1M2RA

Crystal structure of 5,8-di-amino-1,4-di-hydroxy-anthraquinone/ck2 kinase complex
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
327
structure length
327
Chain Sequence
SKARVYADVNVLRPKEYWDYEALTVQWGEQDDYEVVRKVGRGKYSEVFEGINVNNNEKCIIKILKPVKKKKIKREIKILQNLCGGPNIVKLLDIVRDQHSKTPSLIFEYVNNTDFKVLYPTLTDYDIRYYIYELLKALDYCHSQGIMHRDVKPHNVMIDHELRKLRLIDWGLAEFYHPGKEYNVRVASRYFKGPELLVDLQDYDYSLDMWSLGCMFAGMIFRKEPFFYGHDNHDQLVKIAKVLGTDGLNVYLNKYRIELDPQLEALVGRHSRKPWLKFMNADNQHLVSPEAIDFLDKLLRYDHQERLTALEAMTHPYFQQVRAAENS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CASEIN kinase II, alpha chain
publication title Inhibition of protein kinase CK2 by anthraquinone-related compounds. A structural insight
pubmed doi rcsb
source organism Zea mays
molecule tags Transferase
total genus 108
structure length 327
sequence length 327
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2002-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1m2rA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1m2rA01
3Q5ZA 4GVAA 3LQ8A 4O86A 5E8XA 2QU6A 4IHPA 2W7XA 3ORPA 5CEIA 5TKDA 1PXLA 3DXQA 2CCIA 2YABA 1SVHA 2BUJA 3F82A 3PXQA 2PUUA 2O63A 4LYNA 4Y95A 4D4VA 2IVTA 1OL7A 5F9EA 5HE1A 1YKRA 5M56A 3TV7A 3R83A 3EYHA 4N57A 1IG1A 4DINA 3W10A 4XHKB 4MQ1A 5I9WA 2X9FA 4OT6A 3TKUA 4IJ9A 5M06A 1OB3A 5I5ZA 3ORLA 3N51A 4YJQA 4FT9A 4U3YA 4U6RA 5JRSA 4KA3A 2BZHB 3KULB 2R9SA 4KS7A 2VUWA 4XUFA 4NWMA 5HD7A 2WZJA 4FYOA 3E93A 4ASEA 1P5EA 3RPVA 5CAQA 1H4LA 2AYPA 1WBOA 3U9CA 2GNJA 1GZNA 4DG0E 1KOBA 4C38A 2QOQA 5KBQA 4OAUC 4F6UA 3GENA 5CNNA 4MHAA 5LCKA 3EWHA 3E3PA 3W55A 5IA4A 4P2KA 3ZU7A 5IEYA 1AGWA 5KX8A 3KMMA 2NP8A 3KRXA 4RG0A 5FBNC 2VX3A 4EH7A 3G0FA 5JZJA 4BKYA 4CGAA 1NVSA 3PVGA 3R2YA 3CJGA 4C4IA 5FEEA 5I9VA 4BDJA 4GK2A 2OXDA 2BKKA 4R5YA 4JNWA 3MBLA 5K5NA 1ZXEA 3BYSA 4YP8A 3TJDA 4BZOA 4Q5HA 4OGRA 5CF6A 2XP2A 2VTQA 3EIDA 3OC1A 5E91A 4V04A 4NM0A 2BTRA 4BCHA 5L8JA 5TO8A 3CY3A 2R3IA 4CV8A 2XM9A 4DH7A 3MVLA 2ZB0A 1OL5A 1UNLA 2WOUA 4C61A 2VWXA 5JFSA 4RSSA 5DN3A 2HYYA 4TWOA 4WUAA 4YJTA 3SD0A 1V0BA 4DFYA 1XBCA 2VV9A 4U43A 4G3EA 4M67A 5CSHA 3MTFA 2O65A 3U55A 4V01A 5ANEA 1QPDA 2NO3A 3FHRA 4QTEA 2C6OA 4YJOA 4AOIA 4RQKA 3QTSA 1MRYA 2I1MA 1OIQA 3CEKA 4CFMA 1Q4LA 3PYYA 2R3PA 4U41A 1YOJA 5BUJA 5LVPA 4EUUA 1X8BA 5CEQA 3C0IA 5BVDA 5DT0A 4IWDA 4FVPA 5HO8A 1FGIA 3QCSA 2ZJWA 4L53A 4ZLYA 4F1OA 4FKSA 4E6DA 4FKRA 2HY81 3OW3A 2EU9A 4FKIA 3FMMA 5KMIA 1L8TA 3FC2A 4IWQA 4LGDA 1LUFA 2PMIA 4L42A 5HIBA 3NGAA 2OJJA 5EG3A 4TNBA 4DGNA 5HLNA 4OBPA 3QGYA 5FTOA 2VTTA 2XF0A 5BVEA 4II5A 4EHGA 4ALUA 4E5WA 2YERA 2UVYA 2W96B 1VYWA 3FQSA 4I5HA 2SRCA 2J0KA 2WMBA 3IOPA 3ORKA 3QUDA 2Y9QA 2BRBA 3OFMA 3LFQA 3W2PA 4EEVA 4BR3A 5H8GA 5AEPA 2R64A 1J7LA 4BGHA 4BDHA 2GHMA 3GCSA 4GKHA 3L8XA 3OT8A 2C47A 4XG6A 4QYEA 2VGPA 3HP2A 3ROCA 4UMUA 1FBNA 3L9MA 4H1MA 3MPTA 3HX4A 5A14A 2JBPA 4PMTA 4EOJA 4Z55A 2W5BA 5E8WA 4QTDA 4EOSA 1U5QA 1UV5A 3TUDA 1Z9XA 3C13A 4FEQA 4XBUA 5B0XA 3QZHA 1OKYA 3P5KA 3M42A 4EORA 2W9ZB 3WE8A 2CPKE 4FIHA 2F57A 4GK3A 3WZKA 4KRCA 4ZSLA 3DAEA 3K3JA 3W1FA 1R1WA 4BCMA 3RCJA 1VYZA 2ZOQA 4PL3A 2W1HA 4KKHA 3DAJA 5BYZA 4BDEA 3NWWA 3QTIA 3FMEA 3WYXA 4BIBA 3E63A 4QMOA 5CQWA 5EM8A 4JDHA 2EXCX 4HCTA 3FHIA 3NUUA 3RWPA 3VS1A 4YURA 4X3FA 3MB6A 4XLIA 3NZ0A 4HOKA 4WG5A 4MXCA 3DBDA 4DEBA 2QR8A 1JQHA 2ZV2A 2C3IB 4P5ZA 3OBGA 2PVLA 5IMXA 4F7LA 4C3RA 1Q3WA 1YI6A 2YEXA 3E88A 3FXWA 3SLSA 5A4EA 3OWLA 5DWRA 4APPA 4F9WA 2R3QA 1OUYA 2J4ZA 3RINA 4MNFA 2OFVA 1YXUA 3OXZA 5AV4A 1Y57A 3MFTA 4Y5HA 1OI9A 2YIWA 4HGLA 5IQGA 3DLSA 1R39A 5DE2A 3V8TA 4K77A 1JOWB 2R0IA 3AC5A 5CU2A 4F99A 5AX9A 4V0GB 2HK5A 3NCGA 3TXOA 4M97A 5DT4A 3PDTA 3CTJA 4EOLA 5I3RA 5IH6A 3TG1A 4IXPA 3PSBA 4MD8E 4AGDA 4F9YA 5JQ8A 4CFWA 3ZYAA 4H1JA 3RK5A 4G6LA 2QQ7A 4ZOGA 3OY1A 4FSMA 1NVRA 4PTGA 2A4LA 3KK8A 4XRLA 5LWNA 4G3DA 4CZUA 2ITWA 3FY2A 3LM0A 4V0GA 4BCJA 4GVJA 2DQ7X 4FICA 4IM3A 4OTFA 2QOCA 5DRBA 4FZ7A 5L2QA 1UU9A 1Y8YA 2WNTA 4S30A 2XK6A 2YDJA 2JEDA 4YO4A 5M53A 3LMIA 4D2WA 3QTQA 5L6OA 4L45A 3QRJA 1GIIA 1WBVA 2YIRA 4HJOA 5IQDA 1NXKA 2C6MA 3G9LX 1WVXA 3VS5A 1NW1A 2ZDTA 3NRMA 4J52A 3Q5IA 3DT1A 3C4CA 4LRJA 4QQJA 1OBDA 3FZ1A 4PDYA 2XH5A 3CQEA 1BL6A 2UZUE 4FR4A 4K11A 4KD1A 3UVQA 2IG7A 4I20A 2PL0A 2PULA 1FQ1B 1KSWA 2OJFE 1Q8YA 3C9WA 5AP5A 3RVGA 4RIXB 5HESA 3GCPA 4BCNA 4B6LA 4F1TA 2BPMA 5E8VA 5FP5A 2IW9A 5I0BA 2PSQA 2QOBA 4FSTA 3BGZA 4L3LA 4U45A 4YO6A 2OSCA 4RJ4A 4AZTA 4IWOA 2J0LA 3DGKA 4KAOA 5L8LA 3HMIA 4KIPA 2YIXA 4FT3A 3NR9A 3CGOA 4IQ6A 2XS0A 1XH9A 5AWMA 4FV2A 4M7IA 4J98A 5AIRA 2H96A 5A9UA 3MTLA 4F0GA 5EW8A 4OUCA 4F6WA 1MQBA 3JVRA 3Q6UA 3DJ6A 3QRTA 3TACA 2FO0A 4YLLA 4CRLA 5A46A 4YJUA 1MRVA 2F7ZE 4TY1A 1V0PA 2H34A 3MH3A 4FV3A 3PJ8A 1CDKA 3NCZA 3UOJA 4RMZA 4UXQA 4O7NA 4FL2A 2X39A 4XS2A 5AX3A 3T3VA 3FLQA 5F20A 2BILB 2CMWA 2ETKA 3KY2A 4L67A 5KMKA 3DAKA 3IDPA 5LVNA 2BIYA 2GNGA 4KINA 3OTVA 4D1SA 4EOKA 4MQ2A 4MF0A 4LV5A 1YHSA 5D12A 5HX8A 3PA5A 1H28A 4C4JA 4FTIA 3I60A 4GT5A 3AXWA 4JXFA 2OZOA 3NSZA 4AZSA 3QRIA 1H27A 4BZDA 3UNKA 4DF3A 1GIJA 3R8LA 4YHTA 4DCAA 4FBXA 4O0YA 2V7AA 3DLZA 3D83A 3H9RA 4K8AA 4R1YA 3UP2A 4AA4A 1JLUE 3B2WA 3BYUA 5F1ZA 3TTJA 4BDKA 