1M33A

Crystal structure of bioh at 1.7 a
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
256
structure length
255
Chain Sequence
NIWWQTKGQGNVHLVLLHGWGLNAEVWRCIDEELSSHFTLHLVDLPGFGRSRGFGALSLADMAEAVLQQAPDKAIWLGWSLGGLVASQIALTHPERVRALVTVASSPCFSARDEWPGIKPDVLAGFQQQLSDDQQRTVERFLALQTMGTETARQDARALKKTVLALPMPEVDVLNGGLEILKTVDLRQPLQNVSMPFLRLYGYLDGLVPRKVVPLDKLWPHSESYIFAKAAHAPFISHPAEFCHLLVALKQRVGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Integrating structure, bioinformatics, and enzymology to discover function: BioH, a new carboxylesterase from Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Structural genomics, unknown function
molecule keywords BioH protein
total genus 85
structure length 255
sequence length 256
ec nomenclature ec 3.1.1.85: Pimeloyl-[acyl-carrier protein] methyl ester esterase.
pdb deposition date 2002-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1m33A00
1XRRA 1AMNA 5JARA 2GBIA 4KJXA 3PFCA 4OYYA 2LIPA 2YASA 4X90A 4C88A 1N8SA 4OU4A 5AKHA 3I1IA 1XRQA 4HAIA 3SWWA 1CLEA 2RAUA 4G9GA 3EF3A 2XUPA 5YASA 1HPLA 3CXUA 4BRZA 1CUWA 1E89A 5CT5A 4ARAA 5K3DA 3SC2A 4S0XA 4C4XA 1SOMA 4W9RA 3NOXA 2YH2A 1CUGA 5JZ9A 4IQ4A 3WWPA 3DYIA 1CUSA 2DHCA 1LLFA 3R3ZA 2AJLI 1YA8A 1EH5A 3PE6A 1H22A 3LCRA 1HBJA 3KDAA 4OYLA 4L0CA 1DTEA 1PJAA 1XLWA 4AN0A 1CUEA 3E3AA 2X8BA 3R3VA 4P08A 1DWPA 4OB7A 4DLNA 2O7RA 2RGUA 1A8SA 4X94A 5ALIA 1XZGA 5CMLA 3QM1A 3WA7A 1J07A 2XMSA 2OAEA 4CG2A 3KSRA 1FFDA 4LKOA 4FBLA 4W1SA 2XUAA 1ISPA 5BWBA 4C6HA 2ZYSA 4GECA 2QUAA 2C0PA 5KREA 4U2EA 1QIEA 4X85A 4DSAA 1LZKA 1VJ5A 2PPLA 1QZ3A 1XRLA 4AB1A 4BVLA 1DQYA 3B12A 1CUJA 3I1YA 2JIDA 3WA6A 3UUFA 1UKCA 1TAHA 5CT4A 1P0MA 5LKAA 5AK6A 1BCSA 5JADA 4CFSA 5HKBA 2P8SA 1XZHA 4U2CA 4IH1A 3WL6A 3DDUA 5EI5A 3WWCA 2VT6A 5A7FA 1VZ3A 5D7BA 5K3FA 1WB5A 3FCYA 4BAGA 3IDAA 4KRYA 1UOPA 2PVSA 5E4YA 1UXOA 3I28A 4MYDA 1JT2A 3PDCA 4UHBA 4Y2PA 3DKRA 1ZOIA 4MWSA 5IVDA 1IUNA 1EDBA 4EBBA 4I4CA 2WIGA 3WK5A 3UMJA 1WB4A 2DQZA 3HC7A 4DNFA 5LZ7A 4FLFA 1ZI6A 4X92A 3R40A 5AM4A 1CUFA 3WLAA 1VE7A 4LHEA 4EY8A 2CUTA 3WK7A 2JEZA 5DWDA 4RGYA 2JF0A 3QMWA 3AILA 2QKYA 4Y9SA 4G9EA 2PSJA 3CN9A 3G9ZA 1RYYA 3B3QA 3G8YA 1A8UA 1ZIYA 4AZ0A 1UFOA 4IH9A 5A62A 2J3QA 1P0IA 3UUEA 3G9XA 2VJAA 1ORWA 1QOZA 1YR2A 1W52X 1YB7A 3K9BA 4C4ZA 5HFAA 1Y37A 4BRSA 2VA9A 2HU7A 5AJHA 5IKXA 3G0BA 4KAJA 1VZ2A 3EQ9A 1IZ8A 1USWA 2IITA 1BN7A 4J0JA 4QDUA 4BP9A 4AZ3A 3R3XA 5AI4A 4FHZA 2H1IA 1EB9A 5CXUA 7YASA 4PF1A 2ROQA 4OCZA 5EGNA 3X3HA 5AI5A 4IHAA 1TCBA 4UBOA 3RKSA 5DLPA 1MAHA 1CUDA 4B7ZA 1H2ZA 4H7IA 4LYDA 3DEAA 2YYSA 4Q34A 5LLSA 3KD2A 1GKKA 3BE8A 1CEXA 3TJMA 2DQYA 2RONA 4WDRA 4IO0A 2DCMA 2ACKA 3OC0A 3I6MA 1XZFA 3WI7A 3C8DA 1CUXA 2Z3WA 2CB9A 4KE7A 2VQ6A 3C6ZA 5D3KA 4OB8A 3QYJA 4L72A 2WG2A 4B80A 4EY7A 4GW3A 4X3CA 2VATA 2QM0A 3KXPA 4ETWA 1BS9A 3JW8A 4KEAA 4EA6A 4AMYA 2XMCA 5T4EA 1SCQA 4AXBA 1F0NA 1EB8A 5I7UA 1LNSA 5HKAA 4WY8A 4G5XA 2FX5A 1PFQA 1ZI8A 4XX1A 4BC1A 1N5MA 5ALUA 2WFLA 1FJ2A 5BWCA 1LPMA 4PNZA 1EK2A 2OLEA 4DSZA 1H2XA 2YXPX 3IA2A 1EA5A 1JJIA 4ZI5A 3WWEA 1MNQA 4IH4A 5HF5A 4B9AA 1XRMA 3IVMA 3DOHA 4W1PA 3D0KA 4OB6A 3FAKA 2WQZA 4GBGA 3IUMA 3T4UA 2HRQA 2JGMA 2RIPA 3QZUA 3DKKA 3K2IA 2VJDA 1R50A 5DYYA 2EEPA 5AHXA 2WTNA 1ZGCA 5AKIA 1O6FA 5HF8A 3MUNA 2WG1A 4LXHA 5AP9A 5DNUA 3AIOA 1GXSA 1JU4A 1QE3A 3VXKA 1XRNA 3TGLA 3T52A 3VVMA 1GGVA 1OXMA 1KU0A 3ANSA 4FLEA 4MEAA 5E4JA 3M83A 4EY5A 2PUJA 4QDXA 4M0MA 1XZBA 3MUOA 4UFOA 2QUBA 4X95A 2ES4A 4L9AA 1VXRA 4DMHA 4ZGBA 2VAVA 5AKZA 2ECFA 1W76A 1DQZA 3D3NA 1QIMA 2HU8A 4XWGA 3IBTA 4Y7DA 3ZLUA 3E1GA 2ONCA 3LLCA 2QZPA 1THGA 3FNBA 3MGAA 2I03A 3FSGA 5C8VA 5FXMA 2WIJA 4FFVA 4EY4A 2PSHA 2G63A 4FMPA 4H7EA 5JZSA 1BE0A 3DJYA 1TK3A 1ORVA 4HZGA 3FWHA 4BAZA 1CUCA 1EI9A 4BVJA 4DMKA 4EHBA 3DNMA 1Z68A 4G4JA 1L7RA 1W6RA 4DM7A 3H2GA 2GZRA 4UBNA 2I3ZA 3QMVA 3L1IA 2BAGA 1EHYA 4I3FA 5LP1A 3IUNA 3NGMA 5JD6A 4Q1VA 2PBLA 3OURA 1B41A 1CR6A 2D0DA 2CJPA 2QJWA 1XQYA 3FVRA 1EXWA 3HABA 5AKKA 5J3JA 3CCBA 5AICA 3R3YA 1DX6A 2QOEA 3BJMA 1F8UA 3WJ1A 3BIWA 3AZOA 3I2HA 2ACEA 5ALZA 4EB0A 2JGEA 3H04A 4LXGA 2ZVDA 4BVKA 3KWFA 1EK1A 4JH0A 3FSGD 1KU6A 4ARBA 5ALPA 2RI6A 1UK7A 2WFLB 2WTMA 3IB3A 3WQHA 3H0CA 1Y7HA 4BDSA 3ZWQA 4YX9A 1NX9A 1XZEA 3WJ2A 2DSNA 1VA5A 2PSFA 3HACA 3WIOA 2CKMA 2EDCA 5ALGA 4H0CA 1SFRA 3BF7A 2H9YA 5CH3A 3LS2A 4QWMA 3I2JA 3ICVA 4BATA 2GZSA 1HKHA 3A6ZA 5ALVA 4K6GA 1XZIA 4BTLA 3HYSA 3OPMA 4ZWNA 4G8CA 4INZA 2J3DA 2R11A 3F8SA 5AKEA 2QT9A 4KYVA 3KOOA 5AO9A 1QTIA 1QONA 4QDZA 2J4CA 3GUUA 4N8EA 4BTVA 2HA0A 3W05A 3HRHA 4UBMA 2BGRA 3WWOA 3H18A 3B5EA 1AC5A 4H18A 4OUKX 3SK0A 4B6GA 3WK6A 1JJBA 2C7BA 4ZXFA 2Z5GA 2V97A 4DMFA 3WYNA 4HRXA 3WZMA 2XQJA 5DJ5A 1CRLA 3LP5A 3CCCA 4M0FA 4Q3LA 2V98A 3DLTA 1BROA 4EY6A 5EIAA 4QZVA 2WU3A 4W1RA 1QO9A 1LGYA 3ESCA 1C7JA 4CI9A 4J0GA 5AI6A 4QEKA 1M33A 1QFMA 4UHDA 1IZ7A 4MQMA 5ALSA 2W6CX 2RHTA 5DTIA 2WFZA 3RARA 3DD5A 2DHDA 2XQIA 2C4HA 4UBLA 2OCGA 4HS9A 4XVCA 2XMBA 5SYMA 1U2EA 3BWXA 5ALKA 1MX9A 4BC0A 4G4IA 1QIIA 4M0EA 3ZLTA 4PW0A 4C01A 4QDTA 4XJVA 3DL4A 2OGZA 4WFJA 5AK4A 5AM1A 2Y6UA 1ZD2P 2CBGA 5AKYA 4B84A 5DYTA 1DWQA 2E3JA 5JASA 3G7NA 4KAFA 3GELA 1AUOA 3D59A 