 2JBPA 3Q3BA 3R8UA 4KAOA 5F20A 3NUUA 5JFXA 1O6KA 2P0CA 4OUCA 3MIAA 4IC8A 5EFQA 1BI8A 5BMSA 3EFJA 2X9FA 2C1BA 2W1GA 4DF3A 3C7QA 3COHA 4ARKA 2V55A 3EOCA 1H1SA 3GC8A 4OR5A 4IAZA 3CC6A 5HCXA 1XH6A 3MGYA 3G33A 4FTAA 4GK3A 1IG1A 3GOPA 2YHVA 2I0HA 2O63A 3D7TA 2B9HA 4HW7A 2OXXA 3WE4A 3ZDUA 4CD0A 4FKWA 3H30A 4TWOA 3K54A 5LWNA 1OB3A 3BV2A 2DS1A 3PZHA 3EWHA 3ZBXA 1L3RE 4HNFA 5ACKA 5M56A 4R7IA 3F2NA 5AIKA 2I7QA 3L9LA 3U4UA 3S3IA 5LWMA 4EI4A 2OIQA 3FMLA 4W9WA 5LVLA 3FZSA 4W4XA 2R3GA 3R9RA 1VEBA 4IW0A 4ZSLA 3RAKA 5BVEA 3JUHA 5J95A 2GQRA 3NUYA 3F5UA 2DQ7X 4ZY5A 3AC4A 4YLKA 2DWBA 4G2FA 4LFIA 3E3BX 4FKOA 2X6DA 3KFAA 1H0WA 2HAKA 1YDSE 2UZUE 4QTCA 4EOOA 2P2IA 4BBMA 1NXKA 3O71A 4C58A 2YACA 1K3AA 3DJ7A 4YBJA 4TYHB 2CLQA 3W2RA 3DB8A 2XNOA 4J95A 4IAKA 2BKKA 2QOKA 4CYIA 3TV4A 1R1WA 3LMGA 2R7BA 3DT1A 1OL2A 2NRYA 3WZDA 4O0WA 5HHWA 4EOJA 4KIKB 4B0GA 4CLIA 2YA9A 3QZGA 4RQKA 3HVCA 3VUIA 5KNJA 3V5QA 3IKAA 2NRUA 4RZWA 2YCRA 2C4GA 4G34A 1GY3A 3CP9A 3W32A 3SG8A 4O0SA 4TT7A 4H1JA 3EQFA 3F5PA 4PDOA 3A4OX 1OPKA 4QQ5A 2G2FA 5K9IA 4XV9A 5C27A 1RDQE 4KRDA 4C7TA 2XNMA 4WBBB 3ZFYA 3ZO1A 3V01A 1O9UA 4X2NA 4BDKA 4FV8A 5E4HA 5CSWA 2BALA 2F9GA 4IANA 4CTCA 5FDPA 1J7UA 2YM5A 2PMOX 2Z7LA 3JPVA 3NAYA 2VU3A 3D9VA 4YZDA 3LFFA 3F5XA 4DE4A 4CQGA 3F3UA 3PVBA 2WQOA 2OSCA 3DDPA 4WUNA 5CSPA 1Q99A 5KMLA 4DBXA 1XH4A 2YFXA 4FV0A 4H36A 2WTCA 3QQUA 4X2FA 2PZYA 4WT6A 3QX4A 3LE6A 5ANIA 4J71A 3BGZA 4LGDA 4G9CA 2FSTX 5HBEA 2I40A 2R3OA 2XK6A 4PNKA 4E20A 2VTIA 2IVVA 3OCBA 2YABA 1Q8UA 2WTKC 4ZMFA 4GEOA 4IHPA 4MQ1A 5J9YA 3RNIA 5M07A 3GCVA 4EHEA 2CDZA 1H0VA 3MVJA 5BPYA 4O0VA 1G8AA 3C4XA 3NZ0A 5FM3A 2ZB1A 4EOLA 3JXWA 3CE3A 2F7ZE 4IAAA 5DHJA 4D0XA 2IZRA 3ORTA 3NNVA 2RF9A 4ALUA 3I0OA 1SZMA 3VRZA 5DYJA 2ITYA 2R3LA 3PA4A 2FSLX 3RVGA 1IEPA 3VJOA 3BYVA 3OUKA 3BGQA 3W2CA 4BDJA 2R0IA 1GIHA 2W06A 4PP7A 3BV3A 3FI3A 5CF5A 5AP0A 3WBLA 2PVRA 4BDHA 5M06A 4D9TA 1Z9XA 2WOUA 2YIQA 4FTIA 5CAVA 2WFYA 2J50A 4M12A 3R63A 4XYFA 4CQEA 4ZOGA 2JIUA 5DWRA 4HZRA 2OJ9A 4I41A 5AV2A 2C0IA 4E3CA 1QPDA 5IH5A 5E8TA 4G3EA 2XBAA 2JBOA 1PYXA 3FMMA 4TYJA 4U42A 5EQPA 4GUBA 3HZTA 4BF2A 5HCYA 2UVXA 3O8PA 1H08A 1RE8A 4O81A 3E62A 1IA9A 2WMVA 3I5ZA 3WZUA 3GU4A 1M14A 4C33A 2BTRA 4JDIA 5C4LA 1UNHA 5C8KA 2W4KA 3UIBA 3V6RA 1KE6A 4WUAA 3U87A 5A9UA 3O17A 5DIAA 4JQEA 3F82A 2CGVA 2VD5A 2AUHA 5EW3A 5E8XA 2JKKA 2PUPA 1FGIA 3TXOA 3BEGA 3U55A 4J1RA 3GP0A 5KMKA 4IM0A 3V8TA 4AW5A 1OGUA 3RK5A 2Y6OA 3E63A 1GIJA 5IUHA 1M2PA 4MF1A 5CF4A 3ZRMA 3W33A 4KKHA 2QHMA 1PW2A 5HO7A 2ZM3A 3LFDA 2DYLA 3MWUA 2BUJA 5DR9A 2WKMA 2YERA 4EJNA 3MW1A 2BR1A 3DBCA 4M66A 4HPTE 4FVQA 4QTBA 3W16A 3O0GA 4C4IA 2BILB 3ZLSA 3HV5A 4XG2A 2F57A 2VTPA 4QP3A 4OT5A 2BDWA 2IVTA 1H25A 5FQDC 3TG1A 5IA4A 