1M32A

Crystal structure of 2-aminoethylphosphonate transaminase
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
361
structure length
361
Chain Sequence
YLLLTPGPLTTSRTVKEAMLFDSCTWDDDYNIGVVEQIRQQLTALATASEGYTSVLLQGSGSYAVEAVLGSALGPQDKVLIVSNGAYGARMVEMAGLMGIAHHAYDCGEVARPDVQAIDAILNADPTISHIAMVHSETTTGMLNPIDEVGALAHRYGKTYIVDAMSSFGGIPMDIAALHIDYLISSANKCIQGVPGFAFVIAREQKLAACKGHSRSLSLDLYAQWRCMEDNHGKWRFTSPTHTVLAFAQALKELAKEGGVAARHQRYQQNQRSLVAGMRALGFNTLLDDELHSPIITAFYSPEDPQYRFSEFYRRLKEQGFVIYPGKVSQSDCFRIGNIGEVYAADITALLTAIRTAMYWT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-aminoethylphosphonate-pyruvate aminotransferase
publication title Degradation Pathway of the Phosphonate Ciliatine: Crystal Structure of 2-Aminoethylphosphonate Transaminase
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Transferase
total genus 127
structure length 361
sequence length 361
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.6.1.37: 2-aminoethylphosphonate--pyruvate transaminase.
pdb deposition date 2002-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00266 Aminotran_5 Aminotransferase class-V
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 1m32A02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 1m32A01
3A8UX 4WXGA 1SZUA 3H14A 3TFUA 2W7FA 4ZM4A 1ELQA 1O61A 2AEVA 2AY5A 3BS8A 1QZ9A 3HMUA 3ZRRA 3LVKA 1M32A 2BIAA 2XBNA 3EUCA 1IBJA 1BJ4A 3E2ZB 4PIWA 1I41A 4TN4A 4PVFA 1ARGA 1S09A 2W7IA 1WYUB 2WK7A 4WXFA 2X8UA 4W8IA 2O1BA 2W7KA 3FVSA 1AKBA 4N0WA 2EZ2A 4KAMA 3MAUA 1TARA 4Q76A 1TATA 3LWSA 5D95A 1OHVA 1TASA 3FVUA 4IXOA 4ZDOA 2VMOA 2Z61A 1AHEA 2FYFA 2YKVA 5DX5A 3ZRQA 2W7HA 1Z3ZA 1ARTA 1ASEA 5DJ1A 4WYGA 2CANA 1FC4A 1IX8A 2VMXA 3GJUA 3W1IA 1ZOBA 1BJOB 2R0TA 1UU0A 1QIRA 5EIGB 3B8XA 1W3UA 1AY5A 3FFHA 4WD2A 4CXRA 4ADCA 1ZC9A 1LC5A 1N31A 2BHXA 3JW9A 3JTXA 4EMYA 1ASBA 2ZP7A 3ASAA 4OBVA 1AJRA 3GBXA 2CJGA 2D61A 3A9ZA 3FCRA 4LNJA 1G4VA 1PMOA 1YAAA 4A6RA 3LVJA 4DBCA 3IHJA 3MC6A 2BWOA 3A9YA 2BWPA 3VOMA 4F5HA 2V1PA 1N2TA 1GEXA 2OATA 3DXVA 1KKJA 5E4ZA 3QM2A 1AHXA 2DGLA 4RM1A 3N75A 2BIEA 2V0YA 1AIAA 1KL1A 2YKXA 4M2KA 3P1TA 2D63A 4ISYA 4JE5A 4E3RA 3W1HA 1AY4A 2VGUA 2VMTA 3NYSA 2YHKA 2FN6A 2BWNA 2VIAA 3I4JA 2R5CA 4ADBA 3AEPA 5BJ4A 4A6TA 4ATPA 5C6UA 4Y0HA 4RJYA 2E7UA 3JWAA 1P3WA 1PMMA 2Z9VA 1LC8A 3PD6A 4B98A 3MC6C 2E54A 4BQ0A 1ARHA 1IX7A 2QMAA 3ELPA 3PJ0A 3BCBA 2CFBA 3EI8A 1RV3A 1CZEA 3WX9A 1AKAA 1ASCA 2OGEA 1AMSA 4MQQA 1VJOA 3WZFA 2QLRA 4F5FA 2OGAA 1EJIA 4ZWMA 2ZSMA 1C9CA 3RBLA 3RCHB 4ATQA 4WB0B 5DJ9A 3HQTA 2YKUA 4Q6RA 1CQ8A 1M0QA 3BCAA 4ZWVA 2W7EA 3FTBA 3L44A 1N8PA 1QGNA 2HUUA 3E2YA 4TV7A 3AATA 1MGVA 3LY1A 2PO3A 2GSAA 2C7TA 4OTLA 3CQ4A 3RBFA 1ARIA 1OATA 5IWQA 1SPAA 1BS0A 1S08A 2HOZA 4CBRA 2VMRA 5G09A 5F8VA 3DYDA 4L0OA 4XJOA 4F5GA 2W7DA 4QGRA 1D7VA 2CINA 1M0PA 4F5IA 2HORA 1M0NA 1JF9A 3FSLA 2X5DA 4GDYA 4LNMA 1LW5A 1AMAA 3E2ZA 3PAAA 4RJ0A 3VAXA 1WKHA 1X2AA 3QHXA 4IX8A 1FG3A 4M2JA 3FVXA 3PDBB 4XK1A 3WGCA 3ATHA 4ZASA 4GE7A 4IYOA 3MEBA 2VMWA 2CJHA 3BN1A 3HBXA 4A6UA 3AEJA 3NUBA 3EZ1A 2FQ6A 1WYTA 3FZ8A 3PIUA 4JE5D 4RIZA 1ELUA 4UOYA 3TATA 4JEZA 2GB3A 3HDOA 2Z1ZA 3EI5A 4FL0A 4MQPA 3ACZA 1XEYA 5EIGA 1KMJA 2HP2A 3TCMA 2BI3A 1B5OA 1AICA 3H7FA 5EUNA 3EI6A 4AO9A 9AATA 3EZSA 3FDBA 2JJFA 2YCPA 4Y0DA 3COGA 3RUYA 1AX4A 1JS6A 1T3IA 3B1DA 3FZ6A 4I8AA 2O7CA 1G7XA 1GC0A 4LC3A 1WYVB 3USFA 1FG7A 2WKAA 1DJEA 2OKKA 4A00A 1XI9A 5G2PA 1S07A 3CBFA 3QGUA 3N0LA 5FT5A 2VMYA 1H0CA 2AEUA 1VP4A 3AEJC 5TF5A 2D5YA 1B4XA 1EG5A 3KGWA 5F9SA 2ZC0A 2EZ1A 4RLGA 1YOOA 4JEXA 1S0AA 4WYFA 3L8AA 2E7JA 4W1VA 1GBNA 3AEMA 1IJIA 4BHDA 1M0OA 2W8JA 1ECXA 1MDZA 2D7ZA 4MGRA 2TPLA 4RAEA 4KXKA 4CBSA 3NRAA 1RVUA 1V2FA 3HVYA 2VMPA 2FNUA 4IW7A 4WYDA 4EU1A 1TOGA 2DOUA 2CJDA 1X28A 2VLFA 2ZJGA 2FNIA 3JWBA 4XJPA 1SFFA 2ZY3A 3B1EA 2C81A 2EPJA 4EFFA 3AOWA 2Z67A 4UQVA 4WLJA 3WCNA 4NOGA 2FM1A 3QI6A 4PFFA 3LV2A 3FD0A 3M5UA 1B8GA 1YJZA 2BI2A 2W8UA 3W1JA 1IAYA 5M4DA 3HL2A 4K2MA 3E9KA 4CVQA 2W7GA 2ZY4A 3NYUA 1O4SA 5E3KA 4ZSWA 4HVKA 5AX8A 4F5KA 4MSOA 1GCKA 1W23A 3AEMC 4ZSYA 1M7YA 3GWPA 3G0TA 1OXOA 4M2MA 1DFOA 3D6KA 5D5SA 1KMKA 3CAIA 5EQCA 1ASLA 1GC3A 3WCOA 4E1OA 2Q7WA 3FFRA 4UHMA 2CTZA 4XQ2A 4GSAA 2W7MA 2GMSA 2AY6A 2NMPA 2QB2A 3ZRPA 1X29A 1BT4A 3FQAA 2EGYA 3ECDA 2ZSLA 3A2BA 5G4IA 5E5IA 1CZCA 5FT8A 3T32A 4A0FA 3EIAA 2VMSA 4WBTA 1CL1A 8AATA 3K7YA 2R2NA 1MAQA 2GMUA 3AENA 1IAXA 3E6GA 1ASNA 2Z1YA 3DXWA 3MBBA 4LNLA 5EUDA 1CQ6A 3II0A 5EAVA 3R4TA 3ASBA 4E77A 1AHGA 3DR4A 3NYTA 4MKJA 4GE9A 3K40A 1D7SA 3E2FA 3G8MA 1QISA 1MLZA 3PDBA 1TOEA 3BB8A 4ZDPA 3OKSA 3VP6A 1BW0A 5LHAA 1ASMA 1YJSA 4EB5A 3MAFA 4LW4A 2ZY5A 4ZDLA 4WXBA 3AV7A 2BIGA 4UHOA 2DGMA 1YIZA 4EB7A 1GEYA 1C0NA 1H1CA 2E7IA 2VGSA 5HDMA 2YKYA 3WKSA 1YIYA 1DTYA 4TMRA 4AZKA 3NX3A 3QBOA 2AATA 1W7LA 2C44A 1MDXA 1SZKA 4OT8A 4R5FA 4AH3A 2ZYJA 3GZDA 1B9HA 4IY7A 2VMQA 1LK9A 3WY7A 1OHYA 3KKIA 4BMKA 1BQAA 1I29A 1YNUA 4R8DA 2D65A 5I92A 4MQRA 2CY8A 1CL2A 1SZSA 4DGTA 1WYUA 1D7RA 2VYCA 2R5CB 2ZUKA 2W7LA 4AO4A 4ZM3A 1C7OA 2HOXA 4Q31A 1AMRA 1ASGA 4A72A 1DJ9A 1BQDA 3P6KA 1BJWA 4JF0A 3AELA 3AEOA 3VK3A 3KGXA 1ARSA 1RVYA 4F5LA 2W7JA 2R5EA 2YCNA 1E5EA 3G7QA 5BJ3A 2HZPA 1G7WA 4BA4A 3QN6A 4WYCA 1V2DA 5K8BA 4WLHA 1PFFA 4LW2A 4OC9A 2WK9A 4CXQA 1BJOA 2HUIA 3GZDC 1TOIA 2XH1A 3DR7A 3FZ7A 3BC8A 2JGTA 2VGVA 2X3LA 1J32A 1EQBA 4JEWA 4MY5A 4ITXA 4AZJA 3DODA 4RKCA 1O69A 1SF2A 1AKCA 1LW4A 1OXPA 3GR9A 1O62A 4OCAA 2DKJA 3HLMA 3LG0A 2QB3A 3FKDA 2YRIA 1ASDA 1QITA 4H51A 3BWNA 4JF1A 2EO5A 2YRRA 2W8TA 2W8WA 1CJ0A 3PDXA 4FFCA 2GQNA 1JG8A 4HF8A 3F9TA 3UWCA 2AY7A 5FT4A 4Y0IA 1AAWA 2VMUA 4GE4A 7AATA 3GETA 3E77A 1IX6A 2CH2A 3BV0A 4AOAA 1UU2A 2VMVA 1C7GA 5G4JA 1MLYA 2DR1A 1AY8A 1JS3A 3MKJA 2JJHA 4W1WA 3R9AA 1GDEA 4BA5A 3DZZA 1DGEA 2HOYA 3UE8A 3BCXA 5G0AA 3GZCA 1VEFA 3AOVA 3NTJA 3TQXA 3JZLA 2D64A 1AJSB 2AY2A 3NU8A 4IYOB 2W8VA 4RKDA 1BKGA 2G6WA 3QPGA 5LH9A 4W5KA 3BWNC 1AAMA 3I5TA 4E3QA 1X0MA 2Z9UA 4IXZA 3MADA 1PG8A 1WYTB 1U08A 2PB0A 1AMQA 4KYOA 3OP7A 4P3MA 5DB5A 2EH6A 2VI8A 5JAYA 