4HVHA 2CGUA 4RWJA 3E3BX 3TKHA 2VWWA 4ASDA 5GZ9A 1PHKA 3PTGA 1J1CA 4YC3A 4F64A 2Z7RA 2VWIA 3M1SA 2XK8A 4TWPA 3FKLA 3HRCA 3PXZA 4AA5A 3I5ZA 3ORNA 4P7EA 3PPJA 2DS1A 2PMNX 1H00A 2BFYA 2C1AA 1H07A 3QRKA 3HVCA 4GL9A 3V5JA 3EN9A 3EN6A 4N6ZA 3RWQA 3N4UA 3LCKA 3C51A 3UTOA 2UW3A 3H10A 5HOAA 2YDIA 3E5AA 3IK3A 5CYIA 3FPQA 4M84A 4TL0A 5I9UA 3QUEA 1RJBA 4NYEA 4TKSA 4JS8A 3SC1A 4ACHA 1Q8UA 2C0OA 3FYKX 4FOBA 3IW7A 2R7BA 4LMNA 4U80A 2ZM4A 3LFEA 2BRNA 5J8IA 3VHKA 3F66A 1Q8WA 1ZOGA 2G15A 4JOAA 2ZVAA 2R3JA 3P1AA 4XH6A 3RZBA 3TV4A 4O7SA 2VO7A 1YDSE 3KXMA 4K2RA 3TEIA 4HPTE 3L9PA 3CQWA 2W05A 2WTIA 4I4EA 4XV9A 4S31A 4Y8DA 4IM0A 4BKZA 3KCFA 3GU5A 3PP0A 4AN9A 2J6MA 2WMTA 4JG8A 5EYMA 4E4MA 4CKIA 3SG8A 3ZTXA 4D1ZA 4JRVA 5KBRA 3BRBA 1CM8A 4QYYA 2JDSA 3PE2A 4AAAA 3FWQA 4QO9A 2B9JA 4WD5A 3OG7A 4YR8A 4K6ZA 3E8CA 4G3FA 3WIKA 3ZFMA 4F0FA 4W8DA 4RIOA 4IWPA 5KE0A 5DR9A 4IVDA 2PZ5A 5ETFA 3SOCA 1E1XA 3VS2A 4MBJA 3TTIA 2JFMA 4DLJA 2QVSE 3EOCA 3F7WA 3D7TB 4FT5A 3S00A 4UN0C 4N0SA 4R7HA 4RJ7A 3BV2A 3IW8A 3RAWA 5D10A 4ALWA 2PVHA 2X6DA 3O96A 5IPJA 5L3AA 4QTBA 2BRMA 3FLNC 2X2MA 3FZOA 3ZSIA 5IG1A 3RMFA 4QMTA 2OKRA 2VTLA 4U8ZA 2VAGA 2XIKA 4NCTA 4PDOA 4EL9A 2VN9A 5CSXA 3LXKA 4RWLA 2QI8A 3FSFA 3E87A 3QQKA 3G6HA 4MH7A 3U4UA 5FXSA 1H1PA 3HUCA 4FTTA 3ATSA 2C30A 2QKWB 3UOKA 4CQEA 4IDVA 2C6KA 3C0GA 3QUPA 2JIIA 1GZOA 4FTRA 3RCDA 5IU2A 3IQ7A 4FSYA 4IAFA 3U6HA 1M2RA 2UW8A 4XP0A 1PW2A 4JDJA 3V5QA 2UZLA 4EH6A 4EOOA 2AC5A 4CZYB 1U59A 3B2TA 4MKCA 4W8EA 3ZC6A 2YM5A 4X6RA 2ERKA 4PMSA 3AGLA 4A9UA 4ORKA 5IZFA 3S1HA 4WG3A 2W1GA 1ZAOA 3FQEA 3F5GA 4BIEA 1IR3A 1IA9A 4U5JA 5I4NA 4AN2A 2BAQA 1XQZA 4CLIA 2C6LA 1GAGA 5AR2A 1E1VA 2YM7A 4IZ7A 4MXXA 4GFOA 1ZOEA 4H3QA 4I0TA 3SX9A 4CFUA 5C8KA 5LWMA 3D7ZA 4QMWA 2QODA 2CKOA 3TM0A 3R30A 3RPYA 4D2VA 3GU4A 4QMXA 4XG2A 2DUVA 3FI8A 4FZDB 5LXMA 5JSMA 5JEBA 3RZFA 2DYLA 4O2PA 2B1PA 4Q5EA 1EH4A 3CC6A 4G34A 2IW8A 4C4FA 2QNJA 3GNIB 3OROA 4FZ6A 4YSJA 5K4IA 3Q4TA 4ACGA 4FUYA 2V7OA 5D41A 2PUIA 3VIDA 2Z7LA 3BGQA 3RHXA 4BKJA 3OF0A 2VTSA 2YJRA 2PUPA 3QZGA 4F7JA 3ANRA 1ATPE 2LGCA 4KIKB 5EDRA 4I94A 3HV5A 4ZAUA 2OO8X 4L3PA 2HY0A 1OL6A 3W2CA 2B4SB 3QKKA 2X81A 5CF4A 3D14A 2QHMA 3R01A 3FZTA 3IG7A 4HYUA 3TV6A 3KQ7A 1XH8A 4F1MA 3TNQB 4RT7A 2E9VA 2VO3A 3LCOA 5J5TA 1OBGA 2XIXA 3KCKA 1AQ1A 4H3PA 3F88A 3KU2A 5AAEA 4U40A 2WXVA 2QOHA 5TF9A 3W2SA 3NUNA 1UNGA 2GFSA 5EW9A 2R2PA 2C6EA 3E62A 4QYHA 3V51A 5ETAA 3ZZWA 4AT4A 3GGFA 4JG6A 2GSFA 2YM8A 3DQXA 4J8NA 2YAKA 2R3MA 3H0YA 4FK3A 3PPKA 5IKWA 2YLFA 3UJGA 2A27A 4TW9A 4EK3A 2J0MB 2CGXA 3EFKA 5JQ5A 1ZY4A 1SMHA 5AP3A 4BCGA 3CSVA 3ENHA 3FMJA 4L46A 5FGKA 3LMGA 2JKKA 5CSPA 4G2FA 2JDVA 4EQMA 4U81A 5JH6A 2BHEA 2XB7A 4DH8A 5CLPA 4RX8A 3BYMA 5FTQA 1XWSA 3S2PA 4Q2AA 4ZZOA 4FIEA 4HGTA 3ZO4A 4NJ3A 4L6QA 2NRYA 2R3RA 3DFAA 4WBBB 1HCKA 4BI0A 4J53A 2UZWE 5FBOA 5AA9A 5KMNA 3A2CA 3KF4A 5DI1A 2QOOA 1XBBA 3KRWA 1Q62A 1YDTE 3I81A 2BVAA 4H36A 4U97A 2XMYA 5EH0A 4D4SA 3HV3A 2B7AA 3BHUA 4GT4A 4CSVA 5HIEA 4C35A 4EJNA 2OFUA 3FLZA 3KXZA 3MY5A 3OCBA 2PYWA 5E9EA 3QXOA 2RFEA 2VX0A 3QD2B 4WOVA 2VWVA 4L8MA 4BI2A 4NKAA 3PPZA 3UOHA 2I40A 1JPAA 4RLKA 3LLAA 2J5FA 2QO9A 1H0VA 5KMLA 4BCOA 1MUOA 3L1SA 1VR2A 4ZS0A 5A6OA 2G2HA 1RE8A 4BCPA 3ALOA 2PVFA 3UPXA 3QF9A 4XG4A 4BCQA 4E93A 2XK7A 3UVRA 5DT3A 4E73A 4AX8A 3PLAE 5EOLA 2JDTA 4O0WA 2IJMA 2ITVA 4FEWA 4B8MA 1TKIA 3JY9A 4XP3A 3OEFX 3R7EA 5AR4A 3MFSA 4G16A 4YLJA 5GZ8A 2ITQA 2I0EA 4J99A 4FTCA 3CXWA 4C58A 3W2OA 3GEQA 3DKOA 4JAIA 3GCQA 4OW8A 5CVHA 3Q32A 3ZCLA 1WMKA 5A6NA 4LGHA 3F2NA 2UUEA 3QBNA 4ANLA 2ITZA 3D5XA 2VTIA 5AUWA 3BE2A 4I6HA 2UVXA 5BMMA 3V5WA 2RG6A 2GQGA 2QO2A 4NT4A 4D0WA 4YU2A 5CEOA 5ICPA 4DA5A 3LKMA 4GFGA 3HZTA 4UALA 3BX5A 3NNUA 1CKJA 4CKJA 2E9NA 3EN4A 3TIYA 2RGPA 5FDXA 3VUIA 4BWPA 5B2MA 5JFXA 4ZEGA 1ZZ2A 4CYJA 3L9NA 3ODZX 1SZMA 4EQCA 1XH7A 2P0CA 5LVLA 4CLJA 4ITIA 4F6SA 2Y0AA 4QNAA 1OIUA 1JSUA 2R3NA 3ACJA 4IAAA 3FKOA 4KKGA 4GG7A 3DPKA 5C9CA 4USEA 4TXCA 2Q83A 4FKQA 4CT1A 4H05A 4DTAA 2R3GA 4NEUA 2ZYBA 1CKPA 1MP8A 4QOXA 4JIAA 1XHAA 3UMWA 4C0TA 3DK7A 3NNXA 5IEVA 1B39A 2W1FA 2X1NA 4JBPA 3VF9A 5A4LA 5K4JA 5EHYA 4RWIA 2PUNA 2P3GX 4AZFA 4YZNA 2XIZA 4BWKA 1H8FA 3R9DA 2UV2A 2VNWA 2Z7SA 1H1RA 4RIYB 3EQHA 3ZBXA 1MRUA 4HVSA 2UZOA 2FSOX 3IO7A 3PXFA 4Y73A 3R8UA 4DAWA 4ACCA 3ZFXA 5FG8A 4W4XA 1TQMA 2ZM1A 2EB3A 3BLRA 3SOAA 4R7BA 2QHNA 4RX9A 3VRZA 4LL5A 3W8QA 4D4RA 3GQIA 5EKNA 3KA0A 4AQCA 5I9XA 2JDOA 4JBOA 5HO6A 5BVWA 5CEKA 2J90A 5H8BA 4D0XA 2J0JA 5H9BA 4FTNA 1JKTA 3ET7A 5AJQA 1OECA 2J51A 5HG9A 4MBLA 2V55A 3WF7A 1HCLA 4R5SA 5KZ0A 2O5KA 4ANOA 5HCYA 3VW6A 4FV9A 4DG3E 4RIYA 2ITXA 3EQBA 4C7TA 2I0VA 5BYLA 3JPVA 2Y4IB 3A7FA 5T68A 4EBVA 4GFMA 4UMRA 5AP1A 2GCDA 3LJ2A 5FWKK 5DG5A 1GNGA 5AR5A 4EH3A 1YRPA 3FC1X 4IVAA 4NZWB 2BIKB 4M68A 4FKOA 5HX6A 2Y8OA 4EYMA 4EZ7A 5F94A 5JFWA 4K0YA 5KCVA 2WEVA 3KF7A 5EM7A 2ERZE 2GMXA 3ID6C 4JIKA 3U8WA 4J8MA 4Y5QA 2CKPA 1I09A 5CVFA 4BDBA 5BVKA 3S95A 3RM6A 2JLDA 5FM2A 4G9RA 5CQUA 1ZMVA 3MN3A 4YBKA 3GQLA 1H26A 2C5YA 2YN8A 3EQIA 4YJSA 4JLCA 5BUEA 1RW8A 5DA3A 3R8MA 3WI6A 5F95A 3WBLA 3ZO3A 2VWUA 4LI5A 2GS7A 2B0QA 3PJ2A 3PY3A 1FMOE 1OPJA 3QC9A 3QQLA 2WQOA 4FKTA 2H9VA 3TZ9A 3QX4A 5A4CA 