1M35A

Aminopeptidase p from escherichia coli
Total Genus 160
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
160
sequence length
440
structure length
440
Chain Sequence
SEISRQEFQRRRQALVEQMQPGSAALIFAAPEVTRSADSEYPYRQNSDFWYFTGFNEPEAVLVLIKSDDTHNHSVLFNRVRDLTAEIWFGRRLGQDAAPEKLGVDRALAFSEINQQLYQLLNGLDVVYHAQGEYAYADVIVNSALEKLRKGSRQNLTAPATMIDWRPVVHEMRLFKSPEEIAVLRRAGEITAMAHTRAMEKCRPGMFEYHLEGEIHHEFNRHGARYPSYNTIVGSGENGCILHYTENECEMRDGDLVLIDAGCEYKGYAGDITRTFPVNGKFTQAQREIYDIVLESLETSLRLYRPGTSILEVTGEVVRIMVSGLVKLGILKGDVDELIAQNAHRPFFMHGLSHWLGLDVHDVGVYGQDRSRILEPGMVLTVEPGLYIAPDAEVPEQYRGIGIRIEDDIVITETGNENLTASVVKKPEEIEALMVAARKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title An orthorhombic form of Escherichia coli aminopeptidase P at 2.4 A resolution.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords AMINOPEPTIDASE P
total genus 160
structure length 440
sequence length 440
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.4.11.9: Xaa-Pro aminopeptidase.
pdb deposition date 2002-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF05195 AMP_N Aminopeptidase P, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 1m35A01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 1m35A02
4ZWUA 4MATA 2BWWA 4FLIA 4R60A 2BWXA 3IU9A 4QR8A 2ZSGA 1YJ3A 4RZYA 5E5BA 4B28A 2OKNA 4EGEA 2GGBA 1CHMA 3QOCA 1BOAA 1QZYA 1R5HA 1XGNA 1W7VA 2BWTA 1BN5A 2B3HA 2GG2A 3OOOA 1WL6A 4KM3A 4IU6A 3CTZA 4U6WA 1XGMA 2P98A 1WLRA 1WY2A 4ZWOA 2Q93A 5JFRA 2Q94A 2GG9A 2GG0A 3RVAA 2V3XA 3BITA 5CDLA 5FCHA 4S01A 4ZNGA 1YVMA 1QXZA 1JAWA 2B3LA 2BH3A 2GU4A 2BHBA 4PNCA 3TB5A 1M35A 1C22A 2Q95A 4U76A 2GU6A