2YWPA 4NU1A 2UZLA 3DPKA 4FR4A 3QLGA 4YURA 3CD3A 5ETFA 4IH8A 3CSVA 3LFCA 2WMAA 4ZEGA 3T8OA 3HAVA 4EWHA 1Q4LA 3VBXA 4G5JA 1PXIA 4MXCA 3VQUA 1W8CA 2I6LA 4FKLA 3LOKA 3QGYA 3DJ6A 4YJNA 1SVHA 3EKKA 4QTDA 2I1MA 4YZBA 3U8WA 2XMYA 2YDIA 3LFSA 4F63A 4BY9E 4BCQA 4WD5A 4A9UA 1LEWA 1Y91A 2CN8A 3C5IA 1WBOA 2OICA 3RMFA 5IDNA 4P5ZA 4EK5A 4V04A 3BBTB 4FL3A 3LJ2A 3VC4A 4E6CA 3ODZX 4F6WA 4CCBA 5DRDA 3BHVA 4XLIA 5J8IA 4O1OA 4L7FA 3PZEA 5GJDA 3NUAA 3PE1A 2W9ZB 4XHKB 4ENYA 3I0QA 4F99A 2BHEA 4QP4A 5H3QA 4DA5A 4FIHA 2Z7RA 4JR7A 1JOWB 5AWMA 3TL8A 4UXQA 4CKIA 3HMMA 4O7LA 1TVOA 1Q3WA 4C34A 4FTOA 4BDGA 3TWJA 4NIFB 4B4LA 3IGGA 1FQ1B 3NW7A 3ZO2A 4CLJA 2J0JA 2FGIA 3R21A 5HCZA 1UA2A 4HVIA 4PMPA 4O27B 2XM9A 2RFEA 3VUGA 2UZBA 5AUXA 5CU3A 5HVYA 3TV6A 5L8KA 2XJ0A 3LJ0A 4XV1A 3LM0A 4RWKA 2RSVA 3QCSA 4YLLA 3SXRA 4TYHA 2OFUA 2R5TA 3TZMA 3QRJA 3FKLA 3LJ1A 1V0OA 3K5VA 2A0CX 4LOPA 5M55A 4IZAA 3MH1A 4PF4A 4G6OA 4XX9A 4D4YA 3N4UA 3NYNA 2GS7A 3E8NA 3BEAA 3SX9A 4IZ7A 3W8LA 4CYJA 5DE2A 4KIKA 2YISA 1JLUE 3OW4A 4L44A 2VWYA 3LLTA 3S00A 2EXEA 4FTNA 2YCSA 2VX3A 3TI1A 4X3FB 5TR6A 4BDIA 3FSKA 5FP5A 4FZFB 3PYYA 4QMPA 4GG7A 4K18A 2FUMA 3V5WA 4DH1A 4QMNA 5M4IA 2JAVA 4UX9A 4MF0A 4BVUA 3KMWA 4JQ7A 4ALVA 4EH2A 4EORA 3GGFA 4FSWA 3BU5A 3EL8A 4MXXA 4QMWA 5FRIA 4BCPA 2IZUA 1J1BA 5AUYA 3ETAA 1F0QA 1JKLA 3FMDA 4FUXA 4DBNA 2A1AB 3SKCA 5JRSA 3DTWA 3IECA 4MYGA 3A7JA 3EFWA 5EQYA 2VO3A 5EDQA 2YEXA 4U8ZA 1QCFA 4O7NA 3CEKA 2ERKA 1FMKA 5AJQA 3UP7A 2W9FB 4QNAA 4AS0A 2HK5A 5KZ0A 3I6WA 4TL0A 1OKZA 3ZH8A 4UMPA 3WOWA 3TT0A 3QTSA 1WBWA 2OIDA 2WTVA 5E9EA 2YCFA 4ENXA 3R7GA 5L2TA 3LCOA 5JEBA 5L6WL 3TTIA 4BFMA 2ESMA 4ORKA 1OI9A 1QPCA 3P7CA 4JJRA 3LXPA 2A19B 2X4ZA 4QOXA 4ZY4A 3GU7A 5IQCA 1Y8YA 4EBWA 3CTQA 4YSJA 2BKZA 2GU8A 3DGKA 2V7OA 1JBPE 2V22A 4K9YA 4F70A 4OTGA 3H10A 4O7VA 4QRCA 3UZTA 1LUFA 2WMBA 3RHXA 2WMRA 4YHTA 1UU8A 2XVDA 3GFWA 3UMXA 4DAWA 4GCJA 4O2PA 2CKEA 4NW6A 5J5TA 2R3FA 3HP5A 5JQ8A 4RQVA 3ROCA 5ETAA 5GNKA 2XCKA 1OBDA 3TKUA 4GK4A 1XBCA 4XV2A 5FP6A 1ZYCA 5D11A 1PXLA 2XZSA 4FI1A 4W4YA 5TOZA 4D2VA 4F65A 4DCEA 5F9EA 4TYEA 3PXRA 3SRVB 2R3KA 3R00A 4AN9A 3BLRA 3DNDA 3IG7A 2IWIA 5IQHA 3ULZA 2HXQA 3TNPC 3R7VA 4ITHA 3HUCA 3BLHA 3P5KA 4O22A 3HAMA 3DLSA 3U9NA 3PFQA 3UYTA 3U6JA 2G2IA 2DUVA 3UPZA 2W05A 4CSVA 1XKKA 2UW7A 3V8SA 4PPBA 2ETMA 1PMUA 4A9SA 1JNKA 4CZYB 4MXOA 4NUSA 5IMEA 3QRKA 3OXZA 5CEIA 5LMBA 4DH5A 3MYGA 1WVYA 4FTRA 4PDSA 1JKSA 5D41A 2W1CA 2CJMA 3QA8A 4AN2A 2OXDA 3FQHA 2F2UA 3FYJX 2XK8A 4CNHA 2JDTA 5GHVA 4CFVA 5K5NA 4N57A 1ZYLA 4RWIA 5KBRA 3MY0A 1H1QA 3HRCA 3ORPA 2XS0A 5A14A 2WMUA 1W98A 2XIYA 3PUPA 1ZZLA 2FB8A 4C2VA 2OXYA 4RX7A 3KN6A 5KMNA 4RIOA 3DKOA 2VZ6A 2RIOA 4FTCA 4KABA 5KKRC 4FK3A 2CNVA 5BYZA 3Q9WA 3S4QA 4NL0A 