1M33A

Crystal structure of bioh at 1.7 a
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
256
structure length
255
Chain Sequence
NIWWQTKGQGNVHLVLLHGWGLNAEVWRCIDEELSSHFTLHLVDLPGFGRSRGFGALSLADMAEAVLQQAPDKAIWLGWSLGGLVASQIALTHPERVRALVTVASSPCFSARDEWPGIKPDVLAGFQQQLSDDQQRTVERFLALQTMGTETARQDARALKKTVLALPMPEVDVLNGGLEILKTVDLRQPLQNVSMPFLRLYGYLDGLVPRKVVPLDKLWPHSESYIFAKAAHAPFISHPAEFCHLLVALKQRVGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Integrating structure, bioinformatics, and enzymology to discover function: BioH, a new carboxylesterase from Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Structural genomics, unknown function
molecule keywords BioH protein
total genus 85
structure length 255
sequence length 256
ec nomenclature ec 3.1.1.85: Pimeloyl-[acyl-carrier protein] methyl ester esterase.
pdb deposition date 2002-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1m33A00
5EIEA 5FDFA 5D7BA 2DQZA 3FYTA 2XUFA 7YASA 2Z3WA 3HRHA 1CUYA 4HRXA 3H04A 2HA5A 5FLKA 3C6BA 5ALGA 3D2CA 4LXGA 5CXXA 2JIDA 4J0IA 5AI5A 1XRLA 4DM7A 3WK6A 1ISPA 3O4JA 1GQRA 2BUBA 5AIAA 1FFAA 1OCEA 2YASA 2XMBA 1CUXA 4OCZA 4CIAA 4IH1A 1A7UA 4KJXA 4NVRA 4Q82A 2C58A 1DX4A 1TKRA 5K5EA 2QOEA 3OTQA 1C7JA 1CUDA 2PBLA 3V48A 1ZI6A 3DOIA 1VJ5A 4FFWA 5A7FA 1EX9A 5HKAA 2E3JA 3R3WA 4OB6A 5K3BA 1U2EA 4MQMA 4CG1A 3AILA 4X6UA 5HZGA 3R40A 4G5XA 4B81A 1BROA 4KE9A 1NU6A 4EY5A 5ALVA 3FLEA 1CUZA 4B9EA 3WK4A 2ZJ7A 4Y7DA 5HF6A 4X71A 2VSQA 4YPVA 3DNMA 4UHBA 3JW8A 3STYA 1QIKA 1CV2A 3R3UA 1XKLA 5CT8A 5LZ5A 5FKJA 1F6WA 3W2TA 3DYVA 1MN6A 1HDEA 3DD5A 5I9IA 2QS9A 3EQ9A 4KAJA 2WLSA 4BC1A 4GBGA 4Y2JA 3ANSA 4F21A 1F0PA 1GPNA 5EHXA 5C8XA 1TIBA 3D4LA 4BTVA 1AGYA 3WWCA 2G5TA 1G42A 1QJ4A 2WQZA 3EF3A 1ZJ5A 3G9ZA 3QMVA 1N5RA 4CCYA 4LYDA 2BGNA 5AM3A 3WKAA 5IVDA 1TCAA 1QZ3A 5D3ZA 3VXKA 2I3DA 4Q3LA 2VT6A 1UT6A 4QEKA 2YXPX 2Z5GA 5AH0A 2ZYIA 2WIKA 2XQJA 3A2NA 2HRRA 2JF0A 5I7UA 2J4FA 3QYJA 1EDBA 2GYWA 3T52A 5HFAA 5JARA 4C4XA 2R8BA 1L7QA 5BOVA 2PX6A 4DNOA 3WYDA 4RPCA 5A7HA 5AI0A 3PE6A 4UHFA 5KBYA 4Q3OA 1B6GA 1MO2A 1UK6A 3G0GA 3FLAA 4FFVA 2CMFA 4DNFA 4BE4A 1XFDA 3M82A 3BJRA 1WCYA 1MAAA 5ALNA 3CXUA 3AZPA 1DX6A 3FCYA 4Y2PA 5AK5A 3WL7A 4MJ3A 1SFRA 1KU6A 3RARA 2HM7A 3O0DA 3P2MA 1W4LA 4FHZA 2RGUA 3MGAA 5DNWA 2OLEA 4JEIA 3H1BA 1WM1A 1C4XA 4UBJA 3R3XA 3YASA 2QKYA 2DHCA 5DYYA 2XUKA 5A71A 1WOMA 1P0PA 1LNSA 2Y2VA 3MUOA 3O95A 2H7CA 4BB0A 4CCYB 3FNBA 4N8SA 3OM8A 2XQIA 3FSGD 3KOOA 4BCBA 2NW6A 5AI4A 3TRDA 4U2EA 4X90A 3QBJA 4PSCA 1WB4A 3LCRA 2JGFA 4QZVA 4DIUA 1GKLA 2QZPA 1YS1X 5JASA 2RONA 3VJLA 3NUZA 2HFKA 1QTRA 1E66A 1YSCA 2PSEA 5CMLA 3NOXA 2RI6A 1YB7A 3W9BA 4G8CA 2OCIA 4YASA 3B5EA 4W63A 5CRIA 3IDAA 4AO6A 4BP8A 4V2IA 4DTCA 3V1KA 3WK5A 1CVLA 4WDQA 3R3ZA 3G0CA 4B0PA 4BRZA 3I2GA 1XZJA 4B7ZA 4G4IA 2QJRA 5HCUA 2PVSA 2OCGA 1IZ7A 3IUNA 5C7YA 1CPYA 1LPSA 4ZRDA 2XT0A 5EGNA 5EFZA 1UKBA 4IH4A 4QLOA 1EHYA 1XRMA 4K2AA 3F9CA 1W1IA 1ORWA 4G4JA 1AURA 1LPPA 2C5GA 3QVMA 4P9NA 6YASA 2HU5A 4UBLA 1QIDA 4C01A 4F0JA 5T4BA 2PPLA 3ZLUA 2C4HA 1X2BA 2C0QA 3IA2A 5LKAA 3JWEA 3PUIA 4K6GA 2XMQA 4PSDA 3JYHA 5HQ3B 1ODSA 2WILA 3RK4A 4CG3A 2ZVDA 4ROTA 1L7AA 2VJBA 3I2FA 2XUPA 3A70A 2XMSA 5K3EA 1W6RA 3WWEA 3F67A 2JEZA 1BCRA 1CUWA 3EQ7A 2BUAA 2P8SA 2QRUA 3K9BA 3A2LA 3G02A 4MQLA 5ISMA 2WKWA 3BJMA 5JANA 1CUVA 2I78A 4BBZA 1BN7A 3VVMA 2C0PA 4G9GA 3I6ZA 4W1PA 1ODCA 2JBWA 3VKFA 4J7AA 3K6KA 5A62A 2Q0XA 4FNMA 1B41A 4JNCA 1P0IA 4Q3KA 5ALZA 5BV7A 2XUHA 4E46A 1ZGCA 4KRXA 4WY8A 5AK3A 4TVKA 4U2BA 3N0TA 2B9VA 4UPDA 3C5VA 1L7RA 4K6HA 1N5MA 3STWA 4B80A 5ALSA 4J3JA 2QR5A 1JJIA 2DHDA 3D7RA 4EY6A 4BTLA 3DEAA 1XRNA 4S0XA 2WHPB 4AQDA 2W22A 1R3DA 3STUA 5LLSA 1E89A 4FTWA 5F4ZA 1IMJA 2PSFA 4KAFA 3S2ZA 4IHAA 3F97A 3D59A 2CZQA 1DU4A 4F5ZA 2ROQA 5CT4A 5K3CA 4F60A 1UOPA 3OOSA 1HLGA 1YR2A 1XKTA 2XUDA 3E0XA 1UKCA 4TPKA 2QTBA 4C4YA 4QDOA 5ALTA 3BIXA 2QUBA 4L72A 2UZ0A 1BE0A 2FUKA 3C8HA 3G9XA 3CCCA 4DMFA 4INZA 3WL8A 4I4CA 4Y2TA 3H18A 5AIBA 2ACEA 4P93A 5AK4A 5HKBA 1CUUA 3CN9A 1ZI9A 4UHHA 3AZOA 4L3WA 1SOMA 3DL7A 4ZXFA 3U1TA 1JU3A 2EDCA 1EVQA 2WG2A 3ILSA 4HZGA 4XIIA 4AXBA 3ZWQA 2QJWA 1TCBA 5D6OA 4AO7A 3L1IA 5JAPA 4L9AA 4CG2A 4EA6A 1AZWA 2HA0A 3DS8A 2QVBA 2VAXA 2RHWA 3H0CA 4BZZA 5T4HA 4FKBA 5JD4A 4WFJA 4GDMA 1XZBA 3FCXA 4FBLA 2ZYRA 1HBJA 4MEAA 4XWGA 5CTAA 5ALHA 1IVYA 5JADA 5E2IA 1XZHA 3DKKA 3AJAA 4L0CA 5CBKA 2CBGA 2PSJA 2WJ4A 3OC0A 5JALA 1DWPA 1ZD4A 2QMQA 4BATA 1QE3A 3A6ZA 2VF2A 1YB6A 3ESDA 5JIBA 5FPPA 2QUAA 3NWOA 4OB7A 4Y2UA 3WKDA 2HU8A 4BAZA 3DQZA 3O4GA 4J0DA 1EINA 1CQZA 1RYYA 5JAHA 1MAHA 2FJ0A 1A88A 3OG9A 2XLBA 1ACLA 1ZGBA 1XZCA 1LPNA 1J1IA 4QLAA 1A8QA 3F98A 4Q34A 5K3FA 4FLMA 4LXHA 2JGJA 4M0MA 2AJLI 5K3FB 4WY5A 4EUSA 2WUGA 4BVKA 3PUHA 4GLBA 3AIKA 2JGMA 2Y6UA 4DLNA 2XUQA 4OYLA 5H3HA 5IVHA 1C7IA 1EDDA 5AM5A 2O2GA 4H0CA 3R41A 1CFJA 3HEAA 1LPMA 1CUHA 3BXPA 1CQWA 4X91A 3VVLA 1E8NA 2GBCA 5CH8A 4A23A 1QIIA 3C6XA 3WK7A 3QMWA 1W52X 4AZ0A 1USWA 3M81A 4DNPA 3IIIA 2QM0A 1DQYA 5HQ3A 3ICWA 1GPLA 1LLFA 4QA9A 1H22A 1CUAA 1UK9A 1LZLA 5FPQA 1R88A 2DHEA 2WFMA 3QPDA 4OUKX 4QDUA 2OQVA 3KSRA 4XX1A 3KWJA 1BCSA 4WFKA 4M0FA 3GUUA 3W05A 2BCEA 3WJ1A 2WUEA 