1M33A

Crystal structure of bioh at 1.7 a
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
256
structure length
255
Chain Sequence
b'NIWWQTKGQGNVHLVLLHGWGLNAEVWRCIDEELSSHFTLHLVDLPGFGRSRGFGALSLADMAEAVLQQAPDKAIWLGWSLGGLVASQIALTHPERVRALVTVASSPCFSARDEWPGIKPDVLAGFQQQLSDDQQRTVERFLALQTMGTETARQDARALKKTVLALPMPEVDVLNGGLEILKTVDLRQPLQNVSMPFLRLYGYLDGLVPRKVVPLDKLWPHSESYIFAKAAHAPFISHPAEFCHLLVALKQRVGS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BioH protein
molecule tags Structural genomics, unknown function
source organism Escherichia coli
publication title Integrating structure, bioinformatics, and enzymology to discover function: BioH, a new carboxylesterase from Escherichia coli.
pubmed doi rcsb
total genus 85
structure length 255
sequence length 256
ec nomenclature ec 3.1.1.85: Pimeloyl-[acyl-carrier protein] methyl ester esterase.
pdb deposition date 2002-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1m33A00
3W05A 3D59A 2VATA 5AKXA 4B80A 4AX4A 1QLWA 1HDEA 2ACEA 2PM8A 1QOZA 3I28A 4NS4A 2QTBA 3O9VA 3WK6A 3IUMA 1UKCA 3I2HA 4WCVA 1QTRA 4BB0A 4UBJA 1YA8A 2OGZA 5CT4A 3C6XA 4BZZA 1FFCA 1E5TA 3VVLA 4B0PA 1T4MA 2AXEA 4Y9SA 2Y6UA 3WL5A 4X3CA 4H7EA 3ZLTA 2XUAA 4UHBA 5FKJA 4UBMA 1E89A 5A6VA 4B85A 1DTEA 3K2IA 2QOEA 1Q0RA 3WIBA 4DMFA 4CIBA 4PSDA 1XRPA 3HZOA 4X85A 4BAGA 2WKWA 3BJRA 1K5PA 4YPVA 1ACLA 5C7YA 2XLBA 1J07A 1DWPA 3G9UA 4M0FA 1YAJA 3A6ZA 3QBJA 2BGRA 5D6OA 4BE4A 1FFBA 3WK4A 4UFPA 5ISMA 1THTA 5DNWA 4QWWA 5ALNA 4Y7DA 1FFEA 2XMBA 5AI6A 2XT0A 4RE5A 3AIKA 5IH7A 3OOSA 4GWLA 2OG1A 4GDMA 4B82A 1FSSA 4IQ4A 3H1AA 1B6GA 3AZQA 4BC0A 1AQLA 1CQZA 4QA9A 1G66A 4QDZA 5KREA 1LPAB 1N5RA 2VAVA 3G0CA 3JW8A 1W52X 3Q8WA 3R40A 1UXOA 4AXBA 4UHCA 4A23A 5J3JA 1YASA 4K6KA 2Q0XA 3E4DA 4HRYA 3R3ZA 5LZ7A 1ZD3A 3BJMA 1EDEA 1GQSA 3QPCA 4K5QA 4EB0A 5IVDA 1WB4A 3O4HA 3EQ8A 1CUCA 1XFDA 1GGVA 2DQYA 1C7IA 3STVA 2ZYSA 4B83A 4FWBA 3ICVA 3WKBA 2WHPB 3D2AA 5IVKA 5AIBA 2WG0A 5ALUA 3HXKA 1JU4A 3STTA 1L7QA 2H7XA 2QM0A 3STYA 3QPAA 4Q34A 3BXPA 3R41A 2WJ6A 4Y2JA 5AOCA 1CUJA 2WHQA 1IVYA 5HF5A 4BBZA 4MQMA 1MPXA 4DSZA 2B20A 1SFRA 3I2IA 3GZJA 1XLWA 4J0IA 3V1KA 3I6MA 4CCYB 1ZICA 1GQRA 2K2QB 1P0MA 2DFPA 3DQZA 3QVMA 2QXTA 1BEEA 3G0DA 4BVLA 3H18A 2O2GA 2ZYRA 3FYUA 1H23A 1QIMA 1N1MA 4NMWA 2V96A 2ZJ6A 5JZSA 4J0JA 4HXFB 4N8DA 1BCSA 1YSCA 1THGA 3STUA 2WUFA 3W04A 1J2EA 2WFLA 1QIGA 2XUDA 4DNOA 4BYMA 3VVMA 5DTIA 3V48A 5FRDA 5DTJA 4MWSA 1J1IA 1E8MA 2WHRA 2JGIA 2JIDA 2ROQA 5A62A 3M82A 1I6WA 1IZ8A 1DT5A 3TGLA 3OM8A 1HBJA 4UBNA 5C81A 4H7KA 2JGMA 1DINA 1EHYA 3ESDA 1D07A 4MXDA 1SCKA 4F60A 5KWIA 3DCNA 3FCXA 1BN7A 2GZRA 5ALGA 1BN6A 3KWFA 3C6ZA 5CXUA 5ALQA 4GBGA 4FMPA 3UUEA 2WFMA 2ZJ7A 2DQZA 2JGFA 2RI6A 4KAFA 4C6HA 5BWCA 1CUUA 2HFJA 5AM3A 1ZD4A 2HFKA 2HIHA 2WLSA 5AKKA 4DNFA 1IMJA 1OILA 4PSCA 3IURA 4FDMA 1QE3A 1GPLA 1QGED 2PSEA 5BWBA 4Y2YA 1VE6A 2CZQA 4AMZA 5E4TA 5D7BA 5AH0A 4IH1A 5HF8A 3H2GA 4ZREA 3X3HA 4M0EA 1UZAA 4LIPD 3PFCA 1XRRA 4JH0A 4Y2UA 1JMKC 5FLKA 4J0KA 5CT5A 4L72A 2HA4A 4EY5A 4KACA 5EFZA 1TIBA 1HKHA 2PL5A 2R11A 5JARA 1BROA 5JANA 4J0DA 5ALWA 2G5PA 3A70A 1QO9A 2HU5A 2WUGA 2BUCA 4H77A 1XZFA 1CPYA 3G7NA 3NUZA 1QTIA 4TPKA 2IX9A 1LBSA 3I6ZA 3BE8A 3OG9A 3GELA 3BL8A 3FLBA 2XUJA 4HAIA 3HJUA 4X97A 4A5SA 1A88A 2GBIA 3O4JA 4OU4A 3F96A 4UHFA 3HACA 1YCDA 1XZJA 5ALJA 4U2FA 1MNQA 1G5FA 1JT2A 1QFMA 2PX6A 3ZPXA 2VJCA 1DX4A 2WG1A 1XZEA 4OU5A 5HFNA 1U65A 1GKKA 2CKMA 1IUNA 4C87A 4XWGA 5EIEA 4C89A 3LCRA 4UBKA 1BEZA 4E15A 4UBLA 4C4XA 5DJ5A 2B61A 1E3QA 3GA7A 3G0IA 3IUJA 3O0DA 4QDOA 3CN9A 1EB9A 4Y2SA 1XZMA 4GXNA 2V9ZA 2VJDA 5AP9A 5I7UA 3VXKA 5K3AA 2QUBA 2CUTA 2ZVDA 4PQEA 4B6GA 3BWXA 4DTCA 3RARA 4Y2QA 4IHAA 3HYSA 3O4IA 2HA5A 2XMDA 1CEXA 4HXGA 2ACKA 4E46A 3M3DA 2XUIA 3ANTA 1ZI8A 1TQHA 4MJ3A 5FXMA 5ALXA 2WIDA 4ZV9A 4E14A 5A7FA 2AJBA 1E8DA 1O6GA 1S8OA 2BUBA 3H19A 4BDSA 3PDCA 1XZLA 4U2EA 4QEKA 1VA5A 2YASA 5E4JA 4G8CA 3PICA 4OB7A 2OGTA 4BCCA 2C4HA 2FJ0A 1A7UA 5H3HA 2I3ZA 3STXA 1EK1A 3AZPA 3OC0A 1NU6A 4KYVA 3FYUB 1GPKA 1XLVA 2XUGA 4EY7A 1EVQA 3VKFA 3WLAA 3ZLVA 4QDTA 4CG1A 5EHXA 3AJAA 1XRMA 1W75A 4EY8A 2OPHA 4G5XA 1C4XA 3FNBA 3BF8A 4W1RA 1GKLA 5AKIA 5LZ4A 3F8SA 4CCYA 4N5IX 4DIUA 4EBBA 5CURA 3T52A 3ESBA 4LXHA 2O2HA 3RKSA 3UUFA 4AO8A 1H2ZA 1YB7A 1MAHA 4DNPA 2QVBA 1FJ2A 1UOPA 3PUHA 1EDBA 1EA5A 1AUOA 1CFJA 1F0PA 1MX5A 3FSGD 4H35A 1CUHA 3HABA 1KEZA 3AFIA 5A7HA 1A8UA 5AI4A 4J03A 4AB1A 2CEKA 2WHPA 1EXWA 4BC1A 4HXEB 2IIVA 1DU4A 3DOHA 3E1GA 4BVKA 4B9EA 2PKYX 1LNSA 4FFWA 1WM1A 5ALPA 3C6YA 3WYNA 4AQDA 4EY6A 3CCCA 4H0CA 1VE7A 1EI9A 1XZAA 1OCEA 1J06A 3FOBA 4B9AA 2PVSA 4CG3A 4UUQA 2DCMA 1SC9A 2VJAA 3PUIA 1UT6A 3WL8A 2ZYHA 3YASA 3WJ2A 3DD5A 4KAJA 5DNUA 1GXSA 4KE9A 2H1IA 3G9ZA 4G1FA 4CG2A 2D5LA 4QLAA 2P8SA 5FOQA 3IULA 2XUKA 3C87A 3ICWA 1Y7IA 4MWTA 4OSEA 2Y2VA 2GYWA 3FVRA 1CUDA 4XIIA 1UOQA 3MUNA 2G63A 2GBCA 1QIJA 5EIHA 4X94A 2I78A 1EK2A 3K6KA 3I1YA 4FLEA 4OYLA 3DKKA 3HC7A 5AM2A 4NZZA 1TRHA 4KE7A 5SYMA 5ALZA 3WYDA 1CUSA 5IVHA 3FAKA 2PSJA 3G8YA 3H17A 2WU3A 2PSHA 5BOVA 1MN6A 1QIEA 4FFVA 1P0PA 4Q3KA 4BP9A 1PV1A 3WMRA 4L0CA 1NX9A 2JGKA 4BP8A 1IUPA 5I8PA 1EVEA 2HADA 2JGJA 4BAUA 4B81A 5BV7A 