2EDAA 3O9VA 1E8DA 4MYSA 1LPAB 1L7QA 2WILA 3F98A 1GPLA 3EQ7A 5DNWA 1XROA 3G9TA 1QIFA 2OCLA 2HL6A 1XFDA 2PU7A 1FFEA 2QR5A 4UBIA 2OPHA 4O08A 1EVQA 4NS4A 2QTBA 4OPMA 4B82A 5CURA 4ZV7A 1LPSA 3HXKA 2JGJA 1MNAA 4Y2SA 2AJCA 4X97A 1CUIA 4QA9A 1E3QA 3P2MA 3WKBA 1QFSA 1LPOA 1S8OA 1XLUA 2BFNA 2G4LA 3D2BA 4FNMA 1T2NA 2XUHA 4ZRDA 6YASA 4E15A 1CUZA 4CCWA 4HTAA 5A7HA 4F5ZA 5ALQA 4KE6A 3O9MA 5A2GA 3QH4A 2HRRA 4FNGA 5DTJA 3IIIA 2V96A 2WHPB 2JGKA 1CUAA 3R3UA 3EBLA 2J4FA 4H35A 5EIEA 1K4YA 3GROA 3PUHA 2XUIA 3C6XA 2Y6VA 4GDMA 1ZJ4A 4BYMA 1CUYA 3C6BA 5EHXA 4F60A 4C4YA 3WWDA 4PSDA 3I6YA 3S2ZA 1YS2X 4F21A 3ILSA 4UHHA 4DNOA 2OG1A 2VJBA 3L1JA 3NUZA 3H19A 5AKJA 2B9VA 3QVMA 4J0IA 2I78A 2HU5A 2NW6A 5IVKA 1WHSA 2Y2UA 3GZJA 1BEZA 2PSDA 5DYWA 5AOCA 3H2HA 4FLMA 1DX4A 3VISA 3F97A 1PV1A 5K5EA 2JEYA 2XDWA 3BJRA 2PL5A 3A2MA 3AZPA 3PFBA 1YS1X 3W06A 3DQZA 2D5LA 3ZLVA 4UHEA 1ZD4A 3H1AA 3I2FA 5KWJA 5ALXA 4H7FA 3QPAA 4OSEA 1EINA 4WDQA 1SCIA 2QMQA 4JUIA 3M3DA 2WIKA 4P9NA 3FOBA 1RWQA 4E46A 1U8EA 3STWA 2VT7A 1XZKA 3W9BA 2BUAA 4X6YA 1ZJ5A 3C5WP 3FYUB 4EUSA 4N8DA 5FV4A 1JI3A 3WKDA 4UFPA 2FUKA 3WL7A 3M81A 2HM7A 2XUKA 4ROTA 1W1IA 3G0IA 1FFAA 3I2IA 4AQDA 3I2KA 4J03A 3YASA 4WJLA 1AQLA 1E8NA 2G5PA 4GEGA 4J0DA 2C0QA 5FOQA 5EIHA 3AUKA 4CCYB 4UBKA 5AM2A 4YPVA 1JMYA 2AJ8A 4X93A 4FKBA 3E0XA 4YASA 2PUHA 2XQFA 1EVEA 1G4HA 2Z3ZA 3C8HA 3WK9A 3BXPA 3FLAA 4B85A 1LZLA 4U2GA 5AIAA 1P0QA 4BZZA 2QXTA 1VLQA 2VEOA 3O4JA 5AKXA 2JGFA 4Y2JA 4B83A 1MX1A 3BF8A 2HHAA 1ODCA 1MJ5A 3H17A 5ALLA 1FFBA 4Y2XA 2ZYIA 3V1MA 4NMWA 1UKAA 4MWTA 5K3EA 3V1NA 4GXNA 3PICA 2DFPA 3WIBA 3N2ZB 4K5QA 4FFWA 5K3FB 5ISMA 2Y2VA 2QXUA 2UZ0A 3VJMA 5ALHA 2Z8XA 1CVLA 2BKLA 1GQRA 4CIBA 3DYVA 3FCXA 5FLKA 3C45A 2QS9A 4QLOA 1BCRA 1VOTA 1DT5A 1C4XA 2WJ3A 1J1IA 2BUBA 5AI0A 4ITVA 3H2JA 1ACJA 2WHPA 4BAUA 2XUFA 1F0PA 1XZJA 5LKRA 3TRDA 2WUDA 5FRDA 1CIJA 1UT6A 1CUVA 5AK5A 3GBSA 1E8MA 1X2EA 3QPCA 4MJ3A 5AM0A 2Q0XA 1MT3A 4H7JA 4AN1A 1IUPA 1K6EA 1XZAA 3O4HA 4UBJA 2HADA 3G0DA 3L1HA 2OQIA 4X91A 3PF8A 2IIVA 4HRYA 3KWJA 2WM2A 1LPNA 1F6WA 3PF9A 1MU0A 1QLWA 2B20A 4U2BA 3JWEA 3AZQA 4RNCA 3FLBA 2V9ZA 1XKTA 5C81A 5ALMA 4B9EA 1UKBA 4I19A 1DT3A 2ZYHA 3FLEA 4B0OA 3Q8WA 3ED1A 2Y1KA 5ALFA 3DCNA 4DNPA 4KE9A 5E2IA 4W1QA 3BL8A 4U2DA 5HFNA 2G5TA 1H23A 1R3DA 2IX9A 1WOMA 2AXEA 5CT6A 4FTWA 4G8DA 3QITA 3HLKA 2HFJA 3RM3A 4HVTA 1UK9A 5JD4A 1EDEA 2HIHA 1G5FA 5KWIA 1K5PA 2RHWA 1VKHA 5IH7A 2HA4A 5CH8A 3WYDA 5A71A 5A7GA 5JZBA 1HL7A 2XUOA 5JYCA 3D2CA 3NWOA 5CBKA 1XKLA 2H7XA 2GYWA 3O4IA 4A23A 1Y7IA 2XMZA 4BBZA 1CPYA 4B81A 1I6WA 2XE4A 4KACA 1EDDA 3WKCA 1YB6A 2XUGA 1QTRA 5A6VA 1TKRA 4E11A 5HK9A 3VKFA 3F96A 5JAHA 1XQWA 4FOLA 4LYEA 4QWWA 5AK3A 4KE8A 3STYA 4QDOA 5JAOA 3I6ZA 1CFJA 3DOIA 5LIPA 1W4LA 5AKLA 1TQHA 1VA4A 3FYUA 1MX5A 2Z8ZA 3I2GA 5I9IA 1O6GA 2HA3A 4N5IX 5H3HA 1HQDA 5ALTA 4BE4A 3ZPXA 4D9JA 3D2AA 1TIBA 3EIOA 5JIBA 5CRIA 1BEEA 3VVLA 1QO7A 5JALA 4UHFA 5FPPA 4WFKA 2GBCA 1YAJA 2XUJA 2CEKA 5ESRA 5T4FA 4KRXA 1CUBA 4AMZA 5I8PA 1UZAA 3V9AA 2XB6A 5T4BA 3V48A 3PI6A 4FWBA 3S8YA 1YCDA 4J7AA 3IUQA 1UK6A 5FPQA 1YASA 1AX9A 4DIUA 5ALNA 4OD0A 1E5TA 1QIKA 3C43A 1W75A 3QPDA 4KAAA 5AOAA 1MN6A 5E4TA 4X00A 2DHEA 5CT9A 4UUQA 3WK4A 4H7HA 2ZJ7A 5EHZA 3EQ8A 2XMDA 1AZWA 2WJ6A 1MTZA 2WJ4A 4J0KA 5IVIA 2WIFA 2GBGA 1H2WA 5ALYA 2R8BA 3G0GA 3RLIA 3FBWA 4K2AA 1P0PA 1G42A 3WL5A 4CG1A 2WUGA 2XI4A 4DNQA 2WG0A 1LPBB 2H7CA 3FYUC 1K8QA 1J06A 3STXA 4DTCA 3A70A 2XMQA 4BB0A 3LIPA 3OOSA 2WHRA 4J3JA 4RPCA 1CUHA 2O2HA 1NU6A 3O95A 4Q3KA 1ODSA 3V1LA 2XMRA 5AM3A 5D6OA 4BP8A 1C7IA 5LYYA 1DU4A 2WU4A 4WFIA 4LIPD 5AI9A 4AO7A 1OCEA 4GWLA 5KBYA 4EZIA 1SCKA 1XZMA 1YA4A 4WCVA 2WHQA 3A2NA 5CT8A 4ZV9A 1VXOA 2WKWA 1IUOA 2GYVA 1OILA 3DS8A 3D7RA 2PSEA 1A8QA 5BV7A 2C58A 1YSCA 5AH0A 1ZICA 4DYHA 2O2GA 3VJLA 1WPXA 1XZDA 3WK8A 1Q0ZA 1J2EA 2JGIA 4H7KA 1HDEA 1LPPA 3C6YA 3C5VA 4A16A 2CZQA 5IVHA 5LZ8A 3HI4A 4W63A 3LIIA 2WLSA 2OXEA 4Y2QA 4P92A 1GT6A 5HQ3A 3IULA 1Q83A 4GHWA 2B4KA 5HF9A 4WY5A 5ALJA 1JU3A 5AOBA 3WKEA 1JMKC 4Q82A 1A7UA 1JKMA 3AFIA 4FBMA 4BDTA 4BZWA 2BJHA 4H77A 5CW2A 1R88A 1L7AA 5LZ9A 2JGLA 3U0VA 1IMJA 1G66A 5T4HA 4A5SA 1ZIXA 4PSCA 4P93A 4HXFB 2VAXA 3HZOA 4Y2YA 4ZREA 3K6KA 5HK8A 1QIDA 1B6GA 2WUEA 4L3WA 2GYUA 1T4MA 1NU8A 2XT0A 2XUQA 2HA7A 1K63A 1ZI9A 5ALRA 3VJKA 4DGQA 1GPKA 4BCDA 4PO3X 2ZJFA 2OCIA 4Q05A 1N5RA 2HDWA 1DINA 1DWOA 1QIHA 1TCCA 2C5FA 2VSQA 2ZSHA 3PUIA 3M82A 1GQSA 4C87A 2W22A 3HSSA 2XMGA 1QJ4A 3SX4A 2X5XA 4AO6A 1RP1A 1CV2A 3F9CA 1H2YA 4RE6A 4MEBA 1ZD3A 4TGLA 3AIMA 5EHNA 5C8XA 1WM1A 1ACLA 3BDVA 2WSLA 1FFCA 3JYHA 5SYNA 2X76A 4G8BA 4Q3OA 4N5HX 4TVKA 4RE5A 5F4ZA 4QLAA 4QE3A 5HF6A 2HA2A 5ALDA 3STTA 4UHCA 1Q84A 3W9UA 1A88A 1X70A 2WIDA 4KR0A 5JAPA 1UK8A 4MXDA 3N0TA 4HXGA 3HEAA 3MVEA 2QVBA 4E14A 5BOVA 4GI1A 4UPDA 3R3WA 3WKAA 2C5GA 1XRPA 5FUMA 1IVYA 2K2QB 3C87A 3QMMA 1UOQA 3RK4A 2AJDA 3ICWA 2DR0A 2B61A 3BDIA 4NVRA 2CMFA 1KEZA 2XQGA 3GFFA 4GLBA 2ORYA 5FKJA 2VF2A 2PKYX 5FDFA 5HZGA 4JYPA 1BU8A 3FVTA 3E4DA 5DNVA 1HLGA 5HCUA 3W04A 2OCKA 4CIAA 1QIJA 4PV7A 5CH5A 3AJAA 3O0DA 2H7YA 5K3BA 4DMCA 2OGTA 2HFKA 2OGSA 1CQZA 3ANTA 3G02A 5EFZA 2WUFA 4Y2TA 5HQ3B 3ZI7A 4Y2VA 1R9NA 3D4LA 3QBJA 