1DI9A 1EH4A 1JSVA 1KE5A 2JKOA 2O65A 4JRVA 4RFMA 3F6XA 3JVSA 3VHKA 4GU9A 4LOQA 3ZFXA 3VN9A 4AE6A 3TIYA 3PE2A 1YXTA 3ORXA 3TKHA 3PJ3A 5CU2A 3KRRA 3OCGA 2C3KA 3RNYA 4LGHA 5HIEA 3MH0A 5C8MA 4AUAA 3UQGA 4BI2A 1CMKE 1ZAOA 3RZFA 4DTKA 1Y57A 3BX5A 3PG3A 3UDBA 1LEZA 3IDCA 4HVSA 3I79A 1H1PA 2QG5A 4XP3A 4A07A 2OF4A 2A2AA 3FPQA 4E6QA 3R83A 4RPVA 3CTHA 5AX9A 4RJ4A 5IEVA 5ANEA 4DFNA 2QOHA 3KREA 2QCSA 4JBQA 5CZIA 4EZ5A 1ZLTA 5C26A 3PJ8A 3R01A 4ZJVA 5FTQA 4DG2E 1GZOA 2XP2A 4FUYA 3VBVA 2UW9A 4Z55A 4NM5A 5I4NA 5JN2A 3S95A 5CT0A 4UZHA 1NY3A 2J0IA 3F7ZA 4AZVA 4DEHA 3CPCA 3EJ1A 3UIUA 5HU3A 2O0UA 3ZSHA 5I0BA 4APCA 4TWNA 2H34A 4BGGA 2UW5A 4F7LA 3OT3A 3DZOA 1YDRE 3MVHA 1OZ1A 3EZRA 4IVDA 1GNGA 2C3LA 1H00A 3IW8A 4FIEA 5HNBA 3C1XA 4QT1A 1YOMA 1FMOE 2PVLA 2OJIA 2BDFA 3BE9A 4UBAA 4TPTA 4XG7A 3GCSA 5EW9A 4ZTRA 5I9ZA 3ZSIA 3R04A 4UWBA 4NJ3A 1J7LA 3BHYA 3LFNA 4L01A 4FV4A 4DEEA 2OI4X 4W4VA 4NIFA 4TWCA 3A60A 1BX6A 4IWDA 4LM5A 4BKJA 4RC3A 4UEUA 3MFTA 4YJVA 4NEUA 3VS2A 4ASEA 5HTCA 2VO6A 1ZOHA 4FKQA 4DHFA 1NVSA 4EUUA 2X2LA 3QQGA 1G5SA 3R9DA 4G3DA 4USEA 4IX6A 2PTKA 4JIKA 4YPDA 3H0YA 5AMNA 4U44A 1OIYA 1UNLA 3R8MA 3TV7A 2IPXA 4YTIA 5FXQA 4IM2A 4A9TA 3ZXTA 2X2KA 2XIZA 2PVKA 3EN7A 2GNLA 4M69A 4BGQA 1W7HA 5AUVA 5CI6A 3GBZA 3LAUA 3AXWA 4ID7A 3MPMA 3TNHA 5C9CA 4ANMA 3BYMA 5HLWA 4I4EA 2RKUA 3FWQA 2XJ2A 3RK7A 4I6QA 4R5YA 5EI2A 4F9BA 5EKNA 3GT8A 3OOGA 4FODA 3R9NA 4Y85A 4FKTA 1YKRA 3FMEA 2XRWA 2HZIA 4GVAA 1UVRA 2CSNA 3VUMA 3UNZA 3GU8A 4NJDA 4H05A 3G5DA 3QL8A 4PP9A 3S0OA 3R7OA 4AX8A 5K5XA 3UVRA 3NVMB 2PVHA 5CQWA 1MUOA 1SM2A 4E1ZA 5I3RA 2GHLA 3BU3A 3ET7A 5CLPA 3V5TA 4RLKA 4G31A 3G90X 3UQCA 2YM8A 1CKPA 1UWHA 3QKLA 4QP1A 4IZYA 4ZK5A 4FZAB 4FVPA 2E9UA 4U80A 4AU8A 5JQ5A 3MIYA 3RPYA 5CSVA 1RJBA 2YIYA 1XBBA 5KMMA 4I5CA 3G15A 1ATPE 3FZPA 4CGAA 4W8EA 3CQWA 2BRHA 4S33A 5ICPA 4D2TA 4YO6A 5FBNC 4CV9A 3HEGA 2CCIA 3ZOSA 5E8YA 2G15A 3I7BA 4JR3A 3FXXA 2WAJA 5TT7A 3UO6A 4D55A 1YWNA 3VQHA 3MESA 2PE1A 5JGDA 3LPBA 1M7NA 4MNFA 5E90A 4QQCA 4UZDA 4C8BA 4YTFA 1IASA 2W7XA 5BUEA 3OT8A 1STCE 2ZV2A 3GFEA 4IWPA 1JAMA 4L7SA 5EHYA 4OTHA 3FQSA 5EM5A 4QP7A 3DKCA 3UOJA 5HO6A 5CEQA 4FTQA 2C6KA 4XV3A 4AN3A 5L4QA 2UZNA 3MH3A 3NLBA 4ZIMA 2RFSA 1YXVA 4KIPA 2C68A 3BKBA 3W18A 3O2MA 3PVWA 3GC7A 5CQUA 5KMIA 5AUTA 1FOTA 4FGBA 1R39A 3QA0A 2QG7A 3SAYA 3LMIA 3AG9A 2BPMA 3SRVA 3FHIA 4AXAA 3PIXA 2OIBA 2JITA 3VBQA 2W1DA 4FV9A 4O0XA 5CYIA 4TW9A 4UWCA 4BI1A 2ITWA 2PL0A 4YC8A 3MFRA 5KX8A 1B6CB 4PX6A 2CNUA 3BLQA 2WTIA 1DAWA 2BAKA 1NA7A 2H8HA 3QX2A 2XB7A 4KBCA 3IW7A 5CTPA 4BDAA 4RX9A 2FH9A 2FYSA 4MNEB 3GC0A 4QMLA 5CVFA 2XNEA 5HLPA 4X3JA 1UU9A 2BROA 2X7FA
chains in the Genus database with same CATH superfamily
