1M33A

Crystal structure of bioh at 1.7 a
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
256
structure length
255
Chain Sequence
NIWWQTKGQGNVHLVLLHGWGLNAEVWRCIDEELSSHFTLHLVDLPGFGRSRGFGALSLADMAEAVLQQAPDKAIWLGWSLGGLVASQIALTHPERVRALVTVASSPCFSARDEWPGIKPDVLAGFQQQLSDDQQRTVERFLALQTMGTETARQDARALKKTVLALPMPEVDVLNGGLEILKTVDLRQPLQNVSMPFLRLYGYLDGLVPRKVVPLDKLWPHSESYIFAKAAHAPFISHPAEFCHLLVALKQRVGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BioH protein
publication title Integrating structure, bioinformatics, and enzymology to discover function: BioH, a new carboxylesterase from Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Structural genomics, unknown function
total genus 85
structure length 255
sequence length 256
ec nomenclature ec 3.1.1.85: Pimeloyl-[acyl-carrier protein] methyl ester esterase.
pdb deposition date 2002-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1m33A00
1BCSA 1UK9A 4E14A 1WPXA 4G9EA 4KYVA 3KD2A 1K63A 2EDAA 1ZICA 3ANSA 1L7QA 3FYTA 1ETHA 3WIBA 4DIUA 2HADA 3FAKA 4M0MA 2BUAA 1IMJA 1QONA 1T2NA 4CCYB 1D07A 5JD4A 1W6RA 2VJBA 1CUUA 3G0DA 1X70A 3H19A 5AKHA 1YAJA 2WUDA 1XQXA 1SOMA 4MWSA 5EFZA 5CT8A 1AUOA 2C5GA 1DTEA 1TK3A 1UK7A 5HQ3B 3IVMA 5CBKA 1F0NA 4U2EA 4NVRA 1KEZA 3FVTA 3QYJA 4D9JA 2V97A 2BGRA 1MN6A 2CBGA 2X76A 4H7DA 3I28A 3WWCA 3O9VA 2QRUA 2JGMA 2GZRA 5BV7A 1IUNA 1CUFA 1WPRA 5KWJA 3S8YA 3DKRA 3H2GA 3I2IA 5JYCA 1LPOA 4MQLA 1JU3A 3HABA 5ALHA 5AI4A 5AOAA 2HDWA 4J0JA 4KE7A 1ZD4A 1VKHA 3FCXA 5CT4A 5DNWA 5AK6A 2XUGA 1N5RA 2H7CA 3OM8A 2PSFA 1WCYA 3H2KA 3QM1A 5FDFA 1LPNA 3QPAA 1LGYA 1CVLA 3WKCA 1JU4A 4QE3A 1DWOA 4MJ3A 4G8CA 5AI5A 1GT6A 2YH2A 4U2BA 1WHSA 3F97A 3G9UA 4AX4A 1TIBA 3WIOA 3HI4A 3H1BA 3ESCA 1DWPA 3NOXA 2HA3A 4Y9SA 1VE6A 4H7IA 3WKEA 3GFFA 1R88A 3G0GA 1CUWA 5JASA 2XLBA 1IVYA 4UHHA 5AICA 1TCBA 1QFMA 1CQZA 1CPYA 1GKLA 2XUHA 1YSCA 2X5XA 1IZ8A 3OC0A 5ALYA 2B9VA 3VJLA 1S8OA 3BE8A 3QVMA 4UBNA 2WSLA 3W05A 1JFRA 2HA0A 5IKXA 1QGED 3DQZA 1AURA 4G9GA 1M33A 4QDOA 3AFIA 2OAEA 4RPCA 3WK7A 1U4NA 3HZOA 1UKBA 2OG1A 2Y6VA 1W52X 3T52A 3AILA 1ACLA 3PDCA 2AXEA 1DU4A 5ALRA 5JADA 1JKMA 3WK8A 5EIHA 3G9ZA 1CUEA 3JWEA 4YPVA 1YB6A 2VT7A 5FPQA 1MX1A 1W1IA 4TVKA 5FUMA 3G9TA 1JI3A 2HRRA 2WTNA 4G5XA 2Z3ZA 3WL8A 4CI9A 2IITA 3STUA 3BXPA 3WWOA 5EIAA 5EHXA 1P0MA 1XZMA 4QEKA 4YK7A 1XRPA 2IX9A 2OCIA 4IQ4A 5HZGA 1BS9A 3FYUC 4ITVA 1QE3A 1VXOA 3C5WP 5K3FB 3R3YA 2Z8ZA 4UPDA 5AKKA 2W22A 2QXUA 3ZPXA 1MTZA 2C4HA 4Y2XA 4B0PA 2BKLA 3FNBA 3DYVA 5FLKA 5KWIA 1J1IA 1XZGA 2WFLB 1CUBA 5CTAA 1ZGBA 4FOLA 1GQSA 1QLWA 3LS2A 4FBLA 3BWXA 2AJLI 5EHZA 2R8BA 1TCCA 5LZ7A 2WFMA 1XRQA 2XQGA 5LP1A 1R9NA 3LCRA 5T4BA 4BVKA 4BE4A 1XRNA 1GPKA 4BC0A 4BDTA 2Y2VA 1TCAA 4B81A 1HPLA 1VZ2A 4KRYA 1BEZA 1LPBB 1QIHA 3D7RA 3BF7A 1LPSA 1X2EA 1W75A 4EY5A 4C4XA 1A8SA 4ARBA 1A8UA 5DNVA 1QFSA 4TPKA 4IH4A 1ZD5A 1RWQA 3WJ2A 2ACKA 3WWPA 3MUOA 4WY5A 2FX5A 3VJMA 4QDTA 3H0CA 3CN9A 4OCZA 2G5TA 1H2YA 3K9BA 3N0TA 2PSDA 4N5HX 4BE9A 2XMBA 2WJ6A 4H7HA 4DMCA 2WG2A 3VKFA 1MNAA 1MU0A 3DJYA 4YX9A 4PO3X 3AINA 5C8VA 4J3JA 2ZYIA 4UBOA 4X71A 3C8DA 3X3HA 3AUKA 2WUFA 3FLAA 5HCUA 3LP5A 2GYVA 5LZ8A 3HSSA 5LKRA 1ZJ5A 3ILSA 1AGYA 2WUGA 5EGNA 4X00A 1QIDA 5FOQA 1J2EA 1XRLA 4Y2SA 1CUAA 4X91A 4GLBA 4A5SA 3G02A 4V2IA 4GDMA 5AKGA 4GI1A 2ZSHA 3HRHA 1MX9A 1K6EA 3I1IA 4KAFA 2J3QA 1JJBA 1CUGA 5A6VA 4HXEB 5AOCA 1ZJ4A 4MXDA 3I2JA 5AOBA 1A7UA 1F8UA 5JAOA 3QMMA 4BRZA 2AJBA 5A71A 4J7AA 1YA4A 4DM7A 5FPPA 4WCVA 4P9NA 2OCLA 5JZSA 4AQDA 4MEBA 1XKLA 2QXTA 3T4UA 3SX4A 5ALGA 3L1IA 5FXMA 3BDIA 1AQLA 1Z68A 1YS1X 3UMJA 5CW2A 5BWBA 3LIPA 1XZAA 2JGLA 4W1PA 3FYUA 5HKAA 2WILA 5AKJA 1HKHA 3VDXA 4AMYA 1FFCA 4CIBA 5LKAA 1H23A 1ZGCA 2GYWA 4HZGA 1DWQA 3GUUA 4Y2VA 5FP0A 2RGUA 5ALJA 2JEYA 2X8BA 1TKRA 4H18A 4IO0A 2Q0XA 4LYDA 3HLKA 4IHAA 1OCEA 1O6GA 3WZMA 2DQYA 3R3UA 2BAGA 4H0CA 4GXNA 2QTBA 1XLWA 5DJ5A 4BAZA 1XZJA 1EB8A 5T4HA 4U2GA 4DTCA 3O9MA 4X85A 4OB8A 2CMFA 5LZ4A 2WM2A 3PF9A 2I3DA 2WHRA 4ROTA 5HKBA 2BUBA 2B4KA 1G4HA 5AM0A 3PE6A 1FJ2A 1CUCA 3O4JA 5CXUA 2ACEA 5E4JA 2O2GA 2BUCA 2EDCA 1A88A 3TRDA 4FHZA 4CCWA 1VA5A 4G8BA 1QIJA 1K4YA 1Y37A 3DKKA 5ALSA 3DOHA 3OPMA 3I2FA 3BIWA 2XT0A 4Q1VA 1YB7A 2VQ6A 5HFAA 2OGZA 5E2IA 5DNUA 2XMGA 4C01A 3HJUA 4BZZA 3CN7A 4U2DA 4UFPA 3S2ZA 1H22A 3RM3A 5AI0A 2C58A 5AP9A 2DHDA 5AKXA 5JIBA 1BCRA 1AX9A 4DLNA 4BYMA 1P0IA 1Q0RA 3H18A 5AH0A 3B12A 4B85A 2CEKA 4J0KA 4QLOA 1XZFA 5KBYA 4I19A 2BGNA 3ESDA 3RKSA 3N2ZB 3WKDA 3WKAA 4DNFA 4DMKA 3H17A 5EHNA 4N8SA 2ES4A 3WQHA 4WFIA 4L0CA 2I78A 3FBWA 5FKJA 5A7GA 4OB6A 5ALFA 5H3HA 3F96A 4OPMA 3VVLA 1GGVA 1EB9A 5AKZA 5FRDA 1FFDA 1EINA 4FBMA 4JYPA 5CH8A 4PF1A 4EY6A 2GZSA 4FDMA 5C8XA 4G1FA 5DLPA 5D6OA 2XUKA 2ECFA 1CV2A 3ICVA 4OU5A 4W9RA 4C4ZA 1EVQA 4EY4A 4BAGA 1YA8A 6YASA 2BFNA 4HRXA 4Y2QA 3IUMA 1MPXA 1ZD3A 5AM3A 4K6HA 4BDSA 2XUPA 2JEZA 4QZVA 1OILA 5I8PA 5CMLA 2AJCA 2OCGA 3WJ1A 5A62A 5JAUA 3E4DA 1QIKA 3SWWA 4N8EA 2H1IA 2YXPX 4DNPA 4E15A 4LXGA 1EI9A 4P92A 2WUEA 5ALKA 4MWTA 1LZKA 3WK4A 1N8SA 5I9IA 3STVA 2XUFA 3H1AA 5AK4A 1R9MA 3QPDA 3WKBA 2OAGA 4EB0A 1EXWA 1XFDA 3WYDA 1XZEA 2QM0A 2PUJA 2PVSA 4CG3A 4XIIA 5JZBA 3HEAA 1LZLA 3I6YA 4B6GA 