3IPHA 5H8EA 4IZYA 2GQRA 4LV8A 2IWIA 5F4NA 3GCVA 2ETRA 3WZJA 4E4XA 3LJ1A 4DEDA 3NMUF 4GIHA 2JGZA 5E1EA 3POOA 3MVJA 3VRYA 2XKDA 4RJ6A 4BL1A 2C0IA 4D55A 4QNYA 3FE3A 5EDQA 3C1XA 4E26A 1J91A 2BHHA 3Q9ZA 4XYFA 2BFXA 2YWPA 4A9SA 5DRDA 2GHLA 4JR7A 3UYTA 3RBWA 2C3KA 4BGGA 4QPMA 4BGQA 4O7WA 3ZONA 3QALE 1G5SA 4TYEA 5D11A 2PVJA 3PG1A 1REJA 2VX1A 4M12A 4FVRA 4I1ZA 1APME 2HZNA 4X6QC 4IJPA 3B8RA 4ZS4A 4IW0A 5GIOE 4WSQA 4J96A 3Q9YA 3S4QA 4QP4A 1LEZA 3QQUA 3O17A 3UC4A 4NTTA 4U9AA 4M13A 3CJFA 3HECA 4Q9SA 4V05A 3U51A 3UYSA 2VTRA 3CD3A 5EM5A 1YXSA 4GEOA 4S32A 5K0XA 4DT9A 3QQJA 2WMSA 2XRUA 3UQGA 3A62A 2Y7JA 1K2PA 3RNIA 3BU5A 1DAWA 3QWKA 1ZYCA 3NVMB 4FT7A 1OITA 1WBNA 3P08A 5M4CA 3P7BA 3TCPA 2YITA 3QCQA 2VD5A 1Y91A 3R0TA 1QL6A 5EW3A 2GTMA 3Q4UA 4IVCA 2VTHA 3HEGA 3OT3A 4BDGA 3ZLSA 5J9ZA 3CTHA 4C33A 2HOGA 4DBNA 4I92A 4TZRA 5AUUA 3IKAA 3NUYA 2YCFA 3LVPA 3I7BA 3FDNA 4FNYA 4WNMA 4D2PA 2W06A 4TT7A 4GU6A 3ZHPC 4ACMA 3D5UA 4CMUA 4O82A 4GV1A 4MD9E 1JKLA 5HTIA 3SA0A 3O7LB 3HUBA 2CNQA 4ZMFA 3BEGA 5JRQA 3TZ7A 1DI8A 3PIYA 4KABA 4LUEA 5AUYA 4F4PA 5IQIA 2F7XE 4R3RA 3ZUVA 3FI3A 5HLPA 2RF9A 3D94A 3LFSA 1OZ1A 3CS9A 3LXNA 1BLXA 3NYNA 4TWNA 5C1QB 2E9PA 4WNOA 4BTKA 4DFNA 4F70A 4IAYA 3ZH8A 4FKPA 4NW6A 4E6CA 2QD9A 2R3KA 4FSRA 3TUCA 4ZTMA 3A7JA 2IVUA 4GT3A 4EK4A 4EZ5A 2FSMX 4U44A 1VEBA 4CCUA 3PUPA 4R7IA 2YIQA 3Q6WA 3FBVA 2VRXA 3EHAA 4BIDA 3GU8A 3ZRKA 3CR0A 2BROA 4QQ5A 3PJCA 4UYAA 5CSWA 5GHVA 3ZDUA 4HGSA 3KN5A 2PTKA 3WIGA 2G01A 4UWYA 4IAIA 3KRLA 3VS6A 3WOWA 4XJ0A 4X3FB 4IX5A 4G17A 3MVHA 4PP9A 2C6DA 2WAJA 1UWJA 3Q96A 1DS5A 4I41A 4ZZNA 3TDVA 4O2ZA 3R7UA 4AG8A 5JKGA 3G9NA 4M8TA 2H8HA 3NAXA 4WA9A 4ANSA 5CAOA 4EOPA 3FL5A 1PMEA 5JZNA 4FX3A 3D2KA 4BBEA 2HWPA 4JQ8A 4NKSA 4YZCA 3U6IA 5BUIA 4WHZA 2F49A 5E92A 3QA8A 1M2PA 3DKCA 3NS9A 3C4XA 4UV0A 3LFBA 3Q2JA 3ZEWA 4IZAA 1PKGA 3ANQA 3VUKA 4FTUA 4GUBA 5DVRA 4O6EA 4PMPA 1YXTA 4DHFA 4YPSA 4FGRA 2FA2A 4L43A 3QQFA 4YMJA 4RJ3A 1CSNA 2OF4A 4C2WA 3K5UA 4GW8A 4RX7A 4KBCA 3DA6A 5KNJA 2W1IA 4RA5A 3ZEPA 5BVNA 3R9HA 1XKKA 3I4BA 1FPUA 1UU7A 4UEUA 4FE2A 2W4JA 2XKCA 3R04A 3V01A 5CX9A 2Q0BA 4YGAA 4PP7A 5AUXA 2KULA 2XNBA 4E4NA 3EYGA 5CANA 1PJKA 2XA4A 3ETAA 4MF1A 3MB7A 5DMZA 2G1TA 2Z2WA 4HGEA 4CFFA 4BTFA 3P78A 1R0EA 3HP5A 4NW5A 3CPBA 5AP0A 3KREA 3A7HA 3S3IA 3NUXA 3ZXZA 1S9JA 2GFCA 3KXGA 4RC4A 1WZYA 4Y85A 3UNJA 2W1EA 1STCE 3LLTA 5K0KA 3ZO1A 3QKMA 2E9OA 2W4KA 2PZYA 4PL5A 2HXQA 1YWVA 4KBAA 1B6CB 3ZUTA 4E8AA 2XIYA 5HG5A 4QTAA 2OZAA 3HMOA 4FA2A 3I6UA 4HW7A 3AG9A 3DB6A 4RVLA 5CF5A 4AA0A 3C5IA 4QP3A 3V6SA 4Y72A 4M0ZA 4I23A 4XV1A 5LMAA 5LJJA 3NDMA 4MAOA 3UG2A 3EQFA 5KUPA 4DYMA 3Q4CA 4DBXA 4GH2A 1KUTA 5HNGA 4FIGA 1PYEA 5LVOA 4KB8A 3A61A 4J7BA 3MPAA 3F5XA 5AR3A 3W2QA 3ACKA 1OL2A 3E8NA 5CTPA 1YI3A 3DNDA 3OVVA 3ZDIA 2C1BA 3JS2A 3PA3A 2WMQA 3GP0A 4KWPA 2WMAA 3GVUA 4BFMA 4AOTA 2Q0NA 4ERKA 2F2CB 2HW6A 5FXQA 2JD5A 4F09A 5AADA 4O0UA 1H24A 2VGOA 2XBAA 1OL1A 4ZY6A 5J7HA 2XNEA 2X7GA 3GUBA 3OXTA 3LCTA 4FKWA 2WMRA 3NUSA 2R4BA 3REPA 4B9DA 1I44A 2CGWA 2IVSA 2Z7QA 2ZV8A 3ZLXA 4A07A 4BRXA 4FIIA 4KS8A 3LOKA 4D5KA 3O8TA 4ZJIA 4O83A 3CKXA 4F7NA 1H1WA 3KFAA 4W9XA 3OCSA 5EYDA 5C27A 3MESA 4GKIA 3DZQA 2BR1A 1BUHA 3RPRA 4ASZA 4BTMA 3FL4A 4YJNA 5C26A 4NM7A 4TYGA 5M4FA 3DBFA 4ZY5A 1BYGA 2LAVA 3CGFA 5ANDA 3D5WA 4I3ZA 5HBEA 3BYVA 3CLYA 2YCRA 1O6KA 1ZLTA 3DFCB 3UOLA 3AT4A 3MA6A 3MH2A 4MCVA 2ITUA 5DIAA 3OZ6A 4YPDA 5ANJA 4AOJA 5BVOA 2C5NA 3LQ3A 4M15A 4PX6A 5IA2A 3FXXA 5HQ0A 4I21A 5LVMA 3HGKA 3PLSA 2X6EA 4DC2A 4O91A 5DPVA 5CAUA 4IAKA 5J95A 3K5VA 2A0CX 2WOTA 3LAUA 2WTCA 2UW7A 4YC6A 2JAMA 3G2FA 3FEGA 1ZYDA 1OKWA 2ITPA 2RFDA 3EL8A 3Q60A 2B9FA 5T3QA 1H0WA 2PVKA 2WIHA 3BBTB 4GS6A 3VWAA 5EI6A 2J0IA 4OTIA 3C4FA 2O2UA 5EM6A 4GJ3A 2KTYA 1DI9A 3QD0A 4IX4A 3SXFA 2EB2A 2ZMDA 2QC6A 1YDRE 3O51A 4L00A 4DGOA 1YOMA 2BALA 2VTAA 2O3PA 2XZSA 3N9XA 3ORTA 4QMLA 3TUBA 1O6LA 3MH1A 2HAKA 1Y6BA 4DGLC 4ITHA 3H30A 2CLQA 3MH0A 4HNIA 4AW5A 4BCKA 2JBOA 3EQPA 4O0SA 4U0IA 4XNEA 3ZC5A 1F0QA 4NSTA 4PWNA 2W9FB 4QYFA 5DR6A 4W4WA 4EONA 2ACXA 2WQEA 3WF9A 3ZXTA 2X7OA 3WZDA 3ZS5A 4GMYA 3VS7A 1DM2A 3AC1A 5EI2A 5J1VA 3V8WA 5IQBA 3Q04A 1JBPE 5E8TA 5CSVA 4CYIA 5A54A 2ZV7A 3S0OA 1WVWA 3QA0A 3ORIA 1IAJA 5CNOA 4EZ3A 3EQRA 5HE0A 1WBPA 2JITA 4IACA 3CIKA 4FTQA 2PVMA 2RSVA 3HLLA 3OWPA 4OAVB 4IVBA 1Q3DA 3F3ZA 3QLGA 5GJDA 3FV8A 1PXIA 4HYIA 4RGJA 3BQRA 3DY7A 2VWYA 3OY3A 4DH1A 3TWJA 4F9BA 3R2BA 4FSWA 4ZTLA 4CFVA 4YZMA 4EWQA 5HNIX 3C4WA 3JR1A 5HU9A 4G9CA 4MXOA 1PXMA 3BQCA 3BWJA 1V0OA 5AP6A 1MQ4A 5HG8A 4AE9A 3F3VA 2CJMA 5JGDA 2IN6A 3OWJA 3QXPA 5ITAA 2ONLC 5EHOA 3DBQA 2PZRA 4YZDA 1G3NA 3II5A 2R7IA 3TL8A 4E6QA 4WBOA 3UGCA 3F3UA 4R77A 3VBVA 3Q4ZA 4NCTC 3TZ8A 3VBXA 3BEAA 2QG5A 3BHYA 1U46A 4ANBA 3A7GA 3CKWA 2CN5A 4FOCA 4QT1A 3ZLWA 1M14A 4OBQA 3ENMA 3ZM4A 4EH2A 4ZSGA 3PVUA 4JT3A 3TZMA 4AN3A 5JGBA 4RVKA 1A06A 4GYIA 4PPCA 4B0GA 4BB4A 3UO5A 1G8AA 2YZLA 5HKMA 3E64A 2C3JA 3UNZA 3ODYX 5IDPA 5HU3A 4G5PA 3KGAA 4HNFA 4EH5A 3C4ZA 3W32A 5CASA 1LPUA 2OF2A 5BPYA 4QP9A 2CLXA 3TDWA 4F9CA 3KN6A 4YLKA 4FV8A 3D9VA 2XVDA 3PRIA 4WKQA 4QMNA 2P2HA 4FVQA 1PXPA 4HYSA 4C2VA 3MY1A 3KB7A 2JKOA 5KO1A 2YAAA 3KMWA 5CU0A 2J9MA 2C5VA 1IEPA 4WNKA 