1D7UA 1BJNA 1MDOA 1CS1A 2AY9A 2DKBA 4XJMA 3RCHA 2VIBA 3NDNA 2VMNA 5M46A 1B5PA 1E5FA 2VGTA 4WB0A 1KKPA 1ASAA 4B9BA 5HXXA 2ZY2A 1C4KA 1GC2A 3NUIA 1CQ7A 1SVVA 4OBUA 2CH1A 4XAUA 4ADDA 1G4XA 1KL2A 1DKAA 2QA3A 1IVRA 1C7NA 3FRKA 4O6ZA 3TFTA 3JU7A 4A0RA 5J8QA 4R5ZA 1LC7A 1LKCA 1V2EA 1AHYA 1V72A 3FQ7A 3PGYA 2D66A 2VI9A 3F0HA 1Z7DA 1Y4IA 3VK4A 2BKWA 2HP1A 1W7MA 1RV4A 1MAPA 4U2HA 3UAKA 3DRDA 3GSBA 1AHFA 4N0BA 2VGWA 4Q75A 2HUFA 4GEBA 4ITGA 5M4BA 2AY3A 4UHNA 1UU1A 2BI9A 4W1XA 2OKJA 4R2NA 3LVMA 1I43A 2X5FA 1GD9A 2CSTA 2BI5A 2CB1A 3WGBA 3DU4A 3FQ8A 3EIBA 1DGDA 4OMAA 2DGKA 1DJUA 1M4NA 3KE3A 4F5MA 2Z20A 1AIBA 1S06A 1ASFA 4JEYA 4ADEA 1GEWA 1LS3A 4A0GA 2BYJA 4OYTA 3B1CA 4XJLA 1D2FA 1TPLA 4U1TA 3F6TA 5FT6A 4P7YA 3CQ6A 3WKRA 4F4EA 1IUGA 2F8JA 2JJGA 3IF2A 1GC4A 3PA9A 2O0RA 3K28A 4WYEA 1QJ3A 2OQXA 2JJEA 3B46A 1J04A 3FDDA 4RITA 1WYVA 1WKGA 4WP0A 3NNKA 5HHYA 2BYLA 3EI9A 4K2BA 1YJYA 5M49A 5EAAA 3N5MA 2Z9XA 2YOBA 2AY4A 3HT4A 3A9XA 4J5UA 1QJ5A 3WLXA 3PD6B 2D7YA 1ORDA 3RQ1A 4XEWA 4ZLVA 3AENB 2Z9WA 3I16A 3RI6A 4ZAHA 2PB2A 3EI7A 3NU7A 4A0HA 4J8LA 1B9IA 3BWOA 1WSTA 3Q8NA 3ZZKA 4K2IA 1OHWA 3DC1A 4IXSA 1ZODA 2JISA 2AY1A 2YCTA 3LVLB 3PPLA 4W91A 2ORDA 3ZZJA 2QBTA 1I48A 4DQ6A 1M6SA 2VGZA 1AJSA 1TOKA 4F5JA 3ISLA 1TOJA 4MKKA 4PFNA 3ELEA 2C0RA 2JG2A 3MAFB 4GRXA 2VMZA 2WK8A 5EUEA 2BI1A 5G2QA 2VLHA 5EFSA 3CQ5A 4JEVA 4WYAA 1UKJA 3VK2A 1W7NA 2RFVA 2AY8A
chains in the Genus database with same CATH superfamily
3A8UX 4WXGA 1SZUA 3H14A 3TFUA 2W7FA 4ZM4A 1ELQA 1O61A 2AEVA 2AY5A 3BS8A 1QZ9A 3HMUA 3ZRRA 3LVKA 1M32A 2BIAA 2XBNA 3EUCA 1IBJA 1BJ4A 3E2ZB 4PIWA 1I41A 4TN4A 4PVFA 1ARGA 1S09A 2W7IA 1WYUB 2WK7A 4WXFA 2X8UA 4W8IA 2O1BA 2W7KA 3FVSA 1AKBA 4N0WA 2EZ2A 4KAMA 3MAUA 1TARA 4Q76A 1TATA 3LWSA 5D95A 1OHVA 1TASA 3FVUA 4IXOA 4ZDOA 2VMOA 2Z61A 1AHEA 2FYFA 2YKVA 5DX5A 1KAFA 3ZRQA 2W7HA 1Z3ZA 1ARTA 1ASEA 5DJ1A 4WYGA 2CANA 1FC4A 1IX8A 2VMXA 3GJUA 3W1IA 1ZOBA 1BJOB 2R0TA 1UU0A 1QIRA 5EIGB 3B8XA 1W3UA 1AY5A 3FFHA 4WD2A 4CXRA 4ADCA 1ZC9A 1LC5A 1N31A 2BHXA 3JW9A 3JTXA 4EMYA 1ASBA 2ZP7A 3ASAA 4OBVA 1AJRA 3GBXA 2CJGA 2D61A 3A9ZA 3FCRA 4LNJA 1G4VA 1PMOA 1YAAA 4A6RA 3LVJA 4DBCA 3IHJA 3MC6A 2BWOA 3A9YA 2BWPA 3VOMA 4F5HA 2V1PA 1N2TA 1GEXA 2OATA 3DXVA 1KKJA 5E4ZA 3QM2A 1AHXA 2DGLA 4RM1A 3N75A 2BIEA 2V0YA 1AIAA 1KL1A 2YKXA 4M2KA 3P1TA 2D63A 4ISYA 4JE5A 4E3RA 3W1HA 1AY4A 2VGUA 2VMTA 3NYSA 2YHKA 2FN6A 2BWNA 2VIAA 3I4JA 2R5CA 4ADBA 3AEPA 5BJ4A 4A6TA 4ATPA 5C6UA 4Y0HA 4RJYA 2E7UA 3JWAA 1P3WA 1PMMA 2Z9VA 1LC8A 3PD6A 4B98A 3MC6C 2E54A 4BQ0A 1ARHA 1IX7A 2QMAA 3ELPA 3PJ0A 3BCBA 2CFBA 3EI8A 1RV3A 1CZEA 3WX9A 1AKAA 1ASCA 3N4SA 2OGEA 1AMSA 4MQQA 1VJOA 3WZFA 2QLRA 4F5FA 2OGAA 1EJIA 4ZWMA 2ZSMA 1C9CA 3RBLA 3RCHB 4ATQA 4WB0B 5DJ9A 3HQTA 2YKUA 4Q6RA 1CQ8A 1M0QA 3BCAA 4ZWVA 2W7EA 3FTBA 3L44A 1N8PA 1QGNA 2HUUA 3E2YA 4TV7A 3AATA 1MGVA 3LY1A 2PO3A 2GSAA 2C7TA 4OTLA 3CQ4A 3RBFA 1ARIA 1OATA 5IWQA 1SPAA 1BS0A 1S08A 2HOZA 4CBRA 2VMRA 5G09A 5F8VA 3DYDA 4L0OA 4XJOA 4F5GA 2W7DA 4QGRA 1D7VA 2CINA 1M0PA 4F5IA 2HORA 1M0NA 1JF9A 3FSLA 2X5DA 4GDYA 4LNMA 1LW5A 1AMAA 3E2ZA 3PAAA 4RJ0A 3VAXA 1WKHA 1X2AA 3QHXA 4IX8A 1FG3A 4M2JA 3FVXA 3PDBB 4XK1A 3WGCA 3ATHA 4ZASA 4GE7A 4IYOA 3MEBA 2VMWA 2CJHA 3BN1A 3HBXA 4A6UA 3AEJA 3NUBA 3EZ1A 2FQ6A 1WYTA 3FZ8A 3PIUA 4JE5D 4RIZA 1ELUA 4UOYA 3TATA 4JEZA 2GB3A 3HDOA 2Z1ZA 3EI5A 4FL0A 4MQPA 3ACZA 1XEYA 5EIGA 1KMJA 2HP2A 3TCMA 2BI3A 1B5OA 1AICA 3H7FA 5EUNA 3EI6A 4AO9A 9AATA 3EZSA 3FDBA 2JJFA 2YCPA 4Y0DA 3COGA 3RUYA 1AX4A 1JS6A 1T3IA 3B1DA 3FZ6A 4I8AA 2O7CA 1G7XA 1GC0A 4LC3A 1WYVB 3USFA 1FG7A 2WKAA 1DJEA 2OKKA 4A00A 1XI9A 5G2PA 1S07A 3CBFA 3QGUA 3N0LA 5FT5A 2VMYA 1H0CA 2AEUA 1VP4A 3AEJC 5TF5A 2D5YA 1B4XA 1EG5A 3KGWA 5F9SA 2ZC0A 2EZ1A 3H9XA 4RLGA 1YOOA 4JEXA 1S0AA 4WYFA 3L8AA 2E7JA 4W1VA 1GBNA 3AEMA 1IJIA 4BHDA 1M0OA 2W8JA 1ECXA 1MDZA 2D7ZA 4MGRA 2TPLA 4RAEA 4KXKA 4CBSA 3NRAA 1RVUA 1V2FA 3HVYA 2VMPA 2FNUA 4IW7A 4WYDA 4EU1A 1TOGA 2DOUA 2CJDA 1X28A 2VLFA 2ZJGA 2FNIA 3JWBA 4XJPA 1SFFA 2ZY3A 3N7NA 3B1EA 2C81A 2EPJA 4EFFA 3AOWA 2Z67A 4UQVA 4WLJA 3WCNA 4NOGA 2FM1A 3QI6A 4PFFA 3LV2A 3FD0A 3M5UA 1B8GA 1YJZA 2BI2A 2W8UA 3W1JA 1IAYA 5M4DA 3HL2A 4K2MA 3E9KA 4CVQA 2W7GA 2ZY4A 3NYUA 1O4SA 5E3KA 4ZSWA 4HVKA 5AX8A 4F5KA 4MSOA 1GCKA 1W23A 3AEMC 4ZSYA 1M7YA 3GWPA 3G0TA 1OXOA 4M2MA 1DFOA 3D6KA 5D5SA 1KMKA 3CAIA 5EQCA 1ASLA 1GC3A 3WCOA 4E1OA 2Q7WA 3FFRA 4UHMA 2CTZA 4XQ2A 4GSAA 2W7MA 2GMSA 2AY6A 2NMPA 2QB2A 3ZRPA 1X29A 1BT4A 3FQAA 2EGYA 3ECDA 2EYQA 2ZSLA 3A2BA 5G4IA 5E5IA 1CZCA 5FT8A 3T32A 4A0FA 3EIAA 2VMSA 4WBTA 1CL1A 8AATA 3K7YA 2R2NA 1MAQA 2GMUA 3AENA 1IAXA 3E6GA 1ASNA 2Z1YA 3DXWA 3MBBA 4LNLA 5EUDA 1CQ6A 3II0A 5EAVA 3R4TA 3ASBA 4E77A 1AHGA 3DR4A 3NYTA 4MKJA 4GE9A 3K40A 1D7SA 3E2FA 3G8MA 1QISA 1MLZA 3PDBA 1TOEA 3BB8A 4ZDPA 2G7JA 3OKSA 3VP6A 1BW0A 5LHAA 1ASMA 1YJSA 4EB5A 3MAFA 4LW4A 2ZY5A 4ZDLA 4WXBA 3AV7A 2BIGA 4UHOA 2DGMA 1YIZA 4EB7A 1GEYA 1C0NA 1H1CA 2E7IA 2VGSA 5HDMA 2YKYA 3WKSA 1YIYA 1DTYA 4TMRA 4AZKA 3NX3A 3QBOA 2AATA 1W7LA 2C44A 1MDXA 1SZKA 4OT8A 4R5FA 4AH3A 2ZYJA 3GZDA 1B9HA 4IY7A 2VMQA 1LK9A 3WY7A 1OHYA 3KKIA 4BMKA 1BQAA 1I29A 1YNUA 4R8DA 2D65A 5I92A 4MQRA 2CY8A 1CL2A 1SZSA 4DGTA 1WYUA 1D7RA 2VYCA 2R5CB 2ZUKA 2W7LA 4AO4A 4ZM3A 1C7OA 2HOXA 4Q31A 1AMRA 1ASGA 4A72A 1DJ9A 1BQDA 3P6KA 1BJWA 4JF0A 3AELA 3AEOA 3VK3A 3KGXA 1ARSA 1RVYA 4F5LA 2W7JA 2R5EA 2YCNA 1E5EA 3G7QA 5BJ3A 2HZPA 1G7WA 4BA4A 3QN6A 4WYCA 1V2DA 5K8BA 4WLHA 1PFFA 4LW2A 4OC9A 2WK9A 4CXQA 1BJOA 2HUIA 3GZDC 1TOIA 2XH1A 3DR7A 3FZ7A 3BC8A 2JGTA 2VGVA 2X3LA 1J32A 1EQBA 4JEWA 4MY5A 4ITXA 4AZJA 3DODA 4RKCA 1O69A 1SF2A 2FKIA 1AKCA 1LW4A 1OXPA 3GR9A 1O62A 4OCAA 2DKJA 3HLMA 3LG0A 2QB3A 3FKDA 2YRIA 1ASDA 1QITA 4H51A 3BWNA 4JF1A 2EO5A 2YRRA 2QSRA 2W8TA 2W8WA 1CJ0A 3PDXA 4FFCA 2GQNA 1JG8A 4HF8A 3F9TA 3UWCA 2AY7A 5FT4A 2KFPA 4Y0IA 1AAWA 2VMUA 4GE4A 7AATA 3GETA 3E77A 1IX6A 2CH2A 3BV0A 4AOAA 1UU2A 2VMVA 1C7GA 5G4JA 1MLYA 4K05A 2DR1A 1AY8A 1JS3A 3MKJA 2JJHA 2WB6A 4W1WA 3R9AA 1GDEA 4BA5A 3DZZA 1DGEA 2HOYA 3UE8A 3BCXA 