4B7ZA 2PU5A 1NU6A 5ALDA 4XJVA 4Q3KA 2XQIA 2O2HA 4CG2A 3H2JA 2AJDA 1T4MA 4ZGBA 2PU7A 3NWOA 4GBGA 4ARAA 3IUJA 3GELA 1GPLA 2WG0A 1SFRA 1CEXA 1MAHA 1HL7A 3FYUB 1FFBA 1G5FA 2HA7A 3AIMA 3STYA 1I6WA 5ALEA 3DLTA 2XMRA 5JAHA 2HU8A 3EBLA 4FMPA 1YCDA 1ZD2P 3NUZA 4I3FA 3QBJA 4CG1A 2WIJA 4J03A 2I03A 1MT3A 4KE6A 2DFPA 1VXRA 3BIXA 5C81A 4BP8A 5JZ9A 2ZJ6A 1CUVA 1B6GA 1UOPA 4XX1A 4H7JA 2V98A 1IUPA 1EDDA 4H35A 2D0DA 3UUEA 4QWWA 4RE6A 2PPLA 1XQYA 4GWLA 4LHEA 1YS2X 5C8ZA 2CKMA 1C4XA 3WL5A 1BE0A 5KREA 4N5IX 2RI6A 4OB7A 4O08A 1CUHA 1E89A 1ACJA 2GBGA 4AN1A 4WJLA 2HRQA 5F4ZA 1BU8A 5D7BA 1DX6A 2VSQA 1JJIA 2VA9A 1MNQA 5IH7A 4QA9A 1EX9A 1USWA 3DDUA 2Z5GA 3AJAA 3IIIA 2Z8XA 3C6ZA 5ALZA 4UBIA 2CJPA 3ZWQA 1QJ4A 3EQ7A 1WOMA 4BAUA 3EIOA 4J0DA 3CCBA 4A23A 5K3EA 1H2ZA 4Y2RA 3RARA 4KRXA 1UK6A 1AKNA 1O6FA 4FLFA 5DYYA 2WU4A 5J3JA 4H7FA 1G66A 1ODTC 1J06A 4AN0A 1IUOA 5LYYA 2WLSA 1CQWA 1AC5A 2QJWA 3GZJA 3W06A 4MQMA 3VJKA 5A7FA 2Y2UA 3WA6A 3W2TA 2PSEA 4OU4A 3U1TA 5HF5A 4EUSA 4UHDA 3PF8A 3C5VA 1EVEA 4CIAA 4W1QA 2XUIA 3AZOA 1R4ZA 2VAVA 4QDZA 5JD6A 2H7YA 2XDWA 3B3QA 3MGAA 1XZDA 3KXPA 2WU3A 1P0PA 2JGJA 4GHWA 4G4IA 4TGLA 3WK6A 4B80A 1EDBA 2FUKA 2OGSA 3KOOA 4U2FA 1DX4A 4Y2YA 1SC9A 2RONA 4BCBA 4BVJA 4HRYA 3I2HA 2VT6A 4K2AA 4DSZA 3D5EA 1YASA 3VISA 4F21A 1XZBA 4UBJA 2V9ZA 2WHQA 4Q05A 1JJFA 3BF8A 4KE8A 3I2KA 4EZIA 3WL7A 4ZV9A 4JH0A 5ALXA 3R0VA 3BL8A 2GBCA 3STWA 4DMHA 2HA5A 1XRRA 1BEEA 5JANA 3F9CA 3F8SA 3A2LA 3OOSA 3ZI7A 2ONCA 4Z49A 4L3WA 4X6UA 1QIIA 2PL5A 5JARA 1JT2A 3F98A 4AB1A 1DT5A 4I4CA 1Q83A 3EF3A 2VAXA 3HACA 1LPAB 2G63A 4H7EA 3C6XA 5CXXA 2BCEA 5BOVA 1LLFA 5ESRA 5IVIA 5LIPA 2VJDA 1EH5A 3C70A 3G9XA 3O95A 5ALWA 3WL6A 1CLEA 1VE7A 4IH9A 5A7HA 4K6KA 4C89A 5ALVA 2XUJA 2DHCA 5AKEA 5JAPA 2DR0A 1B41A 1BROA 5D3ZA 4KACA 5AIBA 3VVMA 3I6ZA 1DINA 5AM2A 3WMRA 1E8MA 5IVKA 1BN7A 1J07A 4QWMA 5HK9A 1SCKA 4HAIA 3WI7A 3E0XA 4F5ZA 5DTJA 3KSRA 2ZVDA 3H04A 3SC2A 4FNGA 1QTRA 4B0OA 2C7BA 3D3NA 2XI4A 3R3VA 1UT6A 2Z3WA 5K5EA 5CRIA 3WA7A 5CT5A 5HF9A 5K3CA 4XVCA 5AM4A 4AO6A 5I7UA 1W76A 3C87A 3D0KA 2WFZA 1CUDA 4HXFB 2WIDA 4DGQA 1MX5A 1ORWA 1CIJA 3K2IA 1LPMA 1BN6A 3W04A 3STTA 3RK4A 3DL4A 2VJAA 4B82A 2RAUA 4UFNA 1CUJA 3V48A 3IBTA 2OQIA 1XQVA 3BDVA 5CT6A 1OXMA 3CCCA 3DYIA 1XZIA 1VJ5A 4G4JA 2JGFA 3KWJA 1H2WA 3FVRA 4AZ3A 4JEIA 3I1YA 1EK2A 2EEPA 2K2QB 3TGLA 5DYWA 2HA6A 2D5LA 3QPCA 1CUSA 1ODSA 2FJPA 2FJ0A 1XLUA 4UHBA 4E46A 2JGKA 3DEAA 2XMCA 1XZCA 3EQ8A 3LLCA 1XZLA 1WB5A 4L9AA 4Q82A 2XMQA 5CH3A 5D3KA 4BZWA 3G0CA 2O7RA 4OYLA 4ZRDA 4Q3OA 4M0EA 1WB6A 2WJ4A 4FFVA 1VLQA 5CURA 5HK8A 2O2IA 2WTMA 4LXIA 4X93A 4PSUA 2VATA 4P93A 2JGEA 3DD5A 2PM8A 4UHEA 2R11A 4NS4A 4DSAA 5K3AA 3GROA 3IULA 1N5MA 4X6XA 3V1MA 5K3FA 2DHEA 3ED1A 5AKIA 4JUIA 4AO7A 4JYMA 1AZWA 4ETWA 2XE4A 1ZIXA 4LXHA 2HFKA 2XB6A 2PSHA 2XMSA 1ZOIA 2WFLA 1QO7A 4KEAA 4X3CA 3C6YA 4X95A 5ALPA 4BTLA 2HHAA 4UUQA 1CFJA 4G4GA 2OQVA 1ZI9A 2HM7A 4KAJA 3PICA 2Y1KA 3K6KA 4MYDA 4X97A 1TRHA 4HTAA 2QZPA 2C0PA 4G8DA 2HFJA 4X92A 1C7JA 4FWBA 2QS9A 2V96A 3V1NA 4DNQA 3HC7A 3ZLTA 1K8QA 1EDEA 1VOTA 2J4CA 1CUXA 5ALUA 3EQ9A 3ZV7A 1F0PA 3IUQA 3IUNA 2XLCA 5DTIA 1XROA 2CZQA 2YYSA 2B20A 3PFBA 5EIEA 2IIVA 3LIIA 4BTVA 1XKTA 5E4YA 3BJRA 5JATA 4UBKA 4W1SA 4DMFA 3C43A 1THTA 4BATA 1U65A 3NGMA 4AZ0A 1KU6A 2HIHA 2NW6A 2XUQA 2JBWA 4H7KA 1UKCA 3A70A 3DCNA 3WWEA 1ZI6A 1E8NA 2JGIA 2WJ3A 2C5FA 3C6BA 3FLEA 4RE5A 5SYNA 4EY7A 2WIGA 1WB4A 4Y2UA 5C7YA 5AM5A 5AHXA 4HVTA 3OTQA 5DYTA 3WYNA 5HFNA 4EHBA 4AMZA 2XQFA 4Y2PA 5AI8A 4PW0A 1Y7HA 2XUAA 3I6MA 5ALNA 1ODCA 3HYSA 2QVBA 2H7XA 1QIFA 4A16A 1IZ7A 4CFSA 1QO9A 2RHWA 3D2CA 1ZI8A 1F6WA 1SCQA 4J0IA 1KU0A 4DNOA 4EA6A 4ZV7A 1W4LA 2PX6A 3AZPA 3DL7A 3A6ZA 3FOBA 4ZWNA 3BJMA 5K3DA 2ORYA 3D2BA 4Y7DA 4PSDA 4EY8A 1YR2A 2WIFA 1MAAA 2WQZA 4KE9A 5LZ9A 5EHQA 3ZLUA 5AK5A 4PQEA 2UZ0A 3QMWA 1L7RA 4W63A 2WG1A 4INZA 4NMWA 4X7BA 4U2CA 4BVLA 3L1JA 4NZZA 5ALTA 4B83A 3V1KA 4X94A 2XQKA 4F0JA 3P2MA 4XWGA 2HA2A 2OCKA 3IB3A 4WY8A 1E5TA 5YASA 1DQZA 4Q34A 4PV7A 2ZJFA 4FNMA 2XMZA 2OXEA 4C88A 2OLEA 3DNMA 3C45A 2WHPA 1QIMA 4ZI5A 2CUTA 4OYYA 5ALQA 3PFCA 4GEGA 3STXA 2ZYHA 4WDRA 5LZ5A 1YAHA 5AI6A 3R41A 4PNZA 4Y2JA 1EA5A 1NU8A 3IURA 4BC1A 1L7AA 3FWHA 4FKBA 2WKWA 2E3JA 3R3WA 4W1RA 4J0GA 1MJ5A 3JYHA 1R3DA 1ORVA 3MVEA 3DOIA 4FFWA 2XUDA 1JMYA 2PKYX 4LKOA 4AXBA 1BRTA 3RLIA 4EBBA 1CRLA 2DSNA 4BBZA 4P08A 1GQRA 4ZREA 5LLSA 2C0QA 1P0QA 1QZ3A 2XMDA 4YASA 1HBJA 1EK1A 1GKKA 3OURA 4BB0A 3ZLVA 3H2IA 5AKLA 2ZJ7A 3DS8A 3R3XA 5CT9A 3KWFA 1TQHA 4HXGA 3M82A 2HL6A 3W9BA 3V9AA 1LBTA 1R50A 3O0DA 3ANTA 2QKYA 3U0VA 5AJHA 1HQDA 2ZYSA 1C7IA 1QIEA 3ICWA 3L1HA 3R3ZA 3M81A 1DQYA 4OSEA 2LIPA 4F60A 4FLEA 3Q0TA 1Q0ZA 1LNSA 5AI9A 3G7NA 1RYYA 3YASA 3TJMA 3E1GA 3WLAA 4RGYA 4MEAA 5K3BA 1GXSA 2CB9A 3H2HA 4K6GA 1UZAA 4CCYA 1UOQA 5T4EA 3PI6A 5T4FA 1PFQA 2PSJA 4FTWA 3G0IA 2G4LA 3CXUA 3D2AA 5AM1A 1N1MA 4KAAA 5CH5A 1Y7IA 1EHYA 1WM1A 3O4HA 2OGTA 4FLMA 1XRMA 3VXKA 5HQ3A 3AZQA 4GECA 1HLGA 3D59A 4DYHA 4QLAA 4X6YA 3I2GA 4N8DA 4Q3LA 2J4FA 2JF0A 5HF8A 2XQJA 4ZXFA 3OG9A 4J0HA 2QUAA 4B9AA 3WK9A 1PV1A 2Y6UA 4UFOA 4LYEA 1PJAA 3C8HA 2GBFA 3QMVA 5IVDA 2QT9A 1QIGA 2GBIA 3ESAA 2OPHA 4WDQA 3WWDA 2VEOA 4J0CA 