2X8BA 5ALMA 2WHRA 4X6YA 3IUQA 4CCWA 3FVTA 3SWWA 2HA2A 3UUFA 2J3DA 2H7XA 3LLCA 4G4GA 3V9AA 1UK7A 5AICA 4WJLA 1AKNA 2QT9A 4MWSA 3WL6A 3SX4A 4B82A 2X76A 3W9UA 2GYVA 2XQFA 3M3DA 1RP1A 1Z68A 1K4YA 3H2KA 4BVLA 1R9NA 1BEZA 4H7DA 3TEJA 3ZV7A 4YK7A 5E4TA 4EY7A 3DDUA 4B84A 4EY8A 5ALLA 3HYSA 5CW2A 3RKSA 3ED1A 2PU5A 4Q1VA 4RE5A 2OG1A 1YAJA 1VLQA 5E4YA 5EIHA 3O9VA 4UBIA 5HF8A 2VTVA 1LBSA 1DINA 1IUPA 1Y37A 2XMGA 2YH2A 5JAOA 2WIJA 3M83A 3FLBA 5AM0A 3H2JA 1Y7HA 1WHTA 1MX5A 3S8YA 4G1FA 1Q0RA 3G0DA 3WMRA 4QDXA 4FOLA 2ACKA 2CEKA 3BF7A 5FUMA 1TAHA 1EK1A 3FAKA 3U0VA 4HAIA 2BAGA 5K3DA 4H35A 3IURA 4QE3A 4DGQA 3UUEA 1XROA 2XUJA 2HA4A 3I2JA 5C8VA 2IIVA 1P0QA 2I3ZA 1EVEA 3G8YA 1EA5A 2CUTA 1EB8A 4HVTA 2ONCA 2LIPA 3C6ZA 2PM8A 3WKEA 3AFIA 5KWIA 1VE7A 5AOCA 2O2IA 1MX9A 3BDVA 2ZJFA 4EHBA 3WYNA 1VA5A 4KE6A 1JT2A 4UBKA 3O4IA 4JYMA 2V96A 4O08A 4GEGA 4U2CA 5ALUA 2RHTA 3WZLA 1XQVA 5LKRA 3ICVA 1ZI8A 2XLCA 4KAAA 1UKAA 2XMCA 4C4ZA 4HTAA 4N8EA 4GXNA 5AKEA 4EZIA 1XZKA 1AMNA 1DT5A 1EK2A 2ECFA 3ESBA 1MX1A 3EQ8A 3H2IA 5IVKA 2WU3A 2JGEA 1H2YA 3ZI7A 2XUIA 4A5SA 4P08A 2O7VA 2PUJA 3ANTA 5LZ7A 4J03A 5EHZA 5JZBA 4IH9A 5DNVA 1XQXA 1JI3A 4JUIA 4X93A 3DJYA 1DQZA 4J0KA 5CH3A 2XE4A 4C89A 4MYDA 1QIEA 4GHWA 2XQKA 5LZ8A 2WIDA 4ZV7A 5E4JA 4I3FA 1GZ7A 1GGVA 1F8UA 4QDZA 1HPLA 1JFRA 1NU8A 1R50A 5FOQA 4H77A 4W1QA 3A2MA 3MUNA 2CKMA 4BZWA 4UBMA 3AINA 4YX9A 1AC5A 3WIBA 4X94A 4QWWA 5J3JA 2WG1A 5ALKA 5FP0A 4AN1A 1R9MA 4PQEA 1W76A 2DR0A 4Y2RA 4G8BA 3BWXA 5AKHA 3R3VA 1ODTC 5A7GA 2Y6VA 3HXKA 3ZLVA 4JYPA 3KWFA 1EB9A 3C70A 5A6VA 5JD5A 4UFNA 3BL8A 3Q8WA 4FLEA 1QTIA 4EBBA 1GPKA 3BE8A 4CFSA 2HFJA 1DT3A 2PL5A 5AHXA 3I28A 3GA7A 1SCIA 1XZGA 1A8UA 4RGYA 5EIAA 4OD0A 1VZ2A 1U65A 1ZIYA 4N8DA 1HQDA 4UBOA 2G63A 3WWOA 1XRPA 3FSGA 1JKMA 1J06A 2VEOA 4AN0A 1TK3A 2WSLA 2HDWA 3D0KA 1H2WA 3PI6A 4Y2YA 5HK8A 3GROA 4I19A 4NMWA 5BWBA 4ZWNA 2HIHA 1LBTA 1ZD5A 1T4MA 4DSZA 2XQGA 3PFCA 1H23A 3KDAA 5T4EA 1J2EA 5LZ9A 2ZSHA 3WK9A 5AM1A 5AKLA 5EHNA 1FFBA 4AX4A 1QIFA 4KRYA 1LPAB 5CURA 2V98A 1THTA 4HXGA 3L1HA 3W04A 3FOBA 1ACJA 3QITA 5ALXA 5JAUA 1S8OA 2XUGA 4BE9A 4LHEA 5ALRA 2WFZA 3C5WP 4W9RA 3G9TA 3IVMA 2ZYSA 5JATA 2G5PA 1CUIA 1MT3A 1QIMA 2VQ6A 4HRYA 4Y9SA 1Q84A 3UMJA 3H17A 1E5TA 1VKHA 1GXSA 1QOZA 2BGRA 3B3QA 4OYYA 1BN6A 4FDMA 2DQYA 1QIGA 3AIMA 2B4KA 1R4ZA 4OPMA 1XQWA 3H2HA 1TCCA 1JMYA 1AX9A 4X92A 2DSNA 4Y2XA 1G4HA 5AM2A 2WTNA 5AKJA 2VJAA 2AXEA 3R0VA 3IULA 2Z8XA 4AMYA 3STTA 3I2HA 2VATA 4H18A 3I2IA 1EH5A 2JGIA 5ALDA 5AO9A 2I03A 2R11A 1IZ8A 1PJAA 5EHQA 4NZZA 4BCDA 3WA6A 5HFNA 1ZOIA 1U4NA 3WI7A 4K5QA 2HHAA 5IH7A 4LKOA 4E11A 3PF9A 4LXIA 4AB1A 2O7RA 4EB0A 4H7IA 3AZQA 1XZAA 3I1IA 4EY4A 1CLEA 1K5PA 3C45A 5HF5A 2V9ZA 1CUGA 1U8EA 1O6FA 2V97A 1GQSA 5LIPA 4RE6A 1OXMA 1E8MA 3IBTA 2VJDA 4MEBA 2H9YA 1XZDA 3G0BA 3PFBA 5SYNA 2ZJ6A 1MPXA 5IKXA 5CXUA 1GT6A 1XZMA 4HS9A 1WPXA 1N1MA 1YAHA 3AUKA 2WTMA 3I1YA 3HACA 1P0MA 5LZ2A 1X70A 1EXWA 5AOAA 2WFLA 3FWHA 2XUAA 4W1SA 3C87A 4DSAA 4ZI5A 3D3NA 4DMHA 4ETWA 2Y1KA 4AZ3A 2RAUA 3G7NA 1BEEA 2PUHA 1H2ZA 3K2IA 4UFOA 5AOBA 1WB5A 3GELA 5K3AA 4BRSA 1UFOA 1TRHA 1ORVA 3H2GA 4M0EA 3FVRA 4DMKA 3HZOA 1BU8A 4H7HA 3E4DA 3E3AA 1CR6A 1SCQA 4Y2VA 1E3QA 3OURA 1BS9A 4P92A 3WLAA 5DTIA 5HK9A 5AKKA 5ALQA 1VZ3A 2XMZA 5ALWA 2WHQA 3PF8A 2HL6A 3QZUA 1QGED 1XZFA 4OSEA 1KEZA 1QFMA 3T4UA 3ZLTA 3HJUA 2XMDA 3C43A 4LIPD 3WJ2A 2OCKA 5KWJA 3L1JA 2PSHA 1FJ2A 4H7EA 4J0JA 2OAEA 3MVEA 3V1NA 3V1LA 1XLUA 4DNQA 1CIJA 3ESCA 1MNQA 2J3QA 4UBNA 4BDTA 5C8ZA 3H1AA 4N5IX 1Q83A 2HA7A 4BC0A 4Z49A 1YA4A 4ZV9A 3FYUB 1JMKC 3X3HA 4ARAA 3WA7A 5LZ4A 4U2GA 5JZSA 5FV4A 1CUSA 2K2QB 1SCKA 5ESRA 1K6EA 4ARBA 3STXA 5AKYA 4E14A 1CUCA 5DNUA 5DJ5A 4B0OA 4BVJA 4J0HA 4FNGA 1N8SA 2DFPA 5JD6A 2WIFA 4PV7A 5AK6A 3D2AA 1VXOA 2HA6A 2WUFA 3LIPA 4ITVA 1FFEA 1QFSA 2CB9A 1FFDA 1XZIA 4A16A 4ZGBA 1CUFA 2OQIA 2ZSIA 2D5LA 2PKYX 3QMMA 3G9UA 3VJKA 4PO3X 1MTZA 1T2NA 2WJ3A 4QNNA 4G8DA 1HKHA 3STVA 1QLWA 2QXTA 1QO9A 5D3KA 5DWDA 2W6CX 3QM1A 4FLFA 1HL7A 4E15A 2ZYHA 1K8QA 4G9EA 3C6YA 2D0DA 4LYEA 2BUCA 3TGLA 1CUEA 2PU7A 1UK8A 1XZEA 1SC9A 3B12A 1XRRA 1DWOA 1YASA 3ZPXA 1KU0A 1EDEA 4BP9A 4KACA 3DLTA 4KE8A 3OPMA 5AI8A 2GBFA 5AJHA 4W1RA 5AI9A 3FYUA 5AKZA 1ZICA 4XVCA 5AP9A 2OCLA 3LP5A 3IB3A 5FXMA 1X2EA 3G0IA 2OPHA 2WIGA 2EDAA 2XB6A 3QPAA 3D2BA 3PICA 2RIPA 5SYMA 4X7BA 2AJBA 2GBIA 4UHDA 1GKKA 3WIOA 3RM3A 4BCCA 2JGKA 4KE7A 1QO7A 4RNCA 4MYSA 5AI6A 1CEXA 4OU4A 4QWMA 1CUBA 1FSSA 4CIBA 4UUQA 2Z8ZA 4BYMA 1LGYA 4GECA 3O4HA 4IO0A 3EIOA 5AKGA 1JJBA 1J07A 1XZLA 2C5FA 1ZD3A 3HSSA 4CI9A 2IITA 2WJ6A 4J0CA 1M33A 3I6YA 4X6XA 2Y2UA 1LZKA 4FMPA 4TGLA 2H1IA 4Y2SA 5ALIA 3F8SA 4KYVA 2OGSA 3W06A 1UXOA 4GI1A 2FX5A 2HU7A 1R1DA 1FFCA 4OB8A 3VISA 4H7FA 1K63A 4PNZA 1E8DA 2ORYA 2VA9A 1YCDA 3RLIA 1I6WA 4Q05A 3V1MA 4UHEA 3D5EA 2GYUA 1W75A 4OU5A 3FBWA 2J4CA 3I6MA 2AJ8A 2XI4A 3HABA 2WFLB 4ZREA 5ALFA 3WK8A 4X00A 4GW3A 2AJCA 5BWCA 3DL4A 3HLKA 1VA4A 2HA3A 5T4FA 3GFFA 5CT6A 3GBSA 3KD2A 2VAVA 1PFQA 4DYHA 3SC2A 5I8PA 2XMRA 2YYSA 5AKXA 3IUMA 4WCVA 5CT9A 4HXFB 3AIOA 4D9JA 5DLPA 1IUOA 4MXDA 1VXRA 5LYYA 2VT7A 4AMZA 1IUNA 4HXEB 2BFNA 3E1GA 3F96A 3GZJA 3HC7A 4X95A 5JYCA 4GWLA 4WFIA 3Q0TA 3CN7A 