1M35A

Aminopeptidase p from escherichia coli
Total Genus 160
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
160
sequence length
440
structure length
440
Chain Sequence
SEISRQEFQRRRQALVEQMQPGSAALIFAAPEVTRSADSEYPYRQNSDFWYFTGFNEPEAVLVLIKSDDTHNHSVLFNRVRDLTAEIWFGRRLGQDAAPEKLGVDRALAFSEINQQLYQLLNGLDVVYHAQGEYAYADVIVNSALEKLRKGSRQNLTAPATMIDWRPVVHEMRLFKSPEEIAVLRRAGEITAMAHTRAMEKCRPGMFEYHLEGEIHHEFNRHGARYPSYNTIVGSGENGCILHYTENECEMRDGDLVLIDAGCEYKGYAGDITRTFPVNGKFTQAQREIYDIVLESLETSLRLYRPGTSILEVTGEVVRIMVSGLVKLGILKGDVDELIAQNAHRPFFMHGLSHWLGLDVHDVGVYGQDRSRILEPGMVLTVEPGLYIAPDAEVPEQYRGIGIRIEDDIVITETGNENLTASVVKKPEEIEALMVAARKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title An orthorhombic form of Escherichia coli aminopeptidase P at 2.4 A resolution.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords AMINOPEPTIDASE P
total genus 160
structure length 440
sequence length 440
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.4.11.9: Xaa-Pro aminopeptidase.
pdb deposition date 2002-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF05195 AMP_N Aminopeptidase P, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 1m35A01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 1m35A02
4RZYA 1QZYA 4U70A 3PKAA 4FLLA 1WY2A 1N51A 1XGOA 4IF7A 4A6WA 3IG4A 4RGZ1 2B3KA 2HOWA 1JAWA 1A16A 1O0XA 2B3HA 3MX6A 4U69A 4Z7MA 3QOCA 1PV9A 2OKNA 2NQ7A 4IKUA 2BH3A 4U6ZA 1YVMA 4IPAA 4ZWPA 4MATA 4U76A 3FMQA 2BWUA 2GGCA 1C23A 2V3ZA 4U6JA 2BHAA 2BHCA 2GG8A 3OOOA 3S6BA 1WN1A 1CHMA 2V3YA 5CIKA 5CDVA 2EVOA 5CDLA 2B3LA 1B6AA 3PKEA 1YW8A 4U1BA 2GU4A 1YW7A 1M35A 3PN9A 4QR8A 4FKCA 4U71A 4IKRA 4U6EA 1KQ0A 2MATA 2EVMA 1WKMA 4JUQA 4HXXA 4ZWOA 2BWTA 3Q6DA 1WL9A 4A6VA 1QXYA 3RVAA 1XGMA 1QXZA 1C27A 3IU7A 1WL6A 3PEBA 4KM3A 3IU8A 4ZWUA 1KQ9A 2Q94A 2BWXA 2GG3A 2EA2A 4IU6A 4RZZA 3BIQA 2G6PA 5JFRA 4U75A 5D6EA 3BIPA 3PKDA 3FMRA 3MATA 2Q95A 4S01A 4PV4A 1C22A 3OVKA 2BN7A 3FM3A 2EVCA 2NQ6A 1Y1NA 