4OTQA 2C6LA 2GTMA 3MA3A 3E8DA 3K3JA 2IO6A 1GOLA 4LGGA 4X7QA 4XMOA 3VS7A 4AZEA 4HYIA 2W1ZA 3P1AA 3FL5A 4ITIA 4O91A 4D58A 3Q4TA 4ANLA 4FGRA 4JDHA 4CT2A 3A7FA 5BVWA 3NNUA 4O86A 2BDJA 1BLXA 4AF3A 4ZAUA 4KS7A 3NAXA 3FV8A 3PLSA 2ETKA 5L2QA 4JBVA 2NP8A 3GVUA 3H9RA 1XR1A 3P08A 5DH3A 1H8FA 5FEQA 2PYWA 1YHVA 2XK9A 4C4GA 2R3IA 1FBNA 2UV2A 4FKJA 4G6LA 2UZWE 2KTYA 2ITPA 5DMZA 3BE2A 4YJOA 4CVAA 2V62A 5DA3A 3RAHA 1XBAA 2XEZA 2VTNA 4BGHA 4ZSAA 5DFPA 4YU2A 4W4WA 4AOJA 3P7BA 3DAJA 4UB7A 2PSQA 3QZHA 4Q9ZA 4BI0A 3GC9A 2ZB0A 2GPHA 5HTBA 4BN1A 2ZDTA 3QQHA 3O96A 1J91A 4LOOA 3KXGA 3COKA 5I9YA 2OZOA 3NIEA 5HBJA 4FIFA 2WPAA 3A7IA 3E7OA 3LQ5A 3DK7A 4EH9A 1OKVA 2Y8OA 5AR2A 2Z2WA 4QMMA 4QYYA 4BR3A 4BZOA 4X6RA 2P33A 3V6SA 1GZ8A 1ST0A 3AT4A 2PWLA 2QODA 2X81A 5J9ZA 3KRLA 3KMUA 3NGAA 4V01A 5A3XA 4CRSA 3NCZA 4MXAA 2R9SA 3FMKA 5HX8A 2V7AA 5IDPA 1V1KA 5F95A 2OG8A 1ZMVA 2BRGA 2OFVA 2ONLC 2FSOX 3KXNA 3D2KA 1FPUA 4IX4A 4QTAA 3OXTA 3BWFA 3HL7A 4M68A 5CWZA 3W1FA 3TMOA 1P5EA 1APME 4EHZA 1OBGA 3BRBA 3R7UA 2WOTA 3FI8A 3UJGA 3EIDA 2PMIA 4PMMA 1WVWA 4GVJA 2BIKB 1MRUA 3AGLA 4O4DA 2OJFE 2YAAA 2YDJA 2R3JA 3MY1A 4YJUA 3AQVA 5EYMA 1F5QA 5CX9A 3ORZA 3C13A 5M09A 3QRTA 4FKSA 4K11A 4OW8A 1TFFA 4J8MA 4RG0A 1OIRA 3TTJA 3LZBA 3KRXA 4EH8A 3ENHA 4DT9A 4I5MA 1OL7A 4XRJA 2VTHA 5J79A 4YJSA 2BFXA 4FT9A 4D2SA 1ZOGA 1PMEA 4N0SA 3KXZA 5CEMA 3Q52A 1FVVA 3IW6A 3NUXA 4F9WA 4KS8A 3QALE 1V0PA 1H1WA 3LIJA 4ANOA 3R9HA 2WMQA 5G1XA 1QMZA 2QNJA 1OPJA 4YC3A 4AXEA 3R1NA 3OCTA 5FUTA 4F0IA 3DBDA 3EN4A 4MTAA 1U4DA 4UMRA 3F2RA 1PYEA 3NYVA 3WIGA 4OBOA 4FICA 4OTPA 2NO3A 3FY0A 3HUBA 4C57A 5FWKK 5C1QB 5GZ8A 4FTTA 5J9LA 3DTCA 3QTRA 2JFLA 3EN9A 3ZUTA 2C6TA 4FT0A 4J8NA 3O8UA 4X2GA 4YJTA 4DTAA 3VF9A 3OTUA 2EVAA 4CTBA 3GI3A 2QU5A 4ZTMA 5IEYA 3R8ZA 3FY2A 4I6HA 4JX3A 3AC2A 4AA5A 5DOSA 1AQ1A 4RGJA 3JVRA 2Q0NA 1XHAA 2EWAA 3NDMA 3NW5A 3GEQA 2F2CB 2XKCA 4MBJA 3KGAA 4XG6A 4GU6A 4RMZA 2PY3A 1WBNA 3U9CA 2OH4A 2I0YA 4S2ZA 5AA8A 4CXAA 4F0FA 5AIRA 2ZV8A 4U5JA 3BQRA 5ACBC 4JS8A 2QURA 3Q9XA 4JG7A 4A9RA 4M7IA 4BZNA 4HVHA 2PUNA 3HX4A 3LFAA 2C5OA 5BNJA 3P7AA 3C0IA 3TNWA 4DEAA 4C02A 4CFXA 3BYUA 4Y83A 1OGYA 4I0SA 4HJOA 4CKRA 3UBDA 2GQSA 3WZJA 3ROYA 1CSNA 1OPLA 2Q83A 4KNBA 3EN6A 3OMVA 3D0EA 3BIZA 3NUPA 4P2KA 4NFNA 5FLFA 3QQLA 4L42A 4MD9E 3OG7A 3RPOA 4BCOA 3QUEA 4EOMA 3W0OA 2IVSA 3DXPA 2Z7SA 4NK9A 3IW5A 4DFZE 1IA8A 4HYUA 1QPJA 4ANSA 3AMBA 3UG1A 4BCHA 2HW6A 3NNXA 2YAKA 3BZ3A 4ZXTA 3O23A 3QD0A 5AM7A 4AZSA 1CKIA 3DJ5A 4IAIA 5AP6A 3NRMA 2VTQA 2BMCA 4YZNA 4C3RA 4FSRA 1FVRA 4JNWA 1UV5A 3VW6A 5DR2A 2O5KA 4F9YA 3P79A 2H96A 4Y46A 3TZ8A 4EK6A 4YJRA 3D94A 4QP9A 4EQCA 4BCIA 3R28A 4KUJA 4A4LA 1XH9A 2Y4IC 1WBTA 3D15A 2OH0E 2F7EE 5H9BA 4XG4A 3SDJA 4RVTA 1BKXA 5B2KA 1Q8YA 4TKSA 2CKOA 4MNEA 3PTGA 