4DMCA 2VSQA 3LLCA 4OPMA 1TK3A 1NU8A 4UBOA 2BUAA 3EQ9A 1WPRA 1MU0A 3Q0TA 4KAAA 5FV4A 5AKLA 2O7VA 2OCIA 3WWDA 1HQDA 4AN1A 1LZKA 5JZ9A 1WHTA 1UKAA 3QZUA 4AO6A 5DYYA 1QONA 5ALOA 2ECFA 2Y2UA 2FUKA 3KDAA 3DLTA 1PFQA 4FTWA 3I2GA 4YASA 3BIWA 1TKRA 2Z3WA 1UK7A 4W1PA 1QZ3A 4Y2TA 1XQVA 3R0VA 3D2CA 2RHWA 3WWOA 1ZIYA 3C5WP 2XDWA 1XQXA 1Q83A 2QZPA 2ONCA 4ARAA 2J4CA 2J3QA 4P9NA 1CUIA 4FBMA 3MGAA 2HRRA 5LKAA 5A2GA 4BRSA 4G4GA 4H7JA 4EA6A 3H1BA 1IUOA 5ALTA 3IB3A 1DQYA 1N8SA 3BF7A 2B9VA 1XRLA 3QYJA 2OGSA 4DYHA 3DNMA 1QIHA 5JAHA 5HFAA 4ARBA 2WJ3A 2GBFA 1QIDA 5CH8A 1QIIA 3AINA 5ALLA 1WHSA 4LXIA 4Q05A 4XVCA 4DMKA 5LLSA 1MNAA 2HA3A 2XMQA 4OD0A 5AI9A 4ZWNA 3DS8A 2JGEA 5AIAA 2AJCA 2Z5GA 5E4YA 4GW3A 1ZOIA 4ZV7A 1G4HA 1UOOA 3AUKA 3NWOA 3L1IA 2WM2A 4WJLA 4UPDA 4CIAA 1U8EA 5YASA 4X6XA 2W22A 3H2KA 1CUAA 1EX9A 5CT9A 1WCYA 2X76A 2NW6A 1R9NA 4PF1A 4RGYA 3C5VA 4XJVA 3DOIA 7YASA 2XB6A 1ACJA 5LYYA 2WSLA 2H9YA 1KU0A 4UHEA 3F9CA 5K3FA 4QLOA 2XQGA 2HRQA 5FP0A 1UKBA 5CW2A 4J0HA 1YS2X 3KXPA 2XQFA 5D3KA 3DDUA 3KWJA 2V98A 1QIFA 1EINA 3PF8A 4BATA 3WK5A 5AK3A 4U2DA 3WWCA 6YASA 1LPMA 4Q82A 2XMSA 1JJBA 4EZIA 3I2FA 3SX4A 4BTLA 1MAAA 3F67A 5AI5A 1DT3A 2UZ0A 1YS1X 3FVTA 1ODCA 4AZ3A 4BDTA 5JALA 2PBLA 2R8BA 1F0NA 1H2WA 2QKYA 5K5EA 4B84A 1XRQA 3CXUA 3RLIA 5JADA 4O08A 3WA6A 2PSDA 3PE6A 5T4EA 4I19A 2B4KA 3H0CA 3FLAA 3V1LA 3IUQA 1JKMA 2G5TA 2HA0A 4WY8A 1UK8A 3BDVA 3TEJA 4QNNA 4QDUA 5EIAA 4AN0A 5C8ZA 5ALYA 1AZWA 1QIKA 5AK5A 1CVLA 2OAGA 5AOAA 1EH5A 1GZ7A 1F6WA 2CJPA 5AM0A 1TCAA 2JF0A 3DJYA 1BS9A 3GROA 3L1HA 2JBWA 3F98A 1K6EA 3AIOA 4QZVA 1XZBA 1U2EA 5K3CA 1JI3A 1EDDA 2VT6A 5JD6A 4W9RA 4H7IA 1L7AA 2OQVA 3E0XA 3A2MA 4WFKA 5DLPA 4X93A 4X71A 2DHEA 4DM7A 2YYSA 2XMRA 4DNQA 1TAHA 4WDRA 3FSGA 3S8YA 1YR2A 4L9AA 3LS2A 1EB8A 3G0GA 1DX6A 2D0DA 3CCBA 4NVRA 1LPPA 4LKOA 2QUAA 4P08A 5DYTA 5CT6A 3LP5A 1VZ2A 2HHAA 4V2IA 3DEAA 3RK4A 4INZA 2WTMA 4BE9A 3V9AA 5K3EA 3QITA 4LYDA 3GBSA 4W1QA 1DWQA 4IH4A 1H2XA 5KBYA 1XQWA 4RNCA 1ZI9A 1ZJ4A 3F97A 1BU8A 5AI0A 3G02A 1A8QA 1X2EA 5ALDA 3D7RA 2Z3ZA 5E2IA 1H22A 1K4YA 1BE0A 2DHCA 3NGMA 3G0BA 1R3DA 3WK8A 5ALFA 1LBTA 1Y7HA 1M33A 2QRUA 1R50A 2OAEA 4ETWA 4FNMA 2YXPX 4QDXA 5ALIA 4YX9A 1XKLA 2PSFA 2OLEA 5ALMA 2VAXA 2XMGA 4E11A 3KD2A 5LZ9A 1Y37A 2C58A 1Q84A 4RE6A 2V97A 3DL7A 4G9EA 5AM4A 2QS9A 3ILSA 1AURA 3SC2A 5LIPA 5F4ZA 5K3DA 4KE6A 5ALVA 3EF3A 4RPCA 5T4FA 3E3AA 4J3JA 3BDIA 5T4BA 3ESCA 4BZWA 2Z8ZA 3VJLA 3IVMA 3WL7A 3QMMA 2C5FA 4H18A 4FLMA 2WIFA 3QM1A 5AOBA 1XZGA 1MJ5A 5ESRA 1WOMA 3FWHA 2H7CA 2VEOA 4GLBA 5HQ3A 3C8DA 2C0QA 1MT3A 1QO7A 3WKEA 4ZGBA 4Q1VA 4OB6A 1ETHA 3WI7A 5C8XA 3DYIA 2VQ6A 4Y2RA 4G4JA 4JEIA 3O4GA 4JYMA 4OCZA 3R3XA 4BCBA 5CH5A 3HLKA 3QPDA 2HL6A 2I3DA 3ZI7A 4C88A 2VJBA 3C45A 4QWMA 4I3FA 5EHNA 1BRTA 1SCQA 1CV2A 3WJ1A 2WIJA 2IITA 2EDCA 3I2JA 1AMNA 1ISPA 4MQLA 4WFIA 2I03A 2LIPA 5EHZA 2O7RA 3WK7A 4MYDA 5KWJA 1AC5A 1RWQA 5AKEA 3QMVA 2VA9A 1XROA 1LLFA 2GBGA 3W2TA 2WFLB 3U1TA 2HA6A 3W9UA 4X6YA 1AKNA 5CT8A 4FKBA 3WKCA 3W06A 1USWA 3R3YA 2PUHA 2HDWA 1HLGA 1CUGA 3HEAA 5ALKA 3M83A 2DR0A 3T4UA 5T4HA 3PI6A 4Y2XA 2O2IA 4ITVA 5AKHA 5C8VA 2C0PA 3D3NA 2ES4A 2HU8A 3QH4A 1JMYA 4EHBA 4U2CA 2VTVA 1CUEA 3OURA 2JEZA 4A16A 1VOTA 2DHDA 4GHWA 3JWEA 3OTQA 1L7RA 5I9IA 4J7AA 1YAHA 1JJIA 3A2NA 2WFZA 2AJLI 5AKYA 4S0XA 4ZRDA 4IO0A 5FDFA 5ALEA 5CRIA 1F8UA 1LPBB 1ZGCA 2ZJFA 4Z49A 1ODTC 1VJ5A 4OUKX 5JATA 4U2GA 5CH3A 1XKTA 4ROTA 2OCKA 1G42A 1VXOA 1ZI6A 3WWPA 2OCLA 1W6RA 3O9MA 5AHXA 5DNVA 1FFAA 2CMFA 5ALSA 4G8DA 2BCEA 1CUYA 2XI4A 3FBWA 5AK4A 3VISA 5AM5A 4HZGA 3H2JA 4K6GA 2WTNA 2VT7A 3UMJA 1O6FA 3WQHA 1VXRA 2H7YA 1CQWA 3H2IA 5D3ZA 3LIPA 3ZWQA 1DWOA 1CUBA 3FYTA 3AIMA 1SCIA 3WL6A 5SYNA 5DYWA 3D2BA 4AO7A 3GUUA 3DKRA 1CUFA 5AO9A 4M0MA 3FCYA 4EUSA 3IIIA 5IVIA 2QR5A 2BKLA 1LPOA 4H7HA 4DLNA 2GYUA 4PNZA 5FPPA 3WZMA 4B7ZA 4GI1A 1R1DA 3IA2A 1R88A 4KJXA 3L1JA 5HF6A 3B5EA 4KR0A 3C6BA 2XMCA 4BVJA 4LHEA 1XLUA 1QJ4A 5LZ5A 2GYVA 1LZLA 1CRLA 4BAZA 3DL4A 3SK0A 5JASA 2C7BA 3KSRA 2BAGA 1RYYA 1ODSA 4IH9A 3O95A 3HRHA 3G9XA 4H7DA 4BCDA 5JD4A 1WPXA 2CB9A 5HKBA 5AK6A 4P92A 3STWA 1CUXA 4DSAA 5A71A 4BRZA 2RAUA 2Y1KA 1XZKA 2WIKA 1WB5A 1LPNA 3K9BA 2X5XA 5EHQA 4CCWA 2PU5A 2QT9A 3MVEA 3N0TA 4H7FA 1XZCA 2XUFA 4JUIA 3M81A 3JYHA 1XQYA 3IUNA 1R4ZA 1W4LA 2QMQA 1OXMA 4Y2PA 4L3WA 4I4CA 4X91A 2HA7A 1VZ3A 2HU7A 1HPLA 3D5EA 3VJMA 5JZBA 1BCRA 3H2HA 2ORYA 1PJAA 3WK9A 4UFNA 4P93A 1N5MA 3QMWA 4C01A 5AM1A 5EGNA 3AILA 3I2KA 1XZHA 4W1SA 1CUVA 2FX5A 1FFDA 3CN7A 1W76A 4HS9A 1ORWA 2XUHA 4CFSA 2XQJA 2BFNA 1ZIXA 4WDQA 1ZGBA 1VLQA 4FLFA 2PPLA 3B3QA 1P0IA 1XRNA 3WZLA 4OYYA 2GZSA 3ESAA 4DMHA 1E66A 5EI5A 3TRDA 3RM3A 1AX9A 5K3BA 5JYCA 4UFOA 4FNGA 4B0OA 2OQIA 2CBGA 1MX1A 1JFRA 4MEBA 4G9GA 4PW0A 2XMZA 4N8EA 4GEGA 2DSNA 1WB6A 1AGYA 3EBLA 1P0QA 2HM7A 4Q3OA 3R3WA 5JAPA 1A8SA 4N8SA 1SOMA 2WQZA 3PFBA 1RP1A 2RONA 1X70A 3V1NA 3WIOA 4W63A 1TCCA 4KE8A 4AZ0A 2WUDA 4WY5A 5JAOA 5LZ8A 3IBTA 4YK7A 2OCGA 2HA2A 5A7GA 3P2MA 3WKDA 1DQZA 1ZD2P 5HKAA 3ZV7A 4F21A 3WWEA 3C70A 3I1IA 4MEAA 4X90A 3B12A 4HRXA 3D0KA 3C8HA 1VKHA 1CUWA 2XUOA 4WFJA 4C4YA 2BJHA 1K8QA 4K6HA 2JGLA 2FJPA 3H04A 4MYSA 1ORVA 4EY4A 2WJ4A 5AKJA 2E3JA 4FOLA 2C5GA 