4H7DA 3G0CA 3W2TA 2BCEA 3V1KA 2HA5A 4N8SA 3G9UA 3VDXA 2FJPA 4JYMA 3R0VA 3ZV7A 4K6HA 2JBWA 4CCYA 2HA6A 1X2BA 4BCCA 4U2FA 1N1MA 4G1FA 5ALOA 1ETHA 2O2IA 5JAUA 4X71A 2VTVA 4B0PA 5JATA 1ODTC 3AINA 2PX6A 4Y2UA 4PQEA 1XZCA 1R1DA 4Z49A 5CXXA 1XZLA 4X7BA 1JFRA 1TRHA 3TEJA 1R9MA 2OAGA 4G4GA 1CUUA 5EHQA 3OG9A 2I3DA 4X6UA 5C7YA 4XIIA 4AO8A 5LZ4A 1UOOA 5AIBA 2ZJ6A 1EX9A 4J0CA 5AI8A 2BUCA 3GA7A 5K3AA 3F67A 1LBSA 5C8ZA 1U65A 4X6XA 1BN6A 4BE9A 4F0JA 4TPKA 1ZGBA 1GKLA 4JEIA 1UWCA 1CQWA 2ZSIA 2GBFA 3STUA 2XLCA 3WZLA 3H1BA 4YK7A 1AURA 2WFMA 3ESBA 3WMRA 4V2IA 3C70A 1Q0RA 4CG3A 3ESDA 2O7VA 1MAAA 2QRUA 3Q0TA 1QGED 1THTA 4LXIA 2XLBA 1FSSA 5LZ5A 3IUJA 1AGYA 4OU5A 1GZ7A 3HJUA 3A2LA 3WL8A 1D07A 3AIKA 1VE6A 1BRTA 4NZZA 1GPNA 1R4ZA 5FP0A 2PM8A 2QJRA 4JNCA 4J0HA 2OQVA 1U4NA 5K3CA 5JANA 4QNNA 4AX4A 4UFNA 5AKGA 3BIXA 4K6KA 3IURA 3DL7A 1WB6A 2AJBA 1WHTA 5AM5A 1XQXA 2ZYRA 5JD5A 4PSUA 4BCBA 3O4GA 3H2KA 2XQKA 3FYTA 3ESAA 3U1TA 1WPRA 2BGNA 5CTAA 1SC9A 3OM8A 5D3ZA 1XLVA 1MPXA 2PU5A 4Y2RA 1ZD5A 3OTQA 4MQLA 5ALEA 1JJFA 2VJCA 2XUDA 4C89A 1LBTA 3D5EA 1E66A 1YAHA 5LZ2A 1XQVA 1TCAA 3H2IA 1MO2A 5ALWA 3CN7A 4HXEB 3STVA 3R41A 1WCYA 2FJ0A 4FDMA 1QIGA 1AKNA
chains in the Genus database with same CATH superfamily
3Q7EA 1AMNA 1YK0A 2GBIA 1B16A 5ETJA 2H92A 2IY8A 5DMXA 3H1FA 4HQOA 3ZOKA 2H4XA 4X44A 1G9XA 3SYTA 3ZDEA 1DTWB 1HNWB 3QU5A 2Q07A 1QG0A 2YASA 1AGXA 1E1QA 2Y66A 4X90A 2JJ2A 3R7NA 4DILA 3EY9A 1GU0A 2CLHB 1B42A 3WGQA 1JEEA 1K97A 4X1KA 4XGKA 5FFNA 3GWZA 1XRQA 3A1WA 4NMHA 1NVVR 2E82A 3ZS9A 5DX1A 3FPJA 2RAUA 4G9GA 5ADVA 2C8JA 4RK4A 3DT9A 3GDOA 3SM9A 1L8OA 1XEXB 4YPOA 5ECGC 3U1BA 3BA1A 5YASA 4JB0A 1LX6A 2VK4A 2P9GA 4MEJA 2J87A 4TUYB 3WNDA 2JLXA 1PO7A 5L8VA 4MQFB 3V32A 4ZT2A 4MPRA 4G1CA 4P2BA 5J2UF 1E89A 4EW6A 3BREA 3BL6A 4NG4A 4ARAA 1QK3A 2WDZA 1SOMA 4ZQEA 5BSGA 5I45A 1K8ZB 3OHSX 4K9PA 2VDWB 3NOXA 1FSZA 2YH2A 3F4BA 4NBKA 2Y1CA 3KL4A 2B1GA 1CY8A 2Y1LA 3GEBA 3K71B 1Q14A 3WDKA 4TWRA 1R5JA 2IF2A 3EGIA 1DFHA 3NDRA 5B58C 1JVNA 4OM8A 2OO5A 2VNAA 4TOIA 4YAKA 3U7GA 4M8NE 5A9TA 1CUSA 3LCCA 3PVSA 4FINA 2JAUA 5KIAA 4RULA 2HF2A 4A8JA 4G26A 1LLFA 6AT1A 2AJLI 1QG6A 4ODIA 5A05A 3K0EA 5KUTA 4YV1A 1IBRA 2X8AA 2Z57A 2FR8A 3AI3A 3ROKA 3KOZA 2NXNA 2FZ5A 3ABZA 5HE9A 1HBJA 3QKUA 3KDAA 5FTWA 4IJVA 1PJBA 1BGWA 3TKLA 3TIVA 4LHZA 4L0CA 1Z4JA 1P7WA 1NVGA 1FMCA 1WU7A 2I34A 2X58A 3OFNA 3C1UA 1UXKA 3JWGA 3NC1C 3M2PA 4PZCA 2NPIA 2W6JD 1IAVA 2HLDA 2J30A 2RCNA 1C0EA 3ELBA 2ZYUX 3LX8A 3A9VA 3WO0A 3IILA 5DX8A 3ADOA 3R3VA 5DGCA 1P2VA 1NNUA 1ZGZA 4A8PA 4EPXA 1JVSA 1KMQA 2JGDB 3PDHA 4HB0A 5A2QA 4JAVC 4HXYA 4JLSA 2NSLA 4DLNA 4BO0A 3ZZ1A 5GIOE 1CZKA 2EX4A 1A8SA 2J7PD 2B7BA 2P2ZA 1LFDB 3SY8A 5DBHX 2XA1A 2P2LA 5TMDA 1CB7A 3PQ3A 1YJAA 2NO5A 3D64A 2CL6X 3FR8A 4IV5A 1TYEB 3ZHBA 1TIKA 3C85A 4AP9A 1GTL1 1R0RE 2QMZA 3CH7A 1J07A 4EG6A 1K8RA 3NS7A 2RH5A 4B7XA 2YVQA 4RK7A 4U9IS 4WV3A 4XR9A 2OZPA 1CF4A 1RNLA 2DPMA 2Q7OE 1W34A 5K0JA 4IYJA 3KX2A 3QOFA 3PUZA 2CXHA 4A26A 5TXGA 1KK1A 1SVOA 1JQ5A 3LBHA 4GECA 2Q8QA 3SFTA 4U2EA 3ZV4A 4BJ3A 4ACAA 2WWHA 1QRUA 4X85A 1UJNA 3OCWA 4ASUA 1G2QA 1MRSA 1LZKA 3TSZA 2FZLA 2PPLA 1QGYA 2RJ3A 1WZIA 3LQRA 4NU0A 1QZ3A 2FMTA 3SR0A 3FYCA 4DCOA 3HDGA 3H1TA 1GPJA 1N36B 2BR5A 3UT5B 1DGQA 1W94A 2WAXA 1GNLA 2NYUA 3GJ6A 3H5LA 3IPAA 4HQ6A 3I1YA 4P4LA 5CD9A 2H3HA 2NV0A 3RTAA 1J0CA 1X1CA 1TUIA 4HI0E 2XEDA 1ZD8A 1HM5A 1SKUA 1L6RA 1BGVA 1TAHA 2F43A 1P0MA 2IC5A 2V0NA 3IT1A 4ND7A 1DEAA 3N7UA 5I5GA 4OHYA 5JADA 3TM5A 3AH8A 4L6AA 1G8AA 3AJ9A 2LV8A 3ZYZA 1J42A 1SC6A 1YMQA 1XZHA 3CLSD 2H18A 3WL6A 3J81k 2PFGA 3DDUA 4NG5A 5EI5A 3WWCA 3C98A 3E5MA 1D1SA 5A7FA 1N32B 2CBZA 1EFTA 2DG2A 2QNBA 1C9MA 2FWNA 4GZ6A 5D7BA 3AKCA 1GZHB 1NQOA 3WGLA 4Z51A 1HO3A 4HVLA 2HJHA 3BWDD 4HNVA 5CCXA 1QYRA 3HVKA 3Q3VA 3W5IA 4B6SA 1TJ5A 1EFHA 3H5OA 4HNHA 5E4YA 3TVYA 1EJ0A 1CP3A 1SNYA 3OPYA 3R0ZA 4RVOA 4UTVA 1WD7A 1LLUA 1R8XA 2FLWA 2RGWA 3P4XA 4BMOB 2AE1A 3ZVRA 1FP4B 2IU3A 3H86A 4Y2PA 5AJWA 2NVWA 5DK6A 4CU5A 4DLTA 4ETIA 4YLYA 1E1DA 1M66A 3DKRA 1FXSA 5ELLA 4BXOB 1DQNA 3OZDA 1G3IA 5ED4A 2AN4A 2JGDA 4N1AA 1N75A 5D3MA 3A1CA 3KXDA 4I4CA 3D3JA 3ES9A 3IO3A 1WB4A 1YVEI 3CWQA 3PLRA 5GIPE 5E9QA 4CV1A 2YUTA 4DNFA 1OOEA 4DJ5X 3R44A 1CFZA 2MYNA 3R6GA 4J43A 4UDXX 1KE2A 5BSHA 2VZ8A 3MXTA 5DGHA 1WLYA 1X8XA 3HS3A 3Q7IA 4G2NA 3VTAA 3WGVA 4DKXA 5K0TA 4LHEA 2AEEA 2W8BB 1N1DA 3V7WA 2JEZA 3OIVA 1AN9A 3N07A 4RSRA 3L4JA 2IU0A 2ORWA 421PA 2P6RA 1V3UA 4PGGA 3U4AA 1AKUA 5FTKA 4G56A 5CK5A 5CPBA 1SH7A 2HJ9A 1G9SA 1TYCA 4HMPA 4LGMA 5AHWA 4HGRA 3K5PA 4LGCA 1DC5A 3ZDYB 3HQ4O 3Q5EA 2P7IA 4E2YA 1NMYA 1FS5A 1IFXA 2I6UA 4BFZA 1IMOA 1IJFA 1KZHA 3SBEA 4MPPA 4BFCA 1FRNA 2WKRA 3NHAA 4RZHA 3A6FA 4R6XA 4M7OA 3H97A 3MEQA 4ZT3A 4IH9A 3WG9A 1K7YA 2QZZA 1M2KA 1E3WA 2VHWA 3JSXA 1Q17A 3L05A 3NIGB 4PQRA 2CC2A 3W9SA 3G2KA 4ARIA 1P0IA 4Q9KA 4M0PA 4HG2A 3UK7A 1OIWA 2WM3A 1Q7RA 3FSJX 1H5NA 1KMIY 1W52X 1YS9A 1YR2A 1GZ3A 1E1RA 3C3CA 3K9BA 4OTZA 4DV1B 5D6NA 2HC9A 3ZY4A 2FFRA 1FVHA 2VBGA 2FQQA 2FEWB 4X60A 1H9BA 1M1NA 3P9PA 4JUCA 4BRSA 5L53A 4ZYXA 2BEUB 2QTVB 2W2KB 3MT0A 1BXGB 1WRBA 4K9QA 2YL2A 1JKJA 4JSYA 1AKRA 2DKNA 1I3KA 3G0BA 3BCUA 1RQXA 2LNDA 4R9RA 