4IH1A 3B5EA 4HS9A 4Y2TA 5JD5A 2HU5A 1R1DA 1RP1A 2VTVA 2HA4A 4BCCA 1X2BA 5AIAA 1G42A 3FCYA 1LBSA 4E11A 1UFOA 3F67A 1TAHA 4B9EA 1UXOA 3JW8A 5JALA 1HDEA 2XUOA 3KDAA 4JNCA 4RNCA 1AMNA 2G5PA 5A2GA 1H2XA 2PBLA 3AIKA 2AJ8A 2I3ZA 1DT3A 1VZ3A 3PUIA 2BJHA 1XZHA 1U8EA 1CR6A 3E3AA 3M3DA 4OD0A 1FSSA 3FLBA 1K5PA 1E8DA 1UOOA 5IVHA 5LZ2A 2GYUA 1JMKC 3SK0A 3GA7A 1SCIA 2WHPB 4UHFA 1U2EA 3QH4A 2QR5A 3IA2A 2QOEA 1E66A 3M83A 2DQZA 4L72A 3PUHA 3HXKA 4C6HA 4BCDA 3O4IA 5AKYA 1CUYA 1Q84A 1FFEA 3QITA 2ROQA 5HF6A 4UHCA 4B84A 1NX9A 2WIKA 4KJXA 3O4GA 2RIPA 2B61A 1XQWA 3WZLA 4C87A 3V1LA 4S0XA 2YASA 5ALLA 4OUKX 1LPPA 5ALMA 3W9UA 4PSCA 4WFJA 2QJRA 2VJCA 4KR0A 3GBSA 5ISMA 1FFAA 5EI5A 1WHTA 5DWDA 3FSGD 4LIPD 4BP9A 4QNNA 2HU7A 1CUIA 2W6CX 3TEJA 2QUBA 1QOZA 1E3QA 5AK3A 4QDXA 1A8QA 5ALOA 1CUZA 1UKAA 1UWCA 5BWCA 3IDAA 3UUFA 1MO2A 4MYSA 3G8YA 3A2NA 2P8SA 3MUNA 2ZSIA 3AIOA 7YASA 1THGA 1GPNA 3FSGA 1GZ7A 4QDUA 4UBLA 2QMQA 4K5QA 4C4YA 1QTIA 1XLVA 2JIDA 1VA4A 1XZKA 4AO8A 2J3DA 4GW3A 2PUHA 4WFKA 3G0BA 4UBMA 5FV4A 2VF2A 4BRSA 4M0FA 4H77A 3A2MA 3WK5A 2H9YA 1ISPA 5SYMA 5AO9A 2O7VA 3D4LA 3ESBA 3R40A 1UK8A 2ZYRA 2RHTA 5ALIA 4X90A 3QZUA 5E4TA 1ZIYA 3Q8WA 2DCMA
chains in the Genus database with same CATH superfamily
1PJQA 4ZYWA 1PW5A 1Q0HA 3TQCA 4E14A 1WPXA 4OXXA 1I7QB 3CMMA 1JECA 2I80A 1MX3A 3CRRA 3IT1A 2G1JA 1GPMA 1Y3HA 1JR3D 4J75A 1K63A 2EDAA 1P6UA 5GONB 5MN6A 1UM9A 3ANSA 5J4YA 3PIRA 1T9DA 2J9XB 3MMXA 3IOCA 4I1SA 3NB0A 1VB3A 1N3BA 1S4QA 1SOVA 2PANA 2WSSA 4A2CA 2HNKA 3UPUA 2FNAA 3FAKA 3H4TA 4W6ZA 4YPOA 2A1UB 2BUAA 1QONA 2XRYA 1D07A 4OHKA 2BY4A 3C7AA 5CD1A 4Z7JA 2NYAA 4P82A 3FETA 1CYDA 1YB2A 1CUUA 4Z1OA 1WVGA 2Y1XA 3GT7A 3H19A 2P9HA 2Y1WA 3V33A 1YAJA 3JQ7B 3UM9A 4RIGA 2KHZA 4NR0A 1U0JA 2F90A 3E53A 2BGGA 1GV1A 2Q0HA 4MWSA 3IQDB 4DE5A 4GI2A 1QVWA 3BRCA 3GLGB 2ZITA 2XVMA 5KTPA 4MKHA 2KWIA 3LRPA 4MCHA 2OP1A 4NONA 4PHGA 4UHJA 3NNSA 2D00A 1JG2A 3GGOA 3LVFO 3NWEA 1DTEA 2ZSDA 4XB1A 3R5HA 2WJVA 4N54A 2K5UA 3VDRA 2FYTA 2EP5A 1AGNA 4HZUA 5H3LA 5CBKA 4IIDA 1T9ZA 9LDBA 3KZXA 1G63A 1MV5A 3C7CB 3OIUA 3OOEA 3UMMA 3FDIA 2PZAA 4HKTA 3JZDA 4FMDF 4XM2A 4C03A 4PLWA 1V37A 3I73A 4MJLA 3FVTA 3QYJA 1JZQA 1N5KA 4WRRA 1AK9A 3N05A 2P9ZA 1VHQA 2V5UA 3DE6X 3N7UA 2J4DA 4RKFA 2X76A 5HEKA 4M22A 1OAKA 3GFRA 2ATEA 1DKPA 4TQUS 4F4UA 3RVMA 1F0KA 3O9VA 4TUYB 3WWCA 4QJ3A 4ZI7F 3TECE 2GZRA 4JV5B 2YC2C 4B4VA 1G21B 3DEZA 2FPIB 2A1TS 3P2JA 1CUFA 1G55A 1KSHA 2PFGA 4FHEA 4LE2A 2V65A 4EHIA 4AUKA 3B7GA 3V80A 1VMDA 3DVLA 3BMCA 4YFVA 3DKRA 2VTBA 2V6IA 1CY7A 1YH3A 3DFKA 1JXOA 1PGOA 2G07A 4XUGB 3VSEA 5L6LB 1NL3A 2OE2A 5B64A 3ETCA 4KFUA 5IMSA 1AUQA 1OXVA 3IC5A 4EPRA 3AJEA 5L45A 3GJ0A 3R7WB 2PUAA 2O4CA 1ZD4A 2H54A 3K0KA 4ZCLA 3MOGA 3DMRA 1F12A 4O0MA 1A9ZA 5DNWA 5AK6A 1KEUA 1K7YA 3C41J 3KJFA 3UKDA 2H7CA 2B37A 5L95A 4XDGA 3QKRB 1VJGA 4KTTE 4I1YA 4F71A 2VK4A 3VYWA 4Q4AA 1C3OA 2A0YA 3FMFA 2JJQA 4J16A 4B87A 4Q16A 1RKVA 2A9RA 2PQ2A 1KJJA 2VPYA 3IBCA 2TECE 4JBGA 5DXJA 4LF7B 3A6PC 1A4IA 3Q1KA 1C1XA 3PD1A 3QXSA 2CXUA 1GGNA 3PPIA 1XMOB 5LU9A 2AWNA 1T4GA 1WEKA 1Z7WA 2PH5A 3AOEC 3U4IA 5G3ZA 1DWOA 5T3UA 1YJ8A 4NCJA 1PNVA 4PZCA 1U04A 1O54A 1FU8A 2IYYA 2ST1A 2YH2A 1USIA 3T99A 4EVIA 5PNTA 3G8AA 1U2PA 4A0FA 1RMTA 2W4QA 1WXGA 3PX3A 1Q1GA 1KAOA 1V48A 1W46A 1E5QA 2YWGA 3C5HA 4L28A 4OA8A 5FF9A 1PZXA 1JSLA 2B35A 1XA4A 3JQQA 4LY3A 4WHMA 4WWHA 3UA4A 4DCOA 2JK1A 1G4UR 1J2JA 2BMAA 3H1BA 1Q2UA 3L7KA 4LGMA 4BWYA 2X6TA 3RTGA 3AVXA 1O1YA 2FQYA 3V6MA 5LDGA 4BUJA 3KZ1E 1D1SA 3KD3A 4MZDA 4AJ9A 1O7JA 3ETJA 4ZPXA 2BPOA 4Q1BA 1J2RA 2JI6A 3OSZA 3I4FA 4KP7A 2H1WA 4RPHA 3EG9A 4FI3C 1MPTA 3C7DB 2D0IA 4QARA 1XTTA 4UHHA 1R66A 3BFVA 1TCBA 3HLYA 4EPYA 1F0YA 2E85A 2HF9A 4URWR 2XCUA 3N5CA 1ELOA 4MVJA 1OH6A 4IGIA 1QFMA 3C3JA 2VRBA 5FI3A 3VSAA 3GDGA 5LQSA 1XQ1A 3C3EA 2DKNA 2L18A 3H0KA 2F3RA 3QELA 4WVLA 3RC1A 4D6YA 4ZI3A 1T0HB 4BNIA 3LKDA 5DV9A 4NU0A 5EUBA 3B1WA 4ER6A 1WV0A 3L4KA 2Z2YA 5ALYA 4JEUA 2RSLA 1S3FA 1H8EA 1KDOA 4MWBA 2R68A 4TWJA 1O94A 4EQZA 3PEEA 1L3CA 2UVPA 4WW0A 3TPZA 4DV1B 4F2HA 2O4UX 1NI3A 3SYMA 2P75A 2OBXA 2P2SA 4C0KA 3QVMA 4OG2A 1PWZA 2CZCA 5BN4B 3OE5A 5T5QA 5IAGA 3VYRB 3VX4A 2J3IA 4BP1A 4EHAA 4YJGB 3T7EA 2ZUUA 5ADWA 2HA0A 2JATA 4PZAA 1NA5A 3UFBA 1NUHA 2H2DA 3ASYA 1TTPB 2F67A 1UKZA 1Z3IX 3W3AD 2QL9A 1WZ2A 2ORED 5HZHA 1XPJA 1RU3A 1M33A 2H4FA 2HLDA 3JQ8A 4G9GA 3BMNB 3S1AB 3EWIA 3KKPA 1TQ4A 2QQ0A 3KLBA 3NV7A 3P2EA 4HGOA 2Z57A 4NYIR 2DB3A 3SX0A 1WMBA 2KBEA 3NAMA 3HCPA 1NXQA 4YECA 2FSPA 2YYYA 3HZOA 1UKBA 1KDZA 4KTVE 5J5CA 1RRPA 1FS6A 2A88A 2XNDD 3AILA 4RKEA 1IOWA 2C2OA 3QUCA 1ZVKA 4OIFA 4QQRA 4QELA 3OZUA 2YCLA 5EIHA 3W6PA 5BSMA 2PT7A 5FULA 3G9ZA 3LQRA 1QUEA 1CUEA 1U0BB 4ZTZB 2WWWA 3W5JA 2J5KA 3IR5A 4IRXA 5CA1B 3P0HA 1GQQA 2M1ZA 2JB9A 4KYTA 4TVBA 4D4GA 2VT7A 5FLYA 3ADDA 1XU9A 1Z45A 1V3TA 3ZX5A 4FYXA 3ANXA 2CJXA 4LEIA 4W7IA 4ANFA 5ADHA 2QAGB 4N3AA 4D9NA 2IW3A 2O1SA 2V7UA 2B5WA 2WJZB 1TIKA 1NR1A 2HRRA 2BFFA 2ZE7A 5CB8A 1N7GA 3AERA 4M0CA 4WOBA 4DMGA 3DUFB 3OIWA 1USKA 2PA3A 2GX6A 2I33A 4MQFA 1D1PA 1OROA 3STUA 4D9KA 3PQCA 5KYKA 3WWOA 1WD7A 1SKQA 5CDYA 4IYJA 2VP3A 3VHXA 3LFHA 1DEKA 1VCOA 1WXDA 2HRBA 4RWZA 5ERXA 1N32B 