1CUZA 5JIBA 1LGYA 3PF9A 1C7JA 1ZD5A 2WILA 4JNCA 1XZIA 3EIOA 2PU7A 3WKAA 4UHHA 2XE4A 4J0CA 3HSSA 3NOXA 4UBIA 3D4LA 5HQ3B 4G8BA 1CLEA 1W1IA 1QFSA 4ZXFA 1UK9A 5CMLA 1JU3A 3A2LA 4BTVA 3VDXA 4FHZA 2VF2A 2AJ8A 2ZYIA 2XQKA 3VJKA 2J3DA 4G4IA 4GECA 5AJHA 1HL7A 2RIPA 5HK8A 4HTAA 3C43A 1H2YA 1X2BA 2PUJA 2RGUA 2XQIA 2ZSHA 4KEAA 4OB8A 5JD5A 4LYEA 4PSUA 2QXUA 4KRXA 3WA7A 3IDAA 4X95A 2QJWA 1Z68A 5LP1A 4X00A 5DWDA 3S2ZA 5ALRA 2Y6VA 5CTAA 4LXGA 4HVTA 5HZGA 2Z8XA 1ZJ5A 5JAUA 2EDAA 2WG2A 4KRYA 4FBLA 4PO3X 1UFOA 1YA4A 3R3VA 2W6CX 2AJDA 2EEPA 4Q3LA 1UWCA 3BIXA 3I6YA 3G9TA 4J0GA 5HK9A 5K3FB 1CR6A 1E8NA 4K2AA 4QE3A 4Y2VA 2G4LA 1B41A 4TGLA 1T2NA 5IKXA 2WUEA 1JJFA 1TCBA 3ZLUA 2RHTA 5FUMA 5AICA 1CIJA 5FPQA 1LPSA 2JEYA 4N5HX 1VA4A 3LIIA 5LZ2A 5ALHA 3MUOA 3V1MA 2J4FA 3FYUC 3TJMA 2WU4A 4XX1A 4ZI5A 2YH2A 3ED1A 4D9JA 1UK6A 3KOOA 1GT6A 4C4ZA 4X7BA 2QJRA 4PV7A 3DYVA 2OXEA 1XZDA 1YB6A 1KU6A 3EQ7A 1MO2A 3N2ZB 2XLCA 5CXXA 3OPMA 3SWWA 2WIGA 1K63A 1U4NA 3W9BA 2ZSIA 1R9MA 4JYPA 3U0VA 5HCUA 5CBKA 1MX9A 4F5ZA 5AKZA 1Q0ZA 2BGNA 4UHDA 5LKRA 4DGQA 3HI4A 4U2BA 2XUPA 5AI8A 4X92A 4AMYA 1MTZA 4F0JA 3AZOA 4TVKA 3FLEA 3ANSA 2X8BA 3GFFA 1GPNA 1IZ7A 3R3UA 4X6UA 2XUQA 5HF9A 4CI9A 5AKGA
chains in the Genus database with same CATH superfamily
1RU3A 2XWBF 3QGMA 2VATA 3PUKA 4J9UE 5MFZA 3GGPA 5C32A 2AYXA 4YCAA 2CZGA 3UG7A 1B0PA 2XGSA 2ZIZA 2ZU6A 4XIYA 5LBUA 1QLWA 5G4LA 4YRRA 3THXB 2PM8A 2X40A 3B2QA 3OOEA 1J8YF 1TT7A 2XA9A 1FVXA 4U1RA 1SNYA 1U02A 5CVDA 2HNKA 2XT6A 2I4TA 2OCYC 2CHQA 1LDEA 4BVEA 5EGSA 3V33A 5A3JA 3PGKA 1B6SA 3O9VA 3PDHA 1HQKA 3K09C 4Y0VA 1X7XA 3GUYA 1IN1A 4HUTA 5IN5A 4LRSB 3P52A 4J1TA 3MZ0A 1NMYA 3NBUA 4V1CI 5FTLA 4OY3A 1N7IA 4M9UA 2MSLA 1QB7A 2GJ9A 2ZITA 1GZ5A 4UBJA 1A8HA 1QAQA 3AHEA 1AKYA 2ADFA 2PAFA 2W4QA 4M0PA 2OYSA 2DRIA 3K8YA 3QUCA 1XN4A 4BO6A 4Q4JB 2IP1A 3ZE0B 2Z1NA 3ASYA 3ZG6A 4C76A 4IWXA 1E2EA 3O75A 2AXEA 5J43A 2HWXA 3LW7A 1N6NA 2XNKA 5HM6A 3NHWA 3RBVA 4Y9DA 2DPLA 3T4XA 3EGVA 1IEXA 4D0GA 4GPEA 3COWA 3V7WA 1T36B 2Y1OA 1OLSB 2J0VA 2H4ZA 1WEKA 1F1JA 3M4JA 3GNSA 4LC1A 3DULA 3GLHA 5FWXB 3NORA 1HFJA 4XPIA 4LGCA 1ELOA 4MV5A 2QRHA 3SEAA 5KNBD 4CWAA 1F7UA 4HDKA 4IQGA 4I3HA 3LDHA 1SIUA 1V4VA 3HXLA 4G8JA 5BYBA 1E89A 2XIJA 2G9UA 4PS1A 5AQEA 3KQWA 3WIBA 1VL5A 3N2KA 4DMFA 3I62A 4C7VA 1MB4A 5F1OA 1V4NA 2Q5JA 1MIOB 3ANXA 4Z6KA 4AJPA 4RAOA 4PSDA 3K0CC 3MXOA 4BP1A 3WNCA 4BFWA 2HOQA 3UW1A 1X1RA 2WJVA 4PC6A 3OTHA 1HZZC 1PJ2A 4P84A 4DDWA 3AHJA 4YQFA 3E5NA 1LSOA 4LCJA 2XZTA 2ODNA 1EGVB 3OBBA 3ZNPA 1N77A 2GK3A 4S2UA 3AG5A 1ZISA 3HCNA 4Q3CA 3E61A 4URUR 1P91A 2ZWAA 2J3IA 4HDNA 4CU5A 1U31A 4U39A 1S0UA 2QTGA 3O9ZA 3SMQA 1ULBA 2WE8A 3TN7A 1ACLA 2B34A 2XLBA 4JMPA 1K7XB 5ECDA 3EXG1 2HJ9A 4JT2A 5DHRA 3FMGA 1YB4A 2BCJQ 3FRHA 3IMGA 4L95C 1OH6A 2HW8A 1O0SA 2OBBA 3I5XA 1ODIA 4AKGA 1FFBA 1MIHA 3OM1A 4M54A 4DMRA 2CC2A 5ISMA 4RADA 1B8NA 1KVUA 3HBFA 2BSXA 4KIUA 3SQDA 2WB2A 4WZBE 1DBVO 1NIPA 1U1IA 1XVVA 4F86A 4XR9A 3HDJA 1PV4A 3ICPA 4WWHA 4OL9A 2GZMA 5DNWA 3F0TA 2YFHA 4O2BB 2G9QA 5ALNA 1R6UA 2ZCVA 3RC1A 2X8JA 2IHKA 4JR0A 1RBZA 4IF4A 1GSHA 4W8HA 1R0KA 2I3AA 4FT4A 5E7JA 3BN3A 4Q02A 5J5CA 3A7DA 5LQDA 1FW6A 3BTVA 2NGRA 4KLZA 2AI2A 3QG1A 1A97A 2KS6A 3A4LA 4RDCA 2JS7A 1N2HA 1SVKA 3UN1A 4CW7A 2DZDA 1JR3E 2F3PA 3G8CA 4ZANA 3MS4A 3RUAA 4IQ4A 2H0RA 3AZQA 4QO8A 1OZ0A 5JPDA 3L43A 2Z98A 3MHTA 2ZQYA 1M2NA 1WHSB 3DB1A 1LPAB 1GYRA 1W34A 2CY0A 3HDHA 3R40A 4UU8A 3SR4A 2OC4A 1R64A 4UHCA 1KJ9A 1ZM2A 2ZB8A 3NDRA 4TXMA 4FE3A 5FADA 1NBME 3SQLA 4DIOA 3L0PA 3H1PA 4ZEXA 1M54A 1Q77A 2X8WA 1ZC4A 5J3JA 3E4DA 3OMWA 2I4NA 2DG2A 4S2EA 1N25A 1SQ0A 3L05A 4TXJA 4EELA 2VHCA 4ZOAA 4Q03A 2GZ2A 3K9QO 3BSSA 4L22A 4DBLE 1KYTA 1TK9A 4ZTBA 1GQSA 3FHCB 2GKGA 5DXJA 1I3LA 4QHTA 4UVGA 1GLVA 3QXGA 2D3TA 4H3SA 4K5QA 2YY6A 5IVDA 3IV6A 5C5IA 3U7FB 4D0RA 1EBUA 3O4HA 5D6NA 3NG1A 1PQYA 2WWGA 3DEZA 2YQZA 4JP5A 3RHFA 1CUCA 2V8BA 1XFDA 4LW8A 1EUYA 5TJ9A 2NSYA 3OTWA 4IDAA 2QZJA 1GY8A 2HMYB 1TQ8A 5DI3B 2C8KA 4FI3F 4L5IA 1MZVA 1A50B 3MAGA 1PL0A 3QE3A 1TEXA 3HWX1 3KJFA 4OYHA 1QE5A 1JPVA 1N2EA 4C30A 5KYGA 4L08A 1J7JA 2NQ8A 3UHFA 2OLJA 2ZYSA 3BPSA 3SHTA 3FCSB 4PYKA 2TSYB 3CC8A 3D6AA 3S1SA 2VHQA 4EPXA 1RC0A 1BHSA 4BNYA 3IQIX 3Q88A 3D2AA 4TKLA 3D3KA 1PNQA 2MMCA 2GBPA 3MCZA 2WG0A 4CL3A 5K0CA 1Y9DA 5ALUA 1VGQA 2IDJA 1CJUC 2H0AA 3STTA 2ASVA 1UPAA 3CMCO 3MQFA 4KWEA 2QM0A 3JQFA 2D4HA 4PANA 2IYUA 3L7KA 2Y1XA 1XK6A 2ZI5A 2YRWA 1W5BA 1M6WA 3B9PA 4KW7A 2DBRA 5KS2A 3MWKA 1CF4A 3KSAC 4F4FA 1Y6JA 2PT5A 1JPNA 4Z0PA 1PDWA 2OZPA 3VU3A 2FU5C 1KO1A 1HI9A 4RAQA 3IESA 4LHZA 5K2OA 3TW0A 2CJWB 3JSXA 2V0CA 2OHHA 2OV4A 4YMWA 4TT3D 4K6CA 5DRTA 1FYDA 1SFRA 1II8B 5DTRA 2H2FA 3GLGA 2O3SA 2NO6A 4J2OA 4CM4A 4YYZA 1QZXA 4QEZA 4CCYB 3ABZA 1RYHA 1GQRA 2K2QB 2OSBA 4G63A 1P0MA 2XXJA 5G3YA 1LCIA 1E1YA 5F9MA 1KRXA 4HMOA 3D54D 2Q3BA 4QBFA 1MC1A 3KAJA 1LNZA 4EECA 5J2UF 1DUIA 1FMCA 3KKLA 4B4KA 3VNVA 1M34B 2HSGA 4XDZA 4UHKA 2GMWA 4QYXA 4RD3A 2R84A 4YO7A 2I2XB 3OFVA 4FN5A 3G0DA 2MINB 3TQHA 3KQLA 3DLCA 2PGIA 5E3JA 1BDIA 1Z2DA 1AXRA 1EFRD 1L6RA 3QG5A 1NKSA 2W48A 2CD7A 4UE6A 3UUGA 1HC7A 1GLNA 3F5DA 4RHYA 4EMBA 2HZ7A 4KPUB 4KWTA 2PGOA 3FYUA 3PGA1 4RTLA 1H23A 