2XBJA 4NH1A 5AV2A 1UKIA 4OTGA 4YJRA 2GNIA 4BDFA 3BELA 4RZVA 4C8BA 4H3BA 2EWAA 2UW9A 4O1PA 4MX9A 2WHBA 4I0RA 4JAJA 4CZTA 4BHNA 1JVPP 1YXVA 2ZDUA 3HL7A 2X8IA 3D5VA 3M2WA 4MEDA 3VJOA 5M55A 4CVAA 5HTCA 4IZ5A 5CU3A 5JMSA 4QMUA 4XRJA 3DTCA 3QZIA 4C3FA 3COHA 4XEYA 5C03A 4FTMA 4QRCA 4X2GA 4G1WA 4FZAB 1FVVA 1XO2B 2PVRA 4OTDA 4D9UA 3IDBA 5L6WL 4ZTRA 4I6FA 5M44A 3VQUA 4EHVA 1OPLA 2VTOA 4EH4A 4A9RA 2QLUA 5HBJA 3CBLA 3B8QA 4FMQA 1H08A 4L01A 1ZY5A 3PVWA 1Q8ZA 2DWBA 3P23A 3PVBA 4TPTA 4XOZA 1K3AA 3LQ5A 4BVUA 4R78A 3RTPA 3TJCA 2WIPA 3AC3A 4U42A 2WTKB 2G2IA 5GZAA 3QAME 1BI7A 1Q8TA 3BBWA 2V62A 2UZTA 3FKNA 4TNDA 1XH5A 4DEAA 2CDZA 4UBAA 3OP5A 4JX7A 3DXNA 4QQCA 4C62A 4CNHA 3H4JA 5E8UA 4D2SA 1LEWA 4FV4A 4UWCA 3H9FA 4RC3A 2BDFA 1YOLA 4X2JA 2YHVA 4DGMA 1WCCA 3LPBA 4O7RA 2FH9A 2OBJA 1W84A 5IQAA 4QP1A 4EC8A 3BPRA 3A7IA 3VUTA 4ALVA 2Y6OA 5D7AA 1GY3A 1WBWA 4P90A 3L8VA 4KUJA 5KKRB 3H9OA 4CQGA 3TNIA 3FMHA 4ANNA 4ZSEA 1QPCA 4ZLZA 2FGIA 4RFMA 4BI1A 4CV9A 2NPQA 4ZJJA 2WQNA 3LXLA 3EQDA 1G8SA 3HMPA 4EQUA 3UIMA 1R3CA 3DS6A 4FKGA 4CKRA 2Z60A 4CEGA 4AU8A 5HO7A 4ZMEA 2FSTX 2OJ9A 4FKVA 5JN2A 2X8EA 5CZHA 1ZYSA 3SKCA 3RI1A 1ND4A 3IDCA 3IW4A 1P14A 2C5OA 2OH4A 2ESMA 4QP2A 3C4EA 4G3CA 5AAFA 3RPOA 5IQCA 3PIZA 5L2SA 2UW6A 3A8XA 4BTJA 1Q41A 4L52A 4C4HA 3ALNA 5HHWA 4DEGA 4AGUA 1E9HA 1ZMUA 4NM5A 2OK1A 5AP4A 2IPXA 4DT8A 3VBTA 3MDYA 4O7VA 4FTOA 3GU7A 4B4LA 4FSZA 2JAVA 5KZIA 2B55A 2VTMA 2QO7A 2UZDA 2JKQA 2VU3A 1RDQE 3BI6A 4FV7A 5ANIA 3F7ZA 5HE2A 2W0JA 3F5UA 2XJ1A 4DGGA 3MW1A 4GIIA 3F3TA 4EHEA 1OIYA 3PSCA 4M0YA 4O0VA 1XH4A 4YHJA 2JIVA 4O6LA 4QMZA 5EQYA 1P4OA 4GUEA 5BX0A 1PKDA 4LL0A 4PY1A 4ZTNA 2XEZA 3ZUUA 2WMXA 3COKA 5CZIA 3R9OA 4BF2A 3R6XA 3A4OX 3UC3A 1DAYA 4WNPA 3DJ5A 4YSMA 4DH3A 4X2NA 4C57A 1A48A 4IFGA 4IIRA 4FYNA 4FIFA 3PXYA 3WILA 4O21A 5AUZA 3BU6A 3DDPA 3P7CA 5CAPA 4Y83A 3R71A 3V6RA 2PY3A 2PMOX 4M3QA 3VNTA 2NRUA 4F65A 1BL7A 4A7CA 3AC8A 2VTPA 3FQHA 2XKEA 5AIKA 4TWCA 3MS9A 5A3XA 3G90X 4BDIA 5LQFA 5KMOA 3BU3A 4GU9A 4CCBA 4FK6A 1UU3A 2EXEA 3IONA 4DCEA 1R78A 2R3OA 3POZA 4KIOA 3KXNA 4O96A 5FLFA 1W8CA 3QTUA 4XP2A 3VN9A 4LOPA 4AACA 2HW7A 3GU6A 3IW5A 1UVRA 1R0PA 3TI1A 3OCTA 5K9IA 2CHLA 1OM1A 4I5MA 2C69A 1LR4A 4W4VA 5B2LA 4FV0A 2XKFA 4XG3A 4CMOA 2G2FA 4QMPA 1WBTA 1U4DA 3G33A 3FYJX 4QMYA 3BZ3A 4KSPA 4DN5A 3MJ1A 3R1NA 4O7LA 1CTPE 1T46A 4K9YA 5I3OA 2GNHA 3SDJA 4Z7GA 1TVOA 1CMKE 4I4FA 4LFIA 5HBHA 5CF8A 5LMKA 3QKLA 1W7HA 1KV2A 3H0ZA 2YJSA 2PE2A 3RK9A 5IH4A 3IGOA 2ITNA 4FEXA 3FZPA 3SGCA 3LCDA 2GPHA 4QD6A 4E1ZA 2JDRA 4UZHA 3G15A 4KBKA 4C02A 5IQHA 4O0RA 3BGPA 4G31A 2OLCA 3PG3A 3E7OA 3KVWA 5C8NA 2UZEA 3VQHA 4KKEA 3QHRA 1VJYA 2CSNA 4EH9A 3LZBA 4AWIA 5L8KA 4Z16A 4MXAA 5EHLA 4CRSA 4MXYA 4FGBA 4JVGA 3OHTA 1FMKA 5EFQA 2XM8A 3DBCA 4LQMA 3NX8A 2J5EA 4OLIA 4XX9A 2OH0E 4B7TA 4W4YA 1L3RE 4FKLA 3SW4A 4HVGA 3O8UA 3HA6A 4I6BA 5ACKA 3ZRMA 2OU7A 3UQFA 4YNOA 3FLWA 4LM5A 5EYKA 3ITZA 2C4GA 2XNOA 3LE6A 3RALA 3V04A 5DR2A 3VJNA 4RBLA 3KMUA 3GOPA 1IRKA 4J71A 3FMKA 1T45A 4IFCA 3AD6A 2X9EA 5TT7A 4BYIA 3O23A 1ZRZA 4FI1A 5DGZA 2ZB1A 5AV1A 3FMDA 4E5AX 3DU8A 5L2IA 4HVDA 3R73A 3PWDA 2Y4IC 3ROYA 3EZVA 2YCQA 1GIHA 4UXLA 3P9JA 5CVGA 2YM3A 1WVYA 2QOLA 3OUNB 4J97A 5E7RA 1V1KA 1H01A 4O22A 4HCUA 4L68A 2ZM3A 3MSSA 3PZEA 4FSUA 3FLSA 1P2AA 4RFYA 3VW8A 2CGVA 3P79A 3SXSA 4YZBA 2OXXA 3CY2A 4JI9A 3EKKA 3EZRA 3MIYA 4FV5A 1M7NA 2W5AA 3JY0A 2JKMA 2X7FA 3SG9A 4NL0A 3AD5A 5J9YA 4ANMA 3QTXA 4GSBA 4MNEA 3NAYA 5CAVA 5AFVA 2UZVA 4J95A 3HYHA 4GRBA 4RVMA 5EK7A 3QWJA 3WF6A 4NIFB 5E8YA 2C68A 3UODA 5ACBC 5JK3A 3KXHA 2WPAA 4IM2A 1VZOA 3OMVA 4FTAA 3RM7A 3SAYA 3QHWA 2OXYA 1KE9A 4DTKA 2C5XA 4PNIA 5CU4A 3R28A 1W82A 2EVAA 4DEIA 3QX2A 3HAVA 3NEWA 4FL1A 1O6YA 4IE9A 1WFCA 3I1AA 4M69B 3HV4A 4H39A 4PNKA 5L2TA 3QFVA 3VS4A 3I6WA 3O2MA 1AD5A 3O71A 1ZARA 2IZUA 3P0MA 3MWUA 3N4VA 3L9LA 3FJQE 3QTWA 5HGIA 4ERWA 4FODA 3BIZA 1W98A 4JRNA 1YXXA 4NIFA 5AUVA 2GDOA 3UG1A 3PXKA 2GQSA 3MA3A 3UE4A 1GZKA 2IW6A 2FUMA 3FI2A 4A4OA 4FSNA 4M69A 3L8PA 3R8VA 5FTGA 5HVKA 4I93A 4YNEA 4ZSJA 2PK9A 2VTNA 1H1QA 1YHVA 2EUFB 4L9IA 5G1XA 1Q99A 3TNPC 1M2QA 4HYHA 5BVFA 3GOKA 2IZSA 3G0EA 2X2LA 2XNMA 1W83A 3F61A 4HVIA 2OW3A 1PRYA 3EKNA 3MJ2A 2OGVA 2VWBA 4OR5A 4CMTA 4BWXA 2IZRA 4FF8A 2BDWA 3VBWA 3EQCA 2O8YA 2P55A 3KULA 1QPJA 2XNGA 4FSQA 1OVEA 3ORZA 4CTCA 4LMUA 3DOGA 3R7YA 2W1ZA 2B52A 3FPMA 4XBRA 4QP7A 1PY5A 4IX6A 1RQQA 4FEVA 4DFBA 4BDDA 3QD3A 4RJ5A 2RL5A 5I9YA 4EOMA 2QKRA 2X2KA 3DZOA 4YHFA 4UMQA 2HZ4A 4IC8A 1JAMA 1FGKA 4TYIA 3NNVA 5HIDA 3MI9A 3O50A 2XCKA 4RQVA 5H3QA 4BZNA 4ASXA 4EWHA 2VWZA 2H6DA 5A4TA 3JYAA 2BAJA 1QPEA 1Q97A 3GBZA 4TYJA 1FINA 4PRJA 3PSDA 1JSTA 2I0HA 5AR7A 3Q53A 4PUZA 2YWVA 4AFJA 1Y6AA 3AQVA 1XJDA 3QQGA 4IANA 4OBOA 4FTLA 5ANOA 3UIBA 4A4LA 3HKOA 4YUQA 3UO6A 4WO5A 1UA2A 1KE6A 5M4UA 3GC0A 2WTVA 4EI4A 4O7YA 4ZXTA 1YWNA 3C7QA 4EH8A 2YDKA 5BNJA 3LW0A 2OI4X 5M07A 4LOOA 3GI3A 3ULIA 2FB8A 4EKLA 2WTJA 1PXNA 3PP1A 2BMCA 1YVJA 4MXZA 3UVPA 3SXRA 3GC7A 3NUAA 3V3VA 4XMOA 4DH5A 3E92A 4XV3A 3PIXA 2QR7A 3VBQA 3BHVA 1ERKA 4ONAA 2UW4A 4D2RA 4JX3A 2OIQA 4FG8A 4G3GA 4GK4A 1KE8A 1BI8A 3H3CA 5E4HA 1FOTA 2O64A 3DJ7A 5H2UA 2W1CA 3PE1A 1REKA 2AC3A 2V0DA 2XCHA 4WUNA 