1NX9A 5FRDA 1UZAA 5ALPA 5A2GA 2AJDA 3R3YA 5EI5A 5YASA 4PF1A 3BIWA 5ALJA 4C87A 3WWPA 1G5FA 1JJFA 1DWQA 3QH4A 1OILA 4C88A 2ES4A 1WHSA 1LPBB 3H19A 2WUDA 2GZRA 1BRTA 4XJVA 4K6KA 5KREA 5ALOA 4PSUA 1ZJ4A 4X85A 2DCMA 2BKLA 2X5XA 4U2DA 3SK0A 1AUOA 2WM2A 3BF8A 4IQ4A 3FYUC 2XDWA 4X3CA 3DOHA 2QXUA 1ZD2P 4KEAA 1Q0ZA 1QONA 1YS2X 1G66A 1MU0A 5CT5A 5HF9A 1QIJA 1XLWA 4BDSA 2OXEA 2G4LA 1MNAA 3I2KA 3QPCA 2BJHA 2WU4A 2FJPA 1VOTA 4B9AA 1TQHA 4J0GA 3WKBA 2OAGA 4Y2QA 1ZIXA 1CUJA 5AM4A 3N2ZB 4MWTA 1WPRA 1XQYA 5DYTA 3WQHA 3WZMA 3LIIA 1RWQA 5DYWA 1UOOA 1ETHA 2WG0A 3DCNA 2GBGA 4NS4A 2JEYA 2B20A 3WKCA 4FBMA 1LPOA 4X97A 1UWCA 3KXPA 1VE6A 2WHPA 2Z3ZA 4JH0A 3LS2A 1XLVA 5ALYA 3TJMA 2JGLA 1O6GA 4BAUA 5LP1A 2B61A 2H7YA 1H2XA 2C7BA 3DKRA 4KR0A 4N5HX 4B85A 2PSDA 4PW0A 5CH5A 2CJPA 4DMCA 2HADA 1DTEA 2OGZA 4H7JA 4UFPA 4B6GA 3O9MA 1UOQA 1YA8A 3CCBA 4FWBA 2OGTA 2EEPA 2VJCA 4BAGA 4WDRA 3VJMA 3WL5A 2GZSA 1PV1A 3WWDA 4C6HA 3EBLA 2XUOA 5C81A 3PDCA 3C8DA 4H7KA 1MJ5A 1XRQA 1QIHA 1THGA 2O2HA 4QDTA 5AKIA 1A8SA 5ALEA 4B83A 5DTJA 1Y7IA 2HRQA 1AQLA 3ESAA 1JU4A 2IX9A 4U2FA 1WB6A 1EI9A 3IUJA 1D07A 3DYIA 3VDXA 1CRLA 3HI4A 3NGMA 3BDIA 1F0NA 5JZ9A 5IVIA 4AO8A 4UHCA
chains in the Genus database with same CATH superfamily
5E2BA 2CK3D 3OQMA 4REOA 5BORA 5D7BA 1J0DA 1DX9A 3LUFA 4RD0A 4ABYA 1HO3A 3D8UA 4FXPA 2XTJA 4ZI2A 1OYOA 2OP1A 3OU7A 2GZAA 2IU4A 4F71A 1DCTA 2XUFA 2UZ1B 3PQ3A 4EPTA 4Z3KA 1SKAA 2PXCA 5JH7B 4Z8YA 5LWHA 3HRHA 1CUYA 5AVVA 3H04A 3T3MB 5LQKA 2HA5A 2W9XA 3C6BA 1Y5IA 5ALGA 3ROEA 1SPBS 1XN1A 1NMXA 2GYYA 5FI5A 3KR9A 5GONA 3TZHA 2JIDA 2EATA 3I42A 2VJQA 4DM7A 3DMDA 1U2SA 3WK6A 2XVMA 3OPQA 1ISGA 2GN2A 3O4JA 3H5RA 1E63A 1RWNA 2E4VA 1Z88A 4OKIA 4UQOA 5AIAA 4IUDS 1U7XA 3OD1A 4J6FA 2YASA 9ATCA 3INNA 2O5VA 4QYSA 2C5BA 2ZWPA 1VIAA 1C3EA 4JC0A 4M8SA 3DC7A 3U7GA 2ATCA 3ZOZA 4IH1A 4NDAA 2LDXA 3R7BA 3HZZA 4EIWA 1EHCA 3AONB 3NTLA 1GPDG 2Z6VA 1JXOA 2WD7A 4JEUA 1Q3KA 2OEPA 4IFBA 3N07A 2WOJA 3COVA 5KQRA 3OQNA 3C3MA 2PBFA 2WD9A 4OQZA 1N92A 1CUDA 1FEZA 2PX8A 3DAFA 3EPRA 1ZI6A 3EUWA 4N0MA 1PRYA 1DLJA 3AU8A 1ZS9A 4L76A 4DDUA 4BMZA 2YS6A 2UZIR 3SZGA 1L6IA 4JBWA 4DLVA 3O83A 4U63A 3THXA 3QX8A 3G17A 5CFRA 1Z18A 1ZQ1A 5E1BA 5TS2A 5HKAA 4OB6A 2QAJA 3GJ5A 1U2EA 4EPRA 3FPEA 2A1TS 3OMLA 4CG1A 4O4LA 5U1PA 3L1VA 3VI4B 5IXJA 2OHHA 3W2IA 4HVLA 5K7SA 3AF2A 4B81A 1CY8A 1B3BA 3EVFA 2EIHA 3MCTA 3T3PB 4L02A 4EY5A 1RAEA 5DXFA 3WGHA 1SCJA 3FLEA 1CUZA 1IULA 4MR8B 2B2XA 1K08A 1OLXB 1GPAA 3RYFA 1NLFA 3IP1A 4JP2A 3NS7A 4V0MA 3SS7X 4B9EA 2RG1A 4AJ4A 2FMUA 2BGLA 1CETA 5HF6A 1AKEA 3IOYA 1KORA 4X71A 1EGQA 4ZDWA 3FGZA 4Q4AB 4E21A 1RM5A 1R4NB 4N3CA 3TFQA 3ZU6A 3GWGA 1JEJA 3I1JA 421PA 3MTEA 1P2GA 4HDSB 3OH8A 3NORA 2ZJZA 3UK1A 4FDUA 5BSEA 1K6XA 1XAJA 3QV2A 3TS1A 1XJWA 3W3AH 1FTWA 3EW7A 3DB1A 2QD3A 1WMEA 3JU3A 3ZE2B 1BC5A 4P0QB 2C8JA 4IXDA 4HUQA 3T7KA 2AC2A 4H27A 4IHJF 1OD6A 3EXHC 2E87A 1VRVA 1YRLA 2QZ4A 3FPSA 3FTFA 1BG6A 4PO1A 2CGEA 3QLVA 3SYMA 2OBXA 1L5LA 1GCIA 3DD5A 3IBCA 4WZZA 4HADA 2AEFA 5HBGA 1PFVA 3R23A 5LQAA 1K7FB 1NIJA 4DLSA 1HGXA 4G1CA 4RJJA 3TTTA 4F46A 3GP8A 1KFKB 4JUBA 1W85B 4DMRA 2IVZA 4KAJA 5B5SA 1BAPA 1Q3HA 2EW8A 2IDZA 3ROPA 1HV8A 4X7RA 4BC1A 1EVYA 1TMGE 1VSUA 3ANSA 4TLEA 4Z9BA 4F21A 3O84A 3RUDA 1AG9A 3MTDA 1F0PA 3WE7A 2C31A 4DFDA 3EOAI 1MOZA 3LM8A 3EGVA 1GPNA 1Y4DE 3SLRA 1N0IA 4J0FA 1NBHA 4FZ3A 4AKSA 3EC1A 2IH5A 1XL0A 1FTSA 1MKYA 4TMTA 1AGYA 3HNOA 3WWCA 3K30A 1LB1B 3HUDA 2COUA 4P4SB 4XD7A 2PGDA 3DBHB 3TLYA 4CMKA 1P33A 4QQKA 5EMHA 4K81B 1QZTA 1NN1A 1P6QA 3LYHA 1ML4A 1NXPA 1ZJ5A 2HRCA 2JKYA 1BQ3A 2EFDB 5TDHA 1L1FA 2GN6A 3MTAA 4EPXA 4F2GA 2A5LA 5DE3A 1N5RA 2JPDA 1XQ9A 2PUGA 2P41A 4LYDA 2YUIA 1ZGJA 5IC4A 3WKAA 2OD9A 1Z8DA 2PUCA 1EP2B 1PGNA 2UV8A 2HUPA 3CPEA 2C2MA 3EHEA 5KYYB 2R8XA 1GFIA 3A3NA 3QWIA 4FUTA 4Q3LA 4EPVA 4O4JA 1UT6A 1SKYE 2P4EA 2YXPX 5AH0A 4YMUA 2B21A 1YGYA 1M6WA 2FE1A 2QENA 4Y6GB 4GF5A 2BGIA 2C88A 1NI4A 2WIKA 3CZAA 2BEJA 1BKYA 4LZWA 3Q7PA 2ZIUB 5C2JB 1L3CA 3E7DA 3TL3A 3IBFA 2JF0A 3K6SA 1MO6A 4I9NA 2J4FA 3IMKA 1ZXXA 4MR8A 1XR3A 2I1WA 1EDBA 5CM9C 1JQEA 1PEYA 3E3MA 4IJKA 4OGGA 2O2EA 1TTPB 2P1RA 3BORA 4I50F 5EC8A 4ZC8A 2QX9A 1LSOA 3OMXA 1NI5A 4MRMA 1P5RA 5JARA 1B1CA 1D0VA 3LLSA 4NU5A 4GRDA 1V45E 3N6VA 4LNHA 4AYWA 1DAGA 2O6LA 2R8BA 4MMXB 1O9GA 1XA3A 3RTEA 4IGFA 3S70A 4C4XA 4C7VA 4D42A 5JWOA 4DNOA 1U8YA 5J1TB 4W8GA 5PNTA 4OHZA 4RPCA 1V7CA 1A27A 1C81A 1JDSA 3IAUA 4JBXA 1GTMA 4Y0VA 5A7HA 4BFWA 2FU5C 3H13A 4L4SA 4DA7A 4EKNB 1EUYA 3I62A 4NQZA 2QV7A 3AERA 5CHYA 4UHFA 3MTIA 1RADA 3BD8A 4I66A 4QOFA 2ECPA 4LQLA 4TTSA 5A3RA 3EA0A 4MGIR 4CLOA 3QPBA 3E22B 1RP7A 1W4BA 3S2FA 4UUAA 2E85A 1F0YA 3BSFA 1UK6A 3FSEA 3G0GA 3BT7A 2FSVC 2LGJA 2ZFUA 4Y98A 3M82A 3ZDRA 4LC1A 2A5YB 3ZW9A 1WCYA 1XPOA 3HU2A 4H3SA 5DP1A 3GLHB 1JHDA 1Z5ZA 1W5AA 3CXUA 1DX6A 1K3FA 2P5SA 2B7LA 4D96A 4DLRA 4PLWA 2PRSA 1SXJA 3RARA 1W0KD 2B1IA 3P2MA 1RQRA 4JUCA 4XR4A 3VDMA 5BSWA 3GLQA 1XC7A 3O4RA 3K71B 3FR7A 1W4LA 3Q5GA 2FDRA 3MGAA 1ZJYA 4M46A 2ZW9A 4DL9A 3C74A 3RT9A 4MDHA 3WGMA 3H9GA 3K2BA 1ZWKA 1C4XA 4P3OA 4QO7A 4R8LA 2YMMA 2L18A 4W7IA 4ZEWA 4EA9A 4Z5XA 5C7OO 4JI0B 3AUYA 2GM5A 4B46A 1PU2A 1DZ3A 4FJ1A 4MUNA 