2GH1A 2O4UX 3E4CA 3H13A 1N1MA 3R20A 4G23A 4ND6A 4FCTA 2V96A 3TTYA 3LXRA 4KCGA 1NXXA 2I65A 3QPBA 1G291 2W4IA 4EYSA 5MHTA 4MLZA 1Z0DA 1I13A 3KR9A 2FQYA 4A1OA 2RI1A 3B38A 3HYCA 1T3GA 2YVAA 3H3XA 1THGA 3R9KA 3STUA 1L4YA 3VHXB 5JJKA 3TE6A 1NVUQ 2AH5A 1ENYA 1Y9JA 4D9IA 4MHTA 2XF2A 1VE9A 3BORA 4F9EA 2XUDA 1SXQA 3CTPA 1JYEA 1PG5A 1JWAB 1AKVA 3D6HA 1TU3A 1IM5A 3QVKA 3HQ4O 3EYAA 4ZT3A 3V4VB 4DDTA 2K87A 5DTJA 3BWVA 3LCCA 4LZWA 2C2XA 2WHRA 3M4ZA 3Q5EA 2OKCA 4M37A 4UXHA 4XJSA 2FN3A 2JIDA 3P9KA 5EE0A 5FNVB 3EXFA 7GPBA 1I6WA 4E2YA 5ICGA 5I01A 2QLBA 3NZEA 2HGSA 2Q41A 4WD3A 5M34A 4AKIA 1RJ9A 2XY4A 3FYDA 1VLVA 3OM8A 1JIQA 3QW2A 3LLVA 1G7RA 2E1RA 1DXQA 3L07A 1Z3IX 3DMDA 3KT6A 1SIBE 4CKBB 3OSUA 2IXEA 1XELA 1EHYA 2C1EA 1N8NA 1U3DA 4MXDA 1SCKA 5ED4A 2OR3A 1I5OA 1QFJA 1BN7A 4LXXA 5I48A 3ILHA 5ALGA 2XNDD 1BN6A 2IDKA 3ND6A 1H0RA 2HBRA 3VR2A 1C3EA 1T0JB 1VG8A 4YRAA 4V1CA 1GTMA 1S2NA 3MAJA 3E7DA 2OCPA 4ZU3A 1L1RA 1N2JA 1YB5A 1N2CB 2GXUA 4FMPA 4IG9A 2OXCA 5LWHA 3LTEA 2WFMA 421PA 2OO5C 3CIFA 4URWR 2RI6A 1C9MA 3IIKA 1VE3A 3U09A 1XMXA 2GHIA 1J9EA 1K06A 2HFJA 3WY9A 5AM3A 1O9GA 1PGNA 2CGEA 3QEMA 2RBEA 2HFKA 5AKKA 5ADUS 1IJKA 4IYRA 1SCUA 3KUUA 2CVOA 4W4TA 2C2OA 2N1MA 1YE8A 3CLRC 1D6MA 1SCDA 4M3NA 3RODA 4BN0A 4JDUA 5BSFA 2C9ZA 4S24A 3IURA 1VLJA 3AL3A 3DG9A 13PKA 1AKTA 1SRQA 4L8WB 1M5RA 3FUUA 3W4KA 2C8LA 5IJ0B 1ONOA 2PS0A 4I8XA 1U4OA 3N2LA 4UKDA 3S2EA 4AMZA 4NCKA 1IVNA 3MCVA 4W5HA 2YDXA 2QYSA 3W5AA 1TPZA 1TW3A 5DLQC 1GAEO 3DGEC 4IH1A 3K0BA 5HF8A 4EPWA 2H16A 3K8ZA 5A5FA 3GDFA 5EJ9A 3WX0A 1T5HX 4M0EA 4NV0A 1JIXA 1T91A 2EFGA 4DG5A 2GEVA 1UZAA 3JD2A 4E3ZA 2PZ8A 4HFJA 1L5RA 1OTXA 4JH0A 4X6LA 2ZAYA 4CETA 1GG9A 1FZTA 5KHLB 4CNBA 1XEXA 3RC3A 3TTVA 4FVTA 5C1IA 1DDGA 2XTAA 1ZESA 5IX8A 4DA8A 1FYWA 3KT3A 1JGTA 1B8UA 1Z7BA 2Y4NA 1AT1A 4ANFA 1IG3A 4OLAA 5CYOA 5K0GA 5KOHA 3A6DA 5EZ6B 5KAMA 3SS8A 2RH4A 4IS3A 4OXKA 3ZE8A 4KGDA 4XGKA 5CCEA 1UXHA 4KACA 1DG9A 1OTYA 2YWEA 4HRVA 4TTIA 5AVJA 4NBTA 1P1JA 2FF7A 3DBRA 1XVAA 3GEHA 1U7ZA 4K3VA 1EP3B 1QNFA 3AHIA 5IYZA 1KOLA 2B4YA 3CX8A 3OZDA 2NIPA 4LA4A 1S2DA 3KT0A 1ZC3A 3P2YA 4ZKDA 3GLGE 3Q7QA 3W0LB 1XRJA 1SBCA 1VSUA 3Q0EA 5AJUA 1ULAA 3C7AA 2XYHA 1QGUB 4AULA 4HNUA 1QTIA 4QQ8A 4AJKA 2D2VA 5BNTA 5JY1A 5L3ZA 3PR1A 5KJFA 2IPLA 4QPNA 2AKAB 3PQDA 4F72A 4TPKA 4TZKA 1OE0A 4UARA 4X1YB 3K0EA 4Q9NA 2VJPA 1WOYA 2IX9A 4FGKA 1TM2A 4OQLA 3CZ9A 1LBSA 2HJSA 3V5NA 4MW7A 1JEOA 2Q3HA 3DTTA 5JYDA 2EP8A 3QU5A 4MS3A 1G20A 4LYHA 4BO7A 3NJ8A 2ZIGA 1R0ZA 4LTDA 1Q7CA 4NCNA 3GD7A 5EJ4A 2O07A 3OG9A 4PQYA 3R77A 3ZGYA 3CNHA 3BH7A 3OIWA 4G24A 4OI4A 2HXYA 3B78A 2FFAA 1VKRA 1POWA 2BR3A 3SZMA 2Q1SA 3BZWA 1EEXB 4P38A 4R5MA 4B31A 1H4TA 1KY5A 3H5RA 4B76A 3TRJA 1OB5A 2YL2A 3IT0A 1X1QA 4J90A 1PX0A 2FEAA 2WU1A 1TF2A 3B60A 3CNLA 3CRW1 3DKVA 3N74A 4JLDA 4AMBA 1M75A 4UM9B 4AG6A 2NUTA 4KOEC 4OK5A 2VTBB 1XPJA 4KN5A 4TVOA 3QX7A 2ZT7A 4PGFA 4RFSA 3VH2A 4B43A 2E4ZA 3ZUPA 3U7IA 1FP7A 5K0SA 5ALJA 5TT1A 4LN1A 1G5FA 2JI9A 1NBEA 3LG2A 4V0OA 3ROTA 5E9AA 3D3WA 4E32A 1ENZA 1H42A 1VLMA 1NPDA 2V45A 3M5PA 4OGGA 2WNIA 3PPIA 4B17A 3TZHA 3QFCA 2VJCA 4MTCA 4CGZA 4XX0A 4OU5A 1IQRA 4IJ5A 4Q47A 4E31A 2VCYA 4RJTA 4JIGA 5AJZA 4PRZA 4ZJUA 3ZHTA 1U65A 4KR3A 1WXWA 2PLWA 4XB6B 1KS2A 4UM8B 4WN9B 3W5IA 5IAGA 5BVHB 2IVZA 3LF1A 1DIOB 2PQMA 4PR0A 1T35A 1XEFA 4C89A 1VJGA 2JD1A 3O4VA 3SVTA 2ZBRA 4ZEMA 3SDBA 1BNCA 4NYMR 4C4XA 2F8LA 4BMOB 4BO1A 2H4WA 4KO2S 4Y2XA 1WF3A 4I8DA 2B61A 1U1GA 1E3QA 2D5CA 4HSEA 1I0ZA 4OG2A 4RGVA 3RIEA 5KDOA 4LC9A 2YXBA 1RZUA 3IUJA 4DREA 2XVMA 1J56A 1D1PA 1TLTA 3RSQA 3FWKA 2RGCA 1XZMA 1SWVA 2ID9A 4ZCQA 2V9ZA 2VJDA 1USVA 4EAAA 3KEMA 4RH1A 4KQJA 2C2GA 2CFRA 2CXXA 1ZSVA 3VPAA 4GYKA 4CIDA 3GLFE 5AFSA 1LS1A 2P75A 1I2AA 3L0IB 3Q6MA 3OETA 2GVZC 2DUNA 2QUBA 2X2FA 1JAHA 2CUTA 4Y1RA 3SXUA 2ZVDA 2GKOA 3O91A 3DZJA 1QKKA 3FFWA 4LJ6A 4ZCMA 2ZAOA 1HKUA 1ES9A 3C3JA 4JL8A 4P2GA 2HQSA 1N36B 1GL7A 2EG5A 1U9JA 4QM6A 5JNSA 4RF2A 5DBIA 4DTCA 1MMFB 4PAGA 3EH2A 1YCHA 1Q3KA 1R4NB 1Z4PX 4PZEA 4V02A 5FYDA 4JL5A 3IPAA 4WLNA 3OTOB 4MRNA 4TKUA 2Q3DA 3MRVA 3HYSA 4O25A 2YY7A 1M10A 2O23A 1CEXA 2P65A 3P0IA 2XCOA 4L4ZA 4UMFA 4CM9A 2X8AA 4JQZA 4ARZA 4BLPA 3DYBA 2GCOB 3UXYA 1PL8A 3EG5A 4NBVA 3MMPA 1G8SA 3PHLA 3VI4B 1TIKA 3PKIA 3QTLA 2YWBA 3CKLA 3HNOA 1CW2B 3Q0IA 1E6EA 1GN9A 1ZI8A 2FOXA 4RFVA 1TQHA 4DAOA 1REQB 5AK0A 3LUBA 4B6PA 3EZLA 2JFYA 1GFIA 3HCFA 2BRUA 5ALXA 3T12A 4EUHA 3H5VA 2W6OA 1RRVA 1G6Q1 1DIAA 3FKSD 4LNUA 5IDYA 3RYCA 3OQHA 2TMGA 3UAVA 3V3TA 1E8DA 1O6GA 4G86A 1QCCA 1VLZA 2JA2A 2XD4A 2WYHA 4WZ6A 1RLOA 3VNAA 3H19A 2JANA 5FNVA 3E22B 3TPZA 3PDCA 1XNRB 2BBTA 1ISSA 3QF4B 4WLOA 1EJBA 1IBSA 1FTGA 1NJ8A 2VUUA 5KVCA 4DV1B 3U4QA 2FFQA 4AAYA 2HJVA 2R5WA 4CDMA 2ZR7A 4NDAA 4HVAA 1E3EA 2G72A 3OE1A 3NMUF 1TF7A 1MT0A 3DR3A 3LQ4A 4LWPA 4MRMB 4WZBB 5KVQA 5CFPA 5GADl 3KAPA 1ESNA 2P3LA 2OGTA 2IYWA 1TM3E 2C3PA 4FGWA 3LL7A 1A7UA 3D4NA 2AXQA 5G1NA 1NVFA 3HUDA 4AZ3B 4QSHA 3HBMA 2CF6A 1EK1A 4UM7A 5CVJA 1QHGA 1I2ZA 4ZT2A 1E3DA 3PQ8A 2PL3A 1N0VC 3HFSA 2Z8YM 4E3WA 1NVXQ 3LDGA 1LTHR 2J7KA 4W7HA 1JHZA 2VYNA 1S89A 3BRCA 1W5SA 3G2LA 3TXXA 4E21A 1APBA 1BFKA 3AVOA 3G1WA 3IGFA 1CDOA 4EY7A 1D4FA 2XKAA 3QHQA 