2GGBA 1BOAA 1R5GA 4FLIA 4OOKA 2GG7A 4IKTA 2BWWA 2IW2A 5E2CA 4IDYA 2BHBA 2V3XA 4U6WA 4FO7A 2Q8KA 3PKBA 3MR1A 5FCHA 2GA2A 3D27A 4PNCA 3TAVA 5E5BA 5FCFA 2GTXA 2Q96A 4EGEA 3IU9A 3L7GA 2P98A 2EA4A 2GU5A 3CTZA 2BWSA 2DFIA 2GG9A 5JI6A 2ADUA 5D6FA 2BHDA 2GU6A 4IKSA 3RORA 4S00A 3CB6A 1YJ3A 4IECA 3IL0A 2GG0A 1KP0A 3BITA 1C24A 1C21A 1W2MA 1R5HA 1QXWA 1XGNA 1WLRA 2Q93A 4FO8A 5CLSA 2Q92A 2GU7A 4FLKA 1BN5A 1MATA 2GZ5A 1XNZA 2P9AA 4U6CA 3CB5A 4B28A 3L24A 3PKCA 2ZSGA 3O5VA 2BB7A 4FLJA 1R58A 4S2RP 1WBQA 4U73A 1YW9A 3TB5A 5CDEA 2P99A 1B59A 3I7MA 4S2TP 2GG5A 2V6CA 2GG2A 2BWYA 4FUKA 5JHUA 1XGSA 1W7VA 5CNXA 4ZNGA 5CE6A 2BWVA 2OAZA 4R60A
chains in the Genus database with same CATH superfamily
4RZYA 1QZYA 4U70A 3PKAA 4FLLA 1WY2A 1N51A 1XGOA 4IF7A 4A6WA 3IG4A 4RGZ1 2B3KA 2HOWA 1JAWA 1A16A 1O0XA 2B3HA 3MX6A 4U69A 4Z7MA 3QOCA 1PV9A 2OKNA 2NQ7A 4IKUA 2BH3A 4U6ZA 1YVMA 4IPAA 4ZWPA 4MATA 4U76A 3FMQA 2BWUA 2GGCA 1C23A 2V3ZA 4U6JA 2BHAA 2BHCA 2GG8A 3OOOA 3S6BA 1WN1A 1CHMA 2V3YA 5CIKA 5CDVA 2EVOA 5CDLA 2B3LA 1B6AA 3PKEA 1YW8A 4U1BA 2GU4A 1YW7A 1M35A 3PN9A 4QR8A 4FKCA 4U71A 4IKRA 4U6EA 1KQ0A 2MATA 2EVMA 1WKMA 4JUQA 4HXXA 4ZWOA 2BWTA 3Q6DA 1WL9A 4A6VA 1QXYA 3RVAA 1XGMA 1QXZA 1C27A 3IU7A 1WL6A 3PEBA 4KM3A 3IU8A 4ZWUA 1KQ9A 2Q94A 2BWXA 2GG3A 2EA2A 4IU6A 4RZZA 3BIQA 2G6PA 5JFRA 4U75A 5D6EA 3BIPA 3PKDA 3FMRA 3MATA 2Q95A 4S01A 4PV4A 1C22A 3OVKA 2BN7A 3FM3A 2EVCA 2NQ6A 1Y1NA 2GGBA 1BOAA 1R5GA 4FLIA 4OOKA 2GG7A 4IKTA 2BWWA 2IW2A 5E2CA 4IDYA 2BHBA 2V3XA 4U6WA 4FO7A 2Q8KA 3PKBA 3MR1A 5FCHA 2GA2A 3D27A 4PNCA 3TAVA 5E5BA 5FCFA 2GTXA 2Q96A 4EGEA 3IU9A 3L7GA 2P98A 2EA4A 2GU5A 3CTZA 2BWSA 2DFIA 2GG9A 5JI6A 2ADUA 5D6FA 2BHDA 2GU6A 4IKSA 3RORA 4S00A 3CB6A 1YJ3A 4IECA 3IL0A 2GG0A 1KP0A 3BITA 1C24A 1C21A 1W2MA 1R5HA 1QXWA 1XGNA 1WLRA 2Q93A 4FO8A 5CLSA 2Q92A 2GU7A 4FLKA 1BN5A 1MATA 2GZ5A 1XNZA 2P9AA 4U6CA 3CB5A 4B28A 3L24A 3PKCA 2ZSGA 3O5VA 2BB7A 4FLJA 1R58A 4S2RP 1WBQA 4U73A 1YW9A 3TB5A 5CDEA 2P99A 1B59A 3I7MA 4S2TP 2GG5A 2V6CA 2GG2A 2BWYA 4FUKA 5JHUA 1XGSA 1W7VA 5CNXA 4ZNGA 5CE6A 2BWVA 2OAZA 4R60A