5BYJA 4KMRA 1E2NA 1CDDA 2R1VA 3N6RA 1NBOA 2WHYA 1BKDR 1BN7A 1XD9A 4J0JA 5E2AA 2EL9A 5JH7A 2ZRGA 1X0XA 3GEHA 2HK9A 1T9GR 2E0IA 3IRVA 4ND6A 1P4JA 3F8WA 1RI3A 4AZ3A 1UIMA 1VI5A 3ZCSA 5AI4A 5BP7A 3LHKA 2GAIA 1OIVA 3RUHA 3H16A 2GCIA 4F93B 5LM3A 3LVFO 3EFBA 3QEKA 3EF1A 3GT4A 1XAGA 3VQTA 1C7ZA 3AOEC 3P96A 5CXUA 1Q19A 2JCXA 2GUGA 5EIFA 3H2ZA 1J90A 4GI5A 3VRHA 4NDAA 2J0UA 3FGZA 3L8CA 4G3XA 4NJEB 3O8QB 1J39A 3K9FC 3ORRA 1L1QA 5AI5A 3SJAA 1FFYA 5HIJA 3WRXC 4KIWA 1L5OA 3HZZA 4AW9A 2IBSA 5JVDB 3MTQA 3LW8A 4OLHA 1EDZA 3QYFA 1QE0A 1MAHA 1WUKS 5IJXA 1RE1A 4DB2A 1IC6A 1JECA 2BFWA 4GAEA 3I9V6 1QK5A 2IY7A 3SNHA 1HYBA 1Z8NA 2IEYA 3IP1A 4KPEC 4OI0A 2YJ5A 2XTMA 3KT6A 3VNSA 4UREA 1FNCA 1QHEA 1F4LA 2QX9A 3IQGX 3QBEA 3FPBA 3RC9A 3TJZA 1LF5A 1XNJA 3O75A 3ONNA 3U40A 2Z2XA 3L4EA 4OHUA 3VR1A 2I4TA 3S2YA 4D8TA 4ZDKA 1RYDA 2B8NA 3QELB 2NUPA 1TD9A 3C7DB 4Y0NA 3K6SB 1UBNA 3RUAA 4EKDA 3N86A 4I1RA 4OQLA 4RHFA 1XPJA 4Z1MD 3KPWA 1XWFA 4Q34A 3CKLA 1QGUA 5LLSA 2ON6A 4BQOA 5JMWA 3TJMA 3EZGA 1FP6A 5KCMA 2HQRA 3W8DA 2DQYA 1H2BA 4FYWA 1NXQA 1CQPA 1Q15A 2NACA 4LMAA 1I94B 1SHTX 4IO0A 3TLCA 1JU9A 2AGVA 2DCMA 3SEQA 4XVHA 1PBNA 5BT8A 2TS1A 3D6HA 3JRXA 1KDZA 1O8BA 3A4MA 3OQIB 2ZSDA 1LSOA 2QTFA 3H6GA 1D7OA 2FI1A 4PRLA 5DI3B 3TLYA 3WI7A 1M75A 5C7OO 4D9CA 1HOXA 2QIPA 4U9UA 4JB3A 1C1DB 1XBTA 2Q41A 3FH0A 1DMRA 4FCTA 2WMOB 4TUYA 2E4YA 3Q1LA 4YP7A 3RSGA 2QLFA 4HLCA 4KE7A 4X8OA 2AOUB 1RRGA 5EWLB 5SY4A 4KO2S 1KJ9A 1IY1A 1KI1A 2CVQA 3O91A 3V8QA 3PNLA 1AKVA 1X7ZA 4WZ6A 5J58A 4L16A 3IKVA 4QFBA 3ZW7A 4YJFB 3T9FA 4EY7A 2W4MA 4DCSA 3TOVA 1TZJA 2CUZA 1AIPA 4ETWA 1CT9A 4J3NA 1BS9A 5JBNA 3EODA 5HKOA 1X1RA 2G9ZA 2Q4EA 1D0SA 1N0UA 2D5CA 3LY7A 4GC9A 1TO1E 4A2WA 4EG5A 3VAZA 1UBFA 3WBBA 1N6OA 4UAUA 4V1CB 2G76A 4IXMA 4U9HS 3AF2A 3DA8A 4P7GA 3ZHUA 1LVGA 3RSCA 5JSZB 1UUFA 1T1SA 1RPJA 4XM1A 5DOVA 4BIMA 3QNMA 4YJHA 3UPUA 1DBPA 4QM6A 1XMSA 1NP6A 3HYLA 1KK3A 4L8LA 5KTOA 5TARA 1N6LA 2PV7A 4EEKA 1P2DA 2O5RA 1PQPA 4IS2A 4BC1A 1ZUD1 5ALUA 4OP1A 1RQLA 5BRAA 1XDUA 1KH1A 2B6NA 1FJ2A 1TVKA 4J7UA 4DPKA 2FOLA 1G41A 3H5NA 4AJPA 4RZIA 4UZEA 1KJNA 2Q45A 3ZJ4A 4ZTZB 2C9DA 4OQNA 4AS3A 1H2XA 3HB0A 5HKKA 1QLJA 2V7WA 4N3GA 3IA2A 3QSGA 3MPUA 4PZPA 3IUSA 3ER8A 4NU6A 3H5TA 3GRYA 4QT4A 1FRFS 4OYRA 3U49A 4GSYA 2HJSA 5CXQA 2IOHA 5E6UB 3DXZA 3KHTA 3T1NA 2X22A 5HF5A 2NQ2C 1B7GO 4LJ6A 2D00A 1KAQA 4W1PA 1L4YA 3CRVA 4RY2A 1NRJB 1FDWA 5B3KA 5LU8A 2MSEB 3IUMA 4TQ9A 4TLMB 4NYIQ 1EZZA 5EA2A 2A0FA 4I6JA 3TIFA 2HRQA 5H7XA 3TMYA 1LVUA 2JGMA 2Q46A 3CLHA 2B34A 1YACA 3ZH2A 3CJQA 2A5LA 2GLTA 1P61B 1KE1A 1K3TA 4EDHA 5MFZA 5F5LA 2WYUA 4ZCMA 1X94A 4PNEA 1JBEA 3DFFA 3IUPA 1A77A 2WTNA 1ZGCA 4IL5A 2RGXA 1H6DA 3PA8A 4PAMA 4ZO6A 3S1AB 1NRIA 3RS5A 3K5HA 5E7QA 5BQPA 5THKA 3WP0A 5CEFA 3WHKA 2CK3A 3VMFA 1CW2B 5AP9A 4DQLA 2O1EA 4UM9D 1GXSA 2EKZA 4CKEB 2DT8A 4PVDA 5ICMA 1P4GA 2FPOA 2VNKA 3OEWA 3ZXSA 5F7XA 2XGJA 3DEKA 2OR3A 3L9XA 4EMBA 3VZDA 4HAOA 5BSMA 1JLLA 3A3OA 3KQSA 2VF4X 3O3NB 3I92A 3DMRA 1ECLA 2G0AA 2X9LA 4WESB 4HBZA 4KRGA 1KU0A 4EMUA 5EZYB 4P3XA 4L0DA 3TG8A 1ZCFA 4MEAA 2W2LA 5DNYB 3ZTTA 5FAKA 3AKDA 3NBKA 1NWCA 2ZIAA 4QQFA 3R6WA 3C3AA 1T0UA 4I36A 4HB2A 4TLEA 5IN5A 2QRLA 3LM8A 3BFJA 3TB6A 8AT1A 1QR2A 1MJGM 1PZFA 3N8NA 4BX3A 2QUBA 3HCWA 3QOXA 4PHGA 4XDZA 1Q7TA 1PGQA 1Y8RA 3CSSA 5DV9A 1SZDA 3ZE2B 3CX4A 2PJRA 2FPXA 4ZFNA 1JF8A 3WGZA 2ECFA 3L40A 4YMGA 4Q3NA 1JTFA 3ROMA 1KZ1A 1M3SA 2X0JA 3D3NA 4IBOA 2VBIA 4Y7DA 1T9HA 3I2YX 2OFOA 2PKQO 4GVXA 2DM6A 1VBKA 5CLQA 1THGA 1JEQB 1WWKA 2RKWA 3FOCA 4RJKA 1P2SA 2D5IA 4RWEA 3ASYA 4S3MA 1MAVA 1QAQA 4W8GA 4B46A 1N2IA 1WR8A 1SN7A 2ZJZA 1IB6A 3GEMA 5F9HA 1XJ0A 7MHTA 3NM5A 3LPNA 1VFNA 2GN6A 4AY4A 4DLWA 3RRMA 4UW9A 2A9QA 3NBAA 2OLJA 3EGXB 1QBKC 4LMRA 3KSBC 3DJYA 5A3SA 1EWQA 2YMLA 3GCZA 4HZGA 3L6CA 3SKYA 1YZNA 4BAZA 3BRWA 4I3GA 4Q00A 1SU6A 3OIYA 4ALMA 3SSMA 4HY3A 4C9BA 5FL7D 4DDUA 3KQUA 1EI9A 2HBYA 5HKKD 4GICA 4WXRA 2Z2JA 4EVRA 1V8FA 4EHBA 3GB9A 1NONA 3C39A 4K2HA 4RAOA 1RZUA 2PE5A 1W6UA 2VHVA 4E2XA 2YV4A 2YY6A 4IJ5A 2X5NA 3PLNA 4QUJA 2I3ZA 1IXYA 1J8QA 3QMVA 4ON9A 2QE7D 1MIHA 3FI9A 2C5BA 4G0PA 1TM2A 2BAGA 3LBFA 1F4VA 3OFND 3KOMA 2EFYA 2W83A 5AUOB 5CBPB 1GAEO 3WSTA 1CETA 1F2TB 2M98A 3HSYA 4QOSA 3NGMA 3R4CA 4TL6A 1SCJA 1FXWA 1UM9A 2XGGA 4NCNA 4ZZ0A 3SIXA 9LDTA 4RXUA 3LKDA 2Y1DA 5JBQA 2R9VA 1ZCZA 2QJWA 2ZETA 1RADA 2VQDA 4ZYYA 2DFTA 4N6OA 1LC3A 2WOOA 1ULZA 3DDWA 3E9DA 1U5AA 4RA6A 3AESA 1E3MA 3HABA 2NIPA 2RHRA 4JBIA 1QYXA 3JD0A 4ZT7A 1KEVA 4LDRA 5AICA 3KKZA 2R2GA 4MV6A 2QOEA 4RTNA 3VOAA 5IWCA 1E4EB 3PPWA 1OW3B 4ZMSA 1R5OA 2Q6TA 4S24A 4UNNA 2E4WA 2FMHA 3I2HA 2JCVA 2GPYA 1CY2A 3SX2A 4WW0A 2I4LA 5ALZA 2WAAA 1C5KA 1CY1A 3QY0A 4NCKA 1WXWA 2AN5A 2ZVDA 1PW5A 2F90A 4BVKA 5FULA 3H5VA 3EGVA 3RCBA 4XYLA 4Q9DA 1EK1A 2OP1A 2CDRA 4D8YA 2NU9A 5J4YA 4AT1A 4IFBA 1OY1A 3PCRB 3MM4A 2Y3IA 5A5FA 4F1WA 5JZOA 2PS1A 1T4DA 1BE8A 3VPHA 1LA2A 3WQBA 3Q8LA 5DM4A 4KN8A 2CD9A 2YOGA 3WV5A 5CNJA 4M7WA 4HJXA 2YW2A 3AP3A 2QWXA 1EVYA 2RI6A 1UK7A 5HCNA 3IB3A 2BGJA 5TJ9A 5IYZA 1XXLA 2AUNA 3NOOA 5C1OA 1P4RA 1Y7HA 2WOJA 3EIXA 4BDSA 1K2VN 3NEAA 2W2KA 4IIFA 5KI6A 2DBYA 2FN7A 1IIRA 4YECA 1NX9A 1JQEA 4JSTA 2FW6A 1SM4A 4R1NA 