3EQIA 1R0PA 4I6FA 4RJ6A 5EYKA 3WE8A 2PU8A 2HIWA 1OIUA 3VUHA 3LXNA 4IADA 4NCTA 3OFMA 2QOOA 3V3VA 4ERWA 3NWWA 1P4OA 3BI6A 4EH6A 4YR8A 4FT7A 3UE4A 2GCDA 3NVKI 1JQHA 3LXKA 4NH1A 2AC3A 5TE0A 1VR2A 2HELA 4C61A 5IH4A 3PP0A 2RFDA 3PFYA 4BWKA 3FLZA 3EFKA 3FZTA 3EQHA 3EMGA 3R22A 4RFZA 3UQFA 2E9OA 5KHWA 2X8EA 3QUDA 5EK7A 4D5HA 4QDVA 4L3LA 3MVLA 3P78A 3PG1A 5HE3A 5LJJA 3QBNA 4OLIA 4NT4A 5AV0A 3FXZA 1YQJA 2Y0AA 2VTTA 4LRMA 4BYIA 2VWBA 2GS6A 3B8QA 1RW8A 3P9JA 4FEQA 3TKIA 4AOTA 3VUDA 4AFEA 1K9AA 4R8QA 3DZQA 3TNQB 5M4FA 4BWXA 5M08A 3MPAA 3LHJA 3DK3A 4RIXB 5IEXA 4NWMA 4U3YA 2QKWB 2WU7A 4JT3A 2GSFA 2XJ1A 4RWLA 3R2YA 4LRJA 4PL3A 3KQ7A 5HVJA 3VS0A 4R3CA 4EK4A 5AV1A 4YO4A 4HOKA 4LYNA 4MBLA 4PNIA 5E1EA 4CZTA 3N51A 4Z3VA 5LVOA 2YWVA 1YXUA 2GFSA 3POOA 4HGEA 4O6LA 3ZHPC 2RG6A 2BZKB 2PZPA 3PA5A 5D7VA 5IA3A 4IM3A 3TACA 4IXPA 3ZO3A 4O7TA 1ZARA 4FV5A 4I24A 4LV5A 3S1HA 1O6LA 4L8MA 2QU6A 3MDYA 3SOCA 4NM3A 5IQBA 4EC9A 3PY0A 4MWHA 5K3YA 4IB0A 4N6ZA 1PKGA 3IONA 5DLSA 4C4EA 5IQAA 4ACDA 5EQEA 4LL0A 2VNYA 4RJ3A 5GZ9A 4FG7A 5J1WA 4U45A 4QP2A 4FRFA 3PPJA 1B39A 3OWJA 4JG6A 4O6EA 3RAWA 3Q5IA 4YNOA 1NW1A 3D5XA 4XBRA 4KIOA 3CS9A 3Q53A 5EG3A 4KB8A 2ITVA 2OO8X 3C4EA 4L3PA 4QYEA 3VJNA 4DFYA 2X1NA 3PA3A 2GDOA 4EYMA 2VTRA 4Q9SA 3UOLA 4O21A 3C4FA 3MTLA 4GFMA 4ACHA 5HE1A 1A9UA 4CFUA 4QMOA 5K4IA 2XANA 3SG9A 3LMHA 5KUPA 3QWJA 4GG5A 2YIWA 3MV5A 5BUIA 3A8XA 3TM0A 1KOAA 5IISA 4RIYB 4NFMA 5IUIA 4WNOA 4O0TA 1M17A 4WHZA 2CKQA 4L43A 4PUZA 5D12A 1HOWA 5LVNA 4ZLOA 3FMJA 5CXHA 2XCHA 2XM8A 4RIWB 1KE9A 4L52A 3FC1X 3RM6A 4D2RA 3HRFA 2WQBA 3LCDA 2X0OA 1IAJA 4WRSA 5CU4A 5CAUA 2H9VA 5CAOA 3AD5A 3H0ZA 3OWLA 4BDFA 4S30A 3FQEA 3REPA 3ZO4A 1JSUA 4BBFA 2C0OA 2XEYA 4FL2A 3PY3A 4JAIA 4C4HA 4FIGA 4F6SA 4FKVA 1XO2B 2PE0A 3LQ3A 4JX7A 3EQGA 1J7IA 2W5BA 2QLQA 4FTKA 4JIAA 2A27A 3I7CA 3BHHA 3RK9A 4FG8A 3VS6A 1L8TA 2XALA 5EHLA 3PJ1A 4G17A 5IA2A 5IH6A 2Z8CA 2QQ7A 3GCQA 3HMOA 3BGPA 2PVNA 2YM7A 3B2TA 4UALA 3QU0A 3PP1A 4XEYA 2UZEA 3LVPA 5IUGA 3QTUA 4MXZA 2J9MA 5ETIA 3DAKA 3OTVA 3UIXA 4JXFA 5J5SA 3RALA 4DYMA 3EQCA 3OROA 5EM8A 5F94A 5A4EA 5M51A 3UVPA 3NR9A 2B53A 3PY1A 4GUEA 2J90A 3FLWA 3IOKA 4G3GA 4YPSA 1KWPA 2EB2A 4G3CA 3RWPA 5FBOA 3OW3A 4Z16A 2OJJA 3PXYA 4QMSA 1TKIA 3PXKA 4O1PA 3PPZA 4IWQA 3FI2A 4X21A 4I1ZA 5H8GA 4AGCA 4ZTHA 3Q4ZA 3QLFA 4AGWA 4HPUE 3F3WA 4RVLA 4JOAA 5ANOA 2OU7A 3W2PA 1E1VA 2UW8A 2F49A 4MBIA 5CVHA 4IAYA 4IJ9A 4AOIA 3WF7A 3ZMMA 3NUSA 2BHHA 3FLSA 2WU6A 4CG8A 2GNHA 4FZDB 4L00A 4IB3A 4AA4A 4LV8A 1KV2A 2A98A 2XKEA 5CI7A 5KZIA 4JAJA 2WD1A 1WAKA 5B2LA 1V0BA 4DC2A 4MCVA 4E4NA 5HG5A 5CS6A 4O7YA 4I92A 4LQMA 2CMWA 2GHMA 3PWYA 3R2BA 4ZTLA 3CJGA 2ZMDA 5AX3A 4BCJA 4UV0A 4ACCA 3H9OA 4S34A 2R0UA 3KIOC 1U59A 2IW9A 2YN8A 3UP2A 