chains in the Genus database with same CATH topology
4RZYA 1QZYA 4U70A 3PKAA 4FLLA 1WY2A 1N51A 1XGOA 4IF7A 4A6WA 3IG4A 4RGZ1 2B3KA 2HOWA 1JAWA 1A16A 1O0XA 2B3HA 3MX6A 4U69A 4Z7MA 3QOCA 1PV9A 2OKNA 2NQ7A 4IKUA 2BH3A 4U6ZA 1YVMA 4IPAA 4ZWPA 4MATA 4U76A 3FMQA 2BWUA 2GGCA 1C23A 2V3ZA 4U6JA 2BHAA 2BHCA 2GG8A 3OOOA 3S6BA 1WN1A 1CHMA 2V3YA 5CIKA 5CDVA 2EVOA 5CDLA 2B3LA 1B6AA 3PKEA 1YW8A 4U1BA 2GU4A 1YW7A 1M35A 3PN9A 4QR8A 4FKCA 4U71A 4IKRA 4U6EA 1KQ0A 2MATA 2EVMA 1WKMA 4JUQA 4HXXA 4ZWOA 2BWTA 3Q6DA 1WL9A 4A6VA 1QXYA 3RVAA 1XGMA 1QXZA 1C27A 3IU7A 1WL6A 3PEBA 4KM3A 3IU8A 4ZWUA 1KQ9A 2Q94A 2BWXA 2GG3A 2EA2A 4IU6A 4RZZA 3BIQA 2G6PA 5JFRA 4U75A 5D6EA 3BIPA 3PKDA 3FMRA 3MATA 2Q95A 4S01A 4PV4A 1C22A 3OVKA 2BN7A 3FM3A 2EVCA 2NQ6A 1Y1NA 2GGBA 1BOAA 1R5GA 4FLIA 4OOKA 2GG7A 4IKTA 2BWWA 2IW2A 5E2CA 4IDYA 2BHBA 2V3XA 4U6WA 4FO7A 2Q8KA 3PKBA 3MR1A 5FCHA 2GA2A 3D27A 4PNCA 3TAVA 5E5BA 5FCFA 2GTXA 2Q96A 4EGEA 3IU9A 3L7GA 2P98A 2EA4A 2GU5A 3CTZA 2BWSA 2DFIA 2GG9A 5JI6A 2ADUA 5D6FA 2BHDA 2GU6A 4IKSA 3RORA 4S00A 3CB6A 1YJ3A 4IECA 3IL0A 2GG0A 1KP0A 3BITA 1C24A 1C21A 1W2MA 1R5HA 1QXWA 1XGNA 1WLRA 2Q93A 4FO8A 5CLSA 2Q92A 2GU7A 4FLKA 1BN5A 1MATA 2GZ5A 1XNZA 2P9AA 4U6CA 3CB5A 4B28A 3L24A 3PKCA 2ZSGA 3O5VA 2BB7A 4FLJA 1R58A 4S2RP 1WBQA 4U73A 1YW9A 3TB5A 5CDEA 2P99A 1B59A 3I7MA 4S2TP 2GG5A 2V6CA 2GG2A 2BWYA 4FUKA 5JHUA 1XGSA 1W7VA 5CNXA 4ZNGA 5CE6A 2BWVA 2OAZA 4R60A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RZY A;  1QZY A;  4U70 A;  3PKA A;  4FLL A;  1WY2 A;  1N51 A;  1XGO A;  4IF7 A;  4A6W A;  3IG4 A;  4RGZ 1;  2B3K A;  2HOW A;  1JAW A;  1A16 A;  1O0X A;  2B3H A;  3MX6 A;  4U69 A;  4Z7M A;  3QOC A;  1PV9 A;  2OKN A;  2NQ7 A;  4IKU A;  2BH3 A;  4U6Z A;  1YVM A;  4IPA A;  4ZWP A;  4MAT A;  4U76 A;  3FMQ A;  2BWU A;  2GGC A;  1C23 A;  2V3Z A;  4U6J A;  2BHA A;  2BHC A;  2GG8 A;  