5G0AA 3GZCA 1VEFA 3AOVA 3NTJA 3TQXA 3JZLA 2D64A 1AJSB 2AY2A 3NU8A 4IYOB 2W8VA 4RKDA 1BKGA 2G6WA 3QPGA 5LH9A 4W5KA 5KTBA 3BWNC 1AAMA 3I5TA 4E3QA 1X0MA 2Z9UA 4IXZA 3MADA 1PG8A 1WYTB 1U08A 2PB0A 1AMQA 4KYOA 2A1VA 3OP7A 4P3MA 5DB5A 2EH6A 2VI8A 5JAYA 1D7UA 1BJNA 1MDOA 1CS1A 2AY9A 2DKBA 4XJMA 3RCHA 2VIBA 3NDNA 2VMNA 5M46A 1B5PA 1E5FA 2VGTA 4WB0A 1KKPA 1ASAA 4B9BA 5HXXA 2ZY2A 1C4KA 1GC2A 3NUIA 1CQ7A 1SVVA 4OBUA 2CH1A 4XAUA 4ADDA 1G4XA 1KL2A 1DKAA 2QA3A 1IVRA 1C7NA 3FRKA 4O6ZA 3TFTA 3JU7A 4A0RA 5J8QA 4R5ZA 1LC7A 1LKCA 1V2EA 1AHYA 1V72A 3FQ7A 3PGYA 2D66A 2VI9A 3F0HA 1Z7DA 1Y4IA 3VK4A 2BKWA 2HP1A 1W7MA 1RV4A 3N4RA 1MAPA 4U2HA 3UAKA 3DRDA 3GSBA 1AHFA 4N0BA 2VGWA 4Q75A 2HUFA 4GEBA 4ITGA 5M4BA 2AY3A 4UHNA 1UU1A 2BI9A 4W1XA 2OKJA 4R2NA 3LVMA 1I43A 4H63Q 2X5FA 1GD9A 2CSTA 2BI5A 2CB1A 3WGBA 3DU4A 3FQ8A 3EIBA 1DGDA 4OMAA 2DGKA 1DJUA 1M4NA 3KE3A 4F5MA 2Z20A 1AIBA 1S06A 1ASFA 4JEYA 4ADEA 1GEWA 1LS3A 4A0GA 2BYJA 4OYTA 3B1CA 4XJLA 1D2FA 1TPLA 4U1TA 3F6TA 5FT6A 4P7YA 3CQ6A 3WKRA 4F4EA 3N4XA 1IUGA 2F8JA 2JJGA 3IF2A 1GC4A 3PA9A 2O0RA 3K28A 4WYEA 1QJ3A 2OQXA 2JJEA 3B46A 1J04A 3FDDA 4RITA 1WYVA 1WKGA 4WP0A 3NNKA 5HHYA 2BYLA 3EI9A 4K2BA 1YJYA 5M49A 5EAAA 3N5MA 2Z9XA 2YOBA 2AY4A 3HT4A 3A9XA 4J5UA 1QJ5A 3WLXA 3PD6B 2D7YA 1ORDA 3RQ1A 4XEWA 4ZLVA 3AENB 2Z9WA 3I16A 3RI6A 4ZAHA 2PB2A 3EI7A 3NU7A 4A0HA 4J8LA 1B9IA 3BWOA 1WSTA 3Q8NA 3ZZKA 4K2IA 1OHWA 3DC1A 4IXSA 1ZODA 2JISA 2AY1A 2YCTA 3LVLB 3PPLA 4W91A 2ORDA 3ZZJA 2QBTA 1I48A 4DQ6A 1M6SA 2VGZA 1AJSA 1TOKA 4F5JA 3ISLA 1TOJA 4MKKA 4PFNA 3ELEA 2C0RA 2JG2A 3MAFB 4GRXA 2VMZA 2WK8A 5EUEA 2BI1A 5G2QA 2VLHA 5EFSA 3CQ5A 4JEVA 4WYAA 1UKJA 3VK2A 1W7NA 2RFVA 2AY8A
chains in the Genus database with same CATH topology
3A8UX 4WXGA 1SZUA 3H14A 3TFUA 2W7FA 4ZM4A 1ELQA 1O61A 2AEVA 2AY5A 3BS8A 1QZ9A 3HMUA 3ZRRA 3LVKA 1M32A 2BIAA 2XBNA 3EUCA 1IBJA 1BJ4A 3E2ZB 4PIWA 1I41A 4TN4A 4PVFA 1ARGA 1S09A 2W7IA 1WYUB 2WK7A 4WXFA 2X8UA 4W8IA 2O1BA 2W7KA 3FVSA 1AKBA 4N0WA 2EZ2A 4KAMA 3MAUA 1TARA 4Q76A 1TATA 3LWSA 5D95A 1OHVA 1TASA 3FVUA 4IXOA 4ZDOA 2VMOA 2Z61A 1AHEA 2FYFA 2YKVA 5DX5A 3ZRQA 2W7HA 1Z3ZA 1ARTA 1ASEA 5DJ1A 4WYGA 2CANA 1FC4A 1IX8A 2VMXA 3GJUA 3W1IA 1ZOBA 1BJOB 2R0TA 1UU0A 1QIRA 5EIGB 3B8XA 1W3UA 1AY5A 3FFHA 4WD2A 4CXRA 4ADCA 1ZC9A 1LC5A 1N31A 2BHXA 3JW9A 3JTXA 4EMYA 1ASBA 2ZP7A 3ASAA 4OBVA 1AJRA 3GBXA 2CJGA 2D61A 3A9ZA 3FCRA 4LNJA 1G4VA 1PMOA 1YAAA 4A6RA 3LVJA 4DBCA 3IHJA 3MC6A 2BWOA 3A9YA 2BWPA 3VOMA 4F5HA 2V1PA 1N2TA 1GEXA 2OATA 3DXVA 1KKJA 5E4ZA 3QM2A 1AHXA 2DGLA 4RM1A 3N75A 2BIEA 2V0YA 1AIAA 1KL1A 2YKXA 4M2KA 3P1TA 2D63A 4ISYA 4JE5A 4E3RA 3W1HA 1AY4A 2VGUA 2VMTA 3NYSA 2YHKA 2FN6A 2BWNA 2VIAA 3I4JA 2R5CA 4ADBA 3AEPA 5BJ4A 4A6TA 4ATPA 5C6UA 4Y0HA 4RJYA 2E7UA 3JWAA 1P3WA 1PMMA 2Z9VA 1LC8A 3PD6A 4B98A 3MC6C 2E54A 4BQ0A 1ARHA 1IX7A 2QMAA 3ELPA 3PJ0A 3BCBA 2CFBA 3EI8A 1RV3A 1CZEA 3WX9A 1AKAA 1ASCA 3N4SA 2OGEA 1AMSA 4MQQA 1VJOA 3WZFA 2QLRA 4F5FA 2OGAA 1EJIA 4ZWMA 2ZSMA 1C9CA 3RBLA 3RCHB 4ATQA 4WB0B 5DJ9A 3HQTA 2YKUA 4Q6RA 1CQ8A 1M0QA 3BCAA 4ZWVA 2W7EA 3FTBA 3L44A 1N8PA 1QGNA 2HUUA 3E2YA 4TV7A 3AATA 1MGVA 3LY1A 2PO3A 2GSAA 2C7TA 4OTLA 3CQ4A 3RBFA 1ARIA 1OATA 5IWQA 1SPAA 1BS0A 1S08A 2HOZA 4CBRA 2VMRA 5G09A 5F8VA 3DYDA 4L0OA 4XJOA 4F5GA 2W7DA 4QGRA 1D7VA 2CINA 1M0PA 4F5IA 2HORA 1M0NA 1JF9A 3FSLA 2X5DA 4GDYA 4LNMA 1LW5A 1AMAA 3E2ZA 3PAAA 4RJ0A 3VAXA 1WKHA 1X2AA 3QHXA 4IX8A 1FG3A 4M2JA 3FVXA 3PDBB 4XK1A 3WGCA 3ATHA 4ZASA 4GE7A 4IYOA 3MEBA 2VMWA 2CJHA 3BN1A 3HBXA 4A6UA 3AEJA 3NUBA 3EZ1A 2FQ6A 1WYTA 3FZ8A 3PIUA 4JE5D 4RIZA 1ELUA 4UOYA 3TATA 4JEZA 2GB3A 3HDOA 2Z1ZA 3EI5A 4FL0A 4MQPA 3ACZA 1XEYA 5EIGA 1KMJA 2HP2A 3TCMA 2BI3A 1B5OA 1AICA 3H7FA 5EUNA 3EI6A 4AO9A 9AATA 3EZSA 3FDBA 2JJFA 2YCPA 4Y0DA 3COGA 3RUYA 1AX4A 1JS6A 1T3IA 3B1DA 3FZ6A 4I8AA 2O7CA 1G7XA 1GC0A 4LC3A 1WYVB 3USFA 1FG7A 2WKAA 1DJEA 2OKKA 4A00A 1XI9A 5G2PA 1S07A 3CBFA 3QGUA 3N0LA 5FT5A 2VMYA 1H0CA 2AEUA 1VP4A 3AEJC 5TF5A 2D5YA 1B4XA 1EG5A 3KGWA 5F9SA 2ZC0A 2EZ1A 3H9XA 4RLGA 1YOOA 4JEXA 1S0AA 4WYFA 3L8AA 2E7JA 4W1VA 1GBNA 3AEMA 1IJIA 4BHDA 1M0OA 2W8JA 1ECXA 1MDZA 2D7ZA 4MGRA 2TPLA 4RAEA 4KXKA 4CBSA 3NRAA 1RVUA 1V2FA 3HVYA 2VMPA 2FNUA 4IW7A 4WYDA 4EU1A 1TOGA 2DOUA 2CJDA 1X28A 2VLFA 2ZJGA 2FNIA 3JWBA 4XJPA 1SFFA 2ZY3A 3N7NA 3B1EA 2C81A 2EPJA 4EFFA 3AOWA 2Z67A 4UQVA 4WLJA 3WCNA 4NOGA 2FM1A 3QI6A 4PFFA 3LV2A 3FD0A 3M5UA 1B8GA 1YJZA 2BI2A 2W8UA 3W1JA 1IAYA 5M4DA 3HL2A 4K2MA 3E9KA 4CVQA 2W7GA 2ZY4A 3NYUA 1O4SA 5E3KA 4ZSWA 4HVKA 5AX8A 4F5KA 4MSOA 1GCKA 1W23A 3AEMC 4ZSYA 1M7YA 3GWPA 3G0TA 1OXOA 4M2MA 1DFOA 3D6KA 5D5SA 1KMKA 3CAIA 5EQCA 1ASLA 1GC3A 3WCOA 4E1OA 2Q7WA 3FFRA 4UHMA 2CTZA 4XQ2A 4GSAA 2W7MA 2GMSA 2AY6A 2NMPA 2QB2A 3ZRPA 1X29A 1BT4A 3FQAA 2EGYA 3ECDA 2EYQA 2ZSLA 3A2BA 5G4IA 5E5IA 1CZCA 5FT8A 3T32A 4A0FA 3EIAA 2VMSA 4WBTA 1CL1A 8AATA 3K7YA 2R2NA 1MAQA 2GMUA 3AENA 1IAXA 3E6GA 1ASNA 2Z1YA 3DXWA 3MBBA 4LNLA 5EUDA 1CQ6A 3II0A 5EAVA 3R4TA 3ASBA 4E77A 1AHGA 3DR4A 3NYTA 4MKJA 4GE9A 3K40A 1D7SA 3E2FA 3G8MA 1QISA 1MLZA 3PDBA 1TOEA 3BB8A 4ZDPA 2G7JA 3OKSA 3VP6A 1BW0A 5LHAA 1ASMA 1YJSA 4EB5A 3MAFA 4LW4A 2ZY5A 4ZDLA 4WXBA 3AV7A 2BIGA 4UHOA 2DGMA 1YIZA 4EB7A 1GEYA 1C0NA 1H1CA 2E7IA 2VGSA 5HDMA 2YKYA 3WKSA 1YIYA 1DTYA 4TMRA 4AZKA 3NX3A 3QBOA 2AATA 1W7LA 2C44A 1MDXA 1SZKA 4OT8A 4R5FA 4AH3A 2ZYJA 3GZDA 1B9HA 4IY7A 2VMQA 1LK9A 3WY7A 1OHYA 3KKIA 4BMKA 1BQAA 1I29A 1YNUA 4R8DA 2D65A 5I92A 4MQRA 2CY8A 1CL2A 1SZSA 4DGTA 1WYUA 1D7RA 2VYCA 2R5CB 2ZUKA 2W7LA 4AO4A 4ZM3A 1C7OA 2HOXA 4Q31A 1AMRA 1ASGA 4A72A 1DJ9A 1BQDA 3P6KA 1BJWA 4JF0A 3AELA 3AEOA 3VK3A 3KGXA 1ARSA 1RVYA 4F5LA 2W7JA 2R5EA 2YCNA 1E5EA 3G7QA 5BJ3A 2HZPA 1G7WA 4BA4A 3QN6A 4WYCA 1V2DA 5K8BA 4WLHA 1PFFA 4LW2A 4OC9A 2WK9A 4CXQA 1BJOA 2HUIA 3GZDC 1TOIA 2XH1A 3DR7A 3FZ7A 3BC8A 2JGTA 2VGVA 2X3LA 1J32A 1EQBA 4JEWA 4MY5A 4ITXA 4AZJA 3DODA 4RKCA 1O69A 1SF2A 2FKIA 1AKCA 1LW4A 1OXPA 3GR9A 1O62A 4OCAA 2DKJA 3HLMA 3LG0A 2QB3A 3FKDA 2YRIA 1ASDA 1QITA 4H51A 3BWNA 4JF1A 2EO5A 2YRRA 2QSRA 2W8TA 2W8WA 