2QN9A 2WTUA 4CG1A 4E94A 4RDHA 3NC1C 4CI0B 1HDYA 5FIUA 5EHXA 3WGNA 5LMNB 1M2OB 1N2CE 2EX0A 4N39A 1ZX1A 1KDPA 2FZGA 5BQOA 1XRMA 2C5AA 4Z9YA 3NTVA 2EX1A 5CP8A 3TD2A 3V6LA 2JAHA 5LOVA 2C9YA 2RD2A 3SYLA 1W75A 5KYTA 3A7EA 2IBMA 3UWDA 4EY8A 3BC1A 2OPHA 1S6YA 1WU8A 4F84A 1NJ6A 1YL6A 3DBHA 5TQ0B 2PMCA 3N2YA 3A6FA 4W1RA 5DOVA 4OXQA 1EVKA 5H4HA 2PMBA 2PMKA 2CYBA 1BG6A 5AKIA 5E6SA 5IJAA 3H4IA 1JPUA 5CA1A 3ECCA 3TLEA 1X77A 3SFTA 4BUCA 3L7AA 4CCYA 1OGIA 1X80B 4H60A 4TL6A 4Z9FA 3ESBA 1VPDA 3MSCA 5EJAA 1KVRA 1SA0A 2PRKA 5CJJA 3RKSA 3UUFA 2JNWA 3UQZA 1OPRA 3H2ZA 1A5AB 5T3YA 2IHUA 1E7MA 1MAHA 1XKXA 2VYVD 1FDWA 2QVBA 1Z75A 4UPVA 2ZQ5A 1EDBA 2D0PB 2QGFA 3IEIA 1MV8A 1GGHA 3KLBA 1J23A 1UC8A 2O1SA 1CFJA 3K8QA 3KDPA 5JY6A 1F0PA 2B7LA 3KTDA 2VHZA 3FSGD 3H99A 1C14A 1ZQ9A 4H35A 5L8VA 1C8BA 2XBUA 4QBKA 4D2IA 3HABA 1GAWA 3H1TA 4ZAWA 2OCXA 3R75A 3CZPA 1XXHA 1P4HA 1H6AA 1SZJG 4HC4A 1NOKA 5JISA 5JQGA 1KYQA 1RM3A 4UTZA 3PUZA 1XMQB 2A67A 3K0SA 4RPJA 2B3DA 2WHPA 1WDLA 4C4PA 5KTRA 4HEQA 2CNBA 2O2CA 3I45A 1ARZA 4ZZIA 4MP6A 3OIDA 1GFZA 3I5UA 1RJWA 3L8YA 2PKYX 1D4AA 2QDKA 3KT8A 3TL6A 4Q7EA 5JCZA 3GQBA 4ZO6A 5A4MS 2L0XA 3K5HA 1WM1A 2PZBA 1Z73A 2BMAA 1EVYA 1AQUA 2PKXA 3BMCA 3C5HA 4IFIA 1WW2A 5G41A 4ZYXA 3V8NA 1N5LA 4XFDA 1S2MA 3DKIA 4JEHA 5JFGA 3DUFA 3KJQA 3DBLB 2OFOA 1KJ8A 1RQRA 2R47A 3QU9A 3U4IA 4DEXA 1H2RS 5IVPA 4K7JA 1VE7A 3HB1A 3FZGA 3BFXA 3NT5A 1J06A 4LJKA 4OATA 5C80A 1N7JA 2IUSA 1XRSB 1JG7A 2BMWA 3IR5A 4JBNA 3PX3A 1OPXA 1A3CA 1RXYA 1SHZA 2PVSA 4GQAA 1X1SA 4NBUA 2DCMA 2B8WA 4UUQA 2ZUVA 1WCV1 4XYBA 5B37A 4B3BA 3FFAA 4MGHA 3G2OA 1X19A 4U3JA 3T0FA 1PWHA 2CHUA 3MGGA 2IHJA 1XT6A 1JHDA 2X6QA 3IODA 3TJZA 1V8DA 5ENVA 5CDHA 2VWPA 3R6TA 4DMMA 2Q7DA 3CLVA 1DARA 3N05A 3RVMA 3V55A 2HJWA 1IZYA 1D9XA 1GTZA 4G1FA 4IQ8A 4BNJA 4CG2A 2D5LA 5COBA 1M8GA 2QTHA 5DHSA 3BT7A 2GAIA 2Q3EA 2Y68A 1T0HB 2HY7A 3ZZUA 2Q2WA 1Y7IA 5FBKA 3C74A 4H3HB 5HIJA 3E7PA 1TI7A 4JOBA 3D1LA 1XTBA 3PNPA 4MB2A 2E2WA 3U13A 4YXWD 3QLVA 5LR6A 1Z39A 2Y2VA 1F14A 4KSYA 3TDNA 1A7JA 1QO0A 4MVJD 4IMRA 1CUDA 1L5FA 2Q07A 3CH5A 5IP5A 1DP4A 1U3CA 2PGJA 1SMKA 2IU4A 3FCOA 3MUNA 3MTIA 1H5UA 4UE3S 3SC3A 2FPSA 3KWLA 5K8UA 1YFLA 3ZGLA 1E2QA 4CUKA 4NNOA 1QAOA 4EO9A 1QIJA 4AK9A 3HRKA 4X94A 3P0EA 1EK2A 4K9PA 4AJ1A 4F4DA 1TM4E 4RVSA 3C85A 2OC9A 4FLEA 3QEBZ 3HKDA 5TS3A 4OYLA 2MSNA 3DKKA 4WJZA 1F8YA 5JJBA 3DA8A 3OLYA 2YIMA 5H70A 1IQ0A 1H8HD 2DFDA 2WMOB 3TIFA 1GLGA 4N0DA 5A6SB 4B3JA 2H4HA 2NZXA 5K45A 2BGKA 2GN1A 4M49A 4V0LA 1G8MA 3ITDA 1I4LD 2J46A 4F46A 3SLGA 4JI1B 3IOBA 3B20A 4ESVA 4JUBA 1NE7A 2C4UA 5ALZA 2WNSA 1A9ZA 4XJTA 5JXJA 3WLSA 1KC1A 2R7AA 2AR0A 1KI6A 2BJWA 3GVHA 3OVMA 3VR2D 1UZMA 2OMKA 3IUSA 4WKGA 1MW8X 1EUZA 1PS0A 3O1HB 3PD0A 1G5TA 4BZXA 1VB3A 2X19A 1U3WA 3NS7A 1BGXT 3UO8B 3Q8MA 1L5MA 2WR8A 4XIFA 1TJYA 5EP1A 1HYBA 1WHTB 1XO1A 1Z9BA 5H80A 2ZUCA 4BB6A 1ULUA 3LQRA 2AZDA 5HJ5A 1MN6A 1O95A 3O7MA 5G0VA 3B3FA 4FSXA 1BWQA 1QIEA 2AOVA 5TPWB 5K1ZA 4BJ5A 1SPBS 2PD4A 5KYWA 2NYRA 2KX7A 4TUYF 2HBYA 3PWTA 1TVMA 1PV1A 1VPEA 2G3YA 2VHXA 4KRGA 4NEQA 3E9DA 3TPCA 1R0WA 3MTEA 1JG2A 3OHSX 1VCHA 2PZLA 4B6RA 1I30A 1D0VA 5AT1A 4JSYA 1SC4A 2NN3C 4L0CA 1NX9A 5FA8A 5B1IA 4BHTA 5HUJA 3AEKA 1JJAA 4Y9RA 2Z6QA 4BP8A 2A57A 3VR4A 5EINA 5BQFA 1GPYA 4FHGA 2XSZA 2HADA 3IH5A 4AJIA 2JGJA 4N6GA 4BPBA 1DS6A 3SR0A 3JZMA 1OBVA 1G98A 1UBKS 1B42A 4HB2A 2NO4A 4IP0A 3LC1O 5LM3A 5F78A 1YUBA 4D9BA 1NU8A 1KOFA 2P11A 1MHTA 2YYYA 3MTDA 4CM4B 1MU0A 2PWZA 5FV4A 4PZZA 2O7VA 3BE5A 4KNVA 4TMYA 5F7ZA 3QVXA 5B53A 3W5HA 3WLTA 4AW9A 5K8VA 5KNDA 1SK9A 1W2GA 5DK4A 2QENA 2VJMB 4KVZA 5JZ9A 1DIBA 3FDJA 1EGMB 3RUHA 4O2BF 3RHSA 4UAUA 5HPYB 2QZ4A 2YCLA 1VIAA 1CT9A 4PAQA 4WK4B 1EK5A 1MDFA 2XSZD 4JGGA 3FYCA 5ALOA 3DHWC 3N2GA 2PA3A 3RS5A 4AIIA 1B3RA 3CWZA 1Y5MA 3MFYA 3ORSA 2NPIA 2PT6A 2ENUA 2QRZA 3I83A 4MWDA 1W35A 3U44B 3DLTA 1FBTA 4RXMA 1PFQA 1WKCA 2XR1A 4FTWA 4O4LA 2ZJBA 3VPHA 3H9GA 4HDOB 1AHNA 1UANA 4TUYB 4F5DA 2VNAA 4M8IA 2K5UA 4JI3B 1XQVA 2QVZX 4L3VA 4JXKA 3ZCRA 2W6ID 3ZY4A 5HFJA 5LB4A 4O4IB 1H69A 4JLKA 4R84A 4ASUD 1L8QA 4HNGA 4S05A 1WW3A 2XDWA 3VM6A 2H48A 3QVJA 1DC8A 4G84A 4IGIA 2FPMA 4RMJA 4FOTA 1S2IA 5TJHA 4BJ3A 1ZOOA 1Q83A 2YJZA 3PQ7A 4PGHA 4WOBA 3GU3A 4Y67A 2ZQZA 4AUEA 2ONCA 4DA9A 2CFTA 4HOYA 1ZWLA 2J3QA 4W6QA 4P9NA 5CHEA 3F6SA 1N5IA 2NU6A 3A10A 1JB1A 5ENZA 2VDLB 2HRRA 3U19A 4A8PA 5LKAA 3FTPA 4U8GA 4WUTA 1LRLA 3L9WA 4JROA 3H1BA 1F5NA 1Z6GA 1DBPA 1QV7A 4ZI7F 3TSWA 2A5FA 3IB3A 1T9GR 2EHDA 5HS6A 2HK6A 1K4MA 1ODFA 3M33A 1DQYA 1IBRA 2W6IA 3NOOA 4JOQA 4ZRMA 4K9NA 1N8SA 4RQUA 16PKA 3KZKA 2RGWA 2WT9A 2Z2IA 2OGSA 3DOOA 1FNBA 2IPAB 3VKWA 4DJFC 5TPZD 3L18A 2C92A 4KFCA 5DZSA 2X9NA 3KE9A 2HRZA 4NQZA 3USCS 4PPYA 3P5SA 1JUDA 5K51A 3UK0A 5JAHA 2HNAA 4Q9LA 3TPFA 2VN8A 5DBGA 1P39A 4KQXA 1QH0A 5CH8A 1JLHA 3O8LA 1U81A 4A0RA 1NLMA 5BN3B 4B3IA 3KHUA 3MSXA 4LXIA 3CA8A 5LYJA 1P8JA 5IAKA 1KQOA 1ECLA 1FNMA 2W11A 4RHXA 4XVCA 2Q4BA 3W8NA 2X3UA 3CCFA 4MUBA 4BFUA 3AR6A 5T3UA 4TN1A 1EP9A 1RE1A 4W5WA 5ITWA 5AJVB 2OP1A 4ZCPA 2O3QA 3PFNA 1V9CA 2HCFA 2Z2JA 3CEJA 3LUCA 3CLSD 1MJGM 4CLRB 3CVYA 4PZCA 4RD2A 4CIWA 3BWBA 3NNDA 1SK8A 2HEIA 2JGEA 1HM5A 3CLTC 2R7MA 4L15A 4PC2A 