3FI4A 4JVGA 2C6IA 4EEVA 4IVBA 1S9IA 5HTIA 2W1EA 4DGGA 4GFOA 5TO8A 1H28A 5T3QA 2C3IB 3ZUUA 1PMNA 2WNTA 2YLFA 5JT2A 4EOKA 3D4QA 1K2PA 4E4XA 3KY2A 5AUZA 5HG7A 3BPRA 3N4VA 2JKQA 5A54A 5CU6A 3SXFA 4FNWA 3OXIA 4DT8A 4FSTA 2B54A 1VZOA 4FT5A 3ZFMA 1WBPA 2UVZA 2V5QA 1DM2A 4LI5A 3MY5A 3HNGA 4WO5A 5AAEA 4ZSJA 3VS4A 5DG5A 3W0NA 2ZVAA 2LAVA 3QKKA 3FC2A 4BJJA 4MHAA 3MJ1A 1UKIA 1QPEA 3SC1A 4LUEA 3CKWA 4HYHA 2X7OA 4U0IA 5EHOA 3UG2A 3C0GA 3QC9A 2WEVA 5K4JA 4EWQA 2QHNA 3FZRA 3Q96A 2YDKA 3KF7A 3IS5A 2WZJA 4BTMA 3SW7A 1YDTE 4CMUA 1XMMA 4IMYA 3UNJA 3SA0A 4F7JA 2CKPA 5D7AA 4Z7HA 1PJKA 3TUDA 3VIDA 4FVRA 3LFEA 4B6LA 3HV4A 4IWOA 5I9VA 2C6MA 3G0FA 3ZZWA 2G2HA 2VGOA 5BYYA 4O7WA 2W4OA 2WGJA 2Y7JA 3LLAA 1Q8ZA 2C47A 2YLEA 2EU9A 4H39A 2BRMA 2P4IA 4I3ZA 4WSYA 4EH3A 4F4PA 4YMJA 5L3AA 3OUNB 3PXZA 4F1TA 3AT2A 4CFWA 4R1VA 2XARA 1MQ4A 3CTJA 2BRBA 2R3NA 4DITA 4EL9A 3QQJA 3QTXA 3UZRA 3PLAE 3ITZA 4I0TA 2YZLA 3AD6A 4AT3A 3KXHA 1WMKA 3COMA 4NZWB 5K0XA 4RLLA 1SNXA 3R30A 4NM0A 1CTPE 3FLYA 4XLVA 2HOGA 2W17A 2XK3A 1BUHA 5AM6A 4YP8A 1J1CA 2F7XE 3EYHA 3W2QA 1ZWSA 4C37A 4OAUC 4H3PA 3BYOA 1SVEA 3HV6A 2NNWB 4TY1A 5DN3A 4R7HA 1GZNA 1XWSA 2BAQA 4QMXA 3RHKA 5GZAA 3A8WA 1NT2A 4RIXA 3MVMA 4CFFA 5J87A 3FZ1A 4RX5A 5J7HA 4MXYA 3GENA 4DGLC 5FTGA 1UU7A 2B9FA 1PXNA 1XMLA 2BZHB 3DKGA 5D1JA 2YZAA 2QI8A 2WTKB 3FAAA 3ZS5A 4EUTA 4KD1A 5M4CA 1T45A 4OT6A 5ANGA 4ZLZA 1Q8WA 4G9RA 3TUCA 2GNGA 3VVHA 4QMTA 3I4BA 4BICA 4HCUA 4ASZA 2BZIB 4K2RA 2X8DA 3UPXA 4QYGA 3ZCLA 3HLLA 4EOQA 4CV8A 4I0RA 1ZYSA 1GJOA 2X2MA 4R7BA 2BVAA 4C3PA 3D7TB 2PVJA 3K2LA 3PIYA 4PY1A 4Q5EA 3ORMA 4G3FA 2PULA 3E3PA 3RCDA 4ANNA 4NSTA 3TDWA 3MSSA 3RPVA 5CXZA 4A4OA 4C59A 1OITA 2X7GA 3QGWA 4JL9A 2VV9A 4O0RA 1U5RA 3C51A 3QTZA 4F1MA 3TN8A 3VO3A 5A6NA 4RC2A 4MEDA 3SD0A 4AZTA 4FTUA 3R8PA 3WARA 5AV4A 2VUWA 1Y6BA 4LG4A 4M84A 4F7SA 4EONA 1WCCA 4ERKA 1WBSA 1KV1A 2BAJA 2WMSA 3V04A 2R2PA 4PPAA 3ERKA 2E2BA 4QP6A 3D2IA 4GRBA 3R73A 1P2AA 2ZM1A 4MD7E 3K5UA 4RIYA 3VHEA 1OL5A 3KC3A 5CF6A 2QC6A 1U5QA 3OY3A 4IE9A 4QP8A 4K77A 4HVGA 5T6KA 5IQGA 3ZM9A 4KBKA 4RIWA 1XQZA 4U43A 5CU0A 3O50A 3MA6A 2B9JA 4X0MA 4LUDA 1REJA 2I0EA 2ZM4A 5FG8A 3VBWA 4AW0A 3CPBA 4GJ3A 2ZAZA 5F4NA 2YIRA 4ONAA 1PF8A 4X3FA 3MPTA 2CHLA 4BRXA 4RJ7A 2QOLA 3HDNA 3UO4A 4HNIA 4A06A 4BIEA 4ITJA 1UWJA 1B38A 3E88A 4C4JA 1IR3A 4UN0C 1DAYA 4EKKA 5FM2A 3M11A 4FZ6A 5TKDA 5L6OA 5LQFA 3MTFA 4HCTA 4W8DA 1TZDA 2C69A 4WNPA 4BDEA 3F3ZA 4KBAA 2CNQA 4FEWA 3F66A 2OWBA 4OTFA 2XK4A 3CBLA 2VWUA 4BDCA 4A9YA 3NMUF 4R1YA 4BCFA 4FYOA 3KCFA 4KIQA 1YI3A 1JKKA 3QRUA 5DI1A 1YOLA 3FMNA 3QXOA 4IIRA 4X2KA 3F88A 5KBQA 4K1BA 5BUJA 4YJPA 1PXOA 4ZSGA 3QRIA 3PDTA 3MH2A 1YI6A 1ZZ2A 2QOBA 3G0EA 3QWKA 3RTPA 4QPAA 4S32A 2XNBA 4CFMA 5ITAA 