4AF3A 4N70A 4D5HA 4IADA 3WF5A 5FD2A 4USDA 2GTNA 2WMWA 4FV6A 1ZMWA 3OCGA 3TKIA 1OPKA 4A06A 3RKBA 3ZMMA 3UP7A 2OG8A 3UZTA 5AM7A 3IOKA 4Z9LA 3A60A 3E7VA 3OEZA 5ANKA 3LCSA 3CPCA 4USFA 2OWBA 1SNUA 3MY0A 4X3FC 5IF1A 1Q24A 4G6NA 5AUTA 4M14A 4LRMA 4DITA 5HORA 2W17A 4R8QA 1UKHA 4KNBA 2UW5A 3ZBFA 2QOIA 3MV5A 2CNUA 3P86A 4P4CA 5D9HA 2OZAB 3R1QA 3W16A 4KSQA 5KHXA 4FG9A 2J7TA 5DOSA 5ETCA 2ITYA 2BAKA 3Q9XA 3KRJA 3LXPA 1FVRA 2YA9A 4RRVA 5M08A 3GCUA 5GINE 5EDPA 4RLLA 3QCYA 5AM6A 2WGJA 3HA8A 1LP4A 3R7GA 4JG7A 1KE5A 4YTIA 3K2LA 3THBA 5G6VA 3MFUA 3VC4A 4NUSA 4EK6A 3FMNA 4F0IA 1NT2A 4Q9ZA 3QTRA 4DLIA 5CT0A 4LRKA 4AT5A 1QMZA 5ANGA 1NVQA 4C34A 3GFEA 3V5TA 3RNYA 1NY3A 4ZP5A 5M09A 4CT2A 3DK3A 2R3LA 5EOBA 5E8ZA 2GS6A 2UZBA 1PMNA 4Y46A 4A4XA 4APCA 4DEEA 4PV0A 3DV3A 3LFNA 3AGMA 3LJ0A 4FZFB 4S34A 3ZLYA 3LFDA 1M7QA 4IEBA 3FZSA 4EJ7A 3WYYA 2QURA 3U6JA 3FUPA 5GJGA 2GHGA 3MVMA 1IAHA 3NW7A 3NW6A 3HDMA 3F69A 3P4KA 3QCXA 4QMSA 2HIWA 3AMAA 4ZTQA 3VUGA 2YLEA 5JGAA 3VUDA 3NLBA 2C3LA 4EK5A 4L3JA 2G9XA 3AMYA 5HTBA 2QU5A 2XUUA 4RIWB 1KV1A 2JFLA 2XK4A 1Q5KA 4AZWA 4O0TA 4ENXA 2IO6A 3ORXA 3OXIA 1Q61A 3EH9A 3F2AA 4LG4A 2B53A 3MYGA 4UB7A 2CN8A 3WE4A 4ACDA 4R3PA 4AGCA 1XBAA 1OKVA 3FMLA 2WB8A 4EOQA 1URWA 5CY3A 3UBDA 2PWLA 4K33A 4UMTA 4JDKA 4E20A 2BZJA 1PXKA 4BCFA 5IA3A 1J1BA 5J79A 1JSVA 2R5TA 3JUHA 4NFMA 5FQDC 2C0TA 4A9YA 4AT3A 4B99A 4FKJA 3O0GA 4RIWA 4MYGA 5J87A 3R8ZA 4JDIA 3DQWA 4E5BA 3HDNA 3R7OA 1GJOA 2RFNA 3VULA 2FVDA 4CG8A 3MIAA 3VAPA 5I9ZA 4WSYA 5CXHA 3I0QA 4FV1A 3L8SA 3NPCA 3DXPA 4PL4A 5DFPA 3NVKI 3G6GA 3PY1A 4PPAA 5GNKA 4ANQA 2OJIA 4I0SA 2O0UA 2YZAA 3AD4A 5IISA 1SYKA 5IUHA 5C8MA 3IGGA 5T6KA 5IQEA 4RJ8A 3KKVA 4HZSA 2Z02A 2WD1A 1U5RA 2W5HA 3R9RA 5GJFA 3WARA 4IB3A 3F2RA 4FC0A 4RIXA 3RP9A 1TQIA 5BMSA 4JQEA 5IA1A 1OGUA 3E8EA 3ORMA 1KOAA 4WRGA 4X21A 2PPQA 1YI4A 1S9IA 3ZRLA 4A9TA 4R3CA 4AW1A 1YW2A 3D15A 4NFNA 2GNFA 4YJVA 5C4KA 4I24A 4YTFA 4CFNA 4BDAA 5AP7A 5DEYA 4C37A 4YZ9A 3RGFA 5L4QA 3CTQA 1J7IA 3D4QA 5IMEA 2P33A 1M52A 3U4WA 3RJCA 5HVJA 3VS0A 3Q3BA 4HCVA 4J1RA 4F9AA 2HWOA 4E6AA 1Z5MA 3KEXA 3NNWA 2XK9A 4TTHB 3SHEA 1O9UA 2OJGA 2QLQA 4QP8A 3W18A 2OIDA 1ZOHA 1WBSA 1SNXA 3I0OA 3LM5A 4LUDA 4MD7E 4TN6A 5IUIA 2GU8A 2W1DA 4EKKA 3QYZA 4K1BA 4FIJA 3QD4A 4CTBA 3FI4A 3EQGA 5IDNA 3ZM9A 1UU8A 3QU0A 3V8SA 3K3IA 3RHKA 2PVYA 1ZYJA 2XNPA 3NIZA 5TR6A 3ZO2A 4C3PA 4X3JA 4ZSAA 3EFLA 5K5XA 2HENA 4IAZA 5AP2A 3DDQA 4EBWA 4ZY4A 2VO0A 2CKQA 1B38A 2WFYA 3NYOA 5HICA 2Y4PA 3AC4A 3PJ1A 4XLVA 4YTCA 2BRHA 2CCHA 4U3ZA 3QC4A 4CFXA 4O81A 3ZSGA 4JJRA 2YISA 3BE9A 3W2RA 3KRRA 4EYJA 2YM4A 2VO6A 3TT0A 5DHJA 3NYXA 5DBXA 4MWIA 5AV0A 5DLSA 3UO4A 5BQ0A 2XEYA 5AA8A 3QLFA 5CEMA 1HOWA 3U54A 5HCZA 3VHEA 4PF4A 1NA7A 3UPZA 1OMWA 5CXZA 4E4LA 5JT2A 3BCEA 4OTPA 3Q9WA 4ITJA 4EK8A 1IA8A 5FDPA 3ZOSA 3UDBA 3C5UA 4JBVA 3I7CA 3NIEA 4L7SA 3KK9A 3CP9A 2ITTA 2XK3A 1TQPA 3E8DA 5CWZA 4YC8A 4U79A 1BKXA 2WMVA 4AE6A 2NNWB 4XG7A 3Q2MA 5FM3A 1WAKA 3OTUA 3RAIA 4R6VA 2YIYA 4O38A 3T9IA 3OW4A 3RK7A 1KWPA 4EOIA 1F5QA 4QQTA 3ZSHA 5HE3A 2ONLA 2B9HA 4QPSA 4AP7A 2OIBA 1FVTA 2HELA 4MVFA 4CXAA 3PFQA 5D1JA 2EXMA 2ITOA 1KE7A 4FL3A 3DK6A 5FEDA 2F2UA 5LOHA 3AT2A 3W33A 2F4JA 4BHZA 1W0XC 3QL8A 3CCNA 3TN8A 2I7QA 2WKMA 3MFRA 3RAKA 5IA5A 1UNHA 3SRVB 5AR8A 3D7TA 2ZV9A 4AUAA 5CI6A 4UMPA 2PU8A 2I6LA 4ZK5A 3FXZA 5LARA 4O27B 2W99B 3DNEA 3MGYA 2P4IA 4OTWA 5C01A 4BCIA 4NU1A 5KMJA 4IH8A 1URCA 3IECA 4RWKA 2Y6MA 4IB0A 4YTHA 4FEUA 1J3HA 3PY0A 4G5JA 4AGWA 3EJ1A 5M4IA 2BKZA 5AAGA 4LOQA 4IB1A 3C50A 3O8PA 1PXOA 4I6QA 4EUTA 2ETMA 3SRVA 4C4EA 2R0UA 2E2BA 3AT3A 4G6OA 4IBMA 4XV2A 5M57A 1SVEA 5FUTA 1K9AA 2ZMCA 2REIA 2XNNA 4QMMA 3OOGA 3A8WA 2RKUA 1JNKA 4WG4A 2C6IA 3R63A 4WT6A 5L6PA 1Z57A 2CKEA 2WQBA 3HV6A 4Z3VA 3R9NA 3SV0A 3EMGA 3UZRA 3V5PA 5CENA 5J5SA 2B9IA 3SQQA 4P5QA 4FG7A 3PZHA 5EI8A 4NM3A 3TNWA 5TOZA 3ERKA 4FUXA 3EFJA 5IH5A 3VUHA 3DBEA 4W9WA 5AMNA 2QCSA 4WRSA 2XYNA 3BLHA 1BX6A 3M11A 4UZDA 3NYVA 1PYXA 1XH6A 5HNBA 2BZIB 4BDCA 4GJ2A 2ZAZA 3OD6X 3AMBA 4LGGA 4L7FA 4NTSA 1YQJA 3FAAA 4GYGA 4UX9A 4PTEA 4ZJVA 5IUGA 2FYSA 5HEZA 2X4FA 2WTWA 3EB0A 3KVXA 2VZ6A 1ZYLA 4FTKA 5CEPA 4FNXA 3FLYA 1SVGA 4D1XA 3GXLA 2FSLX 4XOYA 4TRLA 3HV7A 4DTBA 2PZIA 3RPSA 2WELA 5E8SA 5FRIA 1QCFA 2WTKC 4QYGA 2XRWA 3ZZEA 4N6YA 2BDJA 3BHHA 3F3WA 5DH3A 4DEHA 4MBIA 2HZIA 4X0MA 3T9TA 2J2IB 4KIKA 4RX5A 5BYYA 3Q52A 4O7TA 3BWFA 1YHWA 4K18A 1GZ8A 1U54B 4ENYA 1OKZA 5C4LA 4GG5A 3KL8A 3AOXA 5CS6A 4O1OA 3GC8A 4XG8A 2GS2A 5HZNA 1Y8GA 5JFVA 1JKKA 5B7VA 5KMMA 3BHTA 3F6XA 1PF8A 1XR1A 5CU6A 5B2KA 5TE0A 2QONA 4I22A 4R1VA 4X2FA 4HPUE 5IA0A 5L2WA 2F7EE 3TIZA 5J9LA 3QZFA 1YWRA 2RFSA 2F9GA 3LIJA 3GFWA 1CKIA 4FTJA 4MTAA 2IZTA 4MWHA 4OTHA 4OTRA 2A2AA 4NJDA 3D2IA 5E1SA 5EKOA 2YFXA 1U54A 4QP6A 3DCVA 5KKRC 2C6TA 2JC6A 4RVTA 4EC9A 2PMLX 2HCKA 5HD4A 2OICA 4M66A 3UIXA 1GOLA 5IQFA 1H25A 4D9TA 3R1YA 4FKUA 4AXAA 4CD0A 4QMQA 3TNHA 4PPBA 4OT5A 4PTCA 4IDTA 3VF8A 1A9UA 2XJ0A 1JKSA 3EN7A 3FSKA 3FZRA 5HVYA 4PDSA 3BYOA 3HRBA 3EL7A 4DE4A 2QOFA 1ZZLA 2A19B 2RIOA 4ZIMA 2YACA 3IW6A 5FXRA 3QYWA 4L44A 3EFWA 1JWHA 1UWHA 4MK0A 3HMNA 4TYHB 4ZTHA 5IEXA 2YCSA 5KHWA 2J50A 3CQUA 4RFZA 5HI2A 4DFLA 5ETIA 4E3CA 4Z7HA 3PA4A 