1CJ0A 3PDXA 4FFCA 2GQNA 1JG8A 4HF8A 3F9TA 3UWCA 2AY7A 5FT4A 2KFPA 4Y0IA 1AAWA 2VMUA 4GE4A 7AATA 3GETA 3E77A 1IX6A 2CH2A 3BV0A 4AOAA 1UU2A 2VMVA 1C7GA 5G4JA 1MLYA 4K05A 2DR1A 1AY8A 1JS3A 3MKJA 2JJHA 2WB6A 4W1WA 3R9AA 1GDEA 4BA5A 3DZZA 1DGEA 2HOYA 3UE8A 3BCXA 5G0AA 3GZCA 1VEFA 3AOVA 3NTJA 3TQXA 3JZLA 2D64A 1AJSB 2AY2A 3NU8A 4IYOB 2W8VA 4RKDA 1BKGA 2G6WA 3QPGA 5LH9A 4W5KA 5KTBA 3BWNC 1AAMA 3I5TA 4E3QA 1X0MA 2Z9UA 4IXZA 3MADA 1PG8A 1WYTB 1U08A 2PB0A 1AMQA 4KYOA 2A1VA 3OP7A 4P3MA 5DB5A 2EH6A 2VI8A 5JAYA 1D7UA 1BJNA 1MDOA 1CS1A 2AY9A 2DKBA 4XJMA 3RCHA 2VIBA 3NDNA 2VMNA 5M46A 1B5PA 1E5FA 2VGTA 4WB0A 1KKPA 1ASAA 4B9BA 5HXXA 2ZY2A 1C4KA 1GC2A 3NUIA 1CQ7A 1SVVA 4OBUA 2CH1A 4XAUA 4ADDA 1G4XA 1KL2A 1DKAA 2QA3A 1IVRA 1C7NA 3FRKA 4O6ZA 3TFTA 3JU7A 4A0RA 5J8QA 4R5ZA 1LC7A 1LKCA 1V2EA 1AHYA 1V72A 3FQ7A 3PGYA 2D66A 2VI9A 3F0HA 1Z7DA 1Y4IA 3VK4A 2BKWA 2HP1A 1W7MA 1RV4A 3N4RA 1MAPA 4U2HA 3UAKA 3DRDA 3GSBA 1AHFA 4N0BA 2VGWA 4Q75A 2HUFA 4GEBA 4ITGA 5M4BA 2AY3A 4UHNA 1UU1A 2BI9A 4W1XA 2OKJA 4R2NA 3LVMA 1I43A 4H63Q 2X5FA 1GD9A 2CSTA 2BI5A 2CB1A 3WGBA 3DU4A 3FQ8A 3EIBA 1DGDA 4OMAA 2DGKA 1DJUA 1M4NA 3KE3A 4F5MA 2Z20A 1AIBA 1S06A 1ASFA 4JEYA 4ADEA 1GEWA 1LS3A 4A0GA 2BYJA 4OYTA 3B1CA 4XJLA 1D2FA 1TPLA 4U1TA 3F6TA 5FT6A 4P7YA 3CQ6A 3WKRA 4F4EA 3N4XA 1IUGA 2F8JA 2JJGA 3IF2A 1GC4A 3PA9A 2O0RA 3K28A 4WYEA 1QJ3A 2OQXA 2JJEA 3B46A 1J04A 3FDDA 4RITA 1WYVA 1WKGA 4WP0A 3NNKA 5HHYA 2BYLA 3EI9A 4K2BA 1YJYA 5M49A 5EAAA 3N5MA 2Z9XA 2YOBA 2AY4A 3HT4A 3A9XA 4J5UA 1QJ5A 3WLXA 3PD6B 2D7YA 1ORDA 3RQ1A 4XEWA 4ZLVA 3AENB 2Z9WA 3I16A 3RI6A 4ZAHA 2PB2A 3EI7A 3NU7A 4A0HA 4J8LA 1B9IA 3BWOA 1WSTA 3Q8NA 3ZZKA 4K2IA 1OHWA 3DC1A 4IXSA 1ZODA 2JISA 2AY1A 2YCTA 3LVLB 3PPLA 4W91A 2ORDA 3ZZJA 2QBTA 1I48A 4DQ6A 1M6SA 2VGZA 1AJSA 1TOKA 4F5JA 3ISLA 1TOJA 4MKKA 4PFNA 3ELEA 2C0RA 2JG2A 3MAFB 4GRXA 2VMZA 2WK8A 5EUEA 2BI1A 5G2QA 2VLHA 5EFSA 3CQ5A 4JEVA 4WYAA 1UKJA 3VK2A 1W7NA 2RFVA 2AY8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A8U X;  4WXG A;  1SZU A;  3H14 A;  3TFU A;  2W7F A;  4ZM4 A;  1ELQ A;  1O61 A;  2AEV A;  2AY5 A;  3BS8 A;  1QZ9 A;  3HMU A;  3ZRR A;  3LVK A;  1M32 A;  2BIA A;  2XBN A;  3EUC A;  1IBJ A;  1BJ4 A;  3E2Z B;  4PIW A;  1I41 A;  4TN4 A;  4PVF A;  1ARG A;  1S09 A;  2W7I A;  1WYU B;  2WK7 A;  4WXF A;  2X8U A;  4W8I A;  2O1B A;  2W7K A;  3FVS A;  1AKB A;  4N0W A;  2EZ2 A;  4KAM A;  3MAU A;  1TAR A;  4Q76 A;  1TAT A;  3LWS A;  5D95 A;  1OHV A;  1TAS A;  3FVU A;  4IXO A;  4ZDO A;  2VMO A;  2Z61 A;  1AHE A;  2FYF A;  2YKV A;  5DX5 A;  3ZRQ A;  2W7H A;  1Z3Z A;  1ART A;  1ASE A;  5DJ1 A;  4WYG A;  2CAN A;  1FC4 A;  1IX8 A;  2VMX A;  3GJU A;  3W1I A;  1ZOB A;  1BJO B;  2R0T A;  1UU0 A;  1QIR A;  5EIG B;  3B8X A;  1W3U A;  1AY5 A;  3FFH A;  4WD2 A;  4CXR A;  4ADC A;  1ZC9 A;  1LC5 A;  1N31 A;  2BHX A;  3JW9 A;  3JTX A;  4EMY A;  1ASB A;  2ZP7 A;  3ASA A;  4OBV A;  1AJR A;  3GBX A;  2CJG A;  2D61 A;  3A9Z A;  3FCR A;  4LNJ A;  1G4V A;  1PMO A;  1YAA A;  4A6R A;  3LVJ A;  4DBC A;  3IHJ A;  3MC6 A;  2BWO A;  3A9Y A;  2BWP A;  3VOM A;  4F5H A;  2V1P A;  1N2T A;  1GEX A;  2OAT A;  3DXV A;  1KKJ A;  5E4Z A;  3QM2 A;  1AHX A;  2DGL A;  4RM1 A;  3N75 A;  2BIE A;  2V0Y A;  1AIA A;  1KL1 A;  2YKX A;  4M2K A;  3P1T A;  2D63 A;  4ISY A;  4JE5 A;  4E3R A;  3W1H A;  1AY4 A;  2VGU A;  2VMT A;  3NYS A;  2YHK A;  2FN6 A;  2BWN A;  2VIA A;  3I4J A;  2R5C A;  4ADB A;  3AEP A;  5BJ4 A;  4A6T A;  4ATP A;  5C6U A;  4Y0H A;  4RJY A;  2E7U A;  3JWA A;  1P3W A;  1PMM A;  2Z9V A;  1LC8 A;  3PD6 A;  4B98 A;  3MC6 C;  2E54 A;  4BQ0 A;  1ARH A;  1IX7 A;  2QMA A;  3ELP A;  3PJ0 A;  3BCB A;  2CFB A;  3EI8 A;  1RV3 A;  1CZE A;  3WX9 A;  1AKA A;  1ASC A;  2OGE A;  1AMS A;  4MQQ A;  1VJO A;  3WZF A;  2QLR A;  4F5F A;  2OGA A;  1EJI A;  4ZWM A;  2ZSM A;  1C9C A;  3RBL A;  3RCH B;  4ATQ A;  4WB0 B;  5DJ9 A;  3HQT A;  2YKU A;  4Q6R A;  1CQ8 A;  1M0Q A;  3BCA A;  4ZWV A;  2W7E A;  3FTB A;  3L44 A;  1N8P A;  1QGN A;  2HUU A;  3E2Y A;  4TV7 A;  3AAT A;  1MGV A;  3LY1 A;  2PO3 A;  2GSA A;  2C7T A;  4OTL A;  3CQ4 A;  3RBF A;  1ARI A;  1OAT A;  5IWQ A;  1SPA A;  1BS0 A;  1S08 A;  2HOZ A;  4CBR A;  2VMR A;  5G09 A;  5F8V A;  3DYD A;  4L0O A;  4XJO A;  4F5G A;  2W7D A;  4QGR A;  1D7V A;  2CIN A;  1M0P A;  4F5I A;  2HOR A;  1M0N A;  1JF9 A;  3FSL A;  2X5D A;  4GDY A;  4LNM A;  1LW5 A;  1AMA A;  3E2Z A;  3PAA A;  4RJ0 A;  3VAX A;  1WKH A;  1X2A A;  3QHX A;  4IX8 A;  1FG3 A;  4M2J A;  3FVX A;  3PDB B;  4XK1 A;  3WGC A;  3ATH A;  4ZAS A;  4GE7 A;  4IYO A;  3MEB A;  2VMW A;  2CJH A;  3BN1 A;  3HBX A;  4A6U A;  3AEJ A;  3NUB A;  3EZ1 A;  2FQ6 A;  1WYT A;  3FZ8 A;  3PIU A;  4JE5 D;  4RIZ A;  1ELU A;  4UOY A;  3TAT A;  4JEZ A;  2GB3 A;  3HDO A;  2Z1Z A;  3EI5 A;  4FL0 A;  4MQP A;  3ACZ A;  1XEY A;  5EIG A;  1KMJ A;  2HP2 A;  3TCM A;  2BI3 A;  1B5O A;  1AIC A;  3H7F A;  5EUN A;  3EI6 A;  4AO9 A;  9AAT A;  3EZS A;  3FDB A;  2JJF A;  2YCP A;  4Y0D A;  3COG A;  3RUY A;  1AX4 A;  1JS6 A;  1T3I A;  3B1D A;  3FZ6 A;  4I8A A;  2O7C A;  1G7X A;  1GC0 A;  4LC3 A;  1WYV B;  3USF A;  1FG7 A;  2WKA A;  1DJE A;  2OKK A;  4A00 A;  1XI9 A;  5G2P A;  1S07 A;  3CBF A;  3QGU A;  3N0L A;  5FT5 A;  2VMY A;  1H0C A;  2AEU A;  1VP4 A;  3AEJ C;  5TF5 A;  2D5Y A;  1B4X A;  1EG5 A;  3KGW A;  5F9S A;  2ZC0 A;  2EZ1 A;  4RLG A;  1YOO A;  4JEX A;  1S0A A;  4WYF A;  3L8A A;  2E7J A;  4W1V A;  1GBN A;  3AEM A;  1IJI A;  4BHD A;  1M0O A;  2W8J A;  1ECX A;  1MDZ A;  2D7Z A;  4MGR A;  2TPL A;  4RAE A;  4KXK A;  4CBS A;  3NRA A;  1RVU A;  1V2F A;  3HVY A;  2VMP A;  2FNU A;  4IW7 A;  4WYD A;  4EU1 A;  1TOG A;  2DOU A;  2CJD A;  1X28 A;  2VLF A;  2ZJG A;  2FNI A;  3JWB A;  4XJP A;  1SFF A;  2ZY3 A;  3B1E A;  2C81 A;  2EPJ A;  4EFF A;  3AOW A;  2Z67 A;  4UQV A;  4WLJ A;  3WCN A;  4NOG A;  2FM1 A;  3QI6 A;  4PFF A;  3LV2 A;  3FD0 A;  3M5U A;  1B8G A;  1YJZ A;  2BI2 A;  2W8U A;  3W1J A;  1IAY A;  5M4D A;  3HL2 