3OOO A;  3S6B A;  1WN1 A;  1CHM A;  2V3Y A;  5CIK A;  5CDV A;  2EVO A;  5CDL A;  2B3L A;  1B6A A;  3PKE A;  1YW8 A;  4U1B A;  2GU4 A;  1YW7 A;  1M35 A;  3PN9 A;  4QR8 A;  4FKC A;  4U71 A;  4IKR A;  4U6E A;  1KQ0 A;  2MAT A;  2EVM A;  1WKM A;  4JUQ A;  4HXX A;  4ZWO A;  2BWT A;  3Q6D A;  1WL9 A;  4A6V A;  1QXY A;  3RVA A;  1XGM A;  1QXZ A;  1C27 A;  3IU7 A;  1WL6 A;  3PEB A;  4KM3 A;  3IU8 A;  4ZWU A;  1KQ9 A;  2Q94 A;  2BWX A;  2GG3 A;  2EA2 A;  4IU6 A;  4RZZ A;  3BIQ A;  2G6P A;  5JFR A;  4U75 A;  5D6E A;  3BIP A;  3PKD A;  3FMR A;  3MAT A;  2Q95 A;  4S01 A;  4PV4 A;  1C22 A;  3OVK A;  2BN7 A;  3FM3 A;  2EVC A;  2NQ6 A;  1Y1N A;  2GGB A;  1BOA A;  1R5G A;  4FLI A;  4OOK A;  2GG7 A;  4IKT A;  2BWW A;  2IW2 A;  5E2C A;  4IDY A;  2BHB A;  2V3X A;  4U6W A;  4FO7 A;  2Q8K A;  3PKB A;  3MR1 A;  5FCH A;  2GA2 A;  3D27 A;  4PNC A;  3TAV A;  5E5B A;  5FCF A;  2GTX A;  2Q96 A;  4EGE A;  3IU9 A;  3L7G A;  2P98 A;  2EA4 A;  2GU5 A;  3CTZ A;  2BWS A;  2DFI A;  2GG9 A;  5JI6 A;  2ADU A;  5D6F A;  2BHD A;  2GU6 A;  4IKS A;  3ROR A;  4S00 A;  3CB6 A;  1YJ3 A;  4IEC A;  3IL0 A;  2GG0 A;  1KP0 A;  3BIT A;  1C24 A;  1C21 A;  1W2M A;  1R5H A;  1QXW A;  1XGN A;  1WLR A;  2Q93 A;  4FO8 A;  5CLS A;  2Q92 A;  2GU7 A;  4FLK A;  1BN5 A;  1MAT A;  2GZ5 A;  1XNZ A;  2P9A A;  4U6C A;  3CB5 A;  4B28 A;  3L24 A;  3PKC A;  2ZSG A;  3O5V A;  2BB7 A;  4FLJ A;  1R58 A;  4S2R P;  1WBQ A;  4U73 A;  1YW9 A;  3TB5 A;  5CDE A;  2P99 A;  1B59 A;  3I7M A;  4S2T P;  2GG5 A;  2V6C A;  2GG2 A;  2BWY A;  4FUK A;  5JHU A;  1XGS A;  1W7V A;  5CNX A;  4ZNG A;  5CE6 A;  2BWV A;  2OAZ A;  4R60 A; 
#chains in the Genus database with same CATH topology