4B8LA 2E9UA 4IMYA 4OTQA 3R1SA 4D4YA 2HXLA 4ID7A 3LFCA 5M51A 2XYUA 3IS5A 5D7VA 4QMVA 3AC2A 2UVZA 3KC3A 3LFAA 4PDPA 3RAHA 4C36A 4F08A 4GCJA 5DEWA 3W8LA 4O0XA 3KXXA 4AW2A 2AUHA 3BKBA 3R8PA 5LCJA 3CE3A 4TYHA 3UQCA 4D58A 4WIHA 5LMBA 2WQMA 3UZPA 3SW7A 4IX3A 2UW0A 5HCXA 5A4QA 1M17A 2B54A 3OS3A 5DNRA 2GNLA 3ZFYA 1J7UA 4YBJA 2X8DA 3HNGA 2QG7A 3R7IA 5AV3A 1PMUA 2P2IA 3R22A 2X0GA 2WEIA 3PRFA 4JL9A 4XG9A 4UY9A 5K3YA 3COIA 2R3FA 2JIUA 3VBYA 4I5PA 3V5LA 4AFEA 4AZVA 4FT0A 4X7QA 3U87A 3MPMA 2XIRA 3HMMA 3VVHA 5FEQA 4PQNA 3ATTA 2PE1A 4HZRA 2VTJA 2XJ2A 4DG2E 3PWYA 3WZEA 1H1SA 3WF8A 4AS0A 2WTDA 4FNWA 3NW5A 4XCUA 4DFZE 4E7WA 4BN1A 2W4OA 4ARKA 4BYJA 4JQ7A 4IC7A 4U7ZA 2Z8CA 1BMKA 3ELJA 4CG9A 1PXJA 2IVVA 4C4GA 3GB2A 1ZWSA 3A99A 4AW0A 5LMKC 2WU6A 4O84A 5GIPE 4DFXE 1OUKA 3VUMA 2PVNA 4O7ZA 4FNZA 3DKFA 3DTWA 3PXRA 4F7SA 4BBMA 4DFUA 3HAMA 5FP6A 2BCJA 3NUPA 1F3MC 2BRGA 4BY9E 3JVSA 3LMHA 3CD8A 3UIUA 3DB8A 1SM2A 5CT7A 4X2KA 3VO3A 4UYNA 2I0YA 2RG5A 4JBQA 3OWKA 3UMXA 4IB5A 2CNVA 2R3HA 5CI7A 3F5PA 3I5NA 4BICA 3U9NA 2HZ0A 1IASA 4AZEA 3WZUA 3OBJA 4BBFA 4C59A 2PE0A 3QRUA 4RA4A 5HG7A 5J1WA 2BZKB 3F9NA 4JR3A 3EN5A 5DYJA 3FY0A 5EQEA 3LFFA 3R21A 3P7AA 3R00A 4EHZA 4UWBA 3G5DA 3SVVA 5EYCA 2PHKA 4RZWA 2V5QA 4KRDA 2WU7A 5J7BA 4MNEB 3QTZA 4RPVA 3BV3A 3N4TA 3GC9A 3QGWA 3HRFA 4QPAA 2YM6A 3GT8A 3I79A 3COMA 4N4SA 4H58A 3R02A 3OUKA 4BC6A 2BTSA 5EQPA 3QQHA 3O7LD 3ULZA 1PMVA 1OIRA 3VS3A 4NK9A 3G51A 3JXWA 3BLQA 4S33A 2PZPA 3T8OA 4YJPA 5E90A 2QOKA 4RC2A 5CALA 4D2TA 5HLWA 4ZLOA 3DKGA 2A1AB 4F63A 4QTCA 2V22A 4S2ZA 4ZTSA 2UZNA 4D28A 1P4FA 3R7VA 2VNYA 2WO6A 3C0HA 4I5CA 2WMUA 3D0EA 2X4ZA 3A4PA 3PJ3A 4PMMA 3LHJA 4ZZMA 3T3UA 3OOMA 4KIQA 3K54A
chains in the Genus database with same CATH superfamily
3Q5ZA 4GVAA 3LQ8A 4O86A 5E8XA 2QU6A 4IHPA 2W7XA 3ORPA 5CEIA 5TKDA 1PXLA 3DXQA 2CCIA 2YABA 1SVHA 2BUJA 3F82A 3PXQA 2PUUA 2O63A 4LYNA 4Y95A 4D4VA 2IVTA 1OL7A 5F9EA 5HE1A 1YKRA 5M56A 3TV7A 3R83A 3EYHA 4N57A 1IG1A 4DINA 3W10A 4XHKB 4MQ1A 5I9WA 2X9FA 4OT6A 3TKUA 4IJ9A 5M06A 1OB3A 5I5ZA 3ORLA 3N51A 4YJQA 4FT9A 4U3YA 4U6RA 5JRSA 4KA3A 2BZHB 3KULB 2R9SA 4KS7A 2VUWA 4XUFA 4NWMA 5HD7A 2WZJA 4FYOA 3E93A 4ASEA 1P5EA 3RPVA 5CAQA 1H4LA 2AYPA 1WBOA 3U9CA 2GNJA 1GZNA 4DG0E 1KOBA 4C38A 2QOQA 5KBQA 4OAUC 4F6UA 3GENA 5CNNA 4MHAA 5LCKA 3EWHA 3E3PA 3W55A 5IA4A 4P2KA 3ZU7A 5IEYA 1AGWA 5KX8A 4DDGA 3KMMA 2NP8A 3KRXA 4RG0A 5FBNC 2VX3A 4EH7A 3G0FA 5JZJA 4MUQA 4BKYA 4CGAA 1NVSA 3PVGA 3R2YA 3CJGA 4C4IA 5FEEA 5I9VA 4BDJA 4GK2A 2OXDA 2BKKA 4R5YA 4JNWA 3MBLA 5K5NA 1ZXEA 3BYSA 4YP8A 3TJDA 4BZOA 4Q5HA 4OGRA 5CF6A 2XP2A 2VTQA 3EIDA 3OC1A 5E91A 4V04A 4NM0A 2BTRA 4FRFA 4BCHA 5L8JA 5TO8A 3CY3A 2R3IA 4CV8A 2XM9A 4DH7A 3MVLA 2ZB0A 1OL5A 1UNLA 2WOUA 4C61A 2VWXA 5JFSA 4RSSA 3TYKA 5DN3A 2HYYA 4TWOA 4WUAA 4YJTA 3SD0A 1V0BA 4DFYA 1XBCA 2VV9A 4U43A 4G3EA 4M67A 5CSHA 3MTFA 2O65A 3U55A 4V01A 5ANEA 1QPDA 2NO3A 3FHRA 4QTEA 2C6OA 4YJOA 4AOIA 4RQKA 3QTSA 1MRYA 2I1MA 1OIQA 3CEKA 4CFMA 1Q4LA 3PYYA 2R3PA 4U41A 1YOJA 5BUJA 5LVPA 4EUUA 1X8BA 5CEQA 3C0IA 5BVDA 5DT0A 4IWDA 4FVPA 5HO8A 1FGIA 3QCSA 2ZJWA 4L53A 4ZLYA 4F1OA 4FKSA 4E6DA 4FKRA 2HY81 3OW3A 2EU9A 3NFFB 3W0SA 4FKIA 3FMMA 5KMIA 1L8TA 3FC2A 4IWQA 4LGDA 1LUFA 2PMIA 4L42A 5HIBA 3NGAA 2OJJA 5EG3A 4TNBA 4DGNA 5HLNA 4OBPA 3QGYA 5FTOA 2VTTA 2XF0A 5BVEA 4II5A 4EHGA 4ALUA 4E5WA 2YERA 2UVYA 2W96B 1VYWA 3FQSA 4I5HA 2SRCA 2J0KA 2WMBA 3IOPA 3ORKA 3QUDA 2Y9QA 2BRBA 3OFMA 3LFQA 3W2PA 4EEVA 4BR3A 5H8GA 5AEPA 2R64A 1J7LA 4BGHA 4BDHA 2GHMA 3GCSA 4GKHA 3L8XA 3OT8A 2C47A 4XG6A 4QYEA 2VGPA 3HP2A 3ROCA 4UMUA 1FBNA 3L9MA 4H1MA 3MPTA 3HX4A 5A14A 2JBPA 4PMTA 4EOJA 4Z55A 2W5BA 5E8WA 4QTDA 4EOSA 1U5QA 1UV5A 3TUDA 1Z9XA 3C13A 4FEQA 4XBUA 5B0XA 3QZHA 1OKYA 3P5KA 3M42A 4EORA 2W9ZB 3WE8A 2CPKE 4FIHA 2F57A 4GK3A 3WZKA 4KRCA 4ZSLA 3DAEA 3K3JA 3W1FA 1R1WA 4BCMA 3RCJA 1VYZA 2ZOQA 4PL3A 2W1HA 4KKHA 3DAJA 5BYZA 4BDEA 3NWWA 3QTIA 3FMEA 3WYXA 4BIBA 3E63A 4QMOA 5CQWA 5EM8A 4JDHA 2EXCX 4HCTA 3FHIA 3NUUA 3RWPA 3VS1A 4YURA 4X3FA 3MB6A 4XLIA 3NZ0A 4HOKA 4WG5A 4MXCA 3DBDA 4DEBA 2QR8A 1JQHA 2ZV2A 2C3IB 4P5ZA 3OBGA 2PVLA 5IMXA 4F7LA 4C3RA 1Q3WA 1YI6A 2YEXA 3E88A 3FXWA 3SLSA 5A4EA 3OWLA 5DWRA 4APPA 4F9WA 2R3QA 1OUYA 2J4ZA 3RINA 4MNFA 2OFVA 1YXUA 3OXZA 5AV4A 1Y57A 3MFTA 4Y5HA 1OI9A 2YIWA 4HGLA 5IQGA 3DLSA 1R39A 5DE2A 3V8TA 4K77A 1JOWB 2R0IA 3AC5A 5CU2A 4F99A 5AX9A 4V0GB 2HK5A 3NCGA 3TXOA 4M97A 5DT4A 3PDTA 3CTJA 4EOLA 5I3RA 5IH6A 3TG1A 4IXPA 3PSBA 4MD8E 4AGDA 4F9YA 5JQ8A 4CFWA 3ZYAA 4H1JA 3RK5A 4G6LA 2QQ7A 4ZOGA 3OY1A 4FSMA 1NVRA 4PTGA 2A4LA 3KK8A 4XRLA 5LWNA 4G3DA 4CZUA 2ITWA 3FY2A 3LM0A 4V0GA 4BCJA 4GVJA 2DQ7X 4FICA 4IM3A 4OTFA 2QOCA 5DRBA 4FZ7A 5L2QA 1UU9A 1Y8YA 2WNTA 4S30A 2XK6A 2YDJA 2JEDA 4YO4A 5M53A 3LMIA 4D2WA 3QTQA 5L6OA 4L45A 3QRJA 1GIIA 1OGYA 1WBVA 2YIRA 4HJOA 3O5AA 1NXKA 2C6MA 3G9LX 1WVXA 3VS5A 1NW1A 2ZDTA 3NRMA 4J52A 3Q5IA 3DT1A 3C4CA 4LRJA 4QQJA 1OBDA 3FZ1A 4PDYA 2XH5A 3CQEA 1BL6A 2UZUE 4FR4A 4K11A 4KD1A 3UVQA 2IG7A 4I20A 2PL0A 2PULA 1FQ1B 1KSWA 2OJFE 1Q8YA 3C9WA 5AP5A 3RVGA 4RIXB 5HESA 3GCPA 4BCNA 4B6LA 4F1TA 2BPMA 5E8VA 5FP5A 2IW9A 5I0BA 2PSQA 2QOBA 4FSTA 3BGZA 4L3LA 4U45A 4YO6A 2OSCA 