5J7BA 4LDTA 2REIA 5FEEA 1KE7A 2R3MA 3QF9A 4IX3A 1ZY5A 3GUBA 4I4FA 4TNBA 1YI4A 1YRPA 5C4KA 5F1ZA 3PXQA 5M53A 4K33A 2JD5A 5BX0A 3P5JC 3KVWA 4BKYA 3BELA 4I5HA 3D14A 1G8JA 1W83A 3L8XA 5BVOA 5IA5A 4FSMA 5AV3A 3AD4A 3KXMA 5KMJA 3L9PA 4GH2A 5JZJA 2UZTA 1SVGA 4DGMA 4FC0A 3EL7A 4ZZOA 3PJ2A 4L46A 3ZSGA 4DLJA 3FPMA 5A4CA 2PPQA 4EJ7A 5GIOE 3C4CA 2WEIA 4ZJIA 2IZSA 3UGCA 3UIMA 3W8QA 3NYXA 3RPRA 1TQIA 1FGKA 3LKMA 2J6MA 3W55A 1R78A 3FKOA 4DEIA 4L3JA 3V5PA 2ITTA 4XS2A 4FTMA 4F0GA 4TZRA 5HORA 2CCHA 3RAIA 1R3CA 4FKUA 2VX0A 4DH8A 1PY5A 3E5AA 4I20A 4YJQA 5AP7A 4KKGA 4ASXA 2RL5A 3HP2A 3I5NA 5HVKA 4DH7A 3LCKA 4FOBA 4USDA 5E92A 3BQCA 2C30A 4AT5A 1TQMA 2JIVA 4PDPA 4AWIA 4F9CA 3ATSA 3T3UA 4QTEA 4U79A 4OTWA 5CAPA 3FLQA 4Y5HA 5JK3A 4Y73A 3QD2B 2EUFB 4FIJA 3RGFA 3VF8A 3Q4CA 3LCSA 3V5LA 3MB7A 3KULB 4AGUA 4Z7GA 2VWVA 4O4BB 5BVDA 3U4WA 3ZC6A 2HWOA 4BCMA 4JG8A 1OMWA 5B0XA 3ACJA 4YHJA 4IFGA 3LM5A 4UWYA 4ACMA 3NS9A 2R3HA 4GIHA 4X3FC 2V0DA 3AMAA 1OL6A 2C5XA 5DR6A 4AAYA 4ZY6A 2UW4A 3AC5A 3OP5A 4IEBA 5CT7A 5HGIA 1R0EA 4TRLA 5AR8A 5HD4A 2PVFA 4TWPA 3EH9A 4MVFA 4H3BA 3JY9A 1U46A 4XG8A 4XP0A 4DFXE 4FT3A 3ZBFA 4O7ZA 2YJRA 5HG8A 3DXQA 3H9FA 2ZDUA 1OIQA 4LRKA 3A61A 2W1FA 3EKNA 4I5PA 2VTLA 3BLAA 1OVEA 4AW1A 1CKJA 3OY1A 1BL6A 4U41A 3FL4A 5H8EA 3LQ8A 4PRJA 5I9WA 3UMWA 5JH6A 1W0XC 2J5FA 4J96A 3VW8A 3W0PA 3OEFX 1YWVA 5HESA 5EW8A 2XNNA 4M67A 1YVJA 1MRVA 3Q4UA 1Y6AA 4ACGA 3QCXA 2QOQA 2OK1A 1PXJA 1DS5A 3A62A 3MJ2A 3DFAA 3P86A 4OTIA 4XRLA 3D7ZA 3ZRLA 4USFA 2VWIA 4P4CA 1GZKA 1H26A 1H4LA 5IG1A 3T9TA 2XIKA 3C4WA 3CJFA 2PZIA 3F7WA 5M57A 3ALNA 2I0VA 2KULA 2PUUA 3C50A 3FE3A 3FKNA 3NPCA 3POZA 4WG4A 4FIIA 4YHFA 3C5UA 5IA1A 3O8TA 4DH3A 3F69A 3ORKA 4KSPA 4DGNA 5DT0A 5AADA 5FEDA 1WVXA 3R9OA 4EOIA 3OOMA 2UZVA 4D9UA 3VNTA 2C0TA 4GT5A 3WF6A 3L9MA 3P23A 1BMKA 1M52A 2UZDA 1W82A 2WTJA 4HGSA 4IC7A 4BB4A 2WIHA 4MX9A 5C01A 5EI8A 1ZXEA 2X6EA 3QTWA 4M13A 5ANDA 2G1TA 2J0LA 4Z9LA 4FV2A 5EM7A 4U3ZA 2XUUA 3G51A 4W9XA 3TNIA 3TYKA 5EYCA 2VWZA 4ZJJA 3VS5A 3U6IA 2NPQA 2EB3A 3IOPA 5LVPA 4QO9A 2IZTA 2YM3A 3EYGA 1ZMWA 4N4SA 4EC8A 5J1VA 2IJMA 2Y4PA 3F3VA 3ORNA 3II5A 5E1SA 4R77A 3ZLYA 3FHRA 1P14A 4IB5A 3W0MA 2GTNA 1BL7A 2R4BA 2QR7A 5CF8A 4DFBA 2O2UA 3NSZA 5I5ZA 5JFVA 2QOIA 4B8MA 1H1RA 5H2UA 1Y8GA 1YXXA 2CGUA 4YBKA 4JBPA 3IW4A 3RINA 4YZ9A 3DQXA 3V5JA 3SGCA 4EQMA 4N6YA 2W4JA 3OF0A 3AKJA 5JRQA 4FEVA 3DA6A 3NNWA 2ZV9A 3Q2JA 1UNGA 1YWRA 3UODA 4OTDA 2OGVA 4BHNA 5LCJA 5IQIA 1OM1A 1YW2A 5KKRB 1XJDA 3GNIB 4M0YA 2PMNX 4GSBA 3DS6A 5EI6A 4YLJA 5CVGA 4IB1A 1ERKA 2O64A 4DN5A 4FKPA 3L1SA 1GAGA 4RVKA 2J5EA 3A7GA 1PHKA 3G6HA 4U40A 5EYDA 5IA0A 3ZDIA 2HXLA 1ZOEA 2FA2A 3KK9A 3AC3A 3OCSA 5FXSA 3SQQA 4J99A 3Q5ZA 4GFGA 3TIZA 4AP7A 4B8LA 1LP4A 3GCUA 