3WGYA 2F8MA 4P8RA 4RDCA 3TL3A 5GM1A 3WIOA 3ZR4B 1S3GA 3PWKA 3RQIA 2EDCA 2FKAA 2W2TA 5IAGA 5TEWA 2EYUA 5L45A 3C3PA 3MS4A 2O8CA 4EFLA 3LXXA 3QFTA 4YUVA 4BJ1A 5CH3A 3C6KA 3ETNA 3HXLA 3ONDA 3TW8B 1QVWA 4QWMA 2V59A 2G1KA 4YAFA 5IJ0B 4YR7A 3DTNA 2J9ZB 1NYRA 3N5KA 2NWQA 4I81A 1ZIPA 2BD0A 2C42A 3A6ZA 3G6KA 3L0DA 4KPYA 3L8FA 5JO0A 1UP4A 3UAWA 1GSHA 5C5EA 2V9PA 4ZOLB 5LP6A 5C52B 3THWA 1V5GA 4PC6A 4RKYA 3EUFA 3G85A 4E08A 5EQFA 3OCUA 2GWRA 3NC0C 4S2EA 4WKNA 1AF4A 2J3DA 3W4JA 4AP5A 4D0RA 3PRKE 4N0PA 1Z4LA 3PGVA 1J8FA 2VUIB 4B40A 2VUHB 3MBOA 3OFKA 3IR7A 2J3HA 4CMIB 2ZPAA 4E4RA 2OV3A 1X1DA 4ZCPA 4NTZA 4D3SA 1C7RA 3FW1A 5AKEA 3HJTA 2BVNA 3L7NA 4E88A 1GGFA 4G41A 5TIIA 2E6UX 5F35A 1W581 2IXTA 2O3QA 2P69A 3FSEA 1QVVA 3IOEA 1VYUA 3KUCA 4QDZA 5AVKA 4B7UA 2PT9A 4NECA 4U8HA 2VLIA 5DNEA 5LMUB 4A36A 3UJNA 4NEHB 3W05A 1XXHB 3HRHA 3DXFA 3P0IA 4UBMA 1M83A 2GPJA 5TT1A 4E5PA 4LJRA 4OUKX 4DV2B 2WDPA 1IDOA 3TNFA 4WLNA 4V1CA 3SR4A 1E79D 1KZ4A 5H4HA 1JG1A 4UEOA 3T15A 5HWSA 1FDOA 4AF7A 4JA0A 5D1HA 2OO7A 3UC5A 4QTTB 3V42A 3RYCB 2PS0A 3GLTA 4ZO9A 1H05A 1UP6A 1PTJC 5K01A 2HKIA 4U63A 4DMFA 1P3Y1 2PMCA 1G6KA 1P45A 4DLRA 4KQGA 1DJMA 4MR9B 2H54A 3RIXA 3VOTA 1WBBA 2XQJA 5CIYA 3ZD6A 4MYRA 1GL7A 5HIAA 1VKJA 1Z83A 1QU2A 1W44A 4S0ZA 1H2HA 3P9IA 4M0FA 3U31A 2GH1A 5B7QA 4WOBA 3DLTA 3MC1A 2P2YA 1N5KA 5EWMB 4EY6A 1P0FA 2XOXA 2OD2A 2AC2A 4I46A 4IDOA 3IE2A 2XZTA 1PBTA 3NAMA 2C9BA 5T3UA 3O47A 3HP1A 2WU3A 3GRFA 1AS2A 2YIJA 3F47A 3I9KA 4RUKA 1RBQA 3QVVA 1VPDA 1UPTA 3DBOB 3IH5A 3IP9A 3K73O 3PDWA 1LGYA 2OAQ1 5EEGA 4WY2A 1C7JA 2R00A 1FYVA 2OL4A 3IAUA 1U2GA 3DE3X 1F8GA 2C20A 3MGKA 2KS6A 3TTXA 3EA4A 5B57C 2N42A 1C0PA 3A10A 2B99A 1JWAB 1TPYA 4MMYB 2F7SA 2WFZA 3ETLA 1ZNQO 4QTZA 6ABPA 4CETA 1ZA2A 4ZCLA 4MRMA 1EBBA 1KK2A 1OXBB 1L4BA 1PQ4A 1HT1E 4JENA 3WTCA 2PO7A 3EEIA 3EFHA 3R7AA 3WYBA 3HKCA 2K4MA 3UC9A 4XWOA 4MIOA 2FX2A 3BXFA 4UNQA 1KDPA 1NF9A 1W5FA 2EX1A 3CUEF 2BRUA 2WPNA 2XMBA 1RWKA 2AZDA 3HBAA 5JWRA 1U4OA 4OBBA 4LRSB 2J5KA 2BR4A 4BMCA 5CFMA 4ALKA 2ZLBA 4Y9TA 4DFDA 2VYVA 4F72A 2H2AA 4G01B 2QVCA 1YR1A 1YT5A 4EHHA 4YT8A 1ZUNA 2VL7A 1MX9A 3A1VA 1C0LA 3EISA 3HDJA 1QIIA 3CU5A 4G4IA 4GNRA 4GX0A 4M3NA 1NJ2A 1UBOS 4MITA 4YRJA 3ZLTA 4YRAA 1CQIA 2FSVC 4A1FA 3EN0A 4PZ0A 1WF3A 1XDSA 3NHLA 2JLZA 2XAAA 4ND8A 5CEJA 2IT1A 1M8JA 1OLXA 2OGZA 2VWPA 3DL4A 5ED0A 1ZD2P 3AUYA 1XQ9A 3BRSA 1SEPA 2PGAA 4QUDA 3N8GA 3SIPA 1DBSA 4YQZA 5JHGB 1SBYA 2CBGA 3ZNNA 2H4JA 2O1WA 3HYTA 2IOYA 2WICA 1V11A 3P9QA 5AKYA 5FADA 1NQUA 1QGOA 5FUQA 1TEHA 2Y1GA 1SHJA 2H9IA 4LJLA 5DYTA 1C81A 2A0YA 3WZ2A 1KOGA 4IFTA 1HNNA 4IHKA 1Z7EA 4D0LB 2I6QA 2IZ1A 3HCOA 3OT4A 2CVOA 3SOZA 5TQVA 5EIXA 1WZCA 5EAIA 1XVLA 2QTHA 4KO8A 2R6HA 4FFMA 2ZEJA 4OHXA 2YMQA 1KZ9A 3Q7RA 3NETA 4JZYA 3ZCXA 2EDAA 1UT5A 2I2XB 4P5EA 3QGMA 1IXZA 1LPAB 1TVCA 3KEMA 1N92A 3ENZA 4MDYA 5EYPA 4WXEA 1JAHA 1SBHA 2WILA 3K6JA 5HX7A 3CKKA 3E9YA 3HKEB 5K0ZA 5IRCD 1U7HA 4MW9A 4P6VF 1YS7A 3DWFA 4CF4A 4ZCTA 3KVVA 4YWHA 2A3NA 4FHDA 1CQJB 3R7DA 3TCXB 1ZY2A 2QSYA 1ZM7A 1U2PA 3GXBA 1EBFA 2PU7A 1UFRA 4MP3A 5C3MA 4WTOA 2PXXA 2P9FA 4Y6GB 5D51S 3GVHA 1GQFA 4IXNA 2OPHA 1JYFA 2QSZA 1C9EA 1PT9A 3G2JA 3GGDA 4O08A 5TPWA 2BFAA 4DE5A 2PD3A 4OPMA 1Q22A 5CURA 1G55A 1ST2A 3NTRA 5DTQA 1UXHA 2FW9A 3ANLA 3CE6A 4L4SA 2X2FA 16PKA 1XHLA 1EJ2A 2C77A 3NTUA 3QXXA 2CD7A 2J5RA 3PC7A 3QIVA 1Q3HA 2AJCA 4X97A 1CUIA 4KR3A 2J9RA 3KPJA 4D74A 4CGYA 2E4AA 1XN4A 1QFSA 4UEKA 3ABRB 1LPOA 4B31A 3AR3A 4DIMA 1XLUA 2SKEA 1OF1A 2G4LA 4EKNB 5IZCC 5JTUA 4FYPA 1BE1A 5EVCA 4G5YA 1JGTA 3TIGA 5LQNA 2ILTA 1R6DA 4H6VA 4NFLA 4CTOA 2PRIA 5HJ2A 3TW4A 4KHPB 3A8TA 4TTPA 5FL7A 6YASA 4ZRMA 2ZE5A 3GRAA 1LDGA 1CUZA 4CCWA 2J6HA 1AOXA 5A7HA 5IU6A 1RAGA 4KE6A 1RVDA 4BFSA 4JOCA 1CSEE 3J81A 1N78A 2HK8A 3O9MA 3RFCA 1BA2A 1DC6A 1P1IA 4RADA 5FWAA 3PX7A 2HRRA 1JEYA 1JEYB 2ZVQX 3HA2A 5DTJA 4KLRA 2V96A 4NFHA 4LDNA 3R3UA 1EG7A 1US8B 4NR0A 4OGWA 4OXIA 5FLYA 5FOUA 2A84A 5B3JA 1BH6A 1PJ3A 1MABB 3HGQA 2J9FB 5EWJB 4TTAA 3NDIA 4H35A 3GRVA 1NR7A 3OJCA 4JT4A 3RUCA 1RPTA 2Q8PA 3HO6A 4ZARA 3I58A 4DF3A 2F1KA 3C6BA 3ISVA 3N0XA 2A7QA 1ZIOA 1T1IA 3P9ZA 2B8TA 4DT1B 3L4BC 3R75A 4B4VA 4JJAA 5B58T 4C4YA 3O2NA 3RLFA 2OMKA 3C24A 4CMAA 4CTNA 1Q0SA 4TSFD 1E2EA 4PSDA 4S1TA 3E81A 1MLDA 1QS0A 3I6YA 2X5OA 3MWGA 4HGPA 3RS2A 3FOFC 2Q9BA 3IIKA 5JJIA 4FFPA 4K6MA 1BCSB 2ADOA 3C3KA 4UTOA 2JHPA 2OTCA 3IMKA 1Z37A 3CTMA 3JAWB 4N82A 4YVFA 1ZYUA 3ZHOA 1V41E 1GUFA 3PJDA 4FW9A 3ZCUA 2IGBA 2HHHB 2FGJA 4B5KA 1YZTA 3MAGA 4MQUA 3G5MA 3L1JA 4WLFA 2YWRA 4NZ9A 2AMFA 4TTRA 3H19A 4G0UA 4GVLA 3EEQA 4TV9A 1NBWB 1SHUX 2ZBFA 5E1DA 4KNYA 1DUVG 4PU0A 4YAOA 2FUG6 2ZIUB 3DR5A 5JC1A 5IDYA 4EOGA 3NWBA 4M9XA 5JAMA 4OXRA 5L4SA 2G9NA 2CYAA 4LS3A 3OQBA 4YP0A 4MV3A 3SLGA 1P9LA 9MHTA 3OH8A 1BEZA 3QWAA 4KSYA 3VSAA 4B3XA 4YMIA 1OB2A 4ER0A 2EOAA 4EO4A 5AOCA 1YH3A 3IMFA 1GZUA 3ZU5A 3F97A 2J3KA 4WEOA 3NTXA 1WVMA 4TMXA 1H9CA 1P1FA 1QGDA 4NYIR 1TO6A 4E3ZA 4KMOA 3E3OA 4TTJA 5B53A 4BHTA 1FPQA 3F3SA 3PFBA 3F6RA 4Q9HA 2VZ9A 1GTMA 3PXEA 1NBIA 1H4TA 3TFQA 2W4IA 1DL5A 2D5LA 2I3AA 3UJCA 4GKKB 2HMYB 4JC5A 1P4SA 3OJXA 1SUIA 3PCXA 5AWFC 5LA6F 5SY6A 1L1RA 3RVJA 3T7IA 1XPOA 1SKYE 1OWPA 1DTSA 