4RJ4A 4AZTA 4IWOA 2J0LA 3DGKA 4KAOA 5L8LA 3HMIA 4KIPA 2YIXA 4FT3A 3NR9A 3CGOA 4IQ6A 2XS0A 1XH9A 5AWMA 4FV2A 4M7IA 4J98A 5AIRA 2H96A 5A9UA 3MTLA 4F0GA 5EW8A 4OUCA 4F6WA 1MQBA 3JVRA 3Q6UA 3DJ6A 3QRTA 3TACA 2FO0A 4YLLA 4CRLA 5A46A 4YJUA 1MRVA 2F7ZE 4TY1A 1V0PA 2H34A 3MH3A 4FV3A 3PJ8A 1CDKA 3NCZA 3UOJA 4RMZA 4UXQA 4O7NA 4FL2A 2X39A 4XS2A 5AX3A 3T3VA 3FLQA 5F20A 2BILB 2CMWA 2ETKA 3KY2A 4L67A 5KMKA 3DAKA 3IDPA 5LVNA 2BIYA 2GNGA 4KINA 3OTVA 4D1SA 4EOKA 4MQ2A 1G8KA 4MF0A 4LV5A 1YHSA 5D12A 5HX8A 3PA5A 1H28A 4C4JA 4FTIA 3I60A 4GT5A 3AXWA 4JXFA 2OZOA 3NSZA 4AZSA 3QRIA 1H27A 4BZDA 3UNKA 4DF3A 1GIJA 3R8LA 3W0QA 4YHTA 4DCAA 4FBXA 4O0YA 2V7AA 3DLZA 3D83A 3H9RA 4K8AA 4R1YA 3UP2A 4AA4A 1JLUE 3B2WA 3BYUA 5F1ZA 3TTJA 4BDKA 4HVHA 2CGUA 4RWJA 3E3BX 3TKHA 2VWWA 4ASDA 5GZ9A 1PHKA 3PTGA 1J1CA 4YC3A 4F64A 2Z7RA 2VWIA 3M1SA 2XK8A 4TWPA 3FKLA 3HRCA 3PXZA 4AA5A 3I5ZA 3ORNA 4P7EA 3PPJA 2DS1A 2PMNX 1H00A 2BFYA 2C1AA 1H07A 3QRKA 3HVCA 4GL9A 3V5JA 4LDTA 3EN9A 3EN6A 4N6ZA 3RWQA 3N4UA 3LCKA 3C51A 3UTOA 2UW3A 3H10A 5HOAA 2YDIA 3E5AA 3IK3A 5CYIA 3FPQA 4M84A 4TL0A 5I9UA 3QUEA 1RJBA 4NYEA 4TKSA 4JS8A 3SC1A 4ACHA 1Q8UA 2C0OA 3FYKX 4FOBA 3IW7A 2R7BA 4LMNA 4U80A 2ZM4A 3LFEA 2BRNA 5J8IA 3VHKA 3F66A 1Q8WA 1ZOGA 2G15A 4JOAA 2ZVAA 2R3JA 3P1AA 4XH6A 3RZBA 3TV4A 4O7SA 2VO7A 1YDSE 3KXMA 4K2RA 3TEIA 4HPTE 3L9PA 2W05A 2WTIA 3CQWA 4I4EA 4XV9A 4S31A 4Y8DA 4IM0A 4BKZA 3KCFA 3GU5A 3PP0A 4AN9A 2J6MA 2WMTA 4JG8A 5EYMA 4E4MA 3AKJA 4CKIA 3SG8A 3ZTXA 4D1ZA 4JRVA 5KBRA 3BRBA 1CM8A 4QYYA 2JDSA 3PE2A 4AAAA 3FWQA 4QO9A 2B9JA 4WD5A 3OG7A 4YR8A 4K6ZA 3E8CA 4G3FA 3WIKA 3ZFMA 4F0FA 4W8DA 4RIOA 4IWPA 5KE0A 5DR9A 5IQDA 4IVDA 2PZ5A 5ETFA 3SOCA 1E1XA 3VS2A 4MBJA 3TTIA 2JFMA 4DLJA 2QVSE 3EOCA 3F7WA 3D7TB 4FT5A 3S00A 4UN0C 2IF8A 1G8JA 4N0SA 4R7HA 4RJ7A 3BV2A 3IW8A 3RAWA 5D10A 4ALWA 2PVHA 2X6DA 3O96A 5IPJA 5L3AA 4QTBA 2BRMA 3FLNC 2X2MA 3FZOA 3ZSIA 5IG1A 3RMFA 4QMTA 2OKRA 2VTLA 4U8ZA 2VAGA 2XIKA 4NCTA 4PDOA 4EL9A 2VN9A 5CSXA 3LXKA 4RWLA 2QI8A 3FSFA 3E87A 3QQKA 3G6HA 4MH7A 3U4UA 5FXSA 1H1PA 3HUCA 4FTTA 3ATSA 2C30A 2QKWB 3UOKA 4CQEA 4IDVA 2C6KA 3C0GA 3QUPA 2JIIA 1GZOA 4FTRA 3RCDA 5IU2A 3IQ7A 4FSYA 4IAFA 3U6HA 1M2RA 2UW8A 4XP0A 1PW2A 4JDJA 3V5QA 2UZLA 4EH6A 4EOOA 2AC5A 4CZYB 1U59A 3B2TA 4MKCA 4W8EA 3ZC6A 2YM5A 4X6RA 2ERKA 4PMSA 3AGLA 4A9UA 4ORKA 5IZFA 3S1HA 4WG3A 2W1GA 1ZAOA 3FQEA 3F5GA 4BIEA 1IR3A 1IA9A 4U5JA 5I4NA 4AN2A 2BAQA 1XQZA 4CLIA 2C6LA 1GAGA 5AR2A 1E1VA 2YM7A 4IZ7A 4MXXA 4GFOA 1ZOEA 4H3QA 4I0TA 3SX9A 4CFUA 5C8KA 5LWMA 3D7ZA 4QMWA 2QODA 2CKOA 3TM0A 3R30A 3RPYA 4D2VA 3GU4A 4QMXA 4XG2A 2DUVA 3FI8A 4FZDB 5LXMA 5JSMA 5JEBA 3RZFA 2DYLA 4O2PA 2B1PA 4Q5EA 1EH4A 3CC6A 4G34A 2IW8A 4C4FA 2QNJA 3GNIB 3OROA 4FZ6A 4YSJA 5K4IA 3Q4TA 4ACGA 4FUYA 2V7OA 5D41A 2PUIA 3VIDA 2Z7LA 3BGQA 3RHXA 4BKJA 3OF0A 2VTSA 2YJRA 2PUPA 3QZGA 4F7JA 3ANRA 1ATPE 2LGCA 4KIKB 5EDRA 4I94A 3HV5A 4ZAUA 2OO8X 4L3PA 2HY0A 1OL6A 3W2CA 2B4SB 3QKKA 2X81A 5CF4A 3D14A 2QHMA 3R01A 3FZTA 3IG7A 4HYUA 3TV6A 3KQ7A 1XH8A 4F1MA 3TNQB 4RT7A 2E9VA 2VO3A 3LCOA 5J5TA 1OBGA 2XIXA 3KCKA 1AQ1A 4H3PA 3F88A 3KU2A 5AAEA 4U40A 2WXVA 2QOHA 5TF9A 3W2SA 3NUNA 1UNGA 1VLRA 2GFSA 5EW9A 2R2PA 2C6EA 3E62A 4QYHA 3V51A 5ETAA 3ZZWA 4AT4A 3GGFA 4JG6A 2GSFA 2YM8A 3DQXA 4J8NA 2YAKA 2R3MA 3H0YA 4FK3A 3PPKA 5IKWA 2YLFA 3UJGA 2A27A 4TW9A 4EK3A 2J0MB 2CGXA 3EFKA 5JQ5A 1ZY4A 1SMHA 5AP3A 4BCGA 3CSVA 3ENHA 3FMJA 4L46A 5FGKA 3LMGA 2JKKA 5CSPA 4G2FA 2JDVA 4EQMA 4U81A 5JH6A 2BHEA 2XB7A 4DH8A 5CLPA 4RX8A 3BYMA 5FTQA 1XWSA 3S2PA 4Q2AA 4ZZOA 4FIEA 4HGTA 3ZO4A 4QDVA 4NJ3A 4L6QA 2NRYA 2R3RA 3DFAA 4WBBB 1HCKA 4BI0A 4J53A 2UZWE 5FBOA 5AA9A 5KMNA 3A2CA 3KF4A 5DI1A 2QOOA 1XBBA 3KRWA 1Q62A 1YDTE 3I81A 2BVAA 4H36A 4U97A 2XMYA 5EH0A 4D4SA 3HV3A 2B7AA 3BHUA 4GT4A 4CSVA 5HIEA 4C35A 4EJNA 2OFUA 3FLZA 3KXZA 3MY5A 3OCBA 2PYWA 5E9EA 3QXOA 2RFEA 2VX0A 3QD2B 4WOVA 2VWVA 4L8MA 4BI2A 4NKAA 3PPZA 3UOHA 2I40A 1JPAA 4RLKA 3LLAA 2J5FA 2QO9A 1H0VA 5KMLA 4BCOA 1MUOA 3L1SA 1VR2A 4ZS0A 5A6OA 2G2HA 1RE8A 4BCPA 3ALOA 2PVFA 3UPXA 3QF9A 4XG4A 4BCQA 4E93A 2XK7A 3KIOC 3UVRA 5DT3A 4E73A 4AX8A 3PLAE 5EOLA 2JDTA 4O0WA 2IJMA 2ITVA 4FEWA 4B8MA 1TKIA 3JY9A 4XP3A 3OEFX 3R7EA 5AR4A 3MFSA 4G16A 4YLJA 5GZ8A 2ITQA 2I0EA 4J99A 4FTCA 3CXWA 4C58A 3W2OA 3GEQA 3DKOA 4JAIA 3GCQA 4OW8A 5CVHA 3Q32A 3ZCLA 1WMKA 5A6NA 4LGHA 3F2NA 2UUEA 3QBNA 4ANLA 2ITZA 3D5XA 2VTIA 5AUWA 3BE2A 4I6HA 2UVXA 5BMMA 3V5WA 2RG6A 2GQGA 2QO2A 4NT4A 4D0WA 4YU2A 5CEOA 5ICPA 4DA5A 3LKMA 4GFGA 3HZTA 4UALA 3BX5A 3NNUA 1CKJA 4CKJA 2E9NA 3EN4A 3TIYA 2RGPA 5FDXA 3VUIA 4BWPA 5B2MA 5JFXA 4ZEGA 1ZZ2A 4CYJA 3L9NA 3ODZX 1SZMA 4EQCA 1XH7A 2P0CA 5LVLA 4CLJA 4ITIA 4F6SA 2Y0AA 4QNAA 1OIUA 1JSUA 2R3NA 4QEBA 3ACJA 4IAAA 3FKOA 4KKGA 4GG7A 3DPKA 5C9CA 4USEA 4TXCA 2Q83A 4FKQA 4CT1A 4H05A 4DTAA 2R3GA 4NEUA 2ZYBA 1CKPA 1MP8A 4QOXA 4JIAA 1XHAA 3UMWA 4C0TA 3DK7A 3NNXA 5IEVA 1B39A 2W1FA 2X1NA 4JBPA 3VF9A 5A4LA 5K4JA 5EHYA 4RWIA 2PUNA 2P3GX 4AZFA 4YZNA 2XIZA 4BWKA 1H8FA 3R9DA 2UV2A 2VNWA 2Z7SA 1H1RA 4RIYB 3EQHA 3ZBXA 1MRUA 4HVSA 2UZOA 2FSOX 3IO7A 3PXFA 4Y73A 3BLAA 3R8UA 4DAWA 4ACCA 3ZFXA 5FG8A 4W4XA 1TQMA 2ZM1A 2EB3A 3BLRA 3SOAA 4R7BA 2QHNA 4RX9A 