4CVNA 4M53A 3SJBA 4EVQA 3U6KA 1NLZA 3T94A 3CNEA 4V0QA 1KYYA 1PYGA 3BMCB 3CNQS 5C1OA 1E2PA 1Z2OX 2B25A 2GERA 2IX3A 1RVV1 4ZV7A 4L76A 3CVVA 1EQ2A 5NLLA 3FOZA 1D2GA 1T4BA 1Z7WA 3IERA 3ND5A 3AUKA 1K98A 3VOBA 5KTPA 1PJSA 3NWOA 5K6AA 1LQ2A 3H1FA 3C48A 3WWYA 4UPDA 1QQTA 3A04A 2QSZA 3DWIA 1CJVC 4LVUA 2XWJI 2J5QA 3EOAI 3GXOA 4X66B 1FVFA 4MGKR 5K0NA 3S7TA 1AM4D 5CT9A 3JZDA 3ND9A 4YALA 2Q3CA 1YC5A 3FFXA 5EJIA 2I7XA 2KW5A 4MV3A 3F6CA 3ETHA 3VMFA 5F2NA 3GB9A 4DOMA 1E5DA 2HQ1A 3R7LA 1MJHA 2H3HA 3W8FA 2GHRA 2PL1A 2Q5EA 1QVRA 3JRXA 4RGYA 4WXHA 3CPSA 3W5JA 1RADA 3C8ZA 2NO7A 1II0A 5LYYA 3RTDA 3TTTA 1H66A 4GXRA 4XQ0A 5KO2A 2ODWA 5E2AA 4Q9JA 5BMVF 4GNKA 2JH8A 1OHHD 3ITKA 3PU6A 4UU1A 4RY2A 1GHTA 2AFHE 3GWGA 3EUFA 3GVXA 5JAMA 1JQJC 2HPVA 1UUFA 4HGZA 2PKQO 3OCZA 4NFSA 4PLWA 2XQGA 4BIMA 2HRQA 3JQAD 4NMMA 5LDGA 4MGZR 3BL5A 1H9BA 2O48X 1B0ZA 2XHZA 3RWMB 4EW6A 1SA0B 1X92A 721PA 5KTMA 2EWMA 5DMHA 1YS2X 1WETA 2XQFA 4MA5A 3JVIA 4YAIA 3JRNA 1VRCA 3V3KA 3VSEA 3C2QA 4GOJA 1DWUA 4F45A 3EFEA 3RSGA 4ZHSA 5IEJA 1LLCA 4ETNA 2V98A 3CINA 1QIFA 3LO8A 4KWIA 4RLFA 4JDPA 5CLFA 1PYDA 4Y6QA 4U2DA 4UM9D 5AK3A 1IZ9A 3ND8A 3TW4A 3WWCA 3A25A 4BVAA 5HZMA 2MR6A 2BMFA 2PUCA 2R48A 2XMSA 1QNLA 1RQNA 4P3YA 3NFRA 3BREA 3G82C 1WEHA 2GHQA 1HFEL 1UPTA 3R5HA 4Z0HO 1XOIA 2WD7A 1EX7A 1U1DA 3P9XA 3PI7A 4KQ1A 4N82A 3AB8A 1T4CB 4LQ4A 4N3AA 3I2FA 1OLUA 1BXZA 2P7IA 3MW8A 2W83A 2HREA 1U5BA 2CW5A 3PXDA 1MAAA 4JLPA 4JP2A 3BILA 3THYB 4AS3A 2JFPA 3IP3A 2V7BA 3KQOA 2J0UA 4AJJA 1JG3A 5LA6A 1E92A 3G2NA 4Y1GA 3DBOB 4WLEA 3A1CA 2QW0X 5DPMA 1GPBA 4WBNF 3BRWD 4A6PA 3A3PA 3B89A 1SH7A 2RK6A 3KVVA 1MAWA 2QKYA 3BB4A 3LGAA 5EP2A 1Z63A 3ER8A 4XTRA 4WOJA 4CTNA 4I50A 2JH3A 1E69A 5SZKB 3UVEA 2QTZA 1NJSA 4HWPA 3PIRA 3VR5D 1E6MA 3WA6A 1RHJA 1SZPA 2ARKA 2H1HA 2QN3A 1IBMB 2I7CA 2IHNA 3GPDG 1WMFA 4IQFA 2EP7A 2WYUA 5A6SA 3TVTA 4BO4A 2B83A 3DD1A 5HBRA 4RHUA 2BH9A 1W36B 1R4MA 4B3RB 3TVYA 4RZSA 1CNEA 1ENPA 4AZTA 1NAIA 1ZN9A 4F1KA 4GMGA 1PU2A 4UUNA 3FTQA 4PLTA 1W9HA 5BSKA 3TEJA 3TIVA 2F9FA 2FN7A 5EIAA 3W4JA 3Q1KA 3HMKA 3S27A 3SMVA 4XYGA 5T8KC 1T2VA 4KJZA 2CLLB 4IO1A 5FFNA 3DF9A 1AZWA 1JAIA 1IQPA 4IIUA 3H0KA 3RREA 1U8AA 5DK6A 4OJQA 4AY5A 1NNI1 5JO0A 1QIKA 2GCOA 4PBRA 3QI2A 1YBHA 3HKCB 4YCJA 1C9JA 1O4VA 5AK5A 5JS2A 5IF9A 4YCBA 2IV3A 1ZVQA 3CUTA 2GAJA 5DYIA 1GZ7A 2QRVB 4BVFA 1H3NA 3V80A 1X74A 2WQ7A 1E7SA 4ZODA 4HGPA 1DTWB 1K2VN 1W0JA 2EKZA 2ZREA 4D3YA 1MLDA 3CRRA 4WI1A 4YS6A 1RAIA 2GJ4A 3D8TA 2JBWA 1NF3A 2Y1WA 3E8XA 6CHYA 4QZVA 4RENA 2EBWA 4PXSA 1XZBA 1W29A 1XHEA 2ZRDA 2BHSA 4ZVMA 4M6WB 2O5RA 3HDGA 4QQNA 4XEUA 5GVSA 3QJ5A 5CYPA 1WXQA 3R7WA 2C5LA 2PT9A 3AEQB 3KFVA 3LD9A 4KXYA 1GT91 3ZGOA 4EP1A 1H6BA 1W5FA 3B48A 3SPXA 3EJWA 2OQVA 3E0XA 4BFLA 2JLUA 1U0HC 2JCXA 1QQ5A 2M6RA 4WFKA 2ZE7A 1TEVA 2A9KA 1NA5A 2IYFA 4N1AA 4X93A 3UOGA 4EKIA 1YWGO 5LMCA 4QULA 3HUTA 3AUSA 3GPBA 3DZBA 1M6NA 4BBJA 3W2GA 1XZNA 2BH2A 3L1VA 4OJYA 1GA1A 2XMRA 2EARA 5IXSA 1UFQA 2D4AA 4DJ5X 1C7FA 1YJ5A 2CHEA 1EM6A 2DF8A 2AGVA 1OBOA 1EPUA 4LHXA 3QVUA 1WDTA 4L9AA 4MV7A 4R31A 2IUUA 4D9CA 2FVYA 3OWXA 3RWOA 3DEJA 1TKBA 1H2BA 2H9IA 2HQBA 1EB8A 3CKMA 1CCWA 3G0GA 4DBLC 3C8UA 5DDIP 3OEHA 1L8OA 3IDQA 3CCBA 2QPAA 1LPPA 1T9ZA 3MJHA 1FQKA 1DCMA 5DLDA 4JXXA 4FEGA 1DBRA 4B8YA 3RS9A 4M0UA 4P08A 1OD6A 1JHVA 4COOA 3DVLA 1EWRA 3NATA 1XQ6A 5CT6A 3X2EA 5BNZA 2P78A 3T35A 5K3SA 4UW9A 4P53A 3F6YA 3K35A 4INOA 3SLKA 5F1KA 3WGYA 5GM1A 2Y71A 3D3WB 3NW9A 3T54A 3VOSA 3OP4A 1EJ2A 4BKUA 2MJLA 3REQB 2QG6A 3DV0B 4ZDJA 1P7YA 1Y6ZA 3TZCA 1Z0UA 2ZT5A 3HDVA 4W1QA 4ETIA 4EG4A 5DCLA 4ENWA 4F85A 1MG0A 1QOQB 3QE9Y 3UPDA 1Z0KA 3PFIA 1HLFA 3F6PA 3HVIA 5HUHA 4DDUA 4LOLA 3A6EA 4J49A 4C43A 1NBWB 3TEMA 5IZ4A 4WADA 4FIZA 3TQFA 3AOEC 3G02A 4E12A 1X2EA 3IKLA 4F2HA 1AF4A 5B58C 2WKSA 1PZMA 2QI9C 4Z86A 5AVWA 3O8RA 5TV2A 5C51B 2GXAA 3CLTD 1DQSA 5E2IA 1LI5A 4HSGA 1A7KA 5LYJF 1NN5A 3BTUA 4LBVA 1N5OX 2UZ4A 1K4YA 3UJPA 4AY4A 5LOVB 1F20A 2F2TA 1IOWA 4IXDA 4G97A 4RGQA 2DHCA 3NGMA 4Q1AA 1V6CA 1JQBA 4GPIB 3D7MA 1JQEA 4JEMA 4GG1A 5T57A 5LU8A 1XPOA 3CRQA 4KLRA 3WK8A 5FFMA 1ZLYA 4KH0A 4LHSA 1IOZA 2YW9A 1V39A 4IGFA 1LBTA 1YJ8A 2X0JA 3BB1A 2JJ8A 2YMLA 3HFGA 1M33A 2QRUA 1U5CA 2P5YA 1O3YA 3FF1A 3LT5A 4OHVA 4QT0A 4YRMA 1T5SA 1ZK4A 3A9VA 1A5SB 1ODKA 3BMNB 3VU9B 3I32A 4E07A 1HYHA 2BKAA 1P1CA 1W4BA 2YXPX 2Q8PA 3IQFA 4OVKA 4MTLA 4QDXA 3RIGA 1YZYA 1P8AA 4JLNA 5ALIA 4D4LA 3L40A 3U7JA 4YX9A 1XKLA 1QH1A 2PSFA 3AJDA 3CW9A 4I5IA 4YBZA 4DS3A 4ZI7A 2OLEA 3ME5A 2FEWB 4EVIA 2Y0EA 2XMGA 4QQRA 5B36A 5LZ9A 3CTMA 2YZKA 3KD2A 3J7AC 1K2WA 4KUGA 4AURA 3HB7A 3OZSA 1USIA 3Q7RA 2ZCUA 4G9EA 3ZHBA 3QLUC 4GBJA 5H02A 3ZLVA 4ZQEA 4TVBA 2H4XA 2FRDC 2I9KA 3LT0A 1AURA 2ZS8A 4JHLA 5JTTA 5LIPA 2CCJA 3GEDA 2BGJA 1O03A 2H2AA 1ZQ1A 3GFBA 3KJIA 2W00A 4HADA 4KIJA 4BB5A 2DLCX 2YICA 2P6UA 5C81A 2Y0CA 5F5XA 1QP0A 1BU5A 5A5DA 4W5RA 1NVVQ 3G0OA 1FFHA 1FOEB 1Y7PA 2V65A 1Q7EA 2FWAA 1XTTA 2NZJA 3EF3A 5T4FA 4I66A 3E3AA 4EHDA 5LD2B 2GN4A 2GK6A 3P26A 3PGVA 3RAFC 1JBKA 2FPOA 2ZRAA 3E3OA 1P1KA 3EBPA 3IVMA 1NRWA 1KI9A 2C5FA 4NV1A 5BR8B 5BN4B 4EKYA 4TXNA 4TS3A 4X64B 1FJGB 1UBMS 5IAEA 3HBLA 3ROFA 3NBFA 7REQA 5T8KA 5FWAA 3HVKA 3CMMA 4PXYA 