A;  4K2M A;  3E9K A;  4CVQ A;  2W7G A;  2ZY4 A;  3NYU A;  1O4S A;  5E3K A;  4ZSW A;  4HVK A;  5AX8 A;  4F5K A;  4MSO A;  1GCK A;  1W23 A;  3AEM C;  4ZSY A;  1M7Y A;  3GWP A;  3G0T A;  1OXO A;  4M2M A;  1DFO A;  3D6K A;  5D5S A;  1KMK A;  3CAI A;  5EQC A;  1ASL A;  1GC3 A;  3WCO A;  4E1O A;  2Q7W A;  3FFR A;  4UHM A;  2CTZ A;  4XQ2 A;  4GSA A;  2W7M A;  2GMS A;  2AY6 A;  2NMP A;  2QB2 A;  3ZRP A;  1X29 A;  1BT4 A;  3FQA A;  2EGY A;  3ECD A;  2ZSL A;  3A2B A;  5G4I A;  5E5I A;  1CZC A;  5FT8 A;  3T32 A;  4A0F A;  3EIA A;  2VMS A;  4WBT A;  1CL1 A;  8AAT A;  3K7Y A;  2R2N A;  1MAQ A;  2GMU A;  3AEN A;  1IAX A;  3E6G A;  1ASN A;  2Z1Y A;  3DXW A;  3MBB A;  4LNL A;  5EUD A;  1CQ6 A;  3II0 A;  5EAV A;  3R4T A;  3ASB A;  4E77 A;  1AHG A;  3DR4 A;  3NYT A;  4MKJ A;  4GE9 A;  3K40 A;  1D7S A;  3E2F A;  3G8M A;  1QIS A;  1MLZ A;  3PDB A;  1TOE A;  3BB8 A;  4ZDP A;  3OKS A;  3VP6 A;  1BW0 A;  5LHA A;  1ASM A;  1YJS A;  4EB5 A;  3MAF A;  4LW4 A;  2ZY5 A;  4ZDL A;  4WXB A;  3AV7 A;  2BIG A;  4UHO A;  2DGM A;  1YIZ A;  4EB7 A;  1GEY A;  1C0N A;  1H1C A;  2E7I A;  2VGS A;  5HDM A;  2YKY A;  3WKS A;  1YIY A;  1DTY A;  4TMR A;  4AZK A;  3NX3 A;  3QBO A;  2AAT A;  1W7L A;  2C44 A;  1MDX A;  1SZK A;  4OT8 A;  4R5F A;  4AH3 A;  2ZYJ A;  3GZD A;  1B9H A;  4IY7 A;  2VMQ A;  1LK9 A;  3WY7 A;  1OHY A;  3KKI A;  4BMK A;  1BQA A;  1I29 A;  1YNU A;  4R8D A;  2D65 A;  5I92 A;  4MQR A;  2CY8 A;  1CL2 A;  1SZS A;  4DGT A;  1WYU A;  1D7R A;  2VYC A;  2R5C B;  2ZUK A;  2W7L A;  4AO4 A;  4ZM3 A;  1C7O A;  2HOX A;  4Q31 A;  1AMR A;  1ASG A;  4A72 A;  1DJ9 A;  1BQD A;  3P6K A;  1BJW A;  4JF0 A;  3AEL A;  3AEO A;  3VK3 A;  3KGX A;  1ARS A;  1RVY A;  4F5L A;  2W7J A;  2R5E A;  2YCN A;  1E5E A;  3G7Q A;  5BJ3 A;  2HZP A;  1G7W A;  4BA4 A;  3QN6 A;  4WYC A;  1V2D A;  5K8B A;  4WLH A;  1PFF A;  4LW2 A;  4OC9 A;  2WK9 A;  4CXQ A;  1BJO A;  2HUI A;  3GZD C;  1TOI A;  2XH1 A;  3DR7 A;  3FZ7 A;  3BC8 A;  2JGT A;  2VGV A;  2X3L A;  1J32 A;  1EQB A;  4JEW A;  4MY5 A;  4ITX A;  4AZJ A;  3DOD A;  4RKC A;  1O69 A;  1SF2 A;  1AKC A;  1LW4 A;  1OXP A;  3GR9 A;  1O62 A;  4OCA A;  2DKJ A;  3HLM A;  3LG0 A;  2QB3 A;  3FKD A;  2YRI A;  1ASD A;  1QIT A;  4H51 A;  3BWN A;  4JF1 A;  2EO5 A;  2YRR A;  2W8T A;  2W8W A;  1CJ0 A;  3PDX A;  4FFC A;  2GQN A;  1JG8 A;  4HF8 A;  3F9T A;  3UWC A;  2AY7 A;  5FT4 A;  4Y0I A;  1AAW A;  2VMU A;  4GE4 A;  7AAT A;  3GET A;  3E77 A;  1IX6 A;  2CH2 A;  3BV0 A;  4AOA A;  1UU2 A;  2VMV A;  1C7G A;  5G4J A;  1MLY A;  2DR1 A;  1AY8 A;  1JS3 A;  3MKJ A;  2JJH A;  4W1W A;  3R9A A;  1GDE A;  4BA5 A;  3DZZ A;  1DGE A;  2HOY A;  3UE8 A;  3BCX A;  5G0A A;  3GZC A;  1VEF A;  3AOV A;  3NTJ A;  3TQX A;  3JZL A;  2D64 A;  1AJS B;  2AY2 A;  3NU8 A;  4IYO B;  2W8V A;  4RKD A;  1BKG A;  2G6W A;  3QPG A;  5LH9 A;  4W5K A;  3BWN C;  1AAM A;  3I5T A;  4E3Q A;  1X0M A;  2Z9U A;  4IXZ A;  3MAD A;  1PG8 A;  1WYT B;  1U08 A;  2PB0 A;  1AMQ A;  4KYO A;  3OP7 A;  4P3M A;  5DB5 A;  2EH6 A;  2VI8 A;  5JAY A;  1D7U A;  1BJN A;  1MDO A;  1CS1 A;  2AY9 A;  2DKB A;  4XJM A;  3RCH A;  2VIB A;  3NDN A;  2VMN A;  5M46 A;  1B5P A;  1E5F A;  2VGT A;  4WB0 A;  1KKP A;  1ASA A;  4B9B A;  5HXX A;  2ZY2 A;  1C4K A;  1GC2 A;  3NUI A;  1CQ7 A;  1SVV A;  4OBU A;  2CH1 A;  4XAU A;  4ADD A;  1G4X A;  1KL2 A;  1DKA A;  2QA3 A;  1IVR A;  1C7N A;  3FRK A;  4O6Z A;  3TFT A;  3JU7 A;  4A0R A;  5J8Q A;  4R5Z A;  1LC7 A;  1LKC A;  1V2E A;  1AHY A;  1V72 A;  3FQ7 A;  3PGY A;  2D66 A;  2VI9 A;  3F0H A;  1Z7D A;  1Y4I A;  3VK4 A;  2BKW A;  2HP1 A;  1W7M A;  1RV4 A;  1MAP A;  4U2H A;  3UAK A;  3DRD A;  3GSB A;  1AHF A;  4N0B A;  2VGW A;  4Q75 A;  2HUF A;  4GEB A;  4ITG A;  5M4B A;  2AY3 A;  4UHN A;  1UU1 A;  2BI9 A;  4W1X A;  2OKJ A;  4R2N A;  3LVM A;  1I43 A;  2X5F A;  1GD9 A;  2CST A;  2BI5 A;  2CB1 A;  3WGB A;  3DU4 A;  3FQ8 A;  3EIB A;  1DGD A;  4OMA A;  2DGK A;  1DJU A;  1M4N A;  3KE3 A;  4F5M A;  2Z20 A;  1AIB A;  1S06 A;  1ASF A;  4JEY A;  4ADE A;  1GEW A;  1LS3 A;  4A0G A;  2BYJ A;  4OYT A;  3B1C A;  4XJL A;  1D2F A;  1TPL A;  4U1T A;  3F6T A;  5FT6 A;  4P7Y A;  3CQ6 A;  3WKR A;  4F4E A;  1IUG A;  2F8J A;  2JJG A;  3IF2 A;  1GC4 A;  3PA9 A;  2O0R A;  3K28 A;  4WYE A;  1QJ3 A;  2OQX A;  2JJE A;  3B46 A;  1J04 A;  3FDD A;  4RIT A;  1WYV A;  1WKG A;  4WP0 A;  3NNK A;  5HHY A;  2BYL A;  3EI9 A;  4K2B A;  1YJY A;  5M49 A;  5EAA A;  3N5M A;  2Z9X A;  2YOB A;  2AY4 A;  3HT4 A;  3A9X A;  4J5U A;  1QJ5 A;  3WLX A;  3PD6 B;  2D7Y A;  1ORD A;  3RQ1 A;  4XEW A;  4ZLV A;  3AEN B;  2Z9W A;  3I16 A;  3RI6 A;  4ZAH A;  2PB2 A;  3EI7 A;  3NU7 A;  4A0H A;  4J8L A;  1B9I A;  3BWO A;  1WST A;  3Q8N A;  3ZZK A;  4K2I A;  1OHW A;  3DC1 A;  4IXS A;  1ZOD A;  2JIS A;  2AY1 A;  2YCT A;  3LVL B;  3PPL A;  4W91 A;  2ORD A;  3ZZJ A;  2QBT A;  1I48 A;  4DQ6 A;  1M6S A;  2VGZ A;  1AJS A;  1TOK A;  4F5J A;  3ISL A;  1TOJ A;  4MKK A;  4PFN A;  3ELE A;  2C0R A;  2JG2 A;  3MAF B;  4GRX A;  2VMZ A;  2WK8 A;  5EUE A;  2BI1 A;  5G2Q A;  2VLH A;  5EFS A;  3CQ5 A;  4JEV A;  4WYA A;  1UKJ A;  3VK2 A;  1W7N A;  2RFV A;  2AY8 A; 
#chains in the Genus database with same CATH topology