3VRZA 4LL5A 3W8QA 4D4RA 3GQIA 5EKNA 3KA0A 4AQCA 5I9XA 2JDOA 4JBOA 5HO6A 5BVWA 5CEKA 2J90A 5H8BA 4D0XA 2J0JA 5H9BA 4FTNA 1JKTA 3ET7A 5AJQA 1OECA 2J51A 5HG9A 4MBLA 2V55A 3WF7A 1HCLA 4R5SA 5KZ0A 2O5KA 4ANOA 5HCYA 3VW6A 4FV9A 4DG3E 4RIYA 2ITXA 2AQXA 3EQBA 4C7TA 2I0VA 5BYLA 3JPVA 2Y4IB 3A7FA 5T68A 4EBVA 4GFMA 4UMRA 5AP1A 2GCDA 3LJ2A 5FWKK 5DG5A 1GNGA 5AR5A 4EH3A 1YRPA 3FC1X 4IVAA 4NZWB 2BIKB 4M68A 4FKOA 5HX6A 2Y8OA 4EYMA 4EZ7A 5F94A 5JFWA 4K0YA 5KCVA 2WEVA 3KF7A 5EM7A 2ERZE 2GMXA 3ID6C 4JIKA 3U8WA 4J8MA 4Y5QA 2CKPA 1I09A 5CVFA 4BDBA 5BVKA 3S95A 3RM6A 2JLDA 5FM2A 4G9RA 5CQUA 1ZMVA 3MN3A 4YBKA 3GQLA 1H26A 2C5YA 2YN8A 3EQIA 4YJSA 4JLCA 5BUEA 1RW8A 5DA3A 3R8MA 3WI6A 5F95A 3WBLA 3ZO3A 3W0PA 2VWUA 4LI5A 2GS7A 2B0QA 3PJ2A 3PY3A 1FMOE 1OPJA 3QC9A 3QQLA 2WQOA 4FKTA 2H9VA 3TZ9A 3QX4A 5A4CA 3IPHA 5H8EA 4IZYA 2GQRA 4LV8A 2IWIA 5F4NA 3GCVA 2ETRA 3WZJA 4E4XA 3LJ1A 4DEDA 3NMUF 4GIHA 2JGZA 5E1EA 3POOA 3MVJA 3VRYA 2XKDA 4RJ6A 4BL1A 2C0IA 4D55A 4QNYA 3FE3A 5EDQA 3C1XA 4E26A 1J91A 2BHHA 3Q9ZA 4XYFA 2BFXA 2YWPA 4A9SA 5DRDA 2GHLA 4JR7A 3UYTA 3RBWA 2C3KA 4BGGA 4QPMA 4BGQA 4O7WA 3ZONA 3QALE 1G5SA 4TYEA 5D11A 2PVJA 3PG1A 1REJA 2VX1A 4M12A 4FVRA 4I1ZA 1APME 2HZNA 4X6QC 4IJPA 3B8RA 4ZS4A 4IW0A 5GIOE 4WSQA 4J96A 3Q9YA 3S4QA 4BJJA 4QP4A 1LEZA 3QQUA 3O17A 3UC4A 4NTTA 4U9AA 4M13A 3CJFA 3HECA 4Q9SA 4V05A 3U51A 3UYSA 2VTRA 3CD3A 5EM5A 1YXSA 4GEOA 4S32A 5K0XA 4DT9A 3QQJA 2WMSA 2XRUA 3UQGA 3A62A 2Y7JA 4DDIA 1K2PA 3RNIA 3BU5A 1DAWA 3QWKA 1ZYCA 3NVMB 4FT7A 4AQKA 1OITA 1WBNA 3P08A 5M4CA 3P7BA 3TCPA 2YITA 3QCQA 2VD5A 1Y91A 3R0TA 1QL6A 5EW3A 2GTMA 3Q4UA 4IVCA 2VTHA 3HEGA 3OT3A 4BDGA 3ZLSA 5J9ZA 3CTHA 4C33A 2HOGA 4DBNA 4I92A 4TZRA 3UDSA 5AUUA 3IKAA 3NUYA 2YCFA 3LVPA 3I7BA 3FDNA 4FNYA 4WNMA 4D2PA 2W06A 4TT7A 4GU6A 3ZHPC 4ACMA 3D5UA 4CMUA 4O82A 4GV1A 4MD9E 1JKLA 5HTIA 3SA0A 3O7LB 3HUBA 2CNQA 4ZMFA 3BEGA 5JRQA 3TZ7A 1DI8A 3PIYA 4KABA 4LUEA 5AUYA 4F4PA 3P5JC 5IQIA 2F7XE 4R3RA 3ZUVA 3FI3A 5HLPA 2RF9A 3D94A 3LFSA 1OZ1A 3CS9A 3LXNA 1BLXA 3NYNA 4TWNA 5C1QB 2E9PA 4WNOA 4BTKA 2X0OA 4DFNA 4F70A 4IAYA 3ZH8A 4FKPA 4NW6A 4E6CA 2QD9A 2R3KA 4FSRA 3TUCA 4ZTMA 3A7JA 2IVUA 4GT3A 4EK4A 4EZ5A 2FSMX 4U44A 1VEBA 4CCUA 3W0MA 3PUPA 4R7IA 2YIQA 3Q6WA 3FBVA 2VRXA 3EHAA 4BIDA 3GU8A 3ZRKA 3CR0A 2BROA 4QQ5A 3PJCA 4UYAA 5CSWA 5GHVA 3ZDUA 4HGSA 3KN5A 2PTKA 3WIGA 2G01A 4UWYA 4IAIA 3KRLA 3VS6A 3WOWA 4XJ0A 4X3FB 4IX5A 4G17A 3MVHA 4PP9A 2C6DA 2WAJA 1UWJA 3Q96A 1DS5A 4I41A 4ZZNA 3TDVA 4O2ZA 3R7UA 4AG8A 5JKGA 3G9NA 4M8TA 2H8HA 3UDTA 3NAXA 4WA9A 4ANSA 5CAOA 4EOPA 3FL5A 1PMEA 5JZNA 4FX3A 3D2KA 4BBEA 2HWPA 4JQ8A 4NKSA 4YZCA 3U6IA 5BUIA 4WHZA 2F49A 5E92A 3QA8A 1M2PA 3DKCA 3NS9A 3C4XA 4UV0A 3LFBA 3Q2JA 3ZEWA 4IZAA 1PKGA 3ANQA 3VUKA 4FTUA 4GUBA 5DVRA 4O6EA 4PMPA 1YXTA 4DHFA 4YPSA 4FGRA 2FA2A 4L43A 3QQFA 4YMJA 4RJ3A 1CSNA 2OF4A 4C2WA 3K5UA 4GW8A 4RX7A 4KBCA 3DA6A 5KNJA 2W1IA 4RA5A 3ZEPA 5BVNA 3R9HA 1XKKA 3I4BA 1FPUA 1UU7A 4UEUA 4FE2A 2W4JA 2XKCA 3R04A 3V01A 5CX9A 2Q0BA 4YGAA 4PP7A 5AUXA 2KULA 2XNBA 4E4NA 2XAMA 3EYGA 5CANA 1PJKA 2XA4A 3ETAA 4QDEA 4MF1A 3MB7A 5DMZA 2G1TA 2Z2WA 4HGEA 4CFFA 4BTFA 3P78A 1R0EA 3HP5A 4NW5A 3CPBA 5AP0A 3KREA 3A7HA 3S3IA 3NUXA 3ZXZA 1S9JA 2GFCA 3KXGA 4RC4A 1WZYA 4Y85A 3UNJA 2W1EA 1STCE 3LLTA 5K0KA 3ZO1A 3QKMA 2E9OA 2W4KA 2PZYA 4PL5A 2HXQA 1YWVA 4KBAA 1B6CB 3ZUTA 4E8AA 2XIYA 5HG5A 4QTAA 2OZAA 3HMOA 4FA2A 3I6UA 4HW7A 3AG9A 3DB6A 4RVLA 5CF5A 2A98A 4AA0A 3C5IA 4QP3A 3V6SA 4Y72A 4M0ZA 4I23A 4XV1A 5LMAA 5LJJA 3NDMA 4MAOA 3UG2A 3EQFA 5KUPA 4DYMA 3Q4CA 4DBXA 4GH2A 1KUTA 5HNGA 4FIGA 1PYEA 5LVOA 4KB8A 3A61A 4J7BA 3MPAA 3F5XA 5AR3A 3W2QA 3ACKA 1OL2A 3E8NA 5CTPA 1YI3A 3DNDA 3OVVA 3ZDIA 4O4EA 2C1BA 3JS2A 3PA3A 2WMQA 3GP0A 4KWPA 2WMAA 3GVUA 4BFMA 4AOTA 2Q0NA 4ERKA 2F2CB 2HW6A 5FXQA 2JD5A 4F09A 5AADA 4O0UA 1H24A 2VGOA 2XBAA 1OL1A 4ZY6A 5J7HA 2XNEA 2X7GA 3GUBA 3OXTA 3LCTA 4FKWA 2WMRA 3NUSA 2R4BA 3REPA 4B9DA 1I44A 2CGWA 2IVSA 2Z7QA 2ZV8A 3ZLXA 4A07A 4BRXA 4FIIA 4KS8A 3LOKA 4D5KA 3O8TA 4ZJIA 4O83A 3CKXA 4F7NA 1H1WA 3KFAA 4W9XA 3OCSA 5EYDA 5C27A 3MESA 4GKIA 3DZQA 2BR1A 1BUHA 3RPRA 4ASZA 4BTMA 3FL4A 4YJNA 5C26A 4NM7A 4TYGA 5M4FA 3DBFA 4ZY5A 1BYGA 2LAVA 3CGFA 5ANDA 3D5WA 4I3ZA 5HBEA 3BYVA 3CLYA 3W0OA 2YCRA 1O6KA 1ZLTA 3DFCB 3UOLA 3AT4A 3MA6A 3MH2A 4MCVA 2ITUA 5DIAA 3OZ6A 4YPDA 5ANJA 4AOJA 5BVOA 2C5NA 3LQ3A 4M15A 4PX6A 5IA2A 3FXXA 5HQ0A 4I21A 5LVMA 3HGKA 3PLSA 2X6EA 4DC2A 4O91A 5DPVA 5CAUA 4IAKA 5J95A 3K5VA 2A0CX 2WOTA 3LAUA 2WTCA 2UW7A 4YC6A 2JAMA 3G2FA 3FEGA 1ZYDA 1OKWA 2ITPA 2RFDA 3EL8A 3Q60A 2B9FA 5T3QA 1H0WA 2PVKA 2WIHA 3BBTB 4GS6A 3VWAA 5EI6A 2J0IA 4OTIA 3C4FA 2O2UA 5EM6A 4GJ3A 2KTYA 1DI9A 3QD0A 4IX4A 3SXFA 2EB2A 2ZMDA 2QC6A 1YDRE 3O51A 4L00A 4DGOA 1YOMA 2BALA 2VTAA 2O3PA 2XZSA 3N9XA 3ORTA 4QMLA 3TUBA 1O6LA 3MH1A 2HAKA 1Y6BA 4DGLC 4ITHA 3H30A 2CLQA 3MH0A 4HNIA 4AW5A 4BCKA 2JBOA 3EQPA 4O0SA 4U0IA 4XNEA 3ZC5A 1F0QA 4NSTA 4PWNA 2W9FB 4QYFA 5DR6A 4W4WA 4EONA 2ACXA 2WQEA 3WF9A 3ZXTA 2X7OA 3WZDA 3ZS5A 4DHJA 4GMYA 3VS7A 1DM2A 3AC1A 5EI2A 5J1VA 3V8WA 5IQBA 3Q04A 1JBPE 5E8TA 5CSVA 4CYIA 5A54A 2ZV7A 3S0OA 1WVWA 3QA0A 3ORIA 1IAJA 5CNOA 4I6LA 4EZ3A 3EQRA 5HE0A 1WBPA 2JITA