1YTLA 2PXHA 4HEA6 4G65A 5LOVF 1DRUA 3TTSA 2HUPA 1Z8NA 3TMKA 3MC1A 3WSTA 5BVGA 1U0BB 3X2FA 1H93A 2G7MC 2VNJA 2A8YA 4JZKA 3TSCA 2AEJA 1Z6ZA 4GF5A 4Y8VA 2QAGA 3FDXA 3GG2A 4OB6A 1FFYA 3QEMB 3LDAA 3DYIA 4A0QA 4MPPA 4IEFB 1T2AA 4LOIA 4ND7A 2J6HA 4IMPA 4ZYWA 1GTSA 2D1FA 3WLKX 1E0SA 3R7FA 5JS8A 5GWXA 1W36C 1RS0A 4NE7A 1ZCZA 4G4JA 4K9RA 1ZRMA 3D6NB 3U17A 4JEIA 1PUJA 2AG0A 1RLJA 2FR8A 3HYRA 1NI4B 1DJNA 2A3RA 3IP9A 3O4GA 4JYMA 1EWYA 3UJNA 1RYMA 5KYYA 4Y1RB 4GPZA 3SXUB 4ETMA 3N70A 5E6RA 5LNK1 2W5UA 1P5ZB 3OECA 5ERYA 1OFHA 5CBPB 9LDTA 5JPIA 2GJ8A 1FRNA 3KOYA 4A7PA 4EYOA 1JA1A 3C3MA 1NDUA 2VUHB 3N5KA 3QVWA 4LX8A 4CKBA 1LDBA 3SC4A 4EPTA 5TEWA 1WE2A 4MLPA 5CCDA 4RQTA 1QCDA 3NHZA 3I2JA 3IELA 3ROQA 2VJKA 1AMNA 3JSAA 1D1QA 4MQLA 4WFIA 3FKJA 5BWLA 5BNFA 2LIPA 5EHGA 1M1XB 1I7DA 3RFTA 3A4VA 3RUDA 4MCAA 2BM9A 4AX8A 4MDEA 1UDBA 1T9AA 1ZW6A 1OI4A 1P7WA 2HF2A 4MVJG 3ROPA 3T5TA 5KWJA 2WJZB 2QP3A 1Z6TA 3SS9X 2VA9A 3U7HB 5JBNA 1DV2A 5DHAA 4RLQA 2XNCA 1FSZA 3W2TA 2OECA 2C7GA 3INNA 1SVIA 2AA3A 4RL6A 2W8BA 3ABIA 3R7BA 4WA8A 3DEFA 2QRPA 5I5GA 4XX0B 2HA6A 5JRJA 5L3SB 1C8VB 1TX4B 3LK7A 1ZH0A 4R4JA 3F5SA 2ZOSA 3KOUA 5HZKA 2QTNA 2VT2A 3B7PA 4RACA 1AKNA 2W2LA 3VNQA 3DT6A 4MPJA 4XR4A 5L7YA 4CM8A 1HYEA 1WV0A 2QWXA 1TM5E 1E3MA 2QRJA 3KSZO 5CB4F 3W06A 1RWVA 4R41A 1L5HA 5BYJA 3B1XA 1BA3A 4BBPA 3ETNA 1XUOA 1UDXA 4GI5A 4P98A 3V8EA 1Y9EA 2DPGA 3A1EA 1Q0TA 4CG0A 1ZWKA 3JASA 2KYRA 2R96A 1CG6A 5C7IO 1NF8A 2HWKA 2MINA 4UCQA 3VYWA 4X60A 4GGPA 3I04M 1M6VB 1SQGA 2OZLA 2SCUB 3VO8A 2O2IA 5KTKA 1BH2A 3GO4A 4WW0A 1J00A 2C0PA 2V4ZA 2ES4A 3DE3X 2QIOA 1JVBA 4OA5A 2GEBA 1RLMA 2UDPA 1LBEA 2IA5A 5JD3A 3RUPA 3QH4A 3TL2A 3PFWO 4N03A 1C1DA 1JHMA 3A1TA 4BLSA 4HNSA 3S2SA 3LZCA 2EBHX 2OA0A 4CTMA 3PP8A 3SF0A 4IX1A 4QXAA 5A9TA 5B7PA 4EI9A 3KKKA 3LDFA 5JVDB 3UAZA 5FAKA 1L7RA 1GV0A 2WVAA 4WGFA 2XRMA 4ZVOA 2DERA 1YAHA 4JJ6A 2OHIA 3A2NA 2AJLI 1FDSA 1TA0A 3GXBA 4NIMA 5REQB 2P4UA 1NONA 3ROKA 3TR0A 4RF5A 4ZRDA 3VFDA 4IO0A 4HDRB 4KYTA 4OQQA 2J30A 4NMLA 2YOGA 3GLHE 3I9MA 3IIMA 2QT0A 4G0QA 1PN3A 3KUKA 1WMEA 4Z49A 2IH5A 2CWDA 1RHUA 4I1VA 3WV4A 4AUKA 2BI8A 4MIOA 2BDTA 4WLUA 5JNLA 4M46A 1I7LA 5DWQA 1JDSA 4ZIRA 1KBZA 3DMYA 3WADA 2NACA 4U63A 3HB0A 2JJYA 3W3ZB 1QHHA 2GZHA 3BFJA 4M7PA 2XTJA 2XF8A 5DASA 3A31A 2ZAIA 5HTKA 3H9EO 3F46A 3H2YA 2JIMA 3O9MA 3T9BA 1OIVA 5CB0A 3LDUA 2V0NA 1PAUA 3MWFA 4AJLA 3ELUA 1E64A 1AA9A 2E48A 1F4VA 2W2XA 3ORHA 4PX9A 4DQXA 2NUAA 2XI4A 3FBWA 3AVYA 5H82A 1R27A 3CLUC 3QKSA 2O3RA 4QIHA 1RKQA 5DHPA 1N3YA 4AJEA 4ZHQF 5DM0A 3DVRX 4RJKA 3EF0A 1TTHA 2CXUA 3MAAC 4FS8A 4K6GA 2O2SA 4DE5A 4OMDA 5AW0A 1ORHA 4JUCA 3ROZA 3L4KA 3GLIA 3JAWA 2FMIA 3LLMA 1SKUA 3B8HA 4BMVA 1CQWA 3H2IA 4ESEA 3LIPA 4HN4B 4C0LA 3PC8A 5DBOA 1L4GA 4HPWA 1CUBA 3QQ5A 3OE5A 3FYTA 4EF5A 3AIMA 2WWRA 4FQ8A 2W98A 3QFTA 1XD2A 5TX7A 2IPNA 3GCZA 1E2IA 3OE7A 3IUEA 4FDTA 1M66A 2GO1A 1B2RA 4M1YA 4ZYZA 4YCNA 4KFRA 2AOUB 5SYNA 1Z0IA 2WHEA 4B47A 1N2GA 2O0MA 2PTGA 1LSSA 3KYBA 5DYWA 4ABYA 2PAAA 3D2BA 2REQB 4B3FX 4MRSA 1S2GA 5D00A 4GM0A 1J97A 5TDHA 3UFXB 1EXMA 5JVDA 2NLOA 1QP8A 3IIIA 5IVIA 2QR5A 2BKLA 4HZIA 2CNLA 3ZQUA 3QUAA 2QX9A 2YUIA 2H31A 1J99A 1PKEA 1UPFA 1Z12A 2R85A 4PNZA 3UWSA 5JCPA 2JLXA 3GFTA 5IJ9B 4Q1EA 5FORA 5B1SA 4BE7B 3WLOA 2C96A 1KZ9A 2EATA 3VH1A 1R88A 3N8DA 2C9OA 2C42A 3LI2A 1C80A 3GOQA 2P9YA 4ZD6A 5HF6A 2ODTX 1JHAA 2UYYA 3AEXA 3FAZA 3GJ3A 3KCQA 2QX6A 1ESMA 1Z0SA 2CE7A 4LHEA 1XLUA 2NT3A 3ADPA 2B94A 3U40A 5EE5B 1RBQA 2GNAA 1COWA 3OBIA 1S02A 3OP1A 4PX2A 4TV8B 1SOAA 2PZAA 3QUTA 1VPLA 3DAOA 2HJGA 4L7QA 1RAHA 3BFKA 1WUIS 4KIFA 4KN9S 4YQZA 1F2UB 3QWHA 2F90A 2I7DA 3PUWA 3RIYA 2XZDA 5B2EA 2GPSA 1Q57A 1QAMA 2BAGA 2E4VA 2Z4RA 3K0AB 3NHBA 3OIGA 4J07A 5JWOA 2FPPA 1JILA 2NV0A 1ODSA 4L4SA 4X45A 2D8AA 1AMOA 4JR2A 5BO5A 4F92B 5ESXA 5JWHA 3WLNA 4LY0A 5DX1A 2WW8A 3IPXA 4UNSA 3GV0A 5IK2A 4S04A 4RVDA 3P9SA 5JD4A 1ST2A 2EERA 5FX2A 3NWJA 4IJKA 2HYDA 3M5WA 2EC5A 2NXNA 1COWD 3A6GA 3M70A 1KE1A 1U1CA 2X0NA 5LD2C 1XK7A 4D5EA 3WSVA 5C35A 3H11B 3NH6A 3G49A 2PUAA 2ZRGA 2DSTA 2I3BA 1X1CA 3UC5A 4B7XA 3RT7A 2OE2A 5F5NA 4BPRA 5I3ZA 5KNCH 4BNTA 4L5CA 4IKEA 2Z30A 2Y1KA 1XZKA 2CLOB 2WIKA 3MNFA 2PCLA 4IX9A 4HDKB 1E2UA 3K5IA 3X1JA 4MS1A 2R00A 1PR9A 3K9BA 2X5XA 2W2PA 2VOJA 3E3MA 3PHCA 2V7PA 5IDWA 2OBMA 5IK2D 3IHKA 2P68A 4AZVA 1IK6A 3WRYC 1DJLA 1GP2A 1Z35A 3GEGA 4PBSA 5SZHB 4D8UA 3K70B 3MVEA 3HO6A 2QUZA 2ZRMA 3WLLA 1GZ6A 2JBHA 1J39A 3CLHA 3NV7A 5CBPA 4H7FA 4WOCA 1O0BA 1A1VA 2FN4A 4HYQA 1NVTA 3HJCA 3KKNA 3MHPA 1VECA 3RTGA 4UTVA 1ZH8A 1OX4B 1Y1RA 2NZ2A 3H6HA 4JUIA 3ROMA 1E99A 3FYSA 3M6WA 3MIIA 4YYEA 2H11A 1JLRA 2JIPA 2WICA 3CWQA 3KXLA 3OF2A 4GFDA 3KB6A 4B5LA 4JCCA 3OU7A 1AKMA 3IUNA 3PNVA 5F98A 2EKDA 3II6X 2R2AA 2QN7A 2DPHA 3CSDA 4J94A 4LZAA 4I4CA 4IDOA 3PXXA 5J1SB 4C1BA 2HMVA 1KZYC 1VZ3A 1X7XB 1Z0JA 3D7NA 1PK9A 4M1EA 3ZV3A 1IDN1 2I29A 1HPLA 2I2BA 3VC2A 1Y3CE 5AJWA 7AT1A 2G1KA 5JZBA 1BCRA 3H2HA 1S5PA 4RTMA 1XV5A 3W5DA 1SXJD 4YTEA 3ZGZA 3KG2A 4E4RA 1US8B 2MSKA 2VAWA 5LP6A 1CJMA 1WZ2A 3UAGA 3IRVA 4C01A 3QVGA 3JR7A 4QOHA 3ONNA 5EGNA 5GIPE 5AYVA 5DI3A 3WGOA 4JJAA 1XZHA 2LCQA 3B52X 3URKA 1M2VB 2FX5A 4N9QA 3SYKA 3LBFA 4HS9A 1ORWA 