5HU9A 1CDKA 1OUYA 5AUWA 5GIPE 3R0TA 3EQPA 1E9HA 3G2FA 4FL1A 4I6LA 3GQIA 2ZOQA 1OUKA 2XYUA 2YCQA 3DY7A 4ZS4A 2X39A 5LMKA 5D10A 5HNGA 3KU2A 3UZPA 1KSWA 3PSBA 5EH0A 4EYJA 3OVVA 1G3NA 3T3VA 4AG8A 3IGOA 4E7WA 2HCKA 2UUEA 4M3QA 4Q5HA 2ZFYA 2QLUA 2X4FA 3IDPA 5CNNA 3E87A 5FDXA 3CXWA 3W2OA 5HLNA 5HNIX 1O6YA 1UU3A 3A2CA 1YOJA 2OZAB 3CY3A 3DOGA 5B2MA 3CQEA 2GS2A 2C1AA 1M2QA 2VTOA 3KMMA 5HG9A 3W2SA 3ZYAA 2HYYA 4ZP5A 3F61A 3UDZA 3VRYA 1E1XA 4I21A 3TUBA 4APPA 1KE8A 3TZ7A 3V8WA 5AP1A 3CGOA 4FKIA 4WIHA 2B7AA 1F3MC 5DVRA 4I94A 5C8NA 4IJPA 4HGTA 1QL6A 1Z5MA 5I9UA 4BC6A 4DDGA 3ZM4A 1OL1A 3L8PA 4O96A 4H3QA 5KE0A 3E93A 4D4SA 5JKGA 3RZBA 3KVXA 3KXXA 3A4PA 5DNRA 4CKJA 3ZC5A 5HI2A 3TCPA 2VTSA 4FG9A 4AE9A 4KWPA 3G9NA 4O84A 5CEOA 2WQNA 1RQQA 5AUUA 4DEBA 2X0QA 5AP5A 4XBUA 4BZDA 3F3TA 3QD4A 4XJ0A 3ULIA 4DFUA 3EN5A 4TN6A 4GK2A 3QYWA 4X2JA 3UNKA 1PKDA 4M8TA 2QOCA 3ZRKA 4R3RA 1JWHA 2WXVA 5AFVA 1ND4A 5FGKA 3Q6UA 3CQUA 3JS2A 2B52A 4I22A 1URCA 4YTCA 1I09A 5EOBA 5CALA 3QKMA 4WNKA 4CFNA 3ATTA 2ITZA 2GHGA 5A46A 1YXSA 4WSQA 2O8YA 1H27A 2QO2A 2RGPA 4FKRA 4IACA 3HMNA 2R3RA 5TF9A 4IX5A 1M2RA 3KULA 4MD8E 4ZLYA 4CG9A 3C0HA 3M2WA 5L2SA 2WTWA 4B99A 5GJFA 1MP8A 4XUFA 2X8IA 2HW7A 3OD6X 3E8EA 5IKWA 4F64A 4OBQA 3SOAA 4U7ZA 5BMMA 2Q0BA 4GT4A 3QTIA 4OGRA 4DLIA 4EOSA 1VYZA 3U6HA 4NM7A 2GNIA 5L8JA 3RWQA 2GQGA 2ITQA 4WNMA 2UW6A 4EHGA 2OF2A 5AAFA 3ANQA 1OECA 3Q60A 4EQUA 3B8RA 3QC4A 4BIDA 3RJCA 3R8LA 3AGMA 1Q61A 5A4LA 4QPSA 2A4LA 3HYHA 4E5WA 3P0MA 3U51A 3VAPA 4NW5A 3WZKA 4IVAA 4D4RA 2IN6A 4UMUA 4UY9A 4K8AA 2CN5A 1W84A 1FVTA 4FK6A 5AR3A 4YSMA 4PTCA 2WQMA 3PVGA 3D5WA 4ALWA 5BYLA 4IVCA 4ZMEA 3IO7A 4V0GB 4DTBA 4L9IA 4XOZA 4WKQA 5HQ0A 4J97A 5LMKC 1H01A 4JQ8A 5IQFA 4ANBA 3I1AA 2XAMA 2VO7A 2YM6A 4ZTNA 2XNPA 4JBOA 2EXCX 4CRLA 2Z02A 2JDVA 3QZIA 4NYEA 4S31A 4F6UA 2PZ5A 3L8SA 4FV7A 4BCNA 4GJ2A 2JFMA 2X9EA 4XOYA 2ITXA 3DCVA 4O0YA 1HCLA 4IDTA 3IDBA 2BIYA 2XH5A 4I93A 2X0PA 5DGZA 3OZ6A 5EM6A 5EOLA 2BFYA 3CIKA 5CNOA 1Z57A 3SV0A 3PRIA 4MQ2A 3JYAA 3UC3A 5CASA 4RX8A 3ZEPA 5E8ZA 1Q41A 2WMXA 3FSFA 4UXLA 3R1QA 5HIBA 4RWJA 2FVDA 5K0KA 4H58A 4D1SA 3QAME 2E9VA 3V51A 4YC6A 3TJDA 3F9NA 4FZ7A 4E4LA 4AT4A 4KINA 2FO0A 3FLNC 4YUQA 2P2HA 4M15A 4M97A 2HY81 4BHZA 5IZFA 2XAOA 1YHWA 3QHRA 2O3PA 4E26A 4R5SA 4P90A 3TEIA 2HENA 2RG5A 2OKRA 5KMOA 1KOBA 3QTQA 3ENMA 4RC4A 3TZ9A 5A4TA 2WELA 1XH5A 4PTEA 4RVMA 3AMYA 3FDNA 2W5HA 3F5GA 1URWA 4UMTA 2VWXA 4II5A 5JMSA 3L9NA 4J53A 3TJCA 1A48A 3ALOA 4KRCA 3KRWA 3ZLWA 3I60A 3IQ7A 2SRCA 3R7EA 2LGCA 4DFLA 4WBOA 5LOHA 5A6OA 2R3QA 3R7YA 4AA0A 4HYSA 1H24A 4YTHA 1UKHA 3AOXA 4BTJA 3GCPA 3QCYA 2C5VA 4FSNA 4OAVB 4PDYA 3TDVA 4TTHB 4U9AA 5ETCA 1W2CA 2WO6A 5HO8A 2W1IA 2YJSA 3EQBA 3WYYA 4M69B 4NCTC 4WOVA 5CSXA