3K96A 5ULLA 2V7EA 4PINA 4PHFA 4BNJA 2H17A 3QI7A 3DPSA 1PKEA 4FMDB 5C80A 1G3RA 3BKWA 4M2LA 3H2BA 1SZPA 3PNYA 5GWXA 4BL5A 4EHDA 4JUAA 1ISJA 1MJGA 2Q3DA 3HEMA 1SD2A 4OSEA 1KTVA 4MINA 1MG0A 3U3KA 1SBIA 2RHOA 4JUIA 1WUIS 5K0NA 3R5FA 3AU8A 2NT4A 1FC0A 4X20A 5KJCA 3FWPA 1RWQA 1PK7A 2X0RA 4CDGA 3Q88A 4MS4B 2P2DA 3RU9A 3STWA 3VDRA 2P4QA 2YWGA 1U9IA 2BUAA 5BWOA 4WOJA 4HNAA 5D2CA 5CB4B 5IT0A 1WNTA 2OBXA 4XWTA 1P5ZB 1ZNZA 4EUSA 4I55B 4N8DA 1SPXA 2OZLA 3EC7A 4XM0A 1KSGA 2XF2A 3ZWPA 1U7DA 1XTPA 2FUKA 1C2TA 3WL7A 1T8RA 2RBGA 1CR2A 4KQHA 1W4BA 2QTZA 5MN5A 3KZNA 4HQFA 1GD1O 3UMCA 3JAWA 3FWYA 3OZCA 4ROTA 4B6EA 2WVHA 3OLWA 3LCUA 1I8TA 3I2KA 3KTFA 4NV0A 1NOJA 5GTDA 4TYYA 1ONSA 1Z0JA 2O3RA 4PR0A 1AQLA 3WYAA 3W3ZB 1F1JA 1I13A 1K6XA 4TSRA 5DCYA 3E8MA 5BV2P 4DREA 1APBA 3QVOA 3O31A 4RJIA 4C0HA 4QUBA 4C7MA 4EECA 5FOQA 3FR7A 5JHHB 2XDQA 3GJYA 2QJTA 1N2CA 2IYWA 1N2CB 1S5PA 2RK4A 3GFPA 4Q1FA 1ZBDA 4TTSA 3GGCA 5EMLA 4ZVKA 4CKWB 5AM2A 1JHOA 4ZQBA 1KNXA 1Q0QA 3HL4A 5JQWA 4F97A 1IWBB 2PZLA 4W9NC 5AW1A 1U7WA 5LXTA 4FFDA 4X93A 1WAMA 2R62A 3ZCPA 1SK8A 1KYVA 2HF8A 3Q9SA 2XQFA 2AOTA 1RHKA 4W7SA 4W9NA 1D2NA 1H3FA 3L0IB 4RD2A 4YB8A 2ZIEA 2C5EA 3C8HA 3WK9A 3B8HA 4J1QA 4C0KA 4Z4IA 4JOBA 1JR3E 1XA4A 4LVOA 4B85A 4HWTA 5L7TA 1J8YF 4LY0A 4QVGA 3OOJA 1C3LA 1QUFA 1NY5A 3O0TA 4TL9A 5AIAA 1SUSA 5EJMA 3VU9B 4E4YA 4TM8A 4QM7A 1V25A 2QXTA 4Q7EA 2B36A 1JDVA 1Q11A 3GMTA 5CM9C 3NU1A 5ERGB 1F2UB 1VL5A 3SYLA 5BOSB 5EKUA 2VEOA 2IJGX 4CM3A 3WWZA 4XTRA 3K0AA 4UHKA 2O05A 3MERA 4C0BA 1L4UA 1NWHA 3QNWA 1PT6A 2Z98A 5IAKA 2I29A 3JALB 2FUNB 4JLDA 4NIMA 5A3RA 3DE1X 1ZM3A 2GR9A 4LJYA 4IINA 2ZI9A 3LXRA 1KBOA 1JB1A 3H2YA 4CEHA 3TLEA 1L5RA 1HDYA 2GEUA 3IIEA 3UCXA 2G0NA 4D5GA 3C3YA 1KRWA 5BN1A 3EXIA 4JLWA 1D6NA 1RMQA 3F3YA 1N3BA 4QREA 1ID1A 3BE6A 4XDGA 1D2EA 4CWAA 4D57A 2GK6A 5FB3A 4ZEVA 4GXTA 4G63A 1BO6A 5FWYA 1C9DB 1FFXA 1QJCA 3PICA 5EUCA 4TUYF 2NTEA 5D3QA 3VU8A 2H0RA 3T8YA 3IV7A 3VNRA 4JC4A 5J2UB 4EG3A 3N2ZB 2DECA 3KQPA 2V7VA 1RS0A 2ZRIA 1YR9A 4K5QA 5B55A 4TVOA 1PYGA 4N5LA 2DPGA 3DAFA 2QTWB 2UUAB 2B5VA 4IWXA 1QVRA 1V1MB 2PZ8A 4FZ5A 5HIKA 2WF6A 1RQ7A 2JK1A 3JQ7A 1FPMA 1I5RA 1QNLA 2EFHB 2G28A 2FU5C 4GBED 4BKQA 1J23A 2DFKB 1N5JA 2F9FA 5C1IA 3I0MA 1JDZA 1FLAA 1T4CB 3KQVA 4TS4A 3N1UA 3O9ZA 2F17A 4KNVA 1U0RA 3H13A 2JLBA 2P35A 1VOTA 3IAFA 4LBWA 1DADA 2JKZA 4GOLD 1OJLA 2IKSA 2JFNA 4MQ4A 3RS3A 4OUDB 3SPXA 3NRBA 2WJ3A 2AC7A 3TNJA 3UPDA 4MVXA 4EB6A 2VPQA 3L5OA 2MR6A 4P5PA 1QV9A 1PJCA 2I76A 4CKYA 5AI0A 3E5RA 4IXWA 2A94A 5KYNA 8MHTA 3H2JA 2FCRA 4N12A 2PXCA 2JVIA 2WHPA 2ANBA 2H06A 1F0PA 2Z0MA 2ZR7A 3T5MA 3TRDA 5I4KA 3G8DA 1V9LA 5FRDA 5DLQC 5DVZA 1M0TA 2H31A 4PFJA 4HQLA 4Z9XA 1CIJA 1UT6A 2NPFA 1CUVA 1E7YA 1ZN9A 3GBSA 3RIYA 4C3VA 4WLEA 5K4HA 1X2EA 4MJ3A 4XLLA 4D82A 5AM0A 1K98A 3O8OB 4JU9A 3HWRA 5FTNA 1MT3A 1IE3A 1XZAA 2C1XA 2G08A 1A9TA 2HGZA 3G0DA 4GGPA 3L1HA 3H65A 4RJTA 2XSZD 4EJ2A 4KZPA 1YU9A 3PF8A 1ZITA 3QFSA 1SVWA 2VDLB 3TBHA 3OMXA 1LPNA 1VL0A 3WC4A 4DEVA 1RD4A 2Q5FA 4OAOA 5E6RB 4YUZA 3RAFC 3A05A 5AK0A 2YUIA 2O0MA 4NQZA 5EJ7A 2B20A 3WL4A 4U2BA 4DMGA 2I9PA 2VH2A 1HT0A 2DFDA 1CR0A 2PJDA 2XPCA 4LZNA 4P0TA 4WVFA 3ZDCA 1YB4A 4N76A 3RRXA 2KMLA 2CNNA 1DKMA 2Y1FA 2C4TA 1XKTA 2OM6A 1EGHA 3CNQS 1RXSA 3EDOA 4H6WA 1YB2A 3L9WA 1YE5A 1JQKA 1C7QA 1MAUA 2FSIA 3GJXC 1OAOA 3KT3A 5E7MA 1MO5A 4PC2A 4I19A 5LJLA 1V47A 4IDHA 1S3SA 1UEJA 4MV5A 2ZYHA 3AFGA 4AS1A 3FLEA 4LW8A 3RT1A 4B5LA 3RD5A 4PXYA 4UNIA 2Y1KA 1MVNA 6PFKA 1EDOA 1SC3A 1PGPA 2UZ1A 2FEPA 3JD4A 4NKRA 4MGHA 1PG2A 4ZAVA 1ONPA 1CJUC 5C4IA 1UC9A 2PZJA 5G3YA 1T9DA 4EHNA 4FQ7A 3PNBA 5FOTA 5E2IA 3BKXA 3BX1A 3QVGA 1XWIA 1EE9A 1Y4AE 1R3DA 4GR5A 1VM6A 1E2LA 2AXEA 3K72B 5CT6A 4E07A 1PQYA 4HB4A 4E6EA 4M9ZA 4PQGA 5BYBA 3VU1A 5TVGA 4CR7A 2XKAA 7MDHA 1MKYA 3N2KA 4FN4A 4HVTA 5IFLA 1UK9A 2IP1A 8ABPA 1Z5GA 2WZQA 2XQVA 5JD4A 1OH7A 2Z95A 5F23A 4CV3A 3QX3A 1WCIB 2JJ8A 4M54A 3BIOA 3VR3A 5KWIA 1K5PA 3S2GA 1H2RS 2V8BA 5CH8A 2IVFA 1YK1A 1RI4A 1HDOA 2YWCA 3DW3X 4XWAA 2LRHA 3VU3A 4X54A 4D9BA 1IY2A 5IC6A 4XGQA 2QN3A 3W8EA 1BXZA 4TKVA 1ISHA 2APJA 4YDRA 4MLZA 3QPBA 2C94A 1I2AA 2V7BA 4FE7A 2D1FA 2DU8A 2GYWA 1NBAA 3O4IA 1F14A 4LISA 4RL6A 4A23A 4D9GA 1MW8X 3AHJA 4GGMX 3CZMA 4H08A 4C0QC 4KTTE 1QFJA 3JQ8B 3WO1A 3JAMA 2XMZA 5KNBH 1CPYA 2IYQA 2X7HA 2GHTA 5GJVC 621PA 2RD2A 1H2AS 2XHEA 5WRFA 4X63A 3RSFA 2V5VA 1N9GB 2ODAA 1WBDA 1VPWA 1EMDA 2C9MA 2RH9B 1XLTA 2ZXFA 1YA6A 1POXA 2ATIA 3WB2A 1J8VA 2MSDB 2OBFA 3CW2A 1IBMB 2XUGA 1QTRA 3EW7A 4CIWA 1E0KA 4IRUB 1TKRA 1PGNA 3O3OB 2YTZA 3VKFA 3M6AA 3RWOA 3TPCA 3VYRB 5GVRA 2YJTD 2F3TA 2VRCA 5AK3A 4IKPA 2CEAA 3E9MA 3GAMA 3EWNA 4JT9A 4KE8A 2FUEA 3GZNB 3KAJA 1RMTA 5JDIC 1KVRA 1KSHA 1C3XA 3DOIA 2O2JA 3GJ5A 3W6PA 1W4LA 4IGKA 1RRVA 3BWBA 4XARA 1JA9A 4OP2A 4TV8F 3TLGA 4CL2A 2J09A 1VA4A 3AETB 4U8GA 3RR2A 2CXQA 4TS9A 1BWQA 3OTOB 3PQEA 1ESZA 2ZRLA 3TGPA 2D8AA 1O87A 1XI2A 4L76A 3HB5X 3ZX5A 1P1CA 2QD3A 1XCBA 3RRYA 3G88A 3FCAA 1MJFA 1R0CA 1WCV1 3DHWC 1RBYA 1E9BA 1B8OA 5ALTA 3QVLA 2ZSBA 4OHWA 4AMUA 3NBUA 4HDRA 3R7SA 4BKOA 1HYQA 4D9JA 1CQIB 4HEA6 3T5CA 1QYIA 4UD6A 1EX6A 4AUMA 3AX6A 3HN6A 4KUGA 5ICFA 4CYMA 2BF4A 4QVIA 1BG6A 2XBUA 