2XUHA 3VR4H 1L9KA 5KX5B 3NAQA 2K4MA 4J3FA 2O0HA 4NCHA 1K97A 1X39A 2ZI3A 4P4SB 4O5AA 1H2AS 4OMFG 1VLQA 4J4TA 5I7RA 1GRVA 4C7KA 5IMSA 2WJPA 4X8MA 4UOQA 5FB3A 1OAAA 2QR3A 2ORIA 3B3QA 3BCSA 2E7ZA 4KN6A 2Z4TA 4M21A 1AQNA 2NYAA 3WZLA 3RRXA 2X41A 3A37A 2Z4SA 3PNOA 4HAOA 4XQGA 4HQFA 3TNFA 4JLOA 2HWYA 3FI9A 3I1FA 2JZNA 3C6KA 3TRDA 1WMAA 4Q15A 3RM3A 3T7IA 4D45A 4Q4CA 1JH9A 3AX6A 1BDMA 3TIIA 1I9CA 4R8LA 4EUFA 2C03A 1MABB 4K26A 5JYCA 1WXDA 1WPQA 3VO9A 2FPRA 2ZB4A 3DMRA 3LA8A 3S99A 4F6LA 3BMNA 1U11A 3LCVB 4BO3A 1N32B 2BELA 2J9RA 3EA4A 1JDNA 1KEEA 1E9SA 1MX1A 5F3WB 4KIGA 2E1PA 2IKSA 4ZU1X 3KYJB 3VYVA 2HN9A 4M55A 1X7ZB 1UPBA 1UMBB 4X20B 4G9GA 1T5IA 3FPJA 3W79A 1T6NA 2G8LA 1NR7A 1Z5WA 3OOYA 4N8EA 4GEGA 1PGJA 2QD3A 5H59A 3U7EB 4DCTA 3UV7A 2J9YB 3PK0A 4F38A 4WBNA 2BC9A 2FSHA 1E3JA 4OQMA 5E7IA 2QBYB 1BXRB 2FQXA 4HK4A 1AGYA 4JVNA 3EBLA 3WMWA 5A3QA 4IV0A 2O0JA 3IVCA 1E5XA 1NYQA 4Y30A 4HLUA 3IT3A 2OV6A 5FQOA 1A8SA 4N8SA 3F7NA 5C9ZA 5G3ZA 2ZWPA 2BEVA 4MJXA 1KZ1A 1NUUA 4TYPA 3LAWA 1WQ1R 4R7GA 4CKCA 3G2HA 4BX2A 3K6SB 2PUBA 1X70A 1UT8A 2EFEB 2WF9A 4DGSA 4QBHA 3Q2OA 5BV8A 3AKCA 3QVOA 4U7GA 3V8MA 2GXQA 5FA6A 2PNJA 9MHTA 2W2MA 1P1FA 4K9LA 4W63A 1H2HA 2HU2A 1YIAA 3PEWA 3KZ1E 1O5OA 2PD6A 3A4TA 3PE4A 4C6TA 3PWZA 2VDRB 1EHCA 1QG0A 4QTUB 3P32A 4W7SA 3UKDA 4LJ4A 4Z3KA 4OXXA 2AOTB 5F9HA 3PHBE 5JAOA 2OO3A 5LZ8A 2WZCA 4B35A 1NUHA 1I7QB 3KKZA 3PQ5A 1GWNA 3R7SA 6ABPA 1YMVA 4W9MC 2PZMA 5AVTA 2Q5IA 3QYAA 3K4QA 2L42A 4W6ZA 3GRVA 3GBPA 2QYHA 1DQZA 1ZD2P 5I7OA 4JXZA 4CM1A 1BD3A 3CVJA 2A88A 4FEYA 4N4AA 2LNDA 4F21A 2F3TA 1ZVJA 3QA3E 1UMCB 2YMQA 5MF6A 4HGOA 1E9AA 2WU8A 3M4YA 4MEAA 4X90A 3VHLB 2FN8A 1WP4A 1SGWA 3SOPA 1KEUA 1CETA 2ZRCA 2HLHA 4WQMA 1SKAA 4GC5A 4BJHB 4DUGA 4MRPA 1ZVMA 4QUAA 1QQBA 3C8HA 3FSJX 1X42A 4WFJA 3KJXA 3MM4A 1UBGA 4CMKA 1K8QA 4NY1A 3V8QA 1F0YA 4OFWA 7MHTA 2JGLA 4HEA1 4ZTUB 2GGSA 3ELWA 4TRMA 4DSUA 3H04A 3BK1A 4FOSA 3JALA 3KYDB 4V0RA 4DM4A 1PR1A 2WJ4A 1TC2A 1V1RB 3W8RA 1PR2A 2GF2A 5KNCD 3KZOA 1J8FA 3N5CA 5AKJA 3U9TA 1SXJE 1ID8A 2E3JA 2CLCX 2IHYA 1CUZA 2ILTA 3B1KA 1JT9A 4MARA 1LGYA 3L4BC 3PF9A 4M1MA 4PZ0A 5DKFA 5G53C 3T3PB 3O8NA 1N3BA 2X0IA 3U9LA 1VG1A 4PM4A 1CRZA 2DCUA 4JNCA 4ZU6X 3DHEA 9ABPA 1E3LA 4DCPA 2E6UX 3G88A 3MBIA 2HIMA 1G8FA 1DIHA 4RVNA 3PD1A 4N12A 1X7GA 5TSDA 4U9IS 3PS9A 2B78A 4QOSA 2ATIA 2PXCA 2XE4A 4ZC8A 3RB8A 4YT2A 4HDAA 5FF9A 2WD9A 2OUKA 4F4UA 4N7BA 1BYUA 5KNCA 1NWHA 2FEOA 4UBIA 1J0XO 2CFIA 2JPDA 2ZJOA 2I7TA 3A14A 1SIWA 3B8EA 4BTEA 4GWKA 4B7AA 4EBFA 1ADGA 1XTKA 3MD9A 3DOUA 1FTWA 3INRA 1QFSA 2H1SA 5CVVA 3L8HA 4DVJA 2FTKE 4R2JA 4KP7A 7REQB 2FFHA 2JFHA 2CL0X 3EA0A 2C7QA 2W42A 2OCDA 2V6JA 4N9WA 1RPAA 1Z34A 5KHOC 1M7HA 1THZA 2GS9A 2Q4EA 2ZYIA 2WTAA 3GJQA 2A1TS 2NNWB 1OXUA 5CNMA 1J2RA 3ANLA 2XAUA 2CT8A 4A0SA 3ET4A 1PZFA 4IEIA 5ECGC 3IVRA 2EZUA 2C5EA 5SV2A 2MT9A 2J3DA 4GECA 4OFZA 1WUYA 4MPTA 2X4GA 5DGTA 1C7RA 1NXOA 3RU9A 3ICEA 5EJEA 4RVHA 4DTIA 1G7TA 4C0JA 4TQUS 4C3UA 1QDLB 2ZRPA 4IIXA 3FOCA 1XNQB 4XUCA 1W1UA 2RGUA 3U4GA 4EX6A 2XQIA 3L6DA 4H08A 4BQNA 3JU3A 4U7DA 2X5NA 4OB8A 2HIGA 3KALA 4J75A 1C9NA 4LJ8A 2JAOA 3DVAB 4FXOA 1CDEA 5AESA 3UGJA 2I1LA 1TYEB 2QTVA 4LYEA 3ORYA 4QICA 5DTEA 2PS9A 3LHDA 4KRXA 1GZSA 3OAAD 5EE3A 3S68A 4JYCA 1PR6A 4XUDA 3T5GA 4M2LA 2XVYA 3ZGNA 1VB5A 2WC1A 4LFBB 4FPXA 1BS1A 3GAFA 3S2FA 2NMVA 4E4TA 2QQ5A 5GZ3A 1GQOA 4BWGA 5DYGA 1Z68A 4GC9A 2EZ4A 1DBQA 1GYQA 2WDPA 3WE7A 3N7TA 5FH9A 4S1WA 3ETLA 4KBGA 3OJ0A 4UZEA 4X00A 3TAHA 3UT0A 1FYXA 5DWDA 1W581 3G79A 4UUOA 3FDIA 4TZ0A 5ALRA 2WSSD 1D4OA 1PL6A 1UJCA 2B4QA 2ZIAA 3RRZA 1PWEA 4LMBA 4LXGA 4RQAA 3WQRA 3ZZNA 1Y3IA 2G28A 3W2EA 1QG4A 3R8XA 3WB1A 1HNZB 3EZ7A 2PEYA 4CQMB 1XX6A 5JAUA 1NOJA 4O4IF 3DP7A 3KYDA 1Z7EA 4FJ0A 4EHJA 1MOQA 1VFNA 2WG2A 3ZBQA 2XTNA 1Y8QA 2O8NA 5CXSA 5B58T 2NSJA 2EFDB 1HURA 5DRYA 3TZ6A 5IANA 5AW8A 1HE4A 3FVVA 2E37A 4NAHA 4N3CA 5JCOA 1R4AA 2AJDA 4H9GA 2IS4A 3EIEA 1NBMA 1U7TA 2LDXA 2BCGY 4XZ3A 4Y6SA 4FUQA 2FH5B 1I4DD 1T5DX 2GARA 2OT3B 2WPDA 5CNIA 3LY5A 3NETA 3SXPA 4B3MB 2W2KA 2ASEA 4XYEA 1A9YA 1SOWA 3BIXA 1SKYB 1M1UA 2AMFA 3I6YA 2JLAA 1V71A 3JPYA 3HBNA 2PLAA 2CL5A 3G9TA 3FPHA 1U63A 2CYAA 3PQCA 5HK9A 2N9UA 2XVXA 4FW8A 1GRNA 4BWFB 4EF6A 1YR9A 2AYYA 5K3FB 1HA3A 4H0NA 1E8NA 4GVPA 3OPYA 1MB2A 2RKWA 3NTUA 3OZUA 5IXJA 4YWJA 3AR4A 3O90A 3NTXA 3JAMA 2G4LA 2WZBA 3I05A 5AJXA 4MYHA 1HORA 1GPMA 1V4BA 2BEUA 3LPMA 1WVGA 2FWBA 3L8FA 5IKXA 2WUEA 1T1GA 3UHAA 2R9VA 4KDCA 1QGYA 1CU1A 2RH9B 3BJEA 3PUVA 3T0IA 5A1TA 3SZRA 1A77A 1QR6A 4ENSA 1K7CA 4FSHA 1XYGA 3KQQA 5F33A 1EFUA 3Q85A 3K9FC 2GUWA 3BKXA 4EO4A 3KLOA 2O59A 1ACMA 2E55A 1NX6A 2QLFA 2ZYTX 3IQDB 4RCVA 3ACCA 3LCUA 1NDQA 3T5PA 2FW0A 5FI1B 1EP1B 2DR2A 2RHGB 4TTSA 3WR5A 2X14A 4JNKA 4LAFA 3HU3A 5K0LA 2A2ZA 3Q9NA 1T4GA 2YH2A 1U8XX 2YNMD 3T3EA 1I2BA 4N65A 5A3RA 1GZUA 1DAKA 2VNSA 4E09A 5KTSA 4DR6B 1LJUA 5FNZA 2OFPA 4BASA 4D4KA 3AL0C 4J9VA 5F9FA 1Q0SA 4C4ZA 1F9EA 2Q29A 3FCCA 2QJRA 3DB2A 4URZR 3DYVA 4RPKA 4HS4A 1S01A 1BXRA 2OXEA 1O95C 3NVKI 2JJ2D 3SD7A 1UXJA 1YB6A 4YUAA 1QYXA 4HNHA 4A8JA 4EMSA 3VO1A 1O94D 1MO2A 1NP6A 1X7ZA 2V6MA 4YR9A 3GGGA 3SWWA 2WIGA 3M9LA 1TFRA 5BRAA 1K63A 1T5OA 2GTHA 3CT6A 3FNFA