4C2UA 3WYEA 2Q3JA 2W2LA 1JEOA 3ICCA 5DLEA 5C1BA 2XUKA 1P2VA 1Z6GA 2YUTA 3MIZA 3MT8A 5DF1A 4E2FA 1TXGA 2QNRA 1SBNE 1S3SA 3GVHA 1HZZC 4MGYR 2I6UA 1LNSA 2Y2VA 1U5BA 1MO3A 3MFYA 1T15A 3MUOA 5E3JA 1A9RA 1P4GA 2HZBA 2KI5A 3EG5A 2IYPA 4MR9B 1SBQA 3FNBA 1LW6E 3OZDA 4N8SA 1E69A 4IRUB 1ZBDA 4BNLA 1RXSA 4EFNA 1K89A 4Y3UA 4IUBS 4M53A 3FSGD 3HY4A 2G9VA 2KHZA 3QTLA 1T2UA 2EJCA 4AIRA 2GZHA 5LA6B 3O8CA 2VP6A 2ZJBA 5DU2A 4DILA 3NOVA 2LIVA 3RADC 1OXUA 3G7SA 4QJ4A 1KARA 2W2KA 4N82A 1XWFA 3E15A 4UEWA 2F67A 3GJ7A 3BIFA 3O91A 4I5IA 4KH0A 3QBJA 1JB9A 4LWPA 1N4AA 2H0RA 3SG0A 4QZVA 5HE8A 1HA3A 1YS1X 2BFDB 5REQA 2RAFA 3WNBA 1NVXQ 1WP4A 3Q7TA 5JSYA 2ORWA 3T4XA 4CM4B 1T2FA 3NUZA 3FCCA 1Y82A 2JBAA 1BX0A 4DDVA 4PCUA 4MV7A 3R7AA 3LX5A 1E66A 2VF8A 2IODA 3OFSA 3OVMA 4BP3A 3ZD8A 5CMLA 5J4YA 3OZAA 4QDKA 5DFAA 5FX2A 4G23A 5J43A 1JNYA 5KAPA 3HCBA 1SBZA 3T06B 3W9BA 2C9OA 2WWFA 5KNDH 4XM2A 1AHNA 2ZCJA 1JLLA 1LRKA 4HDMA 1V37A 4PBRA 4Q6WA 4I6GA 1I6MA 1ORRA 1TL7C 2X2EA 4B8WA 3V1KA 3TVDA 3WK5A 3ZW8A 3QVKA 4UQLA 2BTOA 2OGWA 3R3ZA 4HQ0A 2VHXA 4NESA 1G7TA 4H16A 1S9HA 4PCVA 3P9QA 1R4NA 4B0PA 4IKOA 2ZUSA 3I73A 4C0KA 1R0KA 2H2GA 5FUBA 3RG8A 4UQPA 1XZJA 1OLUA 1I51A 2DHRA 3RYCB 1Y1TA 5EY5B 2CMGA 4R1TA 4JC8A 4G4IA 2CYAA 1TUBA 1R66A 4HLUC 1T8WA 4LXYA 1E1CA 1NNUA 3E9CA 4P82A 4HC4A 4AUMA 3PI7A 2IEGA 5DLQC 2C5LA 2WAAA 2X3UA 5EFZA 4C0WA 3L82B 1TJYA 3GXOA 4M9SA 1WPGA 4U7TB 5BSFA 1PCXA 2FE4A 5HRUA 1C8KA 2AC4A 4ZVSA 4ZOLA 2M6SA 4TUYB 1GR0A 1IJFA 3EDMA 3ZD6A 4IOJA 4YJDA 4C3VA 3VHXA 1H0HA 1TZBA 3QELB 1S7GA 2R7AA 2VXOA 4QYIB 3HR8A 4MUFA 1NF2A 3HB0A 1N3LA 5MN5A 5J2TA 4GXRA 1X86B 1C2TA 4HR7A 4DRXA 3H2BA 4JR1A 1LPPA 2NQ8A 2CV0A 4R2JA 2WMOB 3G5UA 4GM4A 4MVJD 5BXYA 1V2HE 2XJ9A 2R1VA 1Q0QA 3EZ6A 4BLSA 3DZIA 3QVMA 1Z12A 5LXTB 3P97A 3L0ZA 2JKVA 5LLDA 4BFSA 1LDMA 2HMYB 5K99A 5CB4B 1M6VB 4HDQB 5EE5B 3V7FA 2HU5A 2W2QA 4ZIRA 4DIOA 2BMVA 2IZ5A 4HEA6 5ICCA 2ZYWX 5FTMA 3TNDA 1R0ZA 3NT5A 3K8QA 1C1XA 4OKSA 4RSMA 1M66A 3ABRB 4HDMB 3GMIA 4U39A 2CUZA 5LMNB 10MHA 2IY7A 1GRCA 2OPBA 2X5KO 4U5QA 5H4GA 5IWAB 1RABA 3JWEA 2ZULA 3WLPA 2G77B 1H66A 3PUIA 3QIAA 2C2HA 4QTZA 3I9OA 3F7TA 4V0RA 2DFLA 2I54A 2Q6VA 3GC6A 4E2XA 4LF6B 2YWCA 1EFVA 3FPKA 4B4WA 3WGIA 1TZ2A 5E9AA 3CPSA 5B7GA 3JYHA 3CLTD 2BRUA 1BFDA 3HZRA 3PITA 3IUYA 1Z4IA 3VHRA 2CXHA 2FHPA 4WK2B 3RK4A 1U8TA 3JASA 1G59A 3DHNA 4RKEA 1VPLA 4BJHB 1DFHA 2C7OA 2D1FA 1QGDA 2E4YA 2A33A 1Q5PA 3QKRB 4PPFA 3QKIA 3EZLA 4KIFA 2NO9A 1CRWG 4UTRA 2EJVA 1BCRA 2QW8A 3DZHA 3QEJA 4BPRA 2BUAA 3NEAA 3ONDA 4DSOA 3KSMA 3UJAA 3IAAA 4PINA 2VDVE 3TKAA 3VR1A 3ZHOA 2ZSEA 5I7EA 1GAQA 2CEAA 3CX8A 4YR9A 1IZYA 1P3Y1 3KYCB 4GP6A 4UDXX 3B38A 1QLHA 1N7IA 1QKIA 4L57A 1QQTA 4IY1A 3V55A 3HI6A 3JAWB 2WFAA 1N1EA 4XOIA 4CKBB 2ZUWA 1BE8A 3FNRA 3CIFA 1RIFA 1TEHA 3F71A 4RELA 4AF7A 1CUVA 2O2JA 3B7WA 3OTOB 4AS1A 1Q14A 1W25A 3H2ZA 5IJAA 3KAJA 3R6GA 1YFKA 2P68A 3B36A 4HV4A 4M1SA 1RZUA 3KD3A 2XYGA 1KMNA 4MV9A 5DZSA 3T5BA 1MJFA 4XE5A 4W1PA 2KMLA 3NDIA 1Y48E 3WBJA 5E7JA 3CWQA 3GP5A 2B30A 4KODA 4HBGA 2CFSA 3HWSA 3JD1A 2OK7A 4L16A 3K6KA 4L6AA 4TTAA 5A62A 3IT2A 2Q0XA 3C48A 2ZYDA 4FC6A 1BQ4A 1IC6A 1E1DA 2ET6A 1P0IA 3QYFA 4JNCA 5ALZA 3HKEB 1NR5A 4O02B 5HZKA 4UAGA 1Y98A 2O5EA 1G16A 4LJKA 3DWGA 4Z9AA 2CL6X 4HB4A 4E46A 2P2DA 4LPSA 1A8PA 3RC9A 4CDRA 5AK3A 3AX6A 4Q3DA 1NHWA 4TVKA 2NGRA 2PH3A 3BXFA 3TTSA 3OAAA 3L2OB 3F5QA 5J4VA 1U11A 1YQUA 2P9GA 4UPDA 3BH6A 2VJKA 3L9XA 3OZGA 1Q95A 1JHXA 2GNPA 3AERB 3STWA 2A8YA 4TVOA 1BMDA 2FVYA 1BMTA 4G0NA 1YJBA 4FDLA 4MVCA 5FOXA 1G21E 4IW3B 4EDHA 1YDFA 2VP9A 4DBLC 4DVJA 3MNFA 3VKVA 3I04M 3K31A 3K9HA 5ECYA 2C5HA 3U4IA 2WUVA 3V3KA 3W9SA 3JY6A 2QR5A 4XI9A 3IVCA 2Q50A 5JRDS 3L43A 2H0AA 1QOPB 3L6CA 1YC5A 2HMSA 3OLWA 4R1QA 3UUGA 3D4PA 3ZDCA 5SY6A 5I01A 3V8BA 5E9WA 5PGMA 4S0XA 4MINA 3H1PA 4AQDA 3TZCA 4EJMA 2IS1A 1B3RA 1Z5UA 2W22A 3IUSA 3KJQA 6GPBA 5LLSA 4BHTA 5CIWA 1A8IA 2I9PA 3KAQA 4KWHA 5KYVA 4JJGA 2Y0PA 4BJ1A 4IHAA 1OFVA 1AGRA 3KQHA 2DR2A 4NARA 4M37A 1PN3A 4TMFA 3WLQA 3LC7O 3V46A 4DMUB 1XG5A 2ANCA 2O1XA 1V11A 4F5ZA 2ROQA 4JLKA 1N2SA 5K3CA 1NXQA 3HMQA 4ZTBA 3ZGOA 1CEQA 2LR0A 1EA7A 3BWEA 4GL4A 4MA0A 3RU7A 1YR2A 3WHLA 4ZQFA 1JPJA 5EUQB 1APBA 4FYWA 3CUKA 1IRIA 1UT5A 2XUDA 4MICA 4CTJA 1NZFA 3E0XA 1TJ3A 3P94A 5E6UA 2FSHA 2PWAA 1TCUA 2AG0A 2G8NA 3E5RA 3H75A 4WX2B 4B6JA 3PLRA 1AGXA 4BS9A 1Z2OX 2A0KA 4G97A 5SV2A 4DJAA 1A71A 1ETUA 1UBOS 5DB4A 3DBHA 4EJ6A 3O4FA 1WMDA 2AOUB 4YACA 4BUJA 5ALTA 1GPH1 3Q3IA 2QZSA 1CULC 2QUBA 4WZAA 2WKRA 3GO4A 1BE0A 1LK0A 1KYVA 4IDPA 5LD2C 4Z4IA 2Q8PA 5D87A 2FUKA 2E5WA 4Z9YA 4DWVA 1MFPA 5IAEA 1WD5A 2GH1A 3C8HA 1A1VA 4NFLA 4UJ3A 3W1WA 4FE3A 2E7ZA 3GT7A 1DAIA 3ZDBA 2NTVA 4I4CA 3RRZA 1U8CB 3ZWYA 4A8TA 1YHZA 5ICEA 1VJ0A 1ODFA 1BO6A 1BJKA 1QE5A 1FDOA 3CRNA 2EBUA 3SIXA 2Z9BA 1XWIA 1I4TD 1VL0A 1YBFA 3UICA 2H2HA 4DDWA 4NZOA 1W7AA 4Y2TA 3ZJUA 1L4HA 5LLTA 2WSSD 3ND8A 4H3HB 4IOMA 3ADDA 1RFGE 1N0VC 1TQ8A 4L5YA 1JDVA 3ZLJA 1WMBA 4FSHA 4DZRA 4QFCA 1QNFA 2PRZA 4P58A 5HKBA 4MTCA 1S0UA 4QVKA 2FEKA 1QZZA 3R7WA 3TKYA 3FKSD 4ZYWA 1ODLA 4H1UA 5IVPA 1X0XA 1YHYA 2H7VA 3N0VA 5B1EA 3CWZA 4L3WA 5E6RA 5ANRB 3DH0A 4ZDIA 4X54A 4RD3A 5E4FA 4CKWA 3GT3A 3UK7A 