 4RZY A;  1QZY A;  4U70 A;  3PKA A;  4FLL A;  1WY2 A;  1N51 A;  1XGO A;  4IF7 A;  4A6W A;  3IG4 A;  4RGZ 1;  2B3K A;  2HOW A;  1JAW A;  1A16 A;  1O0X A;  2B3H A;  3MX6 A;  4U69 A;  4Z7M A;  3QOC A;  1PV9 A;  2OKN A;  2NQ7 A;  4IKU A;  2BH3 A;  4U6Z A;  1YVM A;  4IPA A;  4ZWP A;  4MAT A;  4U76 A;  3FMQ A;  2BWU A;  2GGC A;  1C23 A;  2V3Z A;  4U6J A;  2BHA A;  2BHC A;  2GG8 A;  3OOO A;  3S6B A;  1WN1 A;  1CHM A;  2V3Y A;  5CIK A;  5CDV A;  2EVO A;  5CDL A;  2B3L A;  1B6A A;  3PKE A;  1YW8 A;  4U1B A;  2GU4 A;  1YW7 A;  1M35 A;  3PN9 A;  4QR8 A;  4FKC A;  4U71 A;  4IKR A;  4U6E A;  1KQ0 A;  2MAT A;  2EVM A;  1WKM A;  4JUQ A;  4HXX A;  4ZWO A;  2BWT A;  3Q6D A;  1WL9 A;  4A6V A;  1QXY A;  3RVA A;  1XGM A;  1QXZ A;  1C27 A;  3IU7 A;  1WL6 A;  3PEB A;  4KM3 A;  3IU8 A;  4ZWU A;  1KQ9 A;  2Q94 A;  2BWX A;  2GG3 A;  2EA2 A;  4IU6 A;  4RZZ A;  3BIQ A;  2G6P A;  5JFR A;  4U75 A;  5D6E A;  3BIP A;  3PKD A;  3FMR A;  3MAT A;  2Q95 A;  4S01 A;  4PV4 A;  1C22 A;  3OVK A;  2BN7 A;  3FM3 A;  2EVC A;  2NQ6 A;  1Y1N A;  2GGB A;  1BOA A;  1R5G A;  4FLI A;  4OOK A;  2GG7 A;  4IKT A;  2BWW A;  2IW2 A;  5E2C A;  4IDY A;  2BHB A;  2V3X A;  4U6W A;  4FO7 A;  2Q8K A;  3PKB A;  3MR1 A;  5FCH A;  2GA2 A;  3D27 A;  4PNC A;  3TAV A;  5E5B A;  5FCF A;  2GTX A;  2Q96 A;  4EGE A;  3IU9 A;  3L7G A;  2P98 A;  2EA4 A;  2GU5 A;  3CTZ A;  2BWS A;  2DFI A;  2GG9 A;  5JI6 A;  2ADU A;  5D6F A;  2BHD A;  2GU6 A;  4IKS A;  3ROR A;  4S00 A;  3CB6 A;  1YJ3 A;  4IEC A;  3IL0 A;  2GG0 A;  1KP0 A;  3BIT A;  1C24 A;  1C21 A;  1W2M A;  1R5H A;  1QXW A;  1XGN A;  1WLR A;  2Q93 A;  4FO8 A;  5CLS A;  2Q92 A;  2GU7 A;  4FLK A;  1BN5 A;  1MAT A;  2GZ5 A;  1XNZ A;  2P9A A;  4U6C A;  3CB5 A;  4B28 A;  3L24 A;  3PKC A;  2ZSG A;  3O5V A;  2BB7 A;  4FLJ A;  1R58 A;  4S2R P;  1WBQ A;  4U73 A;  1YW9 A;  3TB5 A;  5CDE A;  2P99 A;  1B59 A;  3I7M A;  4S2T P;  2GG5 A;  2V6C A;  2GG2 A;  2BWY A;  4FUK A;  5JHU A;  1XGS A;  1W7V A;  5CNX A;  4ZNG A;  5CE6 A;  2BWV A;  2OAZ A;  4R60 A; 
#chains in the Genus database with same CATH homology