3OPXA 2WJGA 2GB4A 3SSMA 3EXAA 4EJ6A 4Z9AA 3RYHA 5J2TA 1HDCA 2EF0A 2OCIA 5CK4A 4YLYA 2H2AA 4BECA 3L43A 3CPEA 3V1UA 1OU0A 2XOEA 2FSHA 1MV8A 2CNWA 2YZGA 3FYUC 4ITVA 9LDTA 5KOIA 1XN1A 4MZXA 1GPDG 1S3SA 4QTUB 5K3FB 5KSWB 3TKYA 4AVYA 4P3XA 3PXEA 2GA9A 1M8JA 2LR0A 4NRDA 4PX9A 1M73E 1JWAB 3IOEA 4CNQA 4ZYLA 5LQJA 3S0JA 5EYPA 2HDHA 3BKXA 2C4HA 4G0VA 4TXLA 2B1IA 1EDOA 1U7ZA 1V8ZA 2R6ZA 3BE4A 4QJIA 4WVFA 5CW1A 1N6KA 4MCJA 1DKQA 3GF4A 3NTLA 2VXYA 1C3LA 2CDBA 1NKTA 3EXEA 3LC1O 2NSJA 3N70A 4L0DA 5K1ZA 1PVOA 1J1IA 2QBYB 4MPTA 2WFLB 2DWPA 1GZUA 4NIMA 3WLSA 4BRUA 1CUBA 3BD6A 2OR3A 3ECSA 5CTAA 3IMGA 5L3ZA 3VR5H 4C0XA 4DDWA 4UTVA 1PSWA 3PQFA 1Q0UA 3AI7A 1MIOA 4GXQA 5J40A 3I5UA 3AUYA 1E7WA 1ZBDA 3OM9A 3PTAA 4C3ZA 4BGVA 2RG1A 2GN6A 3T7TA 1ZSYA 3BTUA 3N76A 2AJLI 1GGMA 1Z12A 2EKBA 2UVDA 3R24A 1P2GA 2A0UA 5DJ5A 1K1EA 1F2TB 3AR4A 3QQPA 4ESOA 3LKVA 1XAJA 1XRQA 5BVHA 3WGIA 2H2WA 4TZTA 1JDTA 2XQGA 3AP3A 3JWHA 2NZYA 4KMRA 5J59A 2RGYA 2XVZA 4WZAB 1J7KA 1WQ4A 2XHEA 4D0NA 1YRYE 3ZDZB 4PCAA 1E5XA 1OKKD 3LCRA 3HJHA 1UM9B 3GDOA 3I9KA 5T4BA 1HG0A 2I55A 4UUOA 5AK0A 5K51A 3ZZUA 4CMIA 4E5SA 3RUFA 1FRVA 4MQ5A 3MOSA 3O03A 5SY4A 2J08A 4HEA6 1GPKA 3UANA 5IU6A 3PL5A 3IRVA 4MHSA 4POOA 4JSRA 5FNVA 3R0QA 4TYPA 4DQXA 1EVJA 1VZ2A 1OOEA 4UUBA 3X1DA 3PNLA 4PPFA 2WYWA 4X84A 4BO5A 1LPBB 2Y66A 2ZREA 3DFZA 3LA6A 2DETA 1QIHA 3D7RA 3WTCA 1KP3A 2IPMA 2OFFA 4BLSA 3VQTA 1FP7A 1M7GA 4BRWA 1TEZA 2BBSA 2PPVA 4H60A 2G4CA 1CS4C 1NMQA 2JFNA 2XDQA 3GMDA 1OXUA 4DRXA 3IQXA 3X2SA 1S0UA 4KKVA 4DREA 1M6NA 1XVLA 5GVRA 4E7PA 5KYTA 1SIWA 4HZUB 3D3JA 1A8SA 4JQOA 1KIAA 2BTEA 4MAFA 1W5FA 2O6HA 3JYNA 3FHJA 4RIEA 1B8VA 1YQ9A 2PMFA 1E2PA 2QQGA 3BX1A 4TPKA 1ZM2A 4IH4A 4YRIA 2FP3A 1Y4ZA 4PG8A 3D6NB 2C4MA 3DOCA 7ADHA 5JXHA 2F62A 1XPOA 5BRNA 1KFBB 4DMRA 1M1YE 4BE7B 1X15A 3EIUA 4WY5A 2MT9A 3LQQA 3VJMA 3UWKA 3ODPA 1RXVA 4OV6B 2QVGA 4QXQA 1UJCA 3FWNA 2AFIA 4O0LA 1EFDN 4YJ3A 4E30A 1GUAA 3H0CA 4H31A 2NPIA 3QIVA 4B5KA 4IUCS 4ZAXA 3VVCA 2V7QD 1NXTA 4II7A 4DLTA 5IDYA 3TR5A 3PENA 5JRZA 1OWNA 1PNTA 1YR3A 1JH8A 1P3DA 1IL0A 3K9LA 3ZCTA 3N1UA 1QRSA 2O3RA 3F78A 1QHIA 3GEIA 1AN9A 3K9BA 4N5HX 1W2WB 4B3DA 2CXPA 1W35A 4B40A 3K9HA 4G0XA 2CJYA 2Y0BA 4DMCA 5TJHA 2CNNA 2XMPA 1POXA 1S2OA 1PFGA 4O5OA 4U7WA 3ZWPA 1T5OA 1Q1NA 5SZHB 1LUAA 3V4ZA 4AP5A 1EBBA 2ZRLA 1KGSA 3PJFA 3WJ7A 1XD9A 1ZLXA 4K3UA 5JZVA 4PO3X 3AINA 3B3JA 1OREA 2VXBA 3OKFA 4X71A 1HSZA 2I5PO 2ZYIA 4YO7A 3T0GA 4Q4AB 3X3HA 2QNRA 1P2FA 3WYCA 2Q46A 3VPSA 5LZ8A 2OWDA 2HQ1A 3EB9A 4PPQA 2QMEA 4MICA 3AESA 4V0KA 2AFVA 3IV9A 1ZJ5A 1C1XB 2WZQA 1XDWA 3PGA1 3QY9A 1ZPDA 3ILSA 2RGCA 3G49A 3F3SA 4MGIR 4XYBA 1L5GB 4D92A 4UNIA 4NMMA 4ZJUA 1ID8A 1AS2A 5FLXA 4JX8A 2A6PA 2W11A 4KIFA 1RYDA 2N47A 4PAWA 3TCNA 2WUGA 3CZAA 2AH5A 3NRCA 5IDQA 5JCOC 2OFXA 2P2CA 3CEHA 1U1CA 2A0KA 2EZ9A 1OWLA 3ESRA 3F90A 4S0ZA 5AHOA 4OFXA 1EAMA 1Y6RA 2R62A 3DZHA 2Z2ZA 2AF3C 1NXXA 3PHLA 2WQ6A 3LUDA 2I6FA 1J2EA 1HYQA 3NUGA 4GZLA 4MJXA 4FHCA 5G2OA 3FZYA 3SHFA 3O47A 4Y2SA 3LQFA 1K5GA 1CUAA 1QMPA 1SXGA 4H0NA 4X91A 3Q4GA 1DBVO 4JYBA 3PU6A 3HP7A 1G8GA 4ISBA 1LLUA 4MK4A 3IBFA 1KZGB 3MN1A 2BLLA 3D8SA 4RD0A 2CLKB 4G09A 4YVFA 3SHOA 1JW9B 3QEMA 1A95A 4LX0A 1SCNE 3GLHB 1L8LA 1N36B 1WOYA 5IARA 3UXYA 2WWTA 5K9ZA 1G8JA 1N6PA 1NJ1A 3EG9B 2BZ1A 1NVFA 3T9FA 2ZI4A 4JUDX 3UT6A 1W25A 3Q12A 5EUMA 4A0QA 4RC9A 3MT8A 4OP3A 4M1OA 4WN9B 2OA0A 4MKZA 2V74B 2CCGA 3UK1A 1JJBA 1CUGA 3HBFA 3PUZA 3ZGOA 3B36A 4CODB 4EL0A 2ADOA 4AS1A 2V6BA 1BOFA 1YCHA 1XK7A 2IS4A 3FTDA 3PC4A 1H2BA 4TKVB 4BLQA 5HUQA 4GWGA 2VP9A 3QELB 4MXDA 3ZC3A 3GGPA 1L7VC 3P2IA 1A7UA 5F12A 5K0GA 1MDFA 5DI3A 2NU8A 3VBCA 2AJBA 5EZ6B 2AD1A 3D0RA 1G21E 1W4RA 1RLOA 4M4SA 4TN5A 4UARA 5I9BA 2UVPB 3EYWA 1K27A 4F3NA 5AESA 1YRLA 2R4TA 3EW9A 4JC0A 3TB6A 5F1PA 1C8VB 4IPTA 4BFWA 5SZJA 1JHRA 5ARCA 4DLYA 4F56A 2ZU0C 2BH2A 1NMXA 3G88A 1K88A 1X87A 5JZSA 1P17A 3N8KA 5IAOA 3C6MA 3V8RA 4J9VA 4MEBA 3WNVA 4MI3A 5I9MA 4KQ6A 3MJDA 3WSVA 2GK7A 4FB5A 4XDHA 1JAXA 4E5UA 4XQ9A 4RW0A 3CUTA 1OH8A 4K1LA 3HVIA 1ZSVA 4X1OA 3KQUA 5ALGA 1WXIA 2F6RA 1LEHA 2DWOA 3BDIA 4Q37A 3IQWA 4NPHA 1Z68A 3VZPA 4CLOA 3ZJTA 1CY8A 3ZQUA 2F00A 2EGUA 3UMJA 2Q3JA 1PN3A 1EFUA 3IPXA 1SA0A 4Z99A 4Z8XA 5EVCA 3JQBA 2RH5A 1NYTA 3LIPA 1C1YA 1F8YA 1KI9A 1XZAA 3IKVA 5ENDA 5G4KA 3RUDA 3T0IA 4DW8A 3KR0A 3R5TA 4C4PA 4CLHA 1ZZEA 3JALB 3ZDYB 1KAGA 3LG2A 1ISGA 2WUVA 4TMVA 4CMBA 4ZVPA 3RRXA 3DG9A 4FDLA 1FFCA 1USVA 3O75A 3OQOA 3UV6A 5KOJA 4G85A 1KYQA 2GXAA 4AO8A 1H65A 2ZSBA 1RZRD 3ZU5A 3ZIAD 1PR3A 2J6HA 3N39C 3ZQJA 5UKDA 8AT1A 3CR8A 3D8RA 3GUUA 4OREX 3VMFA 1Y6JA 3WHIA 2C5SA 4P7GA 3OECA 5ALJA 3D7NA 2OOSA 3LUKA 4MQFB 4S2UA 5GQSA 3NTQA 2ISQA 1YE5A 4IP0A 4PGAA 4QTZA 3VU8A 1W9MA 4QVKA 1IHPA 2Q0XA 3C3AA 3OESA 4YRJA 2EBHX 2WIBA 2V7VA 3BFXA 3NNDA 3HLKA 3VHXB 3Q3EA 3TZHA 2A5JA 2Z2IA 3H84A 2IE0A 1Z17A 2VWHA 3P1JA 3LCCA 5H70A 3RYHB 5AW8A 5J2TB 1BMDA 2Y4OA 5F7JA 2PA0A 2ZULA 3BRWA 1DKUA 1JLSA 1GLNA 1NUTA 4UDNA 1U0TA 4YV0A 1EB8A 2J3JA 4BGUA 4MR7A 5B3AA 2J87A 1RLUA 5JDCC 3NH6A 1QGZA 5JY6A 1Z7GA 1K6JA 3OZFA 2VP2A 2CMFA 2WQ7A 2WM2A 1LDGA 4U02A 1IK6A 3WYAA 1HTBA 5EYPB 1KZHA 2AZDA 3UMYA 4ROTA 1EE1A 2QK4A 3QEBZ 2AT1A 4ZICA 1G9TA 