3D8HA 1RYFA 2NV2B 3ZHZA 1KIFA 5G0SA 3CSDA 4IIJF 5AOVA 5EXPA 3ILSA 5F33A 5DI9A 3R7LA 4L8YA 5C31A 1DOAA 1F0KA 4A0QA 3RVMA 4PGFA 4AXBA 3DLBA 1A9XA 1S4MA 1TCBA 2SKEA 3TOCA 4X66B 2JL1A 1CJVC 2NQ2C 1XDWA 4TM7A 3ZLBA 1PL8A 1TPZA 2UVQA 1AS2A 4J4TA 1CRQA 1Z6QA 3R6WA 1UDWA 2UXBB 4PZ9A 1Z33A 2N1MA 5JBNA 1A4RA 1AQUA 1AZWA 1L4MA 2ZZMA 4GGOA 3E9MA 2QZJA 3ND5A 3RW9A 5JPCA 2ZRIA 2ZJ5A 4H0NA 3DS8A 5JDCA 1HDCA 1VPEA 2QVBA 3KQNA 2VAXA 5EJ4A 3T5AA 2Q07A 4AJOA 1BMFD 2RHWA 3BMNB 1SD5A 2C3MA 2Q49A 2ZOSA 5JZOA 2ZRGA 4H4DA 1BOFA 2JGDA 3W77A 4BZZA 2O8EB 3FXAA 3R7DA 3X2EA 1I3LA 3VYTB 3TXAA 2HIAA 3GAMA 1QR2A 2BFOA 3N8IA 1NNSA 4N6OA 4AJLA 1UXHA 4GYYA 3U62A 2IYLD 4PVCA 4HDNB 4FBLA 2BLLA 1GLNA 2ZYRA 3NT2A 1HBJA 1ZK2A 4K87A 3RREA 4R0VA 1UJNA 4D9GA 1FYEA 3QU7A 3GLFE 1XA0A 3IBSA 2P2NA 4I2VA 4O1HA 2ZRNA 2E5FA 4IX9A 4NBKA 4QASA 1XRJA 5CTAA 1E98A 1PNTA 2NACA 4Q7KA 1U1IA 5JADA 2GR9A 5HMMA 3U6KA 2X23A 3S8MA 3AJAA 2GPWA 4W8HA 1OH6A 2F3SA 5B6IA 5E1OA 2CBGA 4LCJA 2BVNA 4GI3A 2WJ4A 2XDQB 3OC0A 2ZKIA 3UO8B 2X6QA 3QVJA 4CKEB 2BM0A 2ZB4A 1D4FA 2IZ6A 3IP6A 3KAPA 4DLPA 4Q4CA 2QMQA 4QYXA 2BFMA 5FUWA 2DTXA 4ESHA 5KKNB 4XVUA 2L69A 1RU3A 1WCIB 4LYFA 1SQ0A 3WYCA 3D6NB 3BX1A 3ESDA 3UWOA 4H7PA 2N0SA 3OHMA 1BHSA 1OLSA 2VYFA 2VHTA 3ERCA 1BKSB 2YHUA 3MBOA 5BWLA 1QLJA 5KNLA 1BHQ1 1RKVA 2Q3HA 3R44A 4FI3C 4MQ5A 3N39C 4U02A 2ZPUA 1NDUA 4TV8F 2YY7A 2GX6A 4ZJYA 4QAQA 4P36A 4J0DA 3DE4X 4URUR 1CQZA 1EKXA 5EP1A 3J81k 1UC9A 2RJ3A 4NEHB 1TM1E 4R2MA 5F2KA 1Z4LA 2BHTA 2FJ0A 2YWFA 2VHQA 3TD9A 3RLFA 5DEIA 1NUAA 3AVYA 2X4DA 3LUHA 5IZCA 1NPDA 5CNIA 4HQOA 5CVEA 3G88A 1T9AA 4B3RB 1DZIA 2X7JA 1D3AA 5JEEA 4ASUA 1XZCA 4QXOA 1VLMA 1N2CB 2NYUA 1P72A 3F98A 4UXHA 3AY3A 4X65B 5AVXA 1PFUA 3ST7A 3ZK9A 3RVDA 4B87A 4S05A 2WJJA 2FPPB 4RHFA 1XQ1A 4CMIB 5K3FA 5TPWA 2EU8A 4MROA 1M0TA 3MPOA 3NC0C 2K5UA 3F0TA 3TZLA 4M0MA 5K3FB 4G0QA 4EUSA 3TCNA 2YS7A 3BFVA 3S8EA 2V55B 5AJYA 5SZIA 2BHRA 2KBEA 4HVCA 3WLHA 3AF0A 2WUGA 3OSUA 4OHOA 5DSTA 4B6EA 4E5KA 1B74A 1CK4A 3HWX1 1WY5A 3OJOA 2KWIA 2O2ZA 3A3YA 4E5MA 2BYTA 1EK5A 2JGMA 4HLUA 1XK7A 4WASA 4HKTA 2RCYA 4OYLA 1I33A 5AESA 2OO5A 1G8YA 4QFDA 4RGQA 1EDDA 5IVHA 1NLMA 4P32A 2GJAA 2PLFA 2QTTA 4H6WA 4IBOA 3TUIC 1HFKA 4JMLA 3BXPA 3ETHA 4X91A 1Z29A 3RSZA 1E8NA 4MP3A 4YUWA 3ZBUA 3JQ8B 5FULA 5KMGA 4M36A 4IFTA 3L9WA 4A23A 3C6XA 3CRZA 1B15A 4DZTA 3I1FA 1W52X 3QMWA 3N86A 4NCHA 2VK2A 2HIGA 1CZNA 1F8YA 4YAJA 4EPWA 4H08A 4JL5A 3PZBA 4PGHA 3HB9A 2OO3A 3KT6A 4AZ0A 2CFCA 3VGPA 1QK5A 1RPJA 2XTAA 2SBTA 1I4LD 4U7PB 5IAOA 1DRJA 1Z7YA 4G5HA 1CIVA 1OT3A 2QRZA 2V4ZA 3ZY3A 4IXNA 2JLRA 1INLA 3AL0C 1M9NA 3ENWA 4BV8A 1N25A 4IKPA 4KO2S 4MVJE 4CMJA 2PUBA 1DQYA 4K28A 1NBOA 1SUAA 4TQUS 4G0XA 4C4AA 1ST2A 3BM5A 2F3PA 3N8KA 4AUEA 1ZCAA 4G0YA 3CMCO 4IIUA 1CUAA 1LBEA 4N3AA 4REMA 4CF4A 4RULA 5DTMA 3JVDA 1EXDA 1LZLA 4H59A 4LRUA 3SC3A 1R88A 5G2OA 4S1OA 4CEJB 3M9WA 3O8BA 1USVA 3GZ4A 3SD7A 1OI3A 4I9GA 4ZVRA 5JYDA 1QRRA 1MXFA 3UWPA 1WA5A 5CFLA 4QDJA 1BCSA 2GO7A 1Y80A 3EGIA 5KOHB 4WKCA 2XHEA 1F5NA 2HF8A 4M0FA 1PSZA 2OKGA 4P7BA 3GFPA 3QXXA 1CJSA 3RYIB 4F4DA 1A4UA 1MMFB 3PVZA 1QVWA 2WW8A 1NDHA 2X8BA 1Z36A 4KMOA 4MVJG 4RANA 3SXPA 2QMHA 3QEBZ 2PY6A 5F9HA 2IP4A 4EYGA 3HH8A 4X6YA 4E0BA 5BSKA 1FNDA 2O7QA 2QY6A 3IUQA 3RFVA 3DMYA 3CEPB 5HP4A 3KUKA 5D5HA 2ATIA 2X4LA 4C3ZA 1FC0A 4GQBA 1Y0BA 1VJRA 4J0EA 2ONYA 1TQDA 1J0AA 4IV5A 3X2SA 1DHRA 2HW8A 2EV9A 2J3DA 4H3KB 4HDCA 3WHPA 4XWKA 2A78A 2GEKA 1M73E 2O2XA 2W00A 2WSSA 4GMGA 4OIFA 4P80A 3U7RA 1S1CA 1I36A 5LNK6 1T6XA 5LUAA 2NTYC 3IPLA 1JXMA 3QWAA 1FP4B 1JH8A 1UJ5A 2V7VA 5BR1A 4L5IA 5JI2E 1AN0A 4M1KA 1K8ZB 4GBJA 4PG7A 1XHEA 2P2YA 4M6WB 5AICA 5BSUA 4KQ9A 4RJKA 2FRVA 4UVHA 2WNSA 4CR7A 4X1KA 1UM9B 4I5EA 4XTRA 5EKXA 5G02A 3WL6A 1H65A 1JEAA 1DAKA 2E6UX 1WMSA 3LT4A 1YI1A 2QORA 4BY9E 5CHEA 5FWYA 1T0BA 2ZSDA 2XQFA 1FRVA 3H8WA 2AI3A 3NM4A 5WRFA 1K06A 4IQGA 5DYIA 3ADCA 4P35A 3M3DA 2TYSB 1GGHA 2GD1O 2VDMB 1FLNA 2DBZA 4D80A 1RWWA 1Z5VA 3COYA 4HAWA 3O7WA 2PJUA 3TEJA 5KQSA 2DQ4A 3HV2A 2IS2A 3L02A 3AVQA 4M1OA 4R1UA 5AD1A 2OCYC 3AF4A 4K03A 4E2YA 1NUPA 2MYPA 2IX3A 1I3NA 2XNDA 2FYTA 4FGWA 3VR5H 3DDUA 1NYRA 2CJYA 4NMMA 4FMDB 5CEJA 5ALLA 4CXMA 5NULA 3TLJA 2YQ5A 5EWLB 4PIVA 5LQDA 1P2UA 3R2JA 2JLQA 1XNQB 5EKSA 2PU5A 5BQXA 2D4AA 2HQRA 4TZ0A 4Q1VA 4Q1DA 1E6UA 1QCCA 3RHZA 5I4KA 2AF3C 2E9SA 2D62A 3WLMA 3OQ6A 3U40A 1RMQA 1AK9A 2Y1LA 2YJ6A 3MOIA 4WZ6A 2ZANA 1OAKA 4NEGA 3IRUA 4MGKR 4KDCA 3W5CA 3ZQJA 1GZ6A 4BFVA 5E6RB 5HYVA 2FZKA 2VDQB 2BT4A 3LXUX 4JBYA 2KE5A 4O29A 1SQ6A 1DPFA 2UDPA 4YAGA 1ILWA 4MW4A 4L8WB 3QSGA 5JAOA 2Z6QA 2R6GA 1DO0A 4DF3A 5IUKC 3LK6A 2B3TA 3EMDA 4LJ8A 5IC5A 1CC1S 4FCWA 2I87A 2Y92A 1EZ4A 4QOHA 3D8NA 3HYCA 3SDZA 5M5BA 1IL0A 1WHTA 3OHPA 1B93A 4X20B 3GYBA 5DN6A 3S99A 3KXLA 4FDAA 4Y6QA 4BO1A 1BCRB 1L7BA 1I4WA 1R4MA 1RKUA 2TMDA 4GMKA 4QDXA 3SFVA 1SU7A 3GGOA 3KP1A 5L3SA 3WGZA 1TAHA 3NBAA 1EK1A 3LOUA 5CJ2A 3MLEA 3KZOA 2CF5A 4HGYA 2O2SA 1KERA 5GJVC 5K3DA 4H35A 1K4MA 4QE3A 4DGQA 1F4VA 1D04A 4UAJA 1PAUA 3ZC3A 2ADMA 2QMUA 3BHNA 2V6BA 4DR4B 5FNZA 1RM0A 2I65A 3NWJA 4H17A 2DWQA 4INPA 1KYTA 1JAIA 3C14C 3RU3A 2R8RA 3AM3A 3S1AB 1Z0SA 4IAOA 4MLDA 5FPKA 2P79A 1RKXA 2HJRA 