1YDWA 2BBTA 3VVLA 2R7LA 3TM4A 2MTBA 3PL5A 4MLCA 4WFKA 4OK3A 3PJGA 4D3XA 1T3ZA 3WRYA 2PKCA 1T2DA 5JSZA 1SWWA 2C4UA 2DH5A 3BSSA 3PITA 1XSEA 3NNDA 5BN3B 2EU8A 1GPBA 1U7UA 3DV2A 2GEJA 2UZAA 3L6DA 3SEZA 1UPUA 1IDN1 3BXXA 3KOXA 3O83A 1R8YA 3KU4A 4GRAA 5I8PA 2BHSA 3AY7A 1O57A 1B14A 3HKBA 3JARA 2YZMA 4IIEA 5AXAA 1Z8FA 3RHTA 5I7SA 4GPTA 5IULC 4EARA 3QLTA 3V48A 2DYKA 2JLCA 3FVQA 4CIAA 2V7PA 2YYAA 1DAPA 1YCDA 3PI6A 3S8YA 1ZLYA 3DTTA 4QPJC 4EA8A 1P39A 2H7VA 3T94A 1CZNA 2X8WA 3L84A 4DHEA 5FCDA 2FWMX 4F5EA 4GM0A 2H1WA 2VF8A 3DGEC 1F2UA 2B8JA 2VYFA 4OD0A 2G1PA 3RIMA 4PBTA 3NKVA 3KQLA 4HSGA 1H42A 1KFEB 2FG6C 4NX2A 5CDSA 1ZU4A 3IKJA 4HR7A 4DDMA 1PVDA 1E63A 2IDJA 3EHDA 1XELA 2JBAB 5D7NA 4KAAA 3O1IC 5LP6B 2C9ZA 3B3FA 1MXHA 2FZ4A 1U28C 3M0EA 5J2TA 1E2BA 1A9OA 1DAIA 1YS6A 4HH1A 3GVXA 3ZKWA 1WIWA 2NUBA 4YRMA 4RC9A 5CVVA 3Q2IA 5BV8A 2OOKA 2DHEA 4K9SA 4HDCA 4CCAA 4EP1A 3ED5A 4K7JA 5CT9A 4UUQA 2OV1A 4H7HA 5J2UA 1ZEJA 2QLMA 5BNWA 4I9FA 3PTAA 1P60A 2SBTA 1VIMA 1YGPA 2WA1A 3GEGA 3KAQA 1QF9A 4LYYA 1XVIA 1Z0ZA 2NO6A 5EHZA 5FI5A 1ZK3A 2XMDA 4PBSA 3TBKA 4RKQA 2FW7A 4JLBA 1ZD9A 1H0HA 2BJVA 4BLVA 1MTZA 1PNTA 1M1YA 2WIFA 5IVIA 4P84A 1UJ6A 2OOSA 1MB9A 5E3JA 1UZUA 4X1IA 5ALYA 5H8WA 4YRDA 3LLUA 3MSXA 4QOHA 4KU4A 4KXVA 3RLIA 4WUVA 1AZLA 2XXJA 4EO7A 1U0GA 3S8MA 2V4ZA 4K2AA 3KB1A 2GCOA 1MB2A 3DBRB 4PZYA 2IXGA 4NCAA 1X7GA 4ZXPA 2FF5A 4CG1A 1V96A 2RHJA 2XI4A 3BH6A 1M7GA 1GTJ1 1ODJA 2C9CA 4LY3A 1QRSA 3D9QX 4BGIA 3UCEA 1HEUA 1KDOA 2XDAA 1I2DA 1K8QA 1WZEA 2ID9A 2QW1A 3ASUA 2OV2A 3H8WA 1H85A 3T7JA 3M9WA 3U4GA 3IVGA 3B1YA 3STXA 3U7IA 3J80A 5B1SA 2AVNA 2YZKA 3TNDA 3BWYA 3KJQA 2OCAA 2X13A 3A70A 2OEPA 3P32A 1FNMA 1WP4A 3WAKA 3SMVA 3TQIA 5DIFA 1QMPA 2WHRA 3RVMA 2I7DA 1P1BA 1RJ9B 2WWIA 2V7QD 1ZSVA 2KHZA 2O2HA 1U2TA 5A4JA 1QXSA 2QRMA 1EK6A 1W1WA 4NJEA 1J99A 3B6KA 3TLMA 1ODSA 3GR6A 3VPDA 4LF4B 4CQLA 1CF9A 4I14A 2AFIB 2GF9A 3L46A 4FD2A 4MVWA 4PCAA 3IHWA 1RKXA 3A4NA 3QENA 3V1LA 4C20A 1ZRHA 1NASA 1IWOA 3FIUA 4D0SA 4DXHA 2FVYA 4IY1A 1N8TA 2V55B 3UVEA 4NU8X 2XMRA 3WGGA 3QUTA 4EABA 3TRJA 5LJIA 2JB9A 5D6OA 3BBLA 3WYFA 1SBQA 1ZGHA 3ETJA 2Q6IA 4PANA 1Z28A 1ONNA 3IAS6 2ZQZA 4A2CA 4F8YA 3RRNA 1MB3A 4WFIA 3E9NA 1VCOA 3AW8A 1ZK4A 3BILA 5AT1A 4M49A 4JI1B 5H70A 4AO7A 4Q18A 5KBYA 1LDYA 5BN4B 1D5WA 1CULC 3GUCA 4EZIA 4UE6A 1JYEA 1PK8A 3N6VA 1RWNA 1RYHA 2OP0A 4H15A 4L1KA 4OHPA 1MQSA 2Q3JA 1Y8CA 1HR0B 1OFVA 5CT8A 4M1KA 4ZV9A 3AGQA 3IVRA 2E87A 2DC1A 1QKIA 1VXOA 4GRDA 3TEFA 4BKPA 4KQKA 4F5WA 3A9WA 3W1EA 3ODGA 1HDZA 3GRCA 3JYPA 3V9PA 3U3ZA 1Y5RA 3IIJA 2BGWA 2ZYWX 1I5OA 1KYQA 3TDMA 1OFIA 1A8QA 1P44A 4ND1A 5A4KA 1HK7A 2RBKA 1NF3A 2XJ9A 4UEWA 3EXG2 3RABA 1WPXA 4WAUA 1WV0A 4L95C 1UJBA 2DR2A 4O6VA 4XVRA 4B3IA 1D09A 1Z5ZA 4RQUA 3WK8A 1TQ2A 1VTKA 3H3FA 3NJRA 4R83A 1GZ6A 2EWWA 2JGIA 4L5BA 5EHIA 2V4UA 1M0WA 3DO5A 3E18A 1KO1A 2ZPUA 4OQQA 4TRNA 5GV8A 3K2EA 4DZZA 3DEJA 4J49A 3CUWA 4RORA 4HGZA 3DSRA 2CKDA 2N1MA 5C5DA 3KEFA 1QRDA 1WP9A 3KFLA 1GDHA 5LZ8A 4R71A 5IVHA 1E4EA 3HI4A 4W63A 2DVMA 2YY7A 1G18A 2QN1A 3BGOS 4D1YA 2QJFA 4JQZA 4WERA 1XZQA 1CRWG 4CMHA 1DUSA 2GCNA 4JLPA 5JCZA 1XCPA 4OHKA 3A6DA 1LNQA 1GZ5A 5J23A 1RJ9A 1ZL0A 1MGOA 4OMUA 1HZZA 4R1TA 4UJ5A 4L73A 3BXZA 1IEXA 2J4DA 4CTMA 2M2IA 1TADA 1JU3A 1Q7GA 3WKEA 1V71A 1TE2A 4QKQA 1JMKC 1A7UA 3URKA 3F7OA 4NYJR 3AWIA 4FBMA 3SX0A 4BDTA 2W6JA 4I4NA 1MO6A 5CFPA 1GY8A 4ISCA 6LDHA 1DQPA 1UMBA 1YL5A 3MTDA 2ISCA 3OO0A 4FNAA 5DU2A 3MJDA 4NAVA 3WDSA 4UEQA 4MB2A 2DBVO 2LPMA 4CTJA 4IGAA 4DY4A 1PR1A 3EQ6A 3M4ZA 3OZXA 1N2CE 5B7PA 3JVVA 1TNDA 4O5AA 1GLNA 1IMJA 3L6OO 4M0KA 1I1QB 2AUMA 5CDFA 1AUVA 4NENA 5T4HA 3S7TA 2WF8A 1GRRA 2B1QA 4PSCA 4FUTA 1BMFA 4N4AA 4RPIA 3EDYA 4NDZA 1EM8B 2QGFA 1EK5A 1ZPDA 5LU9A 3LTNC 5K0GA 1OAOC 3TO5A 2VHTA 3Q11A 3NGLA 1PJZA 2CHGA 5F98A 3T9BA 1D2HA 4FR2A 4BNLA 4J76A 3ABSB 1Z6AA 1JR6A 2WUEA 3MCTA 2ZUCA 4L3WA 3RVSA 2J3MA 1NG9A 2AMVA 1TQ6A 1WQ4A 3OQ1A 3SZOA 3B2EA 4RTRA 2XVZA 3D6VA 5JSQA 1KKMA 2B78A 4EHAA 3AF4A 1DQSA 1ZI9A 1NUAA 2NNWB 4LE0A 2W6ID 5DGDA 5U4QA 5AW9A 4D4KA 4YS6A 1IBCA 1MVOA 2BJWA 5IJ9A 4XWYA 4ZVLA 1IG3A 2OCIA 4BV8A 3CLUD 2X0NA 3Q9LA 4P53A 3F5QA 1N5RA 2HDWA 1TCCA 4MCHA 2YC2C 5C31A 3ABIA 4HATA 3OX4A 3VJRA 3ZOZA 5EXPA 3WNZA 5BUCA 1C80A 1CZLA 2ZCJA 1GQSA 1PSZA 1PV2A 5KC8A 1DCMA 1X87A 2AZTA 3AK4A 1ZA1A 4LXXA 1Z7GA 4EG4A 3EY4A 2ZT8A 4WZAB 1ZM4A 5EMMA 4X66B 1C3OB 3GJ7A 4UM8B 3O3MB 1A50B 4AO6A 1I7DA 2OB1A 2C61A 3DDHA 1H2YA 2L19A 3NORA 4CQMB 1FMFA 2X6RA 1J21A 4TGLA 1JL3A 1DDIA 1NAHA 2OORC 4N40A 3WGTA 2Q3LA 3AIMA 5DTMA 3RT7A 1WM1A 2R2AA 1BSVA 2PZFA 4R69A 5FBHA 1EXDA 2QRGA 3N2LA 2NYVA 2A1TS 2JARA 2ZT7A 4P4NA 3SXUA 4XIJA 3SF0A 4UCQA 3OCYA 3EGDB 4INAA 4UVGA 1II8B 3DLCA 3KB2A 4O1HA 4K0KB 5KQRA 1BDBA 5EPUA 4X20B 1AGNA 1FFCA 5SYNA 4TKUA 2ZSJA 3V34A 2A4MA 1WXGA 1L5HA 2VPXA 3DMHA 2OHGA 2WM9B 2ZOSA 4HZUA 1V3QE 5SZKB 5G1NA 4MKXA 4RK6A 3E5HA 4O8ZA 5CM8B 5I7OA 4TVKA 5J5VA 2CDBA 2P5UA 4QE3A 2NTNA 3ZDRA 3TIXB 4AJ1A 3CX3A 3PKIA 1EXMA 4CKEA 4B7CA 4L4XA 1Z6TA 3JZAA 3KE8A 1HFJA 2KSQA 5COQA 3Q9UA 2Q21A 4CR6A 3EDRA 4UHCA 3OESA 3UV3A 1A88A 4IJUA 1X70A 3N59A 3KTAB 4KR0A 2VXOA 3FROA 1T8YA 3I12A 3FX2A 1YRYE 2QSUA 4DANA 1C3VA 3OP1A 