 3A8U X;  4WXG A;  1SZU A;  3H14 A;  3TFU A;  2W7F A;  4ZM4 A;  1ELQ A;  1O61 A;  2AEV A;  2AY5 A;  3BS8 A;  1QZ9 A;  3HMU A;  3ZRR A;  3LVK A;  1M32 A;  2BIA A;  2XBN A;  3EUC A;  1IBJ A;  1BJ4 A;  3E2Z B;  4PIW A;  1I41 A;  4TN4 A;  4PVF A;  1ARG A;  1S09 A;  2W7I A;  1WYU B;  2WK7 A;  4WXF A;  2X8U A;  4W8I A;  2O1B A;  2W7K A;  3FVS A;  1AKB A;  4N0W A;  2EZ2 A;  4KAM A;  3MAU A;  1TAR A;  4Q76 A;  1TAT A;  3LWS A;  5D95 A;  1OHV A;  1TAS A;  3FVU A;  4IXO A;  4ZDO A;  2VMO A;  2Z61 A;  1AHE A;  2FYF A;  2YKV A;  5DX5 A;  1KAF A;  3ZRQ A;  2W7H A;  1Z3Z A;  1ART A;  1ASE A;  5DJ1 A;  4WYG A;  2CAN A;  1FC4 A;  1IX8 A;  2VMX A;  3GJU A;  3W1I A;  1ZOB A;  1BJO B;  2R0T A;  1UU0 A;  1QIR A;  5EIG B;  3B8X A;  1W3U A;  1AY5 A;  3FFH A;  4WD2 A;  4CXR A;  4ADC A;  1ZC9 A;  1LC5 A;  1N31 A;  2BHX A;  3JW9 A;  3JTX A;  4EMY A;  1ASB A;  2ZP7 A;  3ASA A;  4OBV A;  1AJR A;  3GBX A;  2CJG A;  2D61 A;  3A9Z A;  3FCR A;  4LNJ A;  1G4V A;  1PMO A;  1YAA A;  4A6R A;  3LVJ A;  4DBC A;  3IHJ A;  3MC6 A;  2BWO A;  3A9Y A;  2BWP A;  3VOM A;  4F5H A;  2V1P A;  1N2T A;  1GEX A;  2OAT A;  3DXV A;  1KKJ A;  5E4Z A;  3QM2 A;  1AHX A;  2DGL A;  4RM1 A;  3N75 A;  2BIE A;  2V0Y A;  1AIA A;  1KL1 A;  2YKX A;  4M2K A;  3P1T A;  2D63 A;  4ISY A;  4JE5 A;  4E3R A;  3W1H A;  1AY4 A;  2VGU A;  2VMT A;  3NYS A;  2YHK A;  2FN6 A;  2BWN A;  2VIA A;  3I4J A;  2R5C A;  4ADB A;  3AEP A;  5BJ4 A;  4A6T A;  4ATP A;  5C6U A;  4Y0H A;  4RJY A;  2E7U A;  3JWA A;  1P3W A;  1PMM A;  2Z9V A;  1LC8 A;  3PD6 A;  4B98 A;  3MC6 C;  2E54 A;  4BQ0 A;  1ARH A;  1IX7 A;  2QMA A;  3ELP A;  3PJ0 A;  3BCB A;  2CFB A;  3EI8 A;  1RV3 A;  1CZE A;  3WX9 A;  1AKA A;  1ASC A;  3N4S A;  2OGE A;  1AMS A;  4MQQ A;  1VJO A;  3WZF A;  2QLR A;  4F5F A;  2OGA A;  1EJI A;  4ZWM A;  2ZSM A;  1C9C A;  3RBL A;  3RCH B;  4ATQ A;  4WB0 B;  5DJ9 A;  3HQT A;  2YKU A;  4Q6R A;  1CQ8 A;  1M0Q A;  3BCA A;  4ZWV A;  2W7E A;  3FTB A;  3L44 A;  1N8P A;  1QGN A;  2HUU A;  3E2Y A;  4TV7 A;  3AAT A;  1MGV A;  3LY1 A;  2PO3 A;  2GSA A;  2C7T A;  4OTL A;  3CQ4 A;  3RBF A;  1ARI A;  1OAT A;  5IWQ A;  1SPA A;  1BS0 A;  1S08 A;  2HOZ A;  4CBR A;  2VMR A;  5G09 A;  5F8V A;  3DYD A;  4L0O A;  4XJO A;  4F5G A;  2W7D A;  4QGR A;  1D7V A;  2CIN A;  1M0P A;  4F5I A;  2HOR A;  1M0N A;  1JF9 A;  3FSL A;  2X5D A;  4GDY A;  4LNM A;  1LW5 A;  1AMA A;  3E2Z A;  3PAA A;  4RJ0 A;  3VAX A;  1WKH A;  1X2A A;  3QHX A;  4IX8 A;  1FG3 A;  4M2J A;  3FVX A;  3PDB B;  4XK1 A;  3WGC A;  3ATH A;  4ZAS A;  4GE7 A;  4IYO A;  3MEB A;  2VMW A;  2CJH A;  3BN1 A;  3HBX A;  4A6U A;  3AEJ A;  3NUB A;  3EZ1 A;  2FQ6 A;  1WYT A;  3FZ8 A;  3PIU A;  4JE5 D;  4RIZ A;  1ELU A;  4UOY A;  3TAT A;  4JEZ A;  2GB3 A;  3HDO A;  2Z1Z A;  3EI5 A;  4FL0 A;  4MQP A;  3ACZ A;  1XEY A;  5EIG A;  1KMJ A;  2HP2 A;  3TCM A;  2BI3 A;  1B5O A;  1AIC A;  3H7F A;  5EUN A;  3EI6 A;  4AO9 A;  9AAT A;  3EZS A;  3FDB A;  2JJF A;  2YCP A;  4Y0D A;  3COG A;  3RUY A;  1AX4 A;  1JS6 A;  1T3I A;  3B1D A;  3FZ6 A;  4I8A A;  2O7C A;  1G7X A;  1GC0 A;  4LC3 A;  1WYV B;  3USF A;  1FG7 A;  2WKA A;  1DJE A;  2OKK A;  4A00 A;  1XI9 A;  5G2P A;  1S07 A;  3CBF A;  3QGU A;  3N0L A;  5FT5 A;  2VMY A;  1H0C A;  2AEU A;  1VP4 A;  3AEJ C;  5TF5 A;  2D5Y A;  1B4X A;  1EG5 A;  3KGW A;  5F9S A;  2ZC0 A;  2EZ1 A;  3H9X A;  4RLG A;  1YOO A;  4JEX A;  1S0A A;  4WYF A;  3L8A A;  2E7J A;  4W1V A;  1GBN A;  3AEM A;  1IJI A;  4BHD A;  1M0O A;  2W8J A;  1ECX A;  1MDZ A;  2D7Z A;  4MGR A;  2TPL A;  4RAE A;  4KXK A;  4CBS A;  3NRA A;  1RVU A;  1V2F A;  3HVY A;  2VMP A;  2FNU A;  4IW7 A;  4WYD A;  4EU1 A;  1TOG A;  2DOU A;  2CJD A;  1X28 A;  2VLF A;  2ZJG A;  2FNI A;  3JWB A;  4XJP A;  1SFF A;  2ZY3 A;  3N7N A;  3B1E A;  2C81 A;  2EPJ A;  4EFF A;  3AOW A;  2Z67 A;  4UQV A;  4WLJ A;  3WCN A;  4NOG A;  2FM1 A;  3QI6 A;  4PFF A;  3LV2 A;  3FD0 A;  3M5U A;  1B8G A;  1YJZ A;  2BI2 A;  2W8U A;  3W1J A;  1IAY A;  5M4D A;  3HL2 A;  4K2M A;  3E9K A;  4CVQ A;  2W7G A;  2ZY4 A;  3NYU A;  1O4S A;  5E3K A;  4ZSW A;  4HVK A;  5AX8 A;  4F5K A;  4MSO A;  1GCK A;  1W23 A;  3AEM C;  4ZSY A;  1M7Y A;  3GWP A;  3G0T A;  1OXO A;  4M2M A;  1DFO A;  3D6K A;  5D5S A;  1KMK A;  3CAI A;  5EQC A;  1ASL A;  1GC3 A;  3WCO A;  4E1O A;  2Q7W A;  3FFR A;  4UHM A;  2CTZ A;  4XQ2 A;  4GSA A;  2W7M A;  2GMS A;  2AY6 A;  2NMP A;  2QB2 A;  3ZRP A;  1X29 A;  1BT4 A;  3FQA A;  2EGY A;  3ECD A;  2EYQ A;  2ZSL A;  3A2B A;  5G4I A;  5E5I A;  1CZC A;  5FT8 A;  3T32 A;  4A0F A;  3EIA A;  2VMS A;  4WBT A;  1CL1 A;  8AAT A;  3K7Y A;  2R2N A;  1MAQ A;  2GMU A;  3AEN A;  1IAX A;  3E6G A;  1ASN A;  2Z1Y A;  3DXW A;  3MBB A;  4LNL A;  5EUD A;  1CQ6 A;  3II0 A;  5EAV A;  3R4T A;  3ASB A;  4E77 A;  1AHG A;  3DR4 A;  3NYT A;  4MKJ A;  4GE9 A;  3K40 A;  1D7S A;  3E2F A;  3G8M A;  1QIS A;  1MLZ A;  3PDB A;  1TOE A;  3BB8 A;  4ZDP A;  2G7J A;  3OKS A;  3VP6 A;  1BW0 A;  5LHA A;  1ASM A;  1YJS A;  4EB5 A;  3MAF A;  4LW4 A;  2ZY5 A;  4ZDL A;  4WXB A;  3AV7 A;  2BIG A;  4UHO A;  2DGM A;  1YIZ A;  4EB7 A;  1GEY A;  1C0N A;  1H1C A;  2E7I A;  2VGS A;  5HDM A;  2YKY A;  3WKS A;  1YIY A;  1DTY A;  4TMR A;  4AZK A;  3NX3 A;  3QBO A;  2AAT A;  1W7L A;  2C44 A;  1MDX A;  1SZK A;  4OT8 A;  4R5F A;  4AH3 A;  2ZYJ A;  3GZD A;  1B9H A;  4IY7 A;  2VMQ A;  1LK9 A;  3WY7 A;  1OHY A;  3KKI A;  4BMK A;  1BQA A;  1I29 A;  1YNU A;  4R8D A;  2D65 A;  5I92 A;  4MQR A;  2CY8 A;  1CL2 A;  1SZS A;  4DGT A;  1WYU A;  1D7R A;  2VYC A;  2R5C B;  2ZUK A;  2W7L A;  4AO4 A;  4ZM3 A;  1C7O A;  2HOX A;  4Q31 A;  1AMR A;  1ASG A;  4A72 A;  1DJ9 A;  1BQD A;  3P6K A;  1BJW A;  4JF0 A;  3AEL A;  3AEO A;  3VK3 A;  3KGX A;  1ARS A;  1RVY A;  4F5L A;  2W7J A;  2R5E A;  2YCN A;  1E5E A;  3G7Q A;  5BJ3 A;  2HZP A;  1G7W A;  4BA4 A;  3QN6 A;  4WYC A;  1V2D A;  5K8B A;  4WLH A;  1PFF A;  4LW2 A;  4OC9 A;  2WK9 A;  4CXQ A;  1BJO A;  2HUI A;  3GZD C;  1TOI A;  2XH1 A;  3DR7 A;  3FZ7 A;  3BC8 A;  2JGT A;  2VGV A;  2X3L A;  1J32 A;  1EQB A;  4JEW A;  4MY5 A;  4ITX A;  4AZJ A;  3DOD A;  4RKC A;  1O69 A;  1SF2 A;  2FKI A;  1AKC A;  1LW4 A;  1OXP A;  3GR9 A;  1O62 A;  4OCA A;  2DKJ A;  3HLM A;  3LG0 A;  2QB3 A;  3FKD A;  2YRI A;  1ASD A;  1QIT A;  4H51 A;  3BWN A;  4JF1 A;  2EO5 A;  2YRR A;  2QSR A;  2W8T A;  2W8W A;  1CJ0 A;  3PDX A;  4FFC A;  2GQN A;  1JG8 A;  4HF8 A;  3F9T A;  3UWC A;  2AY7 A;  5FT4 A;  2KFP A;  4Y0I A;  1AAW A;  2VMU A;  4GE4 A;  7AAT A;  3GET A;  3E77 A;  1IX6 A;  2CH2 A;  3BV0 A;  4AOA A;  1UU2 A;  2VMV A;  1C7G A;  5G4J A;  1MLY A;  4K05 A;  2DR1 A;  1AY8 A;  1JS3 A;  3MKJ A;  2JJH A;  2WB6 A;  4W1W A;  3R9A A;  1GDE A;  4BA5 A;  3DZZ A;  1DGE A;  2HOY A;  3UE8 A;  3BCX A;  5G0A A;  3GZC A;  1VEF A;  3AOV A;  3NTJ A;  3TQX A;  3JZL A;  2D64 A;  1AJS B;  2AY2 A;  3NU8 A;  4IYO B;  2W8V A;  4RKD A;  1BKG A;  2G6W A;  3QPG A;  5LH9 A;  4W5K A;  5KTB A;  3BWN C;  1AAM A;  3I5T A;  4E3Q A;  1X0M A;  2Z9U A;  4IXZ A;  3MAD A;  1PG8 A;  1WYT B;  1U08 A;  2PB0 A;  1AMQ A;  4KYO A;  2A1V A;  3OP7 A;  4P3M A;  5DB5 A;  2EH6 A;  2VI8 A;  5JAY A;  1D7U A;  1BJN A;  1MDO A;  1CS1 A;  2AY9 A;  2DKB A;  4XJM A;  3RCH A;  2VIB A;  3NDN A;  2VMN A;  5M46 A;  1B5P A;  1E5F A;  2VGT A;  4WB0 A;  1KKP A;  1ASA A;  4B9B A;  5HXX A;  2ZY2 A;  1C4K A;  1GC2 A;  3NUI A;  1CQ7 A;  1SVV A;  4OBU A;  2CH1 A;  4XAU A;  4ADD A;  1G4X A;  1KL2 A;  1DKA A;  2QA3 A;  1IVR A;  1C7N A;  3FRK A;  4O6Z A;  3TFT A;  3JU7 A;  4A0R A;  5J8Q A;  4R5Z A;  1LC7 A;  1LKC A;  1V2E A;  1AHY A;  1V72 A;  3FQ7 A;  3PGY A;  2D66 A;  2VI9 A;  3F0H A;  1Z7D A;  1Y4I A;  3VK4 A;  2BKW A;  2HP1 A;  1W7M A;  1RV4 A;  3N4R A;  1MAP A;  4U2H A;  3UAK A;  3DRD A;  3GSB A;  1AHF A;  4N0B A;  2VGW A;  4Q75 A;  2HUF A;  4GEB A;  4ITG A;  5M4B A;  2AY3 A;  4UHN A;  1UU1 A;  2BI9 A;  4W1X A;  2OKJ A;  4R2N A;  3LVM A;  1I43 A;  4H63 Q;  2X5F A;  1GD9 A;  2CST A;  2BI5 A;  2CB1 A;  3WGB A;  3DU4 A;  3FQ8 A;  3EIB A;  1DGD A;  4OMA A;  2DGK A;  1DJU A;  1M4N A;  3KE3 A;  4F5M A;  2Z20 A;  1AIB A;  1S06 A;  1ASF A;  4JEY A;  4ADE A;  1GEW A;  1LS3 A;  4A0G A;  2BYJ A;  4OYT A;  3B1C A;  4XJL A;  1D2F A;  1TPL A;  4U1T A;  3F6T A;  5FT6 A;  4P7Y A;  3CQ6 A;  3WKR A;  4F4E A;  3N4X A;  1IUG A;  2F8J A;  2JJG A;  3IF2 A;  1GC4 A;  3PA9 A;  2O0R A;  3K28 A;  4WYE A;  1QJ3 A;  2OQX A;  2JJE A;  3B46 A;  1J04 A;  3FDD A;  4RIT A;  1WYV A;  1WKG A;  4WP0 A;  3NNK A;  5HHY A;  2BYL A;  3EI9 A;  4K2B A;  1YJY A;  5M49 A;  5EAA A;  3N5M A;  2Z9X A;  2YOB A;  2AY4 A;  3HT4 A;  3A9X A;  4J5U A;  1QJ5 A;  3WLX A;  3PD6 B;  2D7Y A;  1ORD A;  3RQ1 A;  4XEW A;  4ZLV A;  3AEN B;  2Z9W A;  3I16 A;  3RI6 A;  4ZAH A;  2PB2 A;  3EI7 A;  3NU7 A;  4A0H A;  4J8L A;  1B9I A;  3BWO A;  1WST A;  3Q8N A;  3ZZK A;  4K2I A;  1OHW A;  3DC1 A;  4IXS A;  1ZOD A;  2JIS A;  2AY1 A;  2YCT A;  3LVL B;  3PPL A;  4W91 A;  2ORD A;  3ZZJ A;  2QBT A;  1I48 A;  4DQ6 A;  1M6S A;  2VGZ A;  1AJS A;  1TOK A;  4F5J A;  3ISL A;  1TOJ A;  4MKK A;  4PFN A;  3ELE A;  2C0R A;  2JG2 A;  3MAF B;  4GRX A;  2VMZ A;  2WK8 A;  5EUE A;  2BI1 A;  5G2Q A;  2VLH A;  5EFS A;  3CQ5 A;  4JEV A;  4WYA A;  1UKJ A;  3VK2 A;  1W7N A;  2RFV A;  2AY8 A; 
#chains in the Genus database with same CATH homology
 3A8U X;  4WXG A;  1SZU A;  3H14 A;  3TFU A;  2W7F A;  4ZM4 A;  1ELQ A;  1O61 A;  2AEV A;  2AY5 A;  3BS8 A;  1QZ9 A;  3HMU A;  3ZRR A;  3LVK A;  1M32 A;  2BIA A;  2XBN A;  3EUC A;  1IBJ A;  1BJ4 A;  3E2Z B;  4PIW A;  1I41 A;  4TN4 A;  4PVF A;  1ARG A;  1S09 A;  2W7I A;  1WYU B;  2WK7 A;  4WXF A;  2X8U A;  4W8I A;  2O1B A;  2W7K A;  3FVS A;  1AKB A;  4N0W A;  2EZ2 A;  4KAM A;  3MAU A;  1TAR A;  4Q76 A;  1TAT A;  3LWS A;  5D95 A;  1OHV A;  1TAS A;  3FVU A;  4IXO A;  4ZDO A;  2VMO A;  2Z61 A;  1AHE A;  2FYF A;  2YKV A;  5DX5 A;  3ZRQ A;  2W7H A;  1Z3Z A;  1ART A;  1ASE A;  5DJ1 A;  4WYG A;  2CAN A;  1FC4 A;  1IX8 A;  2VMX A;  3GJU A;  3W1I A;  1ZOB A;  1BJO B;  2R0T A;  1UU0 A;  1QIR A;  5EIG B;  3B8X A;  1W3U A;  1AY5 A;  3FFH A;  4WD2 A;  4CXR A;  4ADC A;  1ZC9 A;  1LC5 A;  1N31 A;  2BHX A;  3JW9 A;  3JTX A;  4EMY A;  1ASB A;  2ZP7 A;  3ASA A;  4OBV A;  1AJR A;  3GBX A;  2CJG A;  2D61 A;  3A9Z A;  3FCR A;  4LNJ A;  1G4V A;  1PMO A;  1YAA A;  4A6R A;  3LVJ A;  4DBC A;  3IHJ A;  3MC6 A;  2BWO A;  3A9Y A;  2BWP A;  3VOM A;  4F5H A;  2V1P A;  1N2T A;  1GEX A;  2OAT A;  3DXV A;  1KKJ A;  5E4Z A;  3QM2 A;  1AHX A;  2DGL A;  4RM1 A;  3N75 A;  2BIE A;  2V0Y A;  1AIA A;  1KL1 A;  2YKX A;  4M2K A;  3P1T A;  2D63 A;  4ISY A;  4JE5 A;  4E3R A;  3W1H A;  1AY4 A;  2VGU A;  2VMT A;  3NYS A;  2YHK A;  2FN6 A;  2BWN A;  2VIA A;  3I4J A;  2R5C A;  4ADB A;  3AEP A;  5BJ4 A;  4A6T A;  4ATP A;  5C6U A;  4Y0H A;  4RJY A;  2E7U A;  3JWA A;  1P3W A;  1PMM A;  2Z9V A;  1LC8 A;  3PD6 A;  4B98 A;  3MC6 C;  2E54 A;  4BQ0 A;  1ARH A;  1IX7 A;  2QMA A;  3ELP A;  3PJ0 A;  3BCB A;  2CFB A;  3EI8 A;  1RV3 A;  1CZE A;  3WX9 A;  1AKA A;  1ASC A;  3N4S A;  2OGE A;  1AMS A;  4MQQ A;  1VJO A;  3WZF A;  2QLR A;  4F5F A;  2OGA A;  1EJI A;  4ZWM A;  2ZSM A;  1C9C A;  3RBL A;  3RCH B;  4ATQ A;  4WB0 B;  5DJ9 A;  3HQT A;  2YKU A;  4Q6R A;  1CQ8 A;  1M0Q A;  3BCA A;  4ZWV A;  2W7E A;  3FTB A;  3L44 A;  1N8P A;  1QGN A;  2HUU A;  3E2Y A;  4TV7 A;  3AAT A;  1MGV A;  3LY1 A;  2PO3 A;  2GSA A;  2C7T A;  4OTL A;  3CQ4 A;  3RBF A;  1ARI A;  1OAT A;  5IWQ A;  1SPA A;  1BS0 A;  1S08 A;  2HOZ A;  4CBR A;  2VMR A;  5G09 A;  5F8V A;  3DYD A;  4L0O A;  4XJO A;  4F5G A;  2W7D A;  4QGR A;  1D7V A;  2CIN A;  1M0P A;  4F5I A;  2HOR A;  1M0N A;  1JF9 A;  3FSL A;  2X5D A;  4GDY A;  4LNM A;  1LW5 A;  1AMA A;  3E2Z A;  3PAA A;  4RJ0 A;  3VAX A;  1WKH A;  1X2A A;  3QHX A;  4IX8 A;  1FG3 A;  4M2J A;  3FVX A;  3PDB B;  4XK1 A;  3WGC A;  3ATH A;  4ZAS A;  4GE7 A;  4IYO A;  3MEB A;  2VMW A;  2CJH A;  3BN1 A;  3HBX A;  4A6U A;  3AEJ A;  3NUB A;  3EZ1 A;  2FQ6 A;  1WYT A;  3FZ8 A;  3PIU A;  4JE5 D;  4RIZ A;  1ELU A;  4UOY A;  3TAT A;  4JEZ A;  2GB3 A;  3HDO A;  2Z1Z A;  3EI5 A;  4FL0 A;  4MQP A;  3ACZ A;  1XEY A;  5EIG A;  1KMJ A;  2HP2 A;  3TCM A;  2BI3 A;  1B5O A;  1AIC A;  3H7F A;  5EUN A;  3EI6 A;  4AO9 A;  9AAT A;  3EZS A;  3FDB A;  2JJF A;  2YCP A;  4Y0D A;  3COG A;  3RUY A;  1AX4 A;  1JS6 A;  1T3I A;  3B1D A;  3FZ6 A;  4I8A A;  2O7C A;  1G7X A;  1GC0 A;  4LC3 A;  1WYV B;  3USF A;  1FG7 A;  2WKA A;  1DJE A;  2OKK A;  4A00 A;  1XI9 A;  5G2P A;  1S07 A;  3CBF A;  3QGU A;  3N0L A;  5FT5 A;  2VMY A;  1H0C A;  2AEU A;  1VP4 A;  3AEJ C;  5TF5 A;  2D5Y A;  1B4X A;  1EG5 A;  3KGW A;  5F9S A;  2ZC0 A;  2EZ1 