5DK6A 2XWJI 5KTTA 3P4UA 5E0OA 3TXXA 4ECEA 2XGOA 4MMXB 4HNSA 3F8WA 4DIDA 4LZPA 5FNZA 3S5UA 2QTNA 2PT6A 4Q39A 2XY4A 5I47A 2QN9A 3WL4A 5BN5A 1ZIOA 1FJ2A 4YRTA 1ZUHA 1RLIA 2ACEA 3REQA 4XASA 4ZK6A 2HSDA 3FI0A 4LMRA 4C30A 1MIOB 3RC3A 2O2GA 5BW4A 2FHSA 3HXTA 1ZCAA 3N58A 4CCAA 1XT6A 1IXSB 1NBOA 1KOLA 3Q2KA 3OE7A 2XQVA 4HRAA 4DC1A 2I4NA 4JIGA 5BO5A 1T3HA 5G0UA 1CEEA 4P58A 1N25A 1ZH2A 2NVOA 2PGOA 3NVDA 3ETHA 4JI7B 2GXSA 4QXRA 3TIIA 3UENA 5IBPA 4A0GA 4B7CA 5BVHB 3OPMA 1EWYA 3CB4A 3OY7A 4G89A 4PE5B 3LHIA 4R2MA 2HMSA 1AKYA 1S9DA 3IQGX 2VQ6A 5F21A 4X7RA 2ERYA 3TL2A 1T43A 1Z16A 3OWHA 5BY2A 3S68A 4DEXA 3TAHA 5DNUA 4CMIB 2XMGA 4J7UA 4YMUA 5IANA 3WAGA 1AV7A 2QTHA 3HJUA 3CN7A 3MIZA 4KDEA 2IPNA 3S44A 3UY4A 4BZZA 4UFPA 3JD0A 5FTLA 2JGDA 1GTL1 3KJNA 1KRWA 1D2GA 5FNVB 2ZM5A 3ZWDA 3BSYA 4B43A 1V95A 3GEBA 5AI0A 3IMCA 3BFJA 5AP9A 4BYGA 2X7HA 4FE7A 4CKYA 4JI0B 4TSKA 4CT4B 1XJ0A 2HLNA 4FR0A 5EP3A 2YJGA 4EYOA 3HKCA 1VG0B 1PS9A 1JS1X 1YIDA 3GUYA 3CVVA 3HUEA 4HNHA 2YFQA 2Z43A 3GFGA 2ZJ5A 2XDQB 4P0QB 2QN2A 5A4KA 1WB9A 1PL7A 2OM6A 2GTHA 2WYOA 4KUHA 4F8YA 1BZYA 3GGJA 2ZWIA 3M1AA 4NZNA 5GGXA 4ZXPA 3H6HA 5AW1A 1ISFA 3TZEA 1L7PA 2QLTA 4B85A 4J0KA 2NSHA 3UKOA 1ST3A 3H8SA 1T9AA 4NP6A 4QLOA 3EULA 5ERYA 4D80A 3RSHA 4WECA 1XZFA 3BL6A 5KBYA 5LQUA 2BGNA 4CV1A 2Q7DA 5JQWA 1D6JA 3K9QO 3RKSA 4EY3A 3EW7A 3NC0C 4H59A 4LDJA 4YT4A 3N2ZB 3EDCA 2JW5A 4X8OA 2A4KA 1ZZGA 2JLCA 2O8NA 3ZGLA 3IVRA 1CVRA 3LWZA 3TTSA 3WNDA 3K1TA 5EHNA 5DSXA 3W90A 3ZV5A 2ES4A 2CHGA 4YJ3B 4DQDA 5E9JA 2CV0A 2NZVG 2WE7A 1P3Y1 4L0CA 4WL0A 3WGUA 2BKEA 5A7GA 1JQ3A 4JENA 3WX0A 2A5GA 4PONA 4DZZA 3B78A 5DXFA 3B3AA 3I01A 4UCXA 5H3HA 3WJAA 4D3ZA 3O38A 4O2AB 1YZYA 4YJ2F 1GGVA 5K8LA 3SIRA 4K9QA 5TT0A 3UEOA 2IYLD 3FKSD 5TNXA 3LT4A 4RAQA 1FFDA 4IICA 1EU1A 4RL6A 4YQZA 5H16A 5THQA 1L5MA 3HQ4O 3FWKA 4WACA 5I7RA 4JOSA 4JMLA 2O0KA 3JSXA 1NDQA 5E3IA 1NSFA 1FFSA 1RKXA 3OQPA 4FDMA 5JNUA 5D6OA 1YS6A 1E9RA 2LUOA 3HRKA 1J25A 4GRAA 1KDYA 1S2MA 3L8ZA 3GLUA 4UNPA 4ED9A 2WKPA 1O6BA 5DBFA 3DDZX 4PO1A 4COOA 3NEAA 4L02A 1A4RA 2HT6A 2YUIA 2R1VA 3AESB 2AMLA 4O33A 4IUYA 4GXRA 3RKUA 3Q7TA 2V55B 4WOPA 4QQFA 4X64B 1YJXA 4FK8A 5A5GA 4XWAA 3BB4A 4FSHA 1CZUA 1T0UA 1EFCA 1WUTA 2OHIA 3EMVA 4UTPA 1RAFA 4DDKA 721PA 1YZNA 1Q1AA 3OX3A 4IRMA 3PUWA 3IUMA 1MPXA 3KWLA 4KN8A 2D1TA 4FCTA 4K6HA 4CR6A 3TRKA 2JEZA 3ZKWB 1OILA 4DCJA 3E5MA 5I8PA 2X3YA 2C92A 3ZI0A 2Z9BA 1OSNA 1GCGA 3DSRA 3NEJA 1OWOA 2PWYA 1WUIS 3SLKA 4JLKA 4F06A 5IAEA 1MZPA 4XDYA 4AMBA 2V0GA 4QXOA 5EXTA 5CM2Z 1N8NA 1W88A 2FQXA 2OXCA 4JI2B 1QIKA 5F4BA 3PC8A 4B3HA 1XVTA 2NUPA 4NMLA 3BGVA 1E1NA 4R1NA 2OILA 2HLHA 2LCIA 1LVUA 1QF9A 1QVAA 1T4CA 4B3SB 2W9XA 4BWFB 1ZC3A 1TPZA 2W00A 1UPBA 3ZDQA 3ZDDA 5ITZB 3SHWA 3K9WA 3O90A 2GF9A 4AF8A 2I4OA 3F6CA 4N18A 4H1UA 1W4ZA 1IG0A 2COKA 1GPYA 1QG0A 1Z37A 5CA0A 2YMLA 3M5CA 6PFKA 2HDNB 4S24A 4LXGA 1DQNA 4IQFA 4N41A 3MK31 2CXRA 4P92A 3WNCA 1TQDA 4OAPA 4W82A 3WK4A 3ETNA 1V11A 4CKCA 4DCPA 3WGYA 5I9IA 4S2EA 821PA 3STVA 2XUFA 5DI3B 2NU8B 1CZNA 2R86A 1FUUA 2OO3A 4NCIA 4TT3D 1TO1E 3KTOA 1G3IA 5AVJA 4BX8A 5JFGA 5KNDH 2GFIA 2RHHA 1NONA 2R8PA 1UBNA 2VPWA 3NBMA 2OAGA 3FPLA 5TGDA 4CUKA 2JH3A 2V7PA 5DNDA 1N2CA 1XZEA 3HRIA 3K30A 1NQVA 4AG5A 4LUCA 4BO3A 4CF6A 5AW7A 1E99A 3H9GA 2VTEA 4MJ7A 1Y1SA 2PVSA 1C2TA 1PUXA 3B20A 4OGKA 4Q48A 3QXHA 1FNSA 2EGHA 5GONF 2OKGA 3UGKA 1GR1A 1G0NA 1UBLS 3L05A 5EEHA 2VJNA 4XJVA 4P36A 2XQIA 5AHWA 2EJUA 3GJ4A 4CG2A 1WCV1 2YS6A 4CLOB 1IJFA 2ID4A 3K0BA 2IS1A 2AJDA 3INTA 3KOZA 1EUQA 2IEZA 3QSYA 4YRCA 1P1IA 1R8XA 4PYQA 2D5AA 2ECOA 2N0SA 3EZYA 3OT1A 3QEKA 1L7NA 3NFYA 1Z8FA 1ZOOA 2PU7A 4JDPA 5EE3A 1JQKA 4ARAA 1PZFA 1TC2A 5G4KB 1R12A 1J33A 2Z30A 3OO0A 3P0RA 1J5XA 4PIVA 5JPIA 4Z1MA 4HUTA 1BWQA 4GI3A 1HKUA 1FFBA 1TADA 3ZXYA 1KSFX 5AVYA 2F3TA 4HNGA 1TCUA 4MV0A 3L18A 4F5YA 4QGGA 3IVAA 1DQSA 2IXFA 3GI1A 1A8PA 2AQ8A 1N33B 5HWSA 4WZ6A 3AIMA 1B4DA 1U8FO 3OPNA 4LV5B 2WPDD 5FBRB 2Q3DA 3AL0C 4YBRA 3D6AA 1D2CA 1DDGA 3DLTA 2B5VA 4FOPA 4MGZR 1ZOSA 1EDZA 2HU8A 1JFLA 3FPHA 4FMPA 4ZU3A 3OQ1A 3BORA 4BV9A 4GXTA 4HYTA 5FX2A 4ZRMA 2C7OA 1DJMA 1U2GC 5C3MA 1RXEA 2P9EA 2CLCX 1R6UA 1ZK4A 2R1ZA 2RHMA 2XPCA 3AP1A 3CY6A 3L8GA 3TTXA 4C0QC 3EPJA 2I03A 3NWJA 3VPAA 1E1CA 1VXRA 5DGDA 2Z3VA 1Y34E 5C81A 4I9FA 1V4VA 2ZJ6A 3L4BA 1BA2A 1WMAA 4OQDA 4LNAA 2OSVA 2QXYA 4REQA 4QPPA 4ML3A 4J7CA 3WO1A 2IEBA 2GSWA 1NN0A 3VR5D 2I34A 2RH4A 1EDDA 4NCAA 1DPFA 3CX3A 4H35A 4OQYA 1SXJA 2IYQA 5KQPA 1FW6A 2NZWA 4MVJE 4QWWA 2AZXA 5EKSA 3RODA 3L41A 2A94A 2JFXA 4GWLA 4MR7B 5HUHA 1N3YA 1YS2X 1M0WA 2ODPA 3QXJA 2QTAA 4GQBA 1MAUA 1TYBE 1Z4NA 2CKMA 1C4XA 3D9QX 1EP9A 3HZRA 3PR2B 1BE0A 4KPFC 4XWWA 3L1UA 1FSGA 4N5IX 3PXUA 1JSCA 3ZYCA 2RI6A 4EX7A 1I2BA 2Q1UA 3WLPA 4PBRA 2HQBA 1E89A 3WGOA 2HMVA 1ACJA 1PJTA 2C4NA 3A25A 5BN5B 4XJXA 3QKSB 5FEUA 2CVFA 2HRQA 3LRXA 1BU8A 4MV7A 2GZ3A 1GRVA 3REQB 1R0WA 3WMWA 3MQFA 1U0SY 3B1YA 2ONJA 4MPRA 3WWYA 3B5IA 3GN1A 2W37A 5B1HA 2G72A 1JR4A 3COWA 4UEOA 4QA9A 4ZODA 1UDCA 1OWMA 3CMCO 3SS7X 1S89A 3F49S 3SFZA 1M1NA 2EJTA 5JS7A 3R7FA 4UBIA 1YGYA 3DMGA 3WSWA 5BP7A 2X0EA 1L6RA 3C24A 1QJ4A 2FI1A 1VPTA 1U8UA 2KX7A 2G88A 3FNHA 4PRLA 1R0CA 1W44A 3NDIA 