5JFOA 4DUYB 4KFRA 4CVNA 2NO0A 2FSPA 5DHRA 3AC0A 1G5PA 2G6TA 2H2HA 2WYVA 3DMDA 1N77A 1ECGA 2QVBA 4J9VA 4M8LA 5HMMA 3ZG6A 2BH2A 4E14A 2IOFK 5AVRA 2PX8A 3TQFA 3I8SA 4UPDA 3MQ4A 4QBFA 3DWEX 3V7YA 4EJSB 5ER6A 3S5UA 4Y1RA 1PDWA 1P2GA 1WUTA 2GM9A 3OY7A 4U3JA 5EE5B 5GMOA 4C1BA 3SS7X 4DBLC 4PG4A 1MA0A 3TW0A 1V2GA 5FUMA 3C87A 4PYNA 3INGA 3VX3A 4FK8A 1N2XA 3KRTA 1FF9A 3OC6A 4GMKA 3SHVA 3ICWA 2IEAA 2H59A 3BDIA 1N4DA 8ADHA 2PQMA 4UUMA 5LA6A 1J0XO 2A57A 3VR4A 4CMEC 4B3SB 1RKUA 3D8SA 1WVGA 1T9GS 1Y3BE 3NR2A 3PGA1 2XX3A 3GFFA 5DTEA 4ZAYA 3WR5A 3WLNA 3PIDA 1VC2A 1Q1QA 3A06A 2O8FA 3B82A 3W78A 4OQMA 2QAIA 2CJFA 2PWBA 3AGPA 4KL8S 3GRPA 3O73A 1G5TA 3SZUA 5FKJA 2YQ5A 2OSVA 3INRA 1JIVA 1B0ZA 2J3EA 3E4DA 1N2ZA 4FHFA 1WDWB 2Z5VA 2WFAA 2OCKA 4X1OA 5DNVA 2JNWA 1RU3A 2JVKA 4IDCA 4TWIA 4NCIA 4PV7A 2AKEA 2IYUA 3AJAA 3SYRA 1KH3A 4LQDA 2FXIA 3E9RA 1F2DA 2P5YA 3IP7A 2H7YA 4XFKA 5K3BA 5KAMA 4DMCA 4TZKA 3AV3A 3AR9A 2OGSA 4JJ4A 3UENA 2P68A 4OO3A 2ZSKA 5K6TA 3P94A 1CQZA 3M4YA 3ANTA 3G02A 3PX3A 4B6JA 3OOHA 1L7XA 1J0BA 2WUFA 3ZWXA 1BQEA 1OTHA 3ZI7A 3DF9A 1GKUB 1RXYA 2Z09A 4OQEA 1I80A 5G2OA 1R9NA 3D4LA 4AVYA 3VC7A 2ZULA 1U6IA 3ZY6A 1YJXA 5KOHA 1CJBA 3JRWA 1N2OA 5DWVA 5HXAA 3W5HA 4IGFA 1UFVA 3MMPA 2IF0A 1SBNE 3OEED 2PX2A 2BCEA 1N8NA 3IXMA 1YVDA 2WTAA 3UJDA 3W2HA 4FJ1A 3R5TA 1ND6A 1LJUA 5C1BA 2PX3A 3DEYX 2VH5R 2WYOA 3C2QA 1XCOA 2HA5A 3QHQA 1KY2A 3SF8A 2BHNA 4L2IB 4OHFA 2JDID 3GF4A 4US1R 5GY7A 4MK4A 3LHFA 3GCWA 4ADSG 1J8DA 2RBEA 3VI4B 1NN3A 2Q2WA 3R6DA 5JU6A 5LB2A 3F49S 3NBMA 3EFOA 5JNWA 1OZHA 3R0VA 4RIEA 5P21A 4LNUB 3P52A 4K6HA 1OTYA 1Y8QB 2JBWA 3M4XA 1W5BA 3RTBA 5CNMA 4HPJB 1KO7A 1Y1QA 3LUBA 4A0SA 5JXGA 3AP1A 4XQGA 5J5CA 4AMGA 2LDBA 3ICOA 4IW3B 5LXTF 2O5VA 4YUYA 1AKYA 1ETHA 2O2IA 4S05A 3VR4D 1KRXA 5JAUA 4LSWA 1DXOA 3QJGA 3A04A 3FAZA 4XLZA 5ILGA 5BN5B 4DQDA 2DBQA 3Q5GA 3FCOA 4QAJA 1VMKA 3T5BA 1T43A 3O8LA 4V39A 5H16A 3IAAA 2J31A 3O8BA 2G72A 1IBKB 4GNKA 3MRTA 3SFZA 1XZCA 3G82C 2XIQA 1KEEB 3HWSA 2NV2B 4OQDA 4BNMA 4TLCA 4D0NA 3CJTA 5BVHA 4IJKA 4CM1A 2H29A 2DWPA 4XYGA 2X1LA 4X7BA 4TRJA 1FVXA 3PEUA 4RDIA 3CPEA 3TEJA 4B2LA 1PEDA 3B13B 3WV4A 5JJLA 1E98A 1I3MA 3THSA 1AK1A 3I9MA 2VXYA 1OPRA 1CUUA 3BD7A 4M55A 3GFQA 3TD9A 3DDOA 4MYHA 2DTEA 1M76A 4BASA 4LWPA 1FYDA 4D6YA 1G60A 2EHDA 3ZDBA 4AO8A 1CYDA 2J5QA 4X1KB 5LZ4A 4JV5B 2O8NA 4G6ZA 1M8KA 2ZJ6A 3QEMB 4KK3A 5IAEA 4G1MB 3KHSA 3PJEA 1EX9A 2AL7A 2GO7A 4HLUA 1G63A 3NBFA 3KD3A 4DUPA 3OT5A 1I4WA 5BPFA 3PFIA 1QDUA 4MMZB 1GQ2A 1NA5A 5BNIA 3UWMA 3GA7A 2R97A 3OQOA 2G4VA 2GS9A 5FEMA 3L07A 4HDNB 2DUNA 4GSKA 2QMUA 2F55A 5C35A 2ABWA 2RGNC 1N2EA 3COYA 3HJRA 3RAEC 1M74A 5FUXA 4E1VA 4BO6A 1CYEA 4PYJA 4FFRA 1KVUA 1U65A 4IEFB 4DCJA 2ANCA 3WNQA 1D2GA 4CL0A 1RPNA 1GG5A 4YAIA 1N0HA 1AGPA 10MHA 2M1ZA 5KNCD 5TX7A 2ZB2A 1K86A 1ULHA 5I9MA 1JW9B 4B48A 3B1JA 1GKLA 1VLVA 1WSWA 2A35A 4C0AC 1ACMA 3DNFA 1I1NA 1NC3A 1KI6B 2GBFA 1YCFA 2A0KA 2ZSIA 1KHTA 5B2EA 1XT6A 4CQNA 2YYYA 4NZPA 2NGRA 3IV6A 4H60A 5KNDD 3QE0A 1Z56C 4YK7A 1P9WA 5HHTA 5TS3A 1QG2A 2C59A 1AURA 3HJFA 3ESBA 3GJ3A 4MRRA 2VJYA 4ISBA 4B4KA 3MOGA 5DBEX 1RAIA 5J2TF 1V3VA 1RMYA 1GA6A 4BU0A 2QMYA 1D9ZA 1Z4QA 3H9JA 3TOSA 2D7JA 5EERA 4MV9A 3TD2A 1NUPA 2CXNA 5KU7A 4ZVUA 2WMYA 2GTIA 1JR3A 2C78A 4V0SA 4JELA 5DPMA 3ZN2A 3NATA 3OTHA 1PRYA 4MQEA 4TYQA 2QT1A 4MRVA 3N8DA 1O1YA 3ZQKA 3WLTA 5LQUA 2G80A 5GP1A 1S2LA 1C41A 1QO0A 4OU5A 3BYZA 4Q4AA 2O48X 2IYLD 5DM0A 4ZU6X 1BZYA 2IKQA 4GOMD 5FPYA 2V58A 1RHJA 3EXEA 4LVCA 2FK7A 5BO5A 4EZBA 1GGNA 3AIKA 4OX9Y 1BRTA 2EKBA 1EFUA 5IAOA 4D9IA 1IONA 3ZQJA 1NXSA 3JQAB 2XYVA 4MVJP 3GG9A 1PEAA 1C2YA 1OGIA 3KG2A 1AM4D 2PX5A 3KJGA 4M9QA 4ZU1X 2A88A 1LNZA 2FRXA 1T3GA 1YQ9A 5FP0A 4DZRA 3E15A 3JY6A 2ACVA 3PRYA 2CV0A 1WZUA 3VR6H 3NBZC 3DZDA 3FCSB 3HHEA 4QEDA 4LRWA 4JYBA 4CQMA 5AW4A 4OBEA 5KVQA 2OQVA 4KWTA 1AUPA 2VZ0A 3T5TA 2C92A 4KYUA 3IMEA 1MEEA 2PLAA 2HW8A 1WXIA 2PRZA 2QORA 3K5WA 4LJ4A 3L7KA 4IRMA 2PFKA 3JALA 4IVPA 4M0CA 1JSZA 1E3EA 2AF4C 3EZYA 1Y6ZA 3Q3HA 2PMEA 2XOKD 2GM5A 2FZGA 4OQPA 5FBLB 1J1ZA 4I9UA 4X62B 3OE7A 4CF7A 1EUQA 1DC3A 4YGXB 3DL7A 5KJEA 1OYYA 4AFNA 4BQSA 3MWKA 5JMOA 4LBYA 4O5OA 4CM4B 4J6FA 3HZHA 4B3RB 3K05A 2FW8A 1WHTA 3JYOA 1VP3A 1P75A 2R5NA 1R27A 3C3EA 5IJ9B 1R0LA 1G38A 4ZI3A 1H8ED 3G49A 5A5VA 4LUCA 3I5YA 1C9YA 1YL7A 2XQKA 5DI9A 3L4KA 4CMCA 1USIA 4M0LA 4NJOA 2ZUFA 2QAGC 4HDRB 4RH3A 1ZH0A 2NO9A 4Z3DA 5HTOA 1YI0A 1E6LA 2ECKA 2WD7A 2WD7B 1SC4A 3LUGA 3QOWA 3O26A 3ULKA 1U3TA 1WPRA 4CMIA 1FDVA 4BO7A 4M87A 3LO8A 3GX1A 1Y81A 1E9RA 4J2OA 1VBFA 2GZ1A 3KKOA 3OM8A 2J8ZA 3UM9A 3ZWYA 5BSKA 1E9EA 2ZI6A 5H4GA 4G67A 4OFXA 4ENUA 1XLVA 3JQRA 2GASA 4RZQA 1KA9H 2PU5A 3BEDA 4KOAA 4YMSA 1TF7A 1ADBA 3GLQA 4OI2A 3RVRA 3ZKAA 4JR0A 1ZD5A 2INGX 1M5UA 2P0AA 3CG0A 4YC7A 4Z4HA 2YCLA 3H5IA 4YQYA 5T67A 4URUR 5CFNA 1XTQA 3C5CA 2I99A 4O4IA 5FNVF 1II0A 3H4MA 1PT7A 1NULA 4AX8A 1W7AA 1LBTA 2GI4A 3Q7QA 3D5EA 3UHAA 3TQOA 1HG0A 4X7PA 3ZKWB 2GXSA 4YT5A 4II7A 3S29A 1DKRA 2EIXA 3N74A 5BURA 1KYIA 4CHTA 1GNRA 4A0RA 4QGSA 3EVBA 4BX0A 3EH2A 1TW2A 4FM9A 1W9HA 4PPNA 1G5RA 4CLHA 4YBRA 1WCYA 2P5SA 2Z4TA 3Q3GE 4TYMA 3VUFA 5DCLA 5EZ5A 5L3QB 2ZIXB 1QIGA 1QQBA 1HDGO 2A67A </