3AM5A 3HCNA 3TOZA 1G2IA 2YOGA 3EPHA 1KPGA 1R8XA 5ES3A 1K6MA 3ORQA 2XVZA 3G2HA 1NYTA 1V5GA 3G59A 4HVTA 2XY4A 3T3HA 2ONCA 2O5CA 2GCIA 1J2JA 4O2AB 3H5TA 3QQPA 2JJ1D 2IS4A 3RANA 3H11B 3C6ZA 4F9EA 2W6IA 3DBRA 3Q3GE 1H94A 4ATNA 2PM8A 3CUWA 4IYJA 2LKDA 3AEYA 3DJFA 3RIMA 3N0RA 5KI6A 2UU9B 4BL5A 3DR5A 4EYKA 2D0PB 3LMKA 1NVMB 2RKBA 3T6KA 3LTNC 2JLUA 2BKAA 4OI0A 1VE7A 3I8SA 2NU7A 4Q93A 4IS3A 4U9UA 3PFFA 4MUGA 3JYQA 5TRTA 4GE0A 2ZJFA 4RHXA 4OI1A 3BVPA 3D0QA 4KMSA 3WYNA 5A4MS 1H93A 2IV2X 2BFFB 4FFNA 3UAOA 2P91A 1T2VA 1U94A 1IN4A 4NNJA 3VSCA 1N2CE 1UDXA 3OICA 3O4IA 2YC4C 2IWRA 1NUSA 5H5JA 4L0MA 3WS7A 2CL0X 2H5JA 1N6LA 2I4OA 2O50A 2BCGY 2RHTA 3B1JA 1ODIA 3MGGA 3IR6A 2VPTA 1BD4A 2ZJ1A 1ZI8A 4I4IA 1D7OA 1UC8A 3BG5A 3W4JA 3WLEA 4OHVA 2OL4A 3C3AA 3DG9A 5K8UA 1G7SA 1E4EA 1N2BA 1UKAA 4C4ZA 4C4PA 5IDXA 3BD9A 4HTAA 2V7QD 2YZKA 4N8EA 3K05A 1R6BX 2ZJ3A 4RCVA 2P30A 3C6KA 3D8BA 3DDCA 4D25A 1WXGA 1KZ9A 2DLDA 3M5CA 4OBXA 4ZYZA 4ZOAA 3OLVA 3RHFA 3ESBA 3USZA 2JFGA 2QSUA 3EQ8A 5IVKA 5EESA 5TXGA 1VIMA 3CLTC 1G2QA 1Y5LA 4NICA 4CCSA 5JNUA 3A6DA 3VU9A 1T9BA 5J2UA 3CINA 1Z08A 1VDMA 3UK6A 3CVYA 2KX7A 3ANTA 1CR2A 3N2EA 3ZGYA 4XIFA 3TJRA 3IR5A 1JI0A 2B4TO 4NLLA 4YRFA 5DNVA 3VPXA 4M1WA 3V4FA 3EEOA 3QKRA 3CO0S 1JI3A 4GSYA 4JUIA 2DWPA 3DJYA 1UKEA 2JAUA 3IAM6 2FZLA 2XE4A 3HR7A 3JRWA 5G0VA 2QVZX 2RFLA 4LAFA 2RGBA 4F5WA 1V8FA 2IU3A 2WIDA 3G6WA 5BMVB 1JKIA 4WPGA 4WL0A 4RVUA 1PW7A 3VJRA 4B6RA 1GGVA 1F8UA 3F5MA 4QDZA 4WEQA 1J21A 1EVLA 1C9DB 2Z04A 4WOBA 4CKBA 2ISQA 3IMGA 4YJ3A 1E5DA 1HWYA 4H77A 2H65A 3ORFA 1PD1A 3A2MA 1XTBA 3E8SA 5JJCA 2ZAOA 1JTEA 4BZWA 2LV8A 1F6DA 1QK4A 3IQHX 3PDIB 1SBHA 4GRIA 2AVNA 4W82A 1WETA 4LJRA 4BNTA 4QWWA 3MJEA 2ZSAA 3BL5A 4D46A 1R00A 4JVMA 5ALKA 1FJHA 3KOUA 4MUYA 3RTBA 3KS9A 3ESQA 1TAQA 3GZNB 4EFLA 4YXFA 3NO4A 1QO0A 3AUUA 2D2VA 4W9NC 4Y2RA 2I2WA 4AMBA 4G8BA 5BWMA 2BL4A 3BWXA 4ZGWA 3JRNA 1FCJA 1LTHR 1RVDA 3U5ZB 3CZQA 2GSWA 3R3VA 1ODTC 2ZXFA 5LQRA 4ZZ3A 1FXWF 1AKVA 3A27A 3IB6A 4PHFA 4BKPA 2BHLA 3ZLVA 4E13A 4UUOA 4JI8B 1JFVA 3FUXA 2I55A 2VJLA 4UAUA 3WMEA 1KZYC 4LTDA 4CL3A 1ONNA 1THMA 3KWFA 5KSWB 5AJWA 4GM1A 4CJXA 2HSGA 2WV9A 2DVMA 3I76A 3M6WA 5JD5A 1DAPA 3F73A 1BD3A 4OX9B 4HRVA 4CGYA 4YJHB 1FZTA 1BGVA 1E3EA 1VG1A 3CS3A 3Q8WA 4FLEA 4TV9F 4EBBA 1YVRA 4YWHA 1FUUA 1OJ7A 3SKYA 3C7DB 3K9QO 1DT3A 1F3OA 2AXPA 4ENPA 1F8GA 1RAGA 1RXUA 3CKYA 2A0XA 4FCVA 4J0QA 4E4RA 1KJ9A 1I2CA 3AGQA 1XZGA 2DSTA 3WMFA 4LCBA 2BFBA 3MJFA 4RVNA 3G3EA 4HX9A 1XVLA 1VZ2A 3EWNA 2JW5A 3EBPA 2R65A 4R98A 3DTNA 4DUYB 5HM8A 2QRGA 3PT9A 4IIXA 2WAOA 3IAFA 1E2BA 3K2EA 3WWOA 3FSGA 1JKMA 1M2EA 1J06A 2VEOA 2YW2A 3LQ2A 5JDIA 3A8TA 1CNFA 1QAOA 5HW0A 3OX4A 4MRRA 4XM0A 2I1LA 4AN0A 1Y9JA 2DJ5A 2WSLA 4I14A 5FUVA 2V1UA 3JQAD 1DHTA 1U9ZA 2IXTA 2OSBA 3WRYC 1NONA 3QEKA 2JATA 4YJFB 1P2SA 3S3TA 4CMAA 2C9CA 4IZ6A 1CR4A 2X5OA 5FQOA 1H2WA 1ZNXA 3Q3JB 1QTQA 4Y2YA 4KV7A 3P9CA 4OKNA 2C03A 3S1AA 3VYUB 3EF1A 4I19A 2DJIA 4NMWA 1AOXA 2G9UA 3F6RA 3VR5D 1FYXA 4A8JA 3Q9UA 2IYNA 4D43A 4TTPA 2RGNC 1RCUA 4D3FA 4Y1FA 3D3QA 2YRXA 1VCHA 4HDKB 3ZHBA 4CM4A 2WTUA 2IUUA 5CCEA 3CZ9A 3UJ9A 4LE2A 2GILA 3AF5A 3PFCA 4JOSA 5H82A 5B57C 1VI6A 5T4EA 2GD2A 1W36C 4TS1A 3RRYA 4OQFA 3LFUA 1XL1A 2PZGA 2GASA 3EIHA 5LZ9A 2DPGA 1QHHB 3L5KA 4S2UA 5M2QA 2Z1NA 4Q24A 3G2JA 2OM6A 5AM1A 5AKLA 1EGHA 5EHNA 2FN3A 2Q9BA 2FSUA 1S4QA 3VR6A 5BYBA 2LP4Y 5FBHA 3QXCA 1FFBA 1G5RA 1MH9A 2HWUA 4H1TA 4K9OA 4K6FA 1XWWA 4UE2A 3V33A 4DCTA 3PTAA 4YMSA 4Y2HA 5B12A 1LPAB 1RWKA 4P3KA 3ROMA 2BDTA 1XHFA 1O0BA 3K8ZA 3K1ZA 2X41A 1VLHA 4IJQA 5SZHB 1U3VA 3QP9A 3PGVA 3W04A 1TOAA 3FOBA 2DPMA 2JI7A 4PLGA 4PHCA 4KX3A 1G0OA 3AFMA 1J2UA 3DT8A 1L8QA 2A86A 3RBZA 1P9LA 1SHUX 3VC3A 2AOXA 2IV3A 3K15A 3DO6A 4NOJA 3AGPA 1TF2A 3OO1A 1LY1A 2G5PA 1MT3A 1QIMA 3BMQA 3K1AA 2CHGA 2PMWB 4YQEA 3I8XA 2B1RA 4HRYA 3HM9A 4GI2A 3W7VA 3DKIA 4TKVA 1O0CA 4DCOA 3ZU5A 5J9FA 4G4SP 1E2KA 4R2HA 4S1VA 5B37A 1GXSA 5HRCA 4Q19A 4UM7A 1CG6A 1OYYA 1K3TA 3FMGA 4X3PA 2ZVQX 1MENA 3SZMA 2PJRA 2HT6A 3IDOA 2XB8A 1YDEA 4DPMA 3WGVA 3MCWA 4UCXA 3EDOA 2HC9A 4P4UA 2DKNA 3FPFA 1WUIS 2FWIA 2HGZA 2R60A 2W6PA 2YBEA 1XB2A 3A05A 4IIYA 2AMFA 3ZIDA 3GJQA 3N8NA 1QIGA 3AESA 1HNZB 2B4KA 1T9DA 1YH3A 3H2HA 4CEIB 2L19A 4WKOA 3JQRA 3OM1A 1ZMOA 4XZ3A 5D00A 2GAOA 2DBVO 2G67A 3KYIB 3JV7A 4BKOA 3FFXA 4LZZA 4G0PA 3TX2A 1E79D 1REQB 3L7NA 3FCAA 5C8ZA 1SK8A 5KYXB 1CY6A 4XOUA 1SUFA 1ZOPA 3HB7A 3VX4A 1G4HA 4BKRA 3U3KA 5AM2A 6REQB 3UMRA 2W2VA 2AXEA 1GZ5A 2MMCA 3H05A 1XRSB 1URPA 1U0BB 3ABZA 1QORA 2GLXA 3DYBA 4UCQA 3BWBA 3NPMA 1HTTA 1LLCA 2VATA 3GFRA 1XBTA 4GC5A 3EB9A 4D9CA 3HK2A 2VDKB 2HCBA 1EH5A 3I2IA 4M0DA 4JBLA 3UJNA 2P75A 4PHTA 1YCGA 2J0QA 3KQYA 2I03A 4NECA 4EY3A 1W30A 3DBRB 4ON9A 4YN3A 3TX6A 1PJAA 3CZCA 3Q2OA 4CLRA 4MR7B 3E6AA 1AXEA 2FCAA 3UOAB 5CAEA 4L78A 3G0HA 1KEVA 1I1OA 1DTWA 3JYOA 3N2GA 4ZPJA 5KTPA 1GGJA 4WOPA 4RL4A 4WLVA 3F8WA 1II8A 3E03A 4Z86A 1JPNA 5AFSA 3M33A 2HHAA 3FDZA 2BTQA 2Y67A 3ZCTA 1IHUA 1MX3A 4LKOA 3NHZA 5DEOA 4O1IA 2O7RA 4AB1A 2ZETA 2JLYA 2Z9DA 4H7IA 1SCBA 2CDNA 3O82A 2OY0A 1CLEA 1K5PA 1QB7A 5JJLA 1BU5A 2OVFA 3KOMA 4JI5B 5HF5A 3KR1A 1SB8A 2V9ZA 3LGSA 4QHSA 4R5MA 5EIXA 3LLVA 2L0XA 