4UMDA 3ROEA 4BAUA 5JDIC 2I8LA 1ZSNA 3C74A 4A6EA 3M9WA 1XX6A 2FX3A 3EZ7A 5H3CA 2IY8A 2NP7A 1IZZA 3K53A 1BKSB 1Z18A 5CB4B 3PT9A 3B6MA 3R9KA 1UDBA 1PJ3A 4B1FA 1W0JD 3IVCA 1XALA 2H4JA 3LOUA 2QTRA 4GPAA 2JGDB 2OCYC 4LRSB 4Y8VA 4RTMA 2QRMA 3TRIA 1ANKA 3E9RA 2VF8A 4X20A 2VNIA 5JC8A 5DISB 2FU5C 2QDXA 4KRXA 3PLRA 4P4NA 1O6FA 3G85A 1TAQA 2B8EA 2EERA 3PGJA 4O4LA 3VKUA 4YI3A 2Q5LA 1B73A 2ZI9A 5BT9A 3FNRA 3EK2A 3HKCB 5DOZA 4QULA 3WLKX 2O5CA 1SBHA 4ZYXA 1SKUA 1MFZA 4HH3C 1G66A 1ODTC 4ZAZA 4L5IA 3N8IA 5TS2A 3ZHVA 5IJWA 2CZGA 1B1AA 3M5DA 1M1ZA 4DCNA 1IUOA 1PEKE 1TB4A 2NT3A 3IESA 5E9WA 4MNTA 2WYUA 1AC5A 1R6BX 1XTKA 5CYPA 4CL8A 2A0FA 3DZBA 2VOJA 2QD3A 2XWBF 2B8WA 4H1HA 4HDCA 1NR7A 3T9EA 4EKYA 2F8SA 3WLMA 3W06A 1HLFA 2YKGA 3VJKA 4DKJA 5A7FA 1DIGA 2Y2UA 1VSQA 3FM9A 4ZCQA 1ICEA 4DJ5X 2P68A 4Y30A 2QMUA 5EEGA 2BR4A 3HR7A 4LCBA 5M5BA 1J8YF 3FPFA 3HDQA 4MRPA 3U1TA 2YZNA 5IJ9A 4HCJA 3KEOA 1P1BA 1U9IA 3FFTA 1GY8A 2D74A 3KAJA 2ETVA 4EPTA 4EUSA 3K70B 4NBTA 4DDHA 2HNAA 4WLFA 3KYCA 1WZUA 1HE5A 1NUAA 3C5VA 3G8BA 2GEJA 3TX2A 2X8WA 3UAZA 4AIRA 1VIDA 1SVNA 4YAKA 2VPQA 2HJSA 5L4NA 3TNYA 1I0ZA 4W1QA 4P4SA 2OYCA 2Q3CA 1G5QA 2I7TA 2H2GA 4GD3Q 4DJTA 5JD6A 1CD5A 1Z56C 5CA1F 3SF8A 4Q9AA 4W9NC 2WU3A 3EC7A 2JZOA 4FEYA 2C7QA 1G3QA 2MMGA 2A1IA 1YQXA 3EVFA 2N75A 2EG5A 1FU7A 2RHLA 3MWEA 4TGLA 1MGPA 5KYYA 3WK6A 1CRPA 1V1MB 1D4FA 4DYVA 1UBOS 4MO2A 3ZLJA 1NZDA 4FINA 4G1BA 1O95C 3QV2A 5GJBA 2I4RA 4TMYA 3QEAZ 1U3UA 3IMEA 2R1VB 2OGSA 3D8TA 3DXYA 1WA5A 3I8XA 1AN0A 3JRNA 3K5WA 4U2FA 3S99A 3U4AA 1MORA 1EFAA 3KHUA 2UAGA 3IMFA 3CJQA 3K20A 3M4ZA 4I1UA 4K87A 1T9HA 3MFYA 4B6PA 4BVJA 2NSYA 2ZSFA 3JATB 4JKIA 4JXXA 1Z07A 1ZAYA 4K2AA 4LK3A 4GOXA 1SPBS 3M4JA 3G5AA 2XNJA 3NHMA 1X1AA 4GBJA 4GNRA 4PC7A 1B3BA 4LJSA 3VISA 4RMJA 1J42A 5E9AA 3C4JA 3F7TA 1QO0A 4A0SA 4D4IA 2PWPA 1BHSA 1N78A 2DE0X 3K2EA 3SJAA 3EZ9A 3T1YB 1ISRA 1DZIA 5BV2P 3E7FA 2UU9B 4UBJA 3MCZA 1Q20A 4PAGA 1W88B 2ZSKA 3FOWA 1M2HA 1UBTS 3PDHA 4NK4A 2YJ3A 4G0QA 4QOHA 2NUPB 4ACAA 2UXCB 1M2WA 1QLJA 1T4CB 4OHOA 4EZIA 3U19A 2CFRA 1J39A 1PF7E 3OU6A 4ND8B 4XFDA 1YVEI 4WCFC 3TD2A 4R9RA 1L4MA 4Q66C 6REQA 1MRSA 3BL8A 5EIWA 1CZOA 1I6LA 3ZQ6A 5HR5A 2FA9A 5IH3A 2HA5A 5AW6A 2QU7A 2B7BA 5A4FS 2BL4A 3D5TA 1V11B 3PHCA 3HJGA 4CKCB 5EKUA 4DUZB 3PLAE 5EZYB 2IBMA 4EH1A 3HV0A 1ORTA 1FJHA 2FR8A 2AFIE 2LXNA 4Q47A 3QU4A 2ONCA 2XGJA 1CNEA 1XYGA 3H9CA 1Z6GA 1ZKMA 4KMSA 1M7HA 1BVRA 3AC0A 5CVVA 3Q9NA 2HK9A 3FGZA 2IV7A 4C7KA 4AKHA 2NO1A 4NYIQ 3PR3A 4QG7A 1SQ5A 3PNQA 4I14A 3U1BA 1NXOA 2L69A 4I4CA 3NALA 1N2CB 4MA0A 1Q83A 2XAAA 3GPDG 3EODA 1WUYA 3VNUA 1JDPA 4OHUA 3E27A 1IK4A 2Z2XA 5I9SA 5HQJA 5LB4A 1TT7A 1VIAA 3V42A 1HK7A 3SBDA 1E6LA 3EF3A 3PGKA 1L5HA 1K75A 4NHOA 1JX6A 4KO2S 5B58C 1AQYA 4K9KA 1Q92A 5SYAA 4B3FX 2R8OA 4H7EA 3QYFA 1XDDA 3D8HA 4CQLA 5LP6B 2Y27A 1U31A 1BWPA 3OT1B 2V3CC 3ESYA 2VJDA 4ZAFA 2X13A 1YDMA 3C70A 4CU2A 3OF5A 1QKJA 1J4AA 3AUUA 4LRWA 3CZ9A 2RD2A 2IY7A 1LXCA 3OF3A 3O95A 5LBIA 4W7SA 3MCUA 1OBCA 3F4KA 4DA6A 4YO8A 1JWBB 4JJAA 5A7HA 1X77A 4YONB 2PXCA 4OO3A 3C0KA 3ZU6A 4DXDA 1YR7A 1KQOA 2XUJA 3HDYA 1KORA 1SUWA 2X2FA 3IEIA 4JBXA 4LBVA 2WOOA 4TRRA 2XSZA 1NG9A 4G26A 3W34A 3HP4A 3J81k 2JJ2A 4RORA 1PEDA 3CUUA 4X8MA 3QRWA 3RCBA 4ALLA 5C53B 1B41A 1VJRA 5B30A 5D3ZA 2OV6A 3CBQA 1PR9A 1PQWA 1E1CB 4URYR 3EVNA 3I6ZA 2QPOA 3U4CA 4F11A 1TEXA 5IT5A 3CURA 2ODBA 3F74A 1DINA 4HQ0A 4C29A 4R1TA 2FW1A 2QQ5A 4REQB 1QHXA 1FIUA 2Q1TA 5ANRB 1J07A 2BDUA 4QWMA 1BE8A 3LYLA 2HPAA 1FPMA 3HVUA 5GWXA 1GFWA 3PV0A 4OHCA 2IU0A 1SCKA 1I3KA 1SXJB 3WLEA 1WJGA 2J3LA 4HQ6A 1FCJA 1W5SA 2EJCA 2ZVDA 1N5DA 3UUGA 4KGDA 2JIQA 3CEMA 4M1QA 1HEIA 5CR9A 3D7MA 3F6YA 1NTOA 3H5VA 1MQ8B 4FNGA 3SC2A 4P31A 4YCJA 1PVVA 4X66B 3PXGA 5JD3A 4B0OA 1ENOA 1XD8A 2XA1A 4GR9A 4O63O 1KO7A 2C7BA 1V1JA 3BE5A 2VWQA 2XI4A 1UT6A 1EWTA 3EWNA 4D98A 3AVVA 3N2GA 3DE1X 5HF9A 2BEJA 4RKWA 1UJ2A 2FZEA 2I87A 3L4SO 2Z8YM 3PWSA 4HDNA 3IUSA 5AM4A 2C95A 4AO6A 4Y9DA 1HE3A 3O3CA 1KA9H 5I7UA 2ZRFA 1SUBA 2Q6IA 3C87A 3NT5A 3RTAA 4U2KA 2B78A 1W59A 1ZN8A 2PH7A 5EA2A 3U7IA 4DGQA 5JS8A 5JSZB 5HXAA 3KDSE 2GVZC 4TTVA 3AY3A 2ZJ0A 2GI4A 1FDSA 1ULTA 2X2PA 5IJZA 1ORWA 2Q2QA 1LW6E 4HWRA 3L8MA 4XVHA 3GRKA 3NTXA 1M1NB 2H51A 3A6EA 5EERA 3ZS8A 4EKGA 5C7LO 4P34A 1TUEA 4ZC8A 5AVTA 1WQ1R 3K9GA 3FFBA 5TQ2B 1ZH6A 1BN6A 2J0QA 2PEYA 5FD8A 1KY3A 3RVJA 4AKGA 2H92A 3DL4A 3U3MA 1SOWA 5JJLA 5KDLA 5DTRA 2FMFA 4B82A 2RAUA 3CF0A 4UFNA 2X4LA 3LP8A 1UJ5A 1PBTA 3HH8A 1D7AA 1TYZA 3KC2A 4K9OA 3V48A 4LOAA 1SVKA 3I0ZA 2D06A 1EUZA 1BJRE 1Z0ZA 2Q99A 2VA8A 3RPEA 1BEUB 4IIVA 3T5MA 4EFLA 3QF7A 4R81A 5HM6A 2FZWA 3RIMA 3L9WA 6CHYA 3BDVA 4B6EA 3HXMA 4E1BA 4B17A 3K0SA 2DQ4A 2WIAA 2BFCA 3BTSA 4IZHA 1O95D 4X20B 5JECA 2DWQA 4FIZA 2OT3B 2PXXA 3HNOA 3C16C 4RQBA 4MVJF 1F51E 1PNQA 1VJ5A 2MWMA 2QROA 4O4LB 4P1ZA 4U7HA 1H2WA 2P6OA 1VPWA 2UZ3A 3FVRA 3FSRA 5TEVA 4ATNA 2ZUCA 3QX3A 1W1UA 2B6NA 3I1YA 5DCUA 5LMCA 2YV1A 3FF1A 2J3EA 2J45A 1ECPA 3UB3A 2D5LA 2IOYA 3A3NA 4FZRA 4JLPA 2EL9A 3B9QA 4S35A 2COEA 3MYYA 1CJKC 3KSDO 1AKVA 1GKYA 2FJPA 2OAP1 4G36A 4WOCA 4FSXA 2FJ0A 1TLTA 2VN8A 2HMWA 2YXDA 4RHYA 4Y1EA 5DMHA 3SI7A 1QRUA 1UBFA 1JZTA 3A1FA 2O8EA 3OA0A 5FA8A 3RHZA 3GJYA 4QNMA 2A86A 2P79A 4KQKA 8LDHA 1QBGA 5K8TA 2NWQA 1VL8A 5CVUA 1O4WA 2IU6A 2XMCA 2ZYGA 3WB2A 2EFGA 4J2OA 3KUXA 1L1FA 3EXIB 3CF2A 1JMVA 1XMJA 2Q3HA 3F1KA 2R5NA 1XZCA 3VI4B 3CZRA 5IJ9B 3EHDA 4RIFA 2QRNA 1RTKA 2KLBA 1K3TA 1Z6TA 3KYCB 5DM1A 2DF8A 1DC4A 1QH8A 1IE3A 4MS1A 1PJRA 3OZ7A 4BZWA 1X7XA 2H1HA 4Z9XA 3E7PA 4OYLA 4P4SB 4EZEA 3UHFA 2JFFA 4HT3B 1ID1A 1GADO 1YZFA 3PA8A 4CUZA 1HX7A 4FFVA 1XTVA 2PKQO 1XCLA 3AG5A 2YYZA 4G1EB 3Q9UA 5KTOA 1UBMS 5CURA 4LSZA 4O2LA 5DCWA 5CFZA 1TJNA 1Y8CA 2FZCA 4KLRA 3MWEB 1YS7A 2D5CA 4RZHA 4LXIA 4UCQA 2O23A 1JQJC 1SG9A 3PTZA 2CXSA 3P97A 2JLUA 4M1EA 4HWPA 2WWXA 5AQEA 4LN1A 2QG9A 2PM8A 4UHEA 3WG9A 1YJAA 1CR2A 3PFHA 1BGVA 2PZLA 2RK3A 2EBUA 3KRTA 5G0VA 1JEYA 2AVDA 4LJAA 3G89A 5CNJA 2R60A 3SXJA 5EXEA 1QK3A 1OXSC 2Y1DA 3IP9A 4FYVA 4QASA 1JHYA 5J2TF 4UATA 2IV2X 4BFTA 1VSVA 3DB2A 4RLQA 1HNXB 4ESEA 2AG5A 4UUPA 1JDJA 3CH4B 3HFJA 3WYFA 4E2YA 5EGSA 1X94A 1ESMA 4JYMA 4HNTA 2XCTB 1I1HA 1QGDA 5AUQA 4OHRA 2ZRKA 3LDAA 3VA7A 2XHZA 4ETWA 4TOIA 2QD1A 2XE4A 3L8DA 5CM9C 5JROA 2HFKA 4OUDA 3ETLA 2JAPA 4LRUA 4TRMA 3EIWA 4ENWA 2J46A 2H59A 2QM3A 5FH9A 4DV7B 1X1CA 2YNMA 5GM1A 4K9PA 5LR6A 4Y0AA 4R98A 1B1CA 1P1KA 1UEJA 4KQEA 3WV5A 4FCWA 3MBOA 6REQB 3I0NA 2R7NA 2CUKA 2ZBQA 4PTLA 5DM0A 3U40A 3OZBA 4L08A 1EFRA 2CVPA 4G4GA 2O54A 4ETNA 4TN1A 5F77A 1TYAE 2HAEA 4BVFA 2NG1A 3INRA 4NAVA 4KAJA 4PU0A 1C9KA 2Y1KA 4U7FA 4D9FA 2HW8A 1EFHA 1L9XA 4PLFA 3EFOA 2A57A 4MCAA 4IAOA 4UXJA 3UTCA 3PUVA 3R77A 1G7TA 4JB3A 1IJEA 5J4LA 3UYKA 4GBED 3AO0B 5G41A 3T06B 2ZWMA 5IW8A 2PKXA 3IAS6 3EXG2 1L4LA 3I8OA 4K1XA 2IP2A 1E3IA 1QG6A 2ZTMA 1IB6A 1GU0A 3ORRA 4FWBA 3HGTA 4NBRA 2CWWA 4RVSA 4U7JA 2GEVA 3DKIA 4OGFA 2Q2NA 3R5FA 4MMZB 1L5HB 1M6VA 1MBZA 4Q1CA 3FE2A 1TKBA 5HE8A 1FF9A 4G37A 3ZLTA 3BK1A 3ZCQA 2OCPA 4IJMA 3VYSB 3OP4A 5DW0A 3PCXA 3PDWA 5U1PA 1NP7A 1Q1BA 2QMHA 4GH5A 3F1LA 5FNVF 1XB2A 3MLBA 3EVAA 3LXMA 3SSNA 3W6ZA 3FPAA 1GNSA 2FW9A 2IELA 1A9RA 5C1OA 3V4LA 4I2VA 3VPFA 2GAAA 3BILA 3EGXB 1XEAA 4QO8A 2I6QA 3ZHRA 3HM2A 4C76A 2DKFA 4EHDA 4YRBA 2HCTA 1I80A 2GHQA 5I7EA 3UG7A 3C3YA 5EIEA 1A98A 1N6NA 3LIIA 1RXYA 1AOXA 4ND1A 1HORA 4W5OA 1D9ZA 1RPZA 1QHSA 4DUYB 5J9FA 1HFWA 2QE6A 5KAMA 1R8SA 1YACA 3B8HA 5E4YA 4KU4A 1FBTA 5JATA 3MTBA 3GCGA 1M6HA 2J59A 1IB0A 1G6OA 4P3KA 3QXCA 3BA6A 5CVEA 4AJ4A 4QPJC 4TL8A 1N9ZA 2PD4A 1PVDA 4LDQA 3WR5A 4TYYA 2HHCA 2IX3A 3I61A 4QOJA 1KIFA 3M7IA 5JZOA 2Z95A 3BXGA 4KYIB 5G53C 1KRHA 1GKIA 1NR5A 4YJ3F 4J1TC 3TI9A 4BQQA 1KSGA 2WM9B 3C39A 1XDGA 1E1YA 1RJDA 1ZWKA 4TL9A 3IVXA 1ZI6A 5DNCA 2FW6A 2HSWA 4ZVRA 5GZ6A 2J1LA 3I5XA 1DAKA 2CDRA 2X0KA 4O2AF 2D0OB 1V5FA 4D74A 2DT8A 4ZCMA 2WJ3A 1NAIA 2PRSA 1UBJS 3D6FA 1KFJB 3ON5A 2C5FA 2BFPA 3F4LA 1OGIA 3L5OA 1M66A 2EU8A 3LTEA 5LB2A 1RQRA 3LBYA 5SYNA 3TZCA 4EG8A 2CNKA 3RS0A 4EB3A 2PUCA 3T5CA 1NQWA 1P2DA 3SC4A 1RYMA 3K2QA 5CFOA 5DGTA 3TQSA 5EJFA 1RC0A 2ID8A 2HBQA 3N2GB 4MUFA 2RGBA 2D2FA 1KI2A 4KL8S 2CYBA 2WMYA 3WYNA 4G5YA 1N2CE 3N86A 4LTNA 2IF0A 2FTKE 2ZB7A 2HRDA 3K15A 2VYCA 4Q7JB 3A1WA 1HZZC 2CYCA 1Y7HA 4R9UC 4LZAA 1HR0B 3DJFA 3NHRA 1LK5A 3QJGA 1RS0A 1ODCA 2QVCA 4R40A 1DJOA 1Z2AA 3HYSA 4UAVA 2H7XA 1QIFA 3ZZ0A 2Z6VA 3KZCA 2PMCA 3PVZA 5EMLA 4CFSA 3OJXA 3AKDA 4GVPA 1GTJ1 5D86A 3LDFA 3B2NA 4DSUA 1QO9A 4PO9A 3D2CA 3V2UA 3D4OA 3EBPA 2JHGA 3VU3A 4MI1A 1B0UA 4DS3A 1RHUA 3I9NA 5B2ZA 2ZU6A 1F8GA 2BFAA 4OJQA 4Q3BA 5JV5A 3TB4A 2XOXA 3TOCA 3E3MA 5IDXA 3DL7A 3GT3A 4EG5A 2B4YA 5KSYA 3A6ZA 3VJRA 5B1YA 1WDTA 4NCBA 3BIOA 1TKAA 3L77A 5ULLA 3LPNA 2ZIUB 1XBTA 4YNBA 1V35A 3L40A 3IL2A 3BBPA 2GN2A 4DCSA 2BFCB 3B3GA 4EY8A 3AVOA 2O2XA 3SOPA 3VH2A 1R5JA 3F9RA 3G2KA 3C3DA 4H17A 4LWQA 2DLNA 4AYTA 2WIFA 1KTIA 3MJVA 3DFIA 3OQHA 4XA8A 1TJ3A 2IOFA 1MAAA 2DOKA 4MA4A 3VPXA 5A04A 2WQZA 2MSEB 1G59A 2ZIXA 3DVAA 1QYIA 1WIWA 5EHQA 4V3CA 4URFA 5MGBA 3EY4A 1M2NA 3PFWO 1Q44A 1NKSA 1QAQA 4X1KA 3DOFA 4IWNA 4F5DA 3D6MA 2I2CA 4UAUA 4LZWA 1FMJA 1T8RA 2ZUVA 4ZVLA 5LC1A 2K4MA 1DEAA 1E3WA 2J85A 3EE6A 1ND5A 4YUYA 2BMWA 3ZH2A 1WSBA 1ZEJA 1SXJE 1DAIA 4CKWA 1R5NA 5CU7A 3B38A 3JVDA 4NZOA 3FPGA 2X1HA 1YRQA 4U2CA 4CVNA 2O8EB 1OPRA 2HCRA 3FWYA 4IM7A 2FWPA 1TIPA 3ROGA 4B83A 3V1KA 1KH2A 4RJLA 4LZZA 5JPDA 2H9IA 5I48A 2XH8A 4F0JA 2CJFA 3M3HA 2VNJA 2WHEA 1N5IA 3P2MA 4NLLA 3P9QA 4JP5A 2ZE6A 4QVGA 3EAFA 3CZCA 3UWPA 2YIMA 4QYSA 1CS0A 1GTG1 1OFIA 4RABA 2YOFA 4XTRA 5EXDA 3RSLA 1T3TA 1ML4A 4P53A 4WY8A 3X1ZA 5A5DA 2O19A 1X8LA 4FXPA 1GFZA 1NM5C 3ANNA 4FNOA 5CNIA 3PYMA 3TOXA 3D6VA 5KSOA 5DBEX 3SVZA 4HJRA 1DPGA 2J5QA 4M9XA 1DQZA 1GL7A 3R74A 1QH8B 1BS2A 1XI2A 2C78A 4MS1B 4UU0A 3RQSA 1ENPA 1TLFA 2YFHA 4Q34A 4DEVA 3S5JA 1X7XB 2AFRA 4Y6QA 3RJZA 3IOBA 3MYRA 3AEUA 4GPD1 5HBGA 3MGKA 4FNMA 5EP2A 2NUTA 3QLVC 4HN4B 4C88A 5HYVA 1Z5PA 2OM2A 1TYEB 3TCKA 2OLEA 1XKQA 3DNMA 4B2IA 4OYRA 1MFPA 1U1GA 4ZI5A 1H9BA 2XZDA 3UWDA 1LJUA 4RTPA 2NVBA 2CUTA 1NFFA 5JO9A 2FPLA 4IS3A 4JNKA 3R23A 1VE9A 2AYZA 1AT1A 4FHFA 3N0RA 4N0PA 1M5RA 4DLZA 3EVBA 2R6JA 4GEGA 3OJFA 4WLUA 4LNHA 2ZYHA 5AJTA 1JEYB 4AJ1A 2UZIR 4QHSA 2WJAA 4L85A 3TDKA 1F2UA 1FP1D 1FZQA 2ZIFA 1VG1A 4BNHA 3RVNA 3LT5A 5DEOA 5H9WA 3THOA 4EG4A 1Y9AA 3OBBA 3L82B 2X3FA 3ZV3A 5BWLA 4BFCA 1P0CA 1KOGA 