 4RZY A;  1QZY A;  4U70 A;  3PKA A;  4FLL A;  1WY2 A;  1N51 A;  1XGO A;  4IF7 A;  4A6W A;  3IG4 A;  4RGZ 1;  2B3K A;  2HOW A;  1JAW A;  1A16 A;  1O0X A;  2B3H A;  3MX6 A;  4U69 A;  4Z7M A;  3QOC A;  1PV9 A;  2OKN A;  2NQ7 A;  4IKU A;  2BH3 A;  4U6Z A;  1YVM A;  4IPA A;  4ZWP A;  4MAT A;  4U76 A;  3FMQ A;  2BWU A;  2GGC A;  1C23 A;  2V3Z A;  4U6J A;  2BHA A;  2BHC A;  2GG8 A;  3OOO A;  3S6B A;  1WN1 A;  1CHM A;  2V3Y A;  5CIK A;  5CDV A;  2EVO A;  5CDL A;  2B3L A;  1B6A A;  3PKE A;  1YW8 A;  4U1B A;  2GU4 A;  1YW7 A;  1M35 A;  3PN9 A;  4QR8 A;  4FKC A;  4U71 A;  4IKR A;  4U6E A;  1KQ0 A;  2MAT A;  2EVM A;  1WKM A;  4JUQ A;  4HXX A;  4ZWO A;  2BWT A;  3Q6D A;  1WL9 A;  4A6V A;  1QXY A;  3RVA A;  1XGM A;  1QXZ A;  1C27 A;  3IU7 A;  1WL6 A;  3PEB A;  4KM3 A;  3IU8 A;  4ZWU A;  1KQ9 A;  2Q94 A;  2BWX A;  2GG3 A;  2EA2 A;  4IU6 A;  4RZZ A;  3BIQ A;  2G6P A;  5JFR A;  4U75 A;  5D6E A;  3BIP A;  3PKD A;  3FMR A;  3MAT A;  2Q95 A;  4S01 A;  4PV4 A;  1C22 A;  3OVK A;  2BN7 A;  3FM3 A;  2EVC A;  2NQ6 A;  1Y1N A;  2GGB A;  1BOA A;  1R5G A;  4FLI A;  4OOK A;  2GG7 A;  4IKT A;  2BWW A;  2IW2 A;  5E2C A;  4IDY A;  2BHB A;  2V3X A;  4U6W A;  4FO7 A;  2Q8K A;  3PKB A;  3MR1 A;  5FCH A;  2GA2 A;  3D27 A;  4PNC A;  3TAV A;  5E5B A;  5FCF A;  2GTX A;  2Q96 A;  4EGE A;  3IU9 A;  3L7G A;  2P98 A;  2EA4 A;  2GU5 A;  3CTZ A;  2BWS A;  2DFI A;  2GG9 A;  5JI6 A;  2ADU A;  5D6F A;  2BHD A;  2GU6 A;  4IKS A;  3ROR A;  4S00 A;  3CB6 A;  1YJ3 A;  4IEC A;  3IL0 A;  2GG0 A;  1KP0 A;  3BIT A;  1C24 A;  1C21 A;  1W2M A;  1R5H A;  1QXW A;  1XGN A;  1WLR A;  2Q93 A;  4FO8 A;  5CLS A;  2Q92 A;  2GU7 A;  4FLK A;  1BN5 A;  1MAT A;  2GZ5 A;  1XNZ A;  2P9A A;  4U6C A;  3CB5 A;  4B28 A;  3L24 A;  3PKC A;  2ZSG A;  3O5V A;  2BB7 A;  4FLJ A;  1R58 A;  4S2R P;  1WBQ A;  4U73 A;  1YW9 A;  3TB5 A;  5CDE A;  2P99 A;  1B59 A;  3I7M A;  4S2T P;  2GG5 A;  2V6C A;  2GG2 A;  2BWY A;  4FUK A;  5JHU A;  1XGS A;  1W7V A;  5CNX A;  4ZNG A;  5CE6 A;  2BWV A;  2OAZ A;  4R60 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...