5FBQB 1IOZA 4N5DA 1NMYA 1B76A 3I0MA 3B1XA 3EGCA 2CB0A 4GKKB 1IIBA 3UWMA 3MT9A 5BN3B 5IANA 1CIPA 1XZNA 3SEQA 1GQSA 5JXIA 3GLGA 3BH0A 4KB5A 1VRWA 3HXQA 4RE6A 1F3LA 2CXPA 2FTKE 3RTGA 2BD0A 2GRAA 1UR5A 2C1EA 4RTJA 2H9YA 5JCOC 1E1KA 5I7SA 5K8CA 4GOMD 5F1KA 1JLMA 2OV3A 2JCSA 4HEA1 4QUJA 3X1JA 1XLTC 2CYBA 4CQJA 4QXAA 1AF4A 1DIAA 2C8LA 3P5BA 4L7VA 3SSAA 3MGCA 3U2QA 3ZHVA 2GBLC 2JAPA 2Y68A 3KJFA 4ZI7A 5HFJA 5C3MA 4IDHA 5A4IS 2J7KA 1O8CA 3ZIAD 3Q6IA 3A9RA 4HS9A 5EQFA 2IK8A 3IBYA 1YAHA 4R3WA 2OZPA 3PDJA 2RD2A 1XIVA 2IZZA 3T7CA 5FADA 1OW3B 1CVIA 5IJ0A 1X7GA 4XSVA 2IYYA 2QHXA 1MAUA 2RK4A 4MQEB 3EXEB 5BO5A 3A1DA 3ME5A 4QUAA 2YJZA 3GJ3A 2WFLA 5FL7A 2EGGA 2JVIA 1JZSA 2Q3FA 4GZ5A 5EJAA 4ZAYA 3H65A 1YRBA 2K4MA 1M2GA 2C2OA 4UCWA 4AMGA 2F6RA 2YZ2A 4NP6A 2HWXA 2XDYA 3DP7A 1ORDA 3GLRA 4XCQA 5FYDA 5A04A 3G2KA 1Z45A 1RM3A 4FMBB 3W8NA 3ROKA 1A0OA 3D3NA 5FNVA 4ETWA 3EZFA 4YRGA 1OKKD 3AETA 3JCZA 2F43B 3PYXA 4IDAA 4ZCQA 1PGQA 3MA0A 3VR4D 4N0EA 3T0GA 2PUHA 3IALA 2G36A 5B1YA 4KQXA 3D7NA 3K2IA 5AOBA 4CNBA 1G3UA 1KEKA 5BUCA 3CEHA 5THQA 2NVUB 3VC2A 2Z2XA 3L41A 4JLWA 3PV0A 3M2PA 4ZCSA 5JS6A 5KOIA 1Z73A 1WTAA 1QP0A 1TEXA 1XTPA 4U6NA 1L4NA 5D84A 1GNQA 3FBTA 4RZIA 5TR9A 4DDTA 1P7VA 1UFOA 4FT2A 5G1NA 5TS3A 1Y7LA 1TRHA 3DL0A 4AJKA 3WB0A 1DG9A 2CCKA 2Y05A 3FOAA 2QXYA 3K4PA 1DEKA 2HDHA 1FU7A 5JCJD 2EFHB 2ZVJA 5E0KB 3FVRA 3TW0A 2WQ7A 4AJNA 3HBFA 3EG9A 1YZUA 4POOA 3DDOA 1E4OA 4WOCA 1A50B 1CHDA 3QG5A 2FN7A 4JP5A 2WD7B 1CZUA 3A25A 2DUUA 3BSYA 3OT1A 4PPGA 1CR6A 1IEWA 3HRKA 5GY7A 3ZI0A 1U2GC 5I7RA 1YONA 4NKRA 3MOGA 4Y2VA 5KQGA 2CK3A 3IHWA 2A5DA 3OURA 1ZHOA 2B4RO 1N33B 1KAOA 3MB8A 3GH1A 5JHHB 4KBYA 4V1CB 3UFXB 2PRYA 2ZDQA 5D6NA 4LEIA 4BQSA 4LNUB 3ZV6A 2LRHA 2CCJA 3ELUA 2O0JA 4F3RA 1G7RA 4RH0A 3ORYA 1RBMA 1U5CA 1XDZA 4AJHA 4LF5B 3INYA 1EFKA 5FPSA 5KTNA 1GSOA 4D0GA 4X85A 4EHFA 4GLJA 4UVIA 4D02A 5ABPA 1IEVA 2VT2A 5LYJF 2I8LA 3CUVA 3C4QA 4RIGA 2A14A 4O5AA 5L3ZA 3WNQA 4S1WA 1KETA 2TRSB 1NJGA 3GOHA 3HYTA 4R05A 1H8HD 2I6GA 3C3DA 4JI7B 3LWDA 4M89A 4LIPD 1AB5A 1NVEA 3JR3A 3ETJA 2FGJA 2I80A 3N7TA 1WZNA 4J1SA 2PSHA 3LQKA 3CHYA 4HFNA 4BGUA 1VIDA 4NU8X 4WBNF 2IBSA 3MVEA 1M83A 3ZUPA 2YVKA 4CEJA 1GUZA 3KBBA 1UIMA 1P29A 3V1LA 1KBOA 2QTZA 2NSJA 4DJEC 4DNQA 2NUPA 4WXPA 3VFDA 4PY2A 4BNHA 3ESCA 4ZOCA 3ZDDA 3MHPA 3G1UA 2J3QA 4ZOLF 4BMPB 3R8CA 1VM6A 4HZUB 4BNMA 4OP2A 4UBNA 1W5FA 3OJWA 1MGPA 1WS6A 1T4CA 1SU6A 2J5BA 1UBCA 2QRVB 2QTAA 1D6JA 1NXTA 3GNQA 3L4BC 3ROGA 3AR5A 121PA 2R6CA 4N5IX 4RWZA 3THWB 2HA7A 2IBTA 2AW5A 1RI3A 2O3RA 2X5NA 4ZV9A 3FYUB 1IN5A 1V43A 5KVCA 3X3HA 1E32A 4GGMX 5HRAA 5IBQA 5LZ4A 2DQSA 1N8TA 3BGSA 1I1HA 3GNLA 4M8KA 5JQGB 4KP7A 1WXHA 2ZYUX 4P53A 2EZUA 4YJGB 1WDLA 1UBTS 1HX7A 3JAKB 4ARBA 3IMFA 4DUGD 1K6EA 2F8SA 2XOEA 3EK2A 3QI2A 4KW7A 1G9TA 4AF6A 4IEIA 1A2OA 2IIQA 4TLLB 5KINB 4D8UA 4LRQA 4YCLA 2NZ2A 5ESDA 1JMVA 1OZGA 4CG0A 3A58B 4X61A 4LJ7A 4N6NA 1RJDA 3P26A 4J0HA 2PFGA 8ABPA 3Q7EA 3EJWA 4EL0A 1CDOA 2B98A 4YXWA 2R96A 1LVHA 4JUDX 1N8SA 5IKXA 3A1NA 2B5OA 5HTKA 1GPMA 2AK3A 1IXZA 1F2TA 1QRSA 4GQIA 2N3ZA 5CX1A 4IFEA 6ABPA 2E5LB 3SJ7A 3EARA 5L7WA 1GA6A 3NHKA 2P40A 2JIZA 1PWYE 3HEMA 1ZK0A 2CB9A 1FFDA 2VWGA 1QF7A 1XZIA 2WVGA 3KE8A 5DLDA 4ZGBA 1P5JA 2YXBA 2APJA 4F91B 4J9VA 3G9UA 4Z7NB 3CBQA 4P38A 3I37X 1E0DA 1D6MA 4KK4A 1MTZA 4TKVB 3RJ5A 4TTRA 4O4IF 2GM3A 1KYXA 1T2NA 4B34A 4C5CA 4EKYA 1RYZA 4TLAA 4RD2A 1HKHA 3TAHA 3U39A 4C04A 1CJUC 4CM8B 5JXGA 3DLAA 2NVBA 2RC5A 2DECA 5CXSA 4JVNA 2YVLA 5D3KA 3TOXA 2ZIEA 5JDIC 1DDIA 3OCJA 1BH2A 2YMQA 2DC1A 2GCEA 2IXDA 5FI3A 4YYZA 2ZYAA 3K0AA 4JYAB 1Z4JA 1TYEB 5HOQA 3OQIB 2O9JA 2JS7A 4RMNA 2W6NA 2Q5OA 2X9NA 3RJMA 2CD9A 2GEUA 4LQ4A 1H05A 5F4BA 2B92A 3DTYA 2X0IA 4G9EA 5BV2P 2D0DA 3UBTA 2PYZA 1X1TA 3A6HA 5DHRA 5I7VA 1P2FA 4PR3A 4BEBA 2PS0A 2P6UA 5GPBA 1WHSB 3IE1A 4TXNA 1AF7A 1SC6A 1SR8A 1UK8A 2CMHA 4F3NA 4AUNA 3CF6R 1M54A 2SCUB 2OBFA 1J5PA 1DWOA 1GUFA 1OXXK 1UBGA 1WKVA 1YASA 2P3OA 2VJMA 3KE9A 3GCWA 5FPHA 5BSRA 1RAAA 1WCIA 2GAAA 4KACA 4MZDA 5EXXA 4BP9A 3QHPA 3A1WA 2C00A 4WK6A 4ZKEA 5K0BA 1G3RA 2DKOA 1XKXA 3UT5B 3N2YA 4KBFA 1L4LA 2V6IA 3ET5A 4C2AA 1QF6A 4I1YA 2BV3A 3FRJA 1EEXB 4F1KA 3ENZA 4ZT5A 4YJKA 5DH9A 1KRXA 4XVCA 4GDFA 5AP9A 4PX9A 4TT8A 2ASVA 2OCLA 3B70A 4WADA 1JEQB 2F3UA 3BSSA 3O93A 1N8NA 5BPFA 1C8LA 1FDUA 2WJIA 1J9GA 3IIJA 5FXMA 1P1BA 2AQ8A 1AUPA 5DOVA 3FRIA 1Z5WA 2CF6A 1NMEA 2NSDA 1EGAA 3HDHA 5F12A 2XB6A 1TM3E 1E9CA 3OIDA 3LQ4A 2UZ3A 3BEDA 4I50B 2RIPA 4TXLA 4M9ZA 2HSEA 1LC0A 1PJBA 1RXEA 2AJBA 5DX1A 2JJ1A 3PWSA 4J7XA 4KQMA 4UHDA 3TLBA 3O1LA 1T6YA 1VJTA 2E55A 4YONB 2XTNA 4ZCLA 2ZIVB 5DP2A 4HO1X 1SHZA 2QVXX 2IOYA 3I5UA 4IDQA 4Y9UA 2JGKA 5FWXA 4BV2A 4AKGA 4D44A 1LBHA 2GFHA 4UTZA 4XQ9A 2VPIA 4WHMA 1CEXA 2Z5LA 1DIRA 1NW9B 2PMCA 2QJOA 4CF3A 2PR2A 4MJXA 3RC7A 2OT3B 3K35A 5BQOA 1KJYA 2JFHA 3AW9A 2FSSA 3KWMA 4U7FA 3W7BA 5CA0A 3FNGA 1T1JA 2FEAA 1J33A 5EJ5A 1ZN8A 3ROQA 2OFFA 3GQVA 4EENA 3C3CA 5C7IO 2CSXA 5KYXA 4DV4B 4TUYA 5AKGA 2EXXA 4B35A 1JJBA 1XZLA 1VLJA 4MVJI 1QG2A 4PFSA 3ZQ6A 2ON6A 4C3OB 5CB4F 3THYB 4DR2B 4I8IA 4B3MB 1ARZA 2Y1FA 2A9JA 3H8VA 3V80A 1M33A 2AFVA 4X6XA 4EI9A 4OXNA 3W78A 2FN9A 1UBFA 3KLBA 4O2AF 4OHRA 