1WL8A 2GQ0A 1NU8A 1XHEA 2F9MA 3E3LA 2BTQA 3G79A 3OCUA 4L4ZA 1IQRA 4BC1A 3EFHA 2MU1A 4J4BA 4WJZA 4LAFA 2PR7A 4RJIA 2RHOA 3Q88A 4E31A 4L16A 3HB4X 1M2GA 2IYVA 2HY7A 3MTEA 1WABA 3R3WA 4W1RA 3WQQA 1P61B 1XTSA 4QBTA 1HM5A 7GPBA 4D9BA 2BR5A 3OFSA 4OUDB 4PRKA 1YI8A 1L4UA 3JYHA 3UJCA 4DMLA 3DOIA 5D3MB 1NFRA 1OBHA 1OX6A 1SG0A 1ESZA 2V54A 4JI4B 2MYUA 2I29A 3T3OA 1ZKDA 4KH0A 4NBVA 3KOYA 1KFEB 1V8OA 1E3SA 1JILA 2J7PD 5B57C 4LKOA 4ZVVA 1QKKA 2RHRA 1BRTA 3BZWA 4AQ7A 3VNQA 5CEFA 2C77A 2F9FA 2EKQA 2VHQA 3G9QA 5THXA 4RCVA 1Z2DA 3ZUGA 5KX5A 3KQYA 4KXUA 2WINI 5TR9A 3RAGA 4GZ3A 3GPBA 4P08A 2XADA 4WASA 1G9SA 3IYLW 4D9CA 3OY2A 4G1CA 4IGKA 2C0QA 1FUKA 1P0QA 1Z06A 2FFHA 2W6PA 2HH9A 3BCHA 3HY6A 4IDCA 4MI9A 1OA0A 5CXSA 4N40A 5C1DA 1GA1A 2IHKA 2A0XA 3KKEA 4O4JA 1HBJA 3G7UA 4LSWA 4IINA 4GLLA 1SKMA 2OB1A 3EMDA 3PUJA 3ZLVA 2J9ZB 1DAEA 1WZCA 5L7WA 3K1JA 2FUG6 1BO6A 3DM9B 1YHYA 2D7CA 3SX2A 3H1PA 1M6VB 5F2OA 4BKQA 3DS8A 4YTEA 1JG3A 1ABFA 3ZEAA 4KYUA 4R1UA 5I9TA 5I3ZA 2ZI5A 3KQPA 4L2IA 4YMVA 4IFTA 1DXQA 2ODWA 2IYEA 2WF5A 3DPUA 3C8ZA 4NATA 1RCTE 4CL0A 3F73A 4NENA 4PHTA 2KBFA 5FBHA 5CDSA 1LBTA 5EQDA 1W4AA 6ADHA 1Z22A 1MO4A 4Q6BA 3F47A 3TSWA 5JEDA 1EJ2A 1SBNE 2YW2A 2FRDA 2XKAA 3QW4B 3M9LA 4ZAWA 5F52A 4BP3A 3ZCUA 5C4MA 5JFTA 1KHTA 1JJ7A 5TPZD 5JSUA 3L2OB 3GJXC 3IR6A 3T1VA 3U0VA 4JLVA 4R1MA 1E62A 5AJHA 1A8IA 4FU0A 3GW8A 1HQDA 1NSYA 5LCXA 2EQ5A 4CQJA 2I71A 1H1TA 5IFLA 2L82A 4GR5A 3RIGA 4XLTA 3SF0A 4AKSA 4WK2B 2P0AA 5AFSA 1KQGA 4DVJA 1EWQA 2BKAA 3EARA 2Q21A 2HB6A 2Y0EA 3L1HA 1SBZA 2VSOA 3VC7A 3AKZA 1G2PA 2WV9A 4HLCA 1D2NA 3KQHA 5EUQB 3TZBA 3A0UA 1KYZA 1PHPA 4CWAA 3WHKA 4F60A 5HQTA 1XV5A 5DE3A 4JB2A 4XFJA 3PHIA 4YHHB 1QHHA 1Q0ZA 1WUKS 2ASEA 1LNSA 3FFWA 2NO5A 4L7VA 3TLMA 4GO1A 2GNOA 1ILWA 3G7NA 4W5NA 4FYIA 3NTVA 2R8ZA 1JG4A 1Z4IA 3HXQA 2FZLA 1HLPA 2A3NA 1YZVA 3DH0A 1VMAA 5IM4A 3MELA 3WLAA 1UEIA 2HD4A 3OZSA 4GPEA 3PPYA 3VO1A 5DCYA 2VQEB 4JZYA 2OPBA 4U8GA 1F48A 4ALMA 5K3BA 1WQ3A 2C2WA 1VJDA 4FN4A 3LYHA 3H2HA 4I1IA 5K8VA 4ZYZA 4CCYA 4INJA 1IBMB 2PUBA 1ZHFA 2J0UA 2ZSAA 2QW1A 1HE1C 2JIZA 2PSJA 3FX2A 1SXPA 4BQNA 5AW4A 4HYQA 3UJDA 3G0IA 3N2YA 1BC5A 1EXMA 1ADYA 3DMTA 4HNAB 1CIVA 4Z5XA 4JQSA 2CNOA 1KVSA 3O4HA 1TU3A 1WTCA 1SC1A 5HQ3A 2H9AA 9ATCA 2X2EA 1QXSA 2VKTA 1VCNA 1MXHA 3HDGA 3JU3A 4DDVA 2X6QA 3QJYA 4OGWA 4X6YA 4F4CA 4OOFA 3T3NA 4MYRA 3SYKA 1LW7A 5FQNA 3O73A 4TMTA 4BB6A 2OXRA 4RZ2A 5SZIA 1L5NA 3P32A 4H4CA 4EMTA 1V7PC 3BERA 2FMTA 1E6KA 4DGSA 4QHTA 3O1JC 4Q1AA 2RGRA 3OG9A 2Q1YA 1E1QD 1S6YA 1KERA 1VTKA 3PNYA 5JCJD 4DA4A 1AV6A 3RFXA 5LUAA 5JQGB 4HV4A 3WK9A 5CM8B 3V2GA 3VPHA 3DBVO 1PR0A 2WTEA 2XX3A 5I9NA 1A9TA 1PV1A 2A5DA 1J56A 2EX4A 4QUAA 4UFOA 1NF2A 2DC1A 2JLZA 2OO5A 2OFWA 2NZUG 2A5LA 1LDNA 2GK4A 4FGWA 4PIMA 3HU2A 3FOCA 2HIGA 4M8KA 1Z74A 3RFTA 2WSYB 4JLWA 4WKNA 1C9DB 3TZLA 4DOMA 2BHTA 2OPHA 4WDQA 1ZL0A 2JVIA 3EJWA 5CA0F 4O1IA 4Q93A 2PEZA 3JQ9A 4IH1A 2BFEA 4J0CA 4D5GA 5K7SA 3GPIA 4NI5A 4CRWB 4KCGA 3BXHA 2ZIXB 3BQMB 4V1CA 4NJEA 1TVEA 2EWMA 2VYND 3CSDA 3H3XA 3KLNA 2GRUA 4BX0A 4DSNA 5EJGA 2BBOA 3QKUA 4YBZA 5FUWA 3CIOA 4X1KB 4FFLA 1Z0SA 2GD6A 1Y1LA 2ZM6B 4D3DA 3TQFA 2GASA 3FCYA 3DEJA 2H85A 5EJEA 2PQ6A 1E3WB 1HNNA 2NXNA 3BUSA 4O4IA 4M0KA 4CKWB 4BNMA 1DC7A 3OIDA 4B3JA 2G8LA 4D4KA 1J97A 4ND7A 5BN3A 3VO8A 4JNCA 3T7IA 2LKCA 1AMNA 1CY2A 3UJPA 3LY7A 4J3FA 3V6LA 3JQPA 4A91A 3FPCA 3TYXA 1FRZA 2C7VA 1YZLA 1CY4A 3UHAA 4NOLA 4TWZA 1P45A 2OP0A 3L0SA 4JJZA 1CS0B 3L6OO 4IJ5A 4KN9S 3RBAA 5LP6F 1RQPA 1E2MA 1P4HA 3ECAA 2MR5A 1ODJA 3K7EA 3Q10A 2QLLA 1Q12A 4FZ3A 4L4SA 4MUKA 4KREA 1T2AA 1Q22A 1EVKA 1U8EA 3P9SA 4CGYA 3RAFC 4WXYB 2DRIA 3W1WA 3AQ4A 3K05A 4NDAA 1XWIA 2FPRA 3THSA 4O2BA 4BWVA 2F8MA 3P5BA 5D7NA 4Z4HA 2C59A 2CXNA 3R3HA 4FDAA 1VMEA 2H5LA 2FEMA 3G2HA 4KXQA 3AEUB 1KY2A 5DU2A 4A3SA 3FHOA 1ZYUA 2GBLA 2IYXA 2ID7A 2NUTB 2ONKA 4EGCB 2JH9A 3VR2D 2OG2A 1IM8A 2WU0A 4OK6A 2Q1WA 5B53A 1BVYF 2IDJA 3FTCA 4JLNA 4L27A 2XWQA 4UHFA 1YZGA 2GHIA 5FOUA 1U2EA 3AR6A 3VU9A 3KZMA 1US8A 1JTFA 4B31A 3EUFA 3IA2A 3BN3A 4BLRA 4LZNA 4UVGA 2W2XA 3UZUA 4JSTA 5LSAA 4MS3A 3HJBA 5KHAA 4XGRA 4YQFA 3N8DA 2GBPA 4YP1A 3QI2A 2JFVA 3NMUF 3BGOS 2YVQA 5CX4A 1TL7C 2NO0A 4BCDA 2JD2A 1HFEL 1KP2A 4NV3A 5AKYA 4PIPA 2EF1A 2WNSA 3D43A 4MKRA 3EF0A 4HXYA 1FFEA 1AS3A 1SG6A 3WICA 2NV6A 2NXEA 3OLQA 4Y6LA 1YHNA 4B84A 1GAWA 1HETA 3LUPA 4C0HA 2WIKA 5KHOC 2YVAA 4KXLA 1OB2A 1RJEA 1UWVA 2HJGA 1EEXB 1XQWA 4NBKA 4FR2A 4RHEA 3WZLA 2ZUFA 3PS9A 1Q57A 4YP7A 1D2AA 2X14A 3EXHC 1EA7A 1WG8A 2HPHA 2YOHA 4B3GA 1K7XB 4RPKA 1ULBA 4CR7A 3LX6A 1BX0A 2J30A 1IPEA 2Q6LA 1JDBB 1T6XA 3EAGA 4N47A 4BO4A 5IPFA 3E84A 4L74A 4N49A 2QZZA 1EXDA 1UAYA 1A27A 2XYPA 3KZNA 3CNOA 4KVAA 5CHEA 4IXTA 1SD2A 4YJKA 2NU6A 2QJRA 4CJXA 4JELA 3OA2A 1PD1A 4KR0A 5BOSA 3R7BA 2CK3A 3EASA 1L7BA 2QYSA 3T5BA 5C18A 3MD0A 3WGTA 5J4VA 2A59A 2QD2A 3LT2A 3QBVA 4EECA 3E6AA 1JKFA 2OC4A 4HX2A 4RFSB 3DONA 5DWDA 3SHVA 1OJ7A 4CM9A 2HRCA 2ZIZA 2YIVX 2C2MA 5IVPA 3F2IA 5KX5B 2GCPA 4FMBB 4NEGA 1YCFA 2C4KA 4Q6WA 1I2DA 1HQCA 2QE7A 2HU7A 1R6DA 4UM5A 1FRFS 1NLMA 1SUPA 3K94A 4Z2YA 3TMYA 1CDDA 2W6CX 3TEJA 4WCFA 1TAGA 3MB5A 4H3VA 1KXZA 1SKYB 2BONA 1QOZA 3AK4A 4ZVTA 5AK3A 3V5N