A;  3H9X A;  4RLG A;  1YOO A;  4JEX A;  1S0A A;  4WYF A;  3L8A A;  2E7J A;  4W1V A;  1GBN A;  3AEM A;  1IJI A;  4BHD A;  1M0O A;  2W8J A;  1ECX A;  1MDZ A;  2D7Z A;  4MGR A;  2TPL A;  4RAE A;  4KXK A;  4CBS A;  3NRA A;  1RVU A;  1V2F A;  3HVY A;  2VMP A;  2FNU A;  4IW7 A;  4WYD A;  4EU1 A;  1TOG A;  2DOU A;  2CJD A;  1X28 A;  2VLF A;  2ZJG A;  2FNI A;  3JWB A;  4XJP A;  1SFF A;  2ZY3 A;  3N7N A;  3B1E A;  2C81 A;  2EPJ A;  4EFF A;  3AOW A;  2Z67 A;  4UQV A;  4WLJ A;  3WCN A;  4NOG A;  2FM1 A;  3QI6 A;  4PFF A;  3LV2 A;  3FD0 A;  3M5U A;  1B8G A;  1YJZ A;  2BI2 A;  2W8U A;  3W1J A;  1IAY A;  5M4D A;  3HL2 A;  4K2M A;  3E9K A;  4CVQ A;  2W7G A;  2ZY4 A;  3NYU A;  1O4S A;  5E3K A;  4ZSW A;  4HVK A;  5AX8 A;  4F5K A;  4MSO A;  1GCK A;  1W23 A;  3AEM C;  4ZSY A;  1M7Y A;  3GWP A;  3G0T A;  1OXO A;  4M2M A;  1DFO A;  3D6K A;  5D5S A;  1KMK A;  3CAI A;  5EQC A;  1ASL A;  1GC3 A;  3WCO A;  4E1O A;  2Q7W A;  3FFR A;  4UHM A;  2CTZ A;  4XQ2 A;  4GSA A;  2W7M A;  2GMS A;  2AY6 A;  2NMP A;  2QB2 A;  3ZRP A;  1X29 A;  1BT4 A;  3FQA A;  2EGY A;  3ECD A;  2EYQ A;  2ZSL A;  3A2B A;  5G4I A;  5E5I A;  1CZC A;  5FT8 A;  3T32 A;  4A0F A;  3EIA A;  2VMS A;  4WBT A;  1CL1 A;  8AAT A;  3K7Y A;  2R2N A;  1MAQ A;  2GMU A;  3AEN A;  1IAX A;  3E6G A;  1ASN A;  2Z1Y A;  3DXW A;  3MBB A;  4LNL A;  5EUD A;  1CQ6 A;  3II0 A;  5EAV A;  3R4T A;  3ASB A;  4E77 A;  1AHG A;  3DR4 A;  3NYT A;  4MKJ A;  4GE9 A;  3K40 A;  1D7S A;  3E2F A;  3G8M A;  1QIS A;  1MLZ A;  3PDB A;  1TOE A;  3BB8 A;  4ZDP A;  2G7J A;  3OKS A;  3VP6 A;  1BW0 A;  5LHA A;  1ASM A;  1YJS A;  4EB5 A;  3MAF A;  4LW4 A;  2ZY5 A;  4ZDL A;  4WXB A;  3AV7 A;  2BIG A;  4UHO A;  2DGM A;  1YIZ A;  4EB7 A;  1GEY A;  1C0N A;  1H1C A;  2E7I A;  2VGS A;  5HDM A;  2YKY A;  3WKS A;  1YIY A;  1DTY A;  4TMR A;  4AZK A;  3NX3 A;  3QBO A;  2AAT A;  1W7L A;  2C44 A;  1MDX A;  1SZK A;  4OT8 A;  4R5F A;  4AH3 A;  2ZYJ A;  3GZD A;  1B9H A;  4IY7 A;  2VMQ A;  1LK9 A;  3WY7 A;  1OHY A;  3KKI A;  4BMK A;  1BQA A;  1I29 A;  1YNU A;  4R8D A;  2D65 A;  5I92 A;  4MQR A;  2CY8 A;  1CL2 A;  1SZS A;  4DGT A;  1WYU A;  1D7R A;  2VYC A;  2R5C B;  2ZUK A;  2W7L A;  4AO4 A;  4ZM3 A;  1C7O A;  2HOX A;  4Q31 A;  1AMR A;  1ASG A;  4A72 A;  1DJ9 A;  1BQD A;  3P6K A;  1BJW A;  4JF0 A;  3AEL A;  3AEO A;  3VK3 A;  3KGX A;  1ARS A;  1RVY A;  4F5L A;  2W7J A;  2R5E A;  2YCN A;  1E5E A;  3G7Q A;  5BJ3 A;  2HZP A;  1G7W A;  4BA4 A;  3QN6 A;  4WYC A;  1V2D A;  5K8B A;  4WLH A;  1PFF A;  4LW2 A;  4OC9 A;  2WK9 A;  4CXQ A;  1BJO A;  2HUI A;  3GZD C;  1TOI A;  2XH1 A;  3DR7 A;  3FZ7 A;  3BC8 A;  2JGT A;  2VGV A;  2X3L A;  1J32 A;  1EQB A;  4JEW A;  4MY5 A;  4ITX A;  4AZJ A;  3DOD A;  4RKC A;  1O69 A;  1SF2 A;  2FKI A;  1AKC A;  1LW4 A;  1OXP A;  3GR9 A;  1O62 A;  4OCA A;  2DKJ A;  3HLM A;  3LG0 A;  2QB3 A;  3FKD A;  2YRI A;  1ASD A;  1QIT A;  4H51 A;  3BWN A;  4JF1 A;  2EO5 A;  2YRR A;  2QSR A;  2W8T A;  2W8W A;  1CJ0 A;  3PDX A;  4FFC A;  2GQN A;  1JG8 A;  4HF8 A;  3F9T A;  3UWC A;  2AY7 A;  5FT4 A;  2KFP A;  4Y0I A;  1AAW A;  2VMU A;  4GE4 A;  7AAT A;  3GET A;  3E77 A;  1IX6 A;  2CH2 A;  3BV0 A;  4AOA A;  1UU2 A;  2VMV A;  1C7G A;  5G4J A;  1MLY A;  4K05 A;  2DR1 A;  1AY8 A;  1JS3 A;  3MKJ A;  2JJH A;  2WB6 A;  4W1W A;  3R9A A;  1GDE A;  4BA5 A;  3DZZ A;  1DGE A;  2HOY A;  3UE8 A;  3BCX A;  5G0A A;  3GZC A;  1VEF A;  3AOV A;  3NTJ A;  3TQX A;  3JZL A;  2D64 A;  1AJS B;  2AY2 A;  3NU8 A;  4IYO B;  2W8V A;  4RKD A;  1BKG A;  2G6W A;  3QPG A;  5LH9 A;  4W5K A;  5KTB A;  3BWN C;  1AAM A;  3I5T A;  4E3Q A;  1X0M A;  2Z9U A;  4IXZ A;  3MAD A;  1PG8 A;  1WYT B;  1U08 A;  2PB0 A;  1AMQ A;  4KYO A;  2A1V A;  3OP7 A;  4P3M A;  5DB5 A;  2EH6 A;  2VI8 A;  5JAY A;  1D7U A;  1BJN A;  1MDO A;  1CS1 A;  2AY9 A;  2DKB A;  4XJM A;  3RCH A;  2VIB A;  3NDN A;  2VMN A;  5M46 A;  1B5P A;  1E5F A;  2VGT A;  4WB0 A;  1KKP A;  1ASA A;  4B9B A;  5HXX A;  2ZY2 A;  1C4K A;  1GC2 A;  3NUI A;  1CQ7 A;  1SVV A;  4OBU A;  2CH1 A;  4XAU A;  4ADD A;  1G4X A;  1KL2 A;  1DKA A;  2QA3 A;  1IVR A;  1C7N A;  3FRK A;  4O6Z A;  3TFT A;  3JU7 A;  4A0R A;  5J8Q A;  4R5Z A;  1LC7 A;  1LKC A;  1V2E A;  1AHY A;  1V72 A;  3FQ7 A;  3PGY A;  2D66 A;  2VI9 A;  3F0H A;  1Z7D A;  1Y4I A;  3VK4 A;  2BKW A;  2HP1 A;  1W7M A;  1RV4 A;  3N4R A;  1MAP A;  4U2H A;  3UAK A;  3DRD A;  3GSB A;  1AHF A;  4N0B A;  2VGW A;  4Q75 A;  2HUF A;  4GEB A;  4ITG A;  5M4B A;  2AY3 A;  4UHN A;  1UU1 A;  2BI9 A;  4W1X A;  2OKJ A;  4R2N A;  3LVM A;  1I43 A;  4H63 Q;  2X5F A;  1GD9 A;  2CST A;  2BI5 A;  2CB1 A;  3WGB A;  3DU4 A;  3FQ8 A;  3EIB A;  1DGD A;  4OMA A;  2DGK A;  1DJU A;  1M4N A;  3KE3 A;  4F5M A;  2Z20 A;  1AIB A;  1S06 A;  1ASF A;  4JEY A;  4ADE A;  1GEW A;  1LS3 A;  4A0G A;  2BYJ A;  4OYT A;  3B1C A;  4XJL A;  1D2F A;  1TPL A;  4U1T A;  3F6T A;  5FT6 A;  4P7Y A;  3CQ6 A;  3WKR A;  4F4E A;  3N4X A;  1IUG A;  2F8J A;  2JJG A;  3IF2 A;  1GC4 A;  3PA9 A;  2O0R A;  3K28 A;  4WYE A;  1QJ3 A;  2OQX A;  2JJE A;  3B46 A;  1J04 A;  3FDD A;  4RIT A;  1WYV A;  1WKG A;  4WP0 A;  3NNK A;  5HHY A;  2BYL A;  3EI9 A;  4K2B A;  1YJY A;  5M49 A;  5EAA A;  3N5M A;  2Z9X A;  2YOB A;  2AY4 A;  3HT4 A;  3A9X A;  4J5U A;  1QJ5 A;  3WLX A;  3PD6 B;  2D7Y A;  1ORD A;  3RQ1 A;  4XEW A;  4ZLV A;  3AEN B;  2Z9W A;  3I16 A;  3RI6 A;  4ZAH A;  2PB2 A;  3EI7 A;  3NU7 A;  4A0H A;  4J8L A;  1B9I A;  3BWO A;  1WST A;  3Q8N A;  3ZZK A;  4K2I A;  1OHW A;  3DC1 A;  4IXS A;  1ZOD A;  2JIS A;  2AY1 A;  2YCT A;  3LVL B;  3PPL A;  4W91 A;  2ORD A;  3ZZJ A;  2QBT A;  1I48 A;  4DQ6 A;  1M6S A;  2VGZ A;  1AJS A;  1TOK A;  4F5J A;  3ISL A;  1TOJ A;  4MKK A;  4PFN A;  3ELE A;  2C0R A;  2JG2 A;  3MAF B;  4GRX A;  2VMZ A;  2WK8 A;  5EUE A;  2BI1 A;  5G2Q A;  2VLH A;  5EFS A;  3CQ5 A;  4JEV A;  4WYA A;  1UKJ A;  3VK2 A;  1W7N A;  2RFV A;  2AY8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...