4Q0MA 3BWDD 5DGIA 4TGLA 1RS0A 1UKZA 2XB9A 2Z5FA 3UCFA 1DRVA 1GL6A 1G8SA 2QTVA 2GKSA 3CNLA 3CWCA 2IHUA 1G1MA 3IVGA 1NW7A 1X8JA 1XCPA 5BMVF 2Q62A 3R7WB 1NFQA 4GP9A 3HTXA 1NI3A 1SUWA 3SVLA 2XWQA 1FFCA 3JVVA 4MW7A 2XB2A 4QULA 3IVRA 5IN5A 5F1YA 5LMUB 3ZG6A 3BTUA 3B9PA 3DMTC 5ER6A 2JD1A 3AHIA 5MN4A 3IEXA 5DBOA 1OFUA 2OYSA 2Z83A 5JYBA 1T43A 2YJ4A 2XBLA 1YCDA 1SK9A 1I6WA 4UZEA 1U2PA 4IM7A 3URMA 2NP7A 3V1MA 4UHEA 2R47A 2WA1A 2DR3A 4HDRB 1DMRA 2QLMA 1O94C 3ADPA 1CQIB 1I7DA 4OU5A 1ZUHA 2CUNA 1Q2UA 3IUPA 4F3YA 5IM4F 5DNCA 2QRKA 5JMPA 1X15A 1ESCA 1F60A 2VOEA 4LBVA 2JLCA 2M2IA 4G25A 3JQ9C 3HABA 1PS8A 4OL0A 5TMEA 3V8MA 3AIIA 1TZJA 1KVUA 1T13A 2FB9A 5ALFA 3WK8A 4RSRA 3R20A 5HCNA 5C80A 1Q74A 4GW3A 2VRWA 1G2OA 1F20A 4I8XA 2AJCA 4KXMA 2E0IA 3KV1A 4JJ7A 3OZCA 4LECA 2W8ZA 2HA3A 1JJVA 5CT6A 4OFWA 3V3TA 3MSXA 4RGBA 2MDTA 2J09A 2VAMA 2OV4A 1FX0A 1YQWA 3KD2A 2H2IA 2WABA 1E1QD 4PAWA 2JI6A 3KIPA 3M6FA 4LRWA 1O8BA 1NBIA 4R1MA 1B0ZA 5JQGF 2AK2A 5LJLA 2OCAA 5L3RA 4UTVA 1QWSA 3GFVA 1TNDA 4DYHA 1NMQA 4A82A 4ANFA 4F9GA 1VE3A 2EGUA 5DM0A 3O1JC 4JJEA 2G8LA 1RPTA 2V7WA 4PQFA 5J40A 3M1IA 3RIXA 4DCMA 1YF3A 1G2PA 3PHHA 4BMYA 2FPMA 2YYSA 3EA4A 5LM3A 3T3IA 1Z0DA 4BKUA 2MSKA 3LNTA 1C0LA 1YJXA 3LW7A 5BSTA 1PSWA 3RJ9A 5IEJA 1Q44A 5JTUA 3HXMA 1U8XX 2D1RA 3AIOA 4D9JA 1HI9A 1KQPA 3TAXA 1NSFA 3CTMA 1CZRA 2H4WA 2WPNA 1IUOA 2BGWA 1HYGA 3IDZA 4DLTA 2H59A 1EWTA 4HXEB 4CWAA 1UBMS 2JLWA 4Q4JA 1ILEA 4MAMA 2CXOA 1NJ6A 2F3TA 3IVAA 4W8OA 4WFIA 4X95A 1YBVA 1SXJB 1TKBA 2B0JA 3U4HA 5IAAA 4OO3A 5TEVA 3ZDAA 1OWNA 5FRDA 1GPUA 4WNIA 2A94A 2Q41A 4QUBA 4XFKA 2LKCA 5H16A 5JZVA 2R6DA 4ZO8A 3KXDA 4TL9A 5ALPA 2CNNA 2GBPA 1TUBB 2PEZA 1UJCA 1W4AA 3BK1A 3DZDA 4I5GA 3PS9A 1O96A 3OE7D 2R1VB 4U3JB 2F1OA 3U3RA 1AKUA 1I2AA 1Y9EA 2JNWA 1IZ9A 4I8DA 4L08A 1I0IA 2B7CA 2IXAA 5TT1A 3SHTA 1MBZA 4HB0A 1G21A 1O97C 3NBZC 1I4OA 1X7ZA 1M2WA 2IIBA 2XT9A 5YASA 1H2RS 1OFUX 4ZMRA 5AJZA 1Z6YA 3WWPA 1YRAA 3P2IA 4HWGA 2BSXA 1T4BA 4CKCA 4WKPA 3K9GA 3QH4A 4GR9A 4ZVKA 2PVPA 2QTMA 3EULA 1R9JA 3C1OA 3LUAA 2ES4A 2GERA 1H5NA 1MC5A 4FNOA 3UC9A 1LPBB 2WU0A 1DE0A 4M83A 4ZCPA 3UV3A 1JB1A 4QXRA 1J0XO 2RI1A 2LCFA 1GZHB 1QV7A 1P5FA 3CW8X 3FG9A 3BRWA 2GZRA 3OQJA 1BRTA 4KQ2A 4QIHA 3ZXSA 4XJVA 4CIVA 1L5QA 4WCFB 5KREA 1IY1A 4Q3BA 3BAFA 1K2WA 1X7HA 4B5KA 4E1BA 1SY7A 3KKNA 1VBKA 2AI1A 2R4TA 3DE5X 4G0WA 3NXKA 3LVQE 4URVR 2BKLA 2BM1A 5TVGA 4HLDA 1DIGA 2W37A 4U2DA 3N2IA 3SK0A 2ZI4A 1DQRA 3TIFA 3VZCA 3ZX4A 3DGFC 3VOTA 4CU5A 2WM2A 3GZNA 1CRZA 4YHBA 4EJSB 3JXEA 5G0WA 4C76A 3FZGA 4CT5A 3INGA 2IYTA 3AHCA 2M98A 5GWXA 1U1CA 5K2MA 4W9MC 5KDLA 2OYCA 2O57A 3DOHA 1NT4A 5HUHA 4C0BA 3ICOA 4UTOA 3SC6A 3ZEAA 3A11A 1JUDA 1W93A 4BNWA 2PH1A 2XWJI 4ZTUB 1SJ9A 1Q7TA 4R2LA 1U0TA 1LD3A 3GPIA 4A10A 1DBWA 1G9SA 1QONA 1Z4OA 2RARA 2GNAA 4QM7A 4FGLA 2GEDA 3JYNA 2A9OA 1MU0A 2IYUA 3AH8A 3JASB 4DMMA 5JAMA 4LJ9A 1F2UA 2P0EA 2QTWB 3DW3X 5BN5A 3DEYX 1XXHA 2AG8A 2OXEA 3SKXA 1K8YB 3ZVRA 2WB4A 2X13A 1LWNA 4LV6A 5LA6F 4DTCA 3RHTA 3MEQA 1KGDA 3TB6A 1QHSA 2EWWA 3H16A 3IRVA 5A4KA 4A36A 4AZTA 1MR3F 2ZAGA 5EWMB 5DNEA 5BOSB 2L17A 1UJMA 5I7HA 1KZ6A 4R0NA 5BR4A 1B2RA 4J0GA 4ASUD 4QFMA 2H1WA 4MHSA 2OAGA 2GK4A 1RSZA 4J90A 1C8BA 1ZIXA 1EEHA 3G8DA 2XF8A 1KO7A 1QYCA 3JX9A 3DE7X 4HB3A 3KLPX 2PV7A 5BQ3A 3I5AA 5LVAA 1V8ZA 1EUZA 1YO6A 4PNHA 1XQYA 5DYTA 3AR2A 1AGNA 4L8FA 2YQZA 3EZNA 3RS2A 1Y3DE 2IA5A 4RMJA 1T5IA 2HLPA 4BFXA 1S02A 5DYWA 4F8JA 1YUNA 1D2MA 1XCOA 4E09A 3RAPR 3EF0A 1JIQA 2WG0A 3KELA 2RBGA 4EP1A 1JGTA 4J49A 1EHIA 1EFCA 3A4MA 3M1AA 1B0UA 2HBYA 5FLEX 1M2HA 3WKCA 1TPYA 3QWBA 3TZ6A 4FBMA 4LOLA 1IK6A 2XNJA 4Q15A 4HPXB 3U3DA 2VDRB 1UWCA 2A0YA 2BDEA 2REQA 4EG6A 2RSLA 4I4TA 1XJQA 2OBMA 2CMDA 2IXBA 2FWNA 1N77A 2Z3ZA 2P9ZA 3BULA 3MK31 1HLDA 3KALA 4R8KA 1Q22A 5BSHA 1AQNA 5T7BA 2EWMA 4S04A 1L3BA 1SUEA 2WHYA 3LS2A 1L7DA 4M8IA 1P2BA 3BH7A 5I9TA 3DEKA 4QTUB 3UTCA 1GADO 1XTKA 4DCGA 4JSTA 4RD6A 5ARBA 4JYZA 4LDAA 1JV2B 5LP1A 1K7SN 4A15A 2VZ9A 3FIUA 1JHOA 2B61A 3DW1X 4HQNA 1X39A 1PLKA 4NZNA 1NGSA 3BRSA 5G1OA 2ISCA 2C3OA 4DPLA 1T3HA 2W93A 4TUYF 2FP3A 4ZT3A 2OXFA 3CW9A 4KOAA 1ZK1A 2WINI 3HKDA 3EFBA 1B8NA 4GEKA 2X8LA 1OI4A 1LX7A 4KXXA 2CJPA 4JT2A 3AVUA 1KDPA 2PH7A 1E60A 4O2AA 4OSPA 4EHIA 1KDZA 1YWGO 3GEHA 3LCJA 3HO1A 3H5AA 4CKXA 3LBFA 5KUTA 3L7KA 1XMOB 3ECSA 2HNBA 3H2SA 16PKA 1CNMA 3D4NA 1QDEA 1HEIA 3VKHA 1J2RA 4GXQA 4OHBA 4KFUA 4R9NA 4B6GA 3S8YA 1R18A 3RSFA 4MRMB 1BMFA 1JS1X 1V7QA 2D5AA 2XGSA 1GV0A 3A4IA 4HLCA 4IO1A 2XTZA 3GJSA 1YA8A 5EP3A 1GCGA 2XKAA 3F2VA 4ALMA 4E31A 5CCBA 2BZ1A 4XSGA 2F90A 4CKYA 2OGTA 4HWKA 4UREA 3H9EO 3AOGA 2VJCA 3LUGA 3VNUA 5CA1F 4WLEA 2VHYA 5FBVB 1D2GA 3VJMA 1YFLA 4I1RA 2W0MA 3WL5A 1KAHA 4RPIA 5ENZA 2GZSA 3OQVA 4KO4S 1SUCA 2VYVD 4H2DA 1X80A 4F5DA 4ZPXA 1RWXA 1MIHA 5LIRA 5C81A 2XUOA 4DE5A 3PDCA 2C1XA 1A5AB 4NE7A 3JPYA 4HDAA 2QLTA 5KX5A 1ZHHA 2JHAA 4PPYA 3PEFA 2HI0A 3PZRA 4DRYA 2IL1A 3LD9A 5IM4A 3V2UA 5HNKA 2WICA 4HTFA 5ALEA 3JVIA 1RQXA 1JLKA 3L7MA 3MD0A 5DCUA 4PX5A 4QBFA 2W70A 1XLTA 2LUOA 3QKSB 3L79A 3QFTA 1LWOA 2CHEA 3ESAA 5KNCD 2H5IA 1TVEA 3EGEA 5JY6A 3FKSA 4N5NA 1MZVA 2Y1GA 4QG7A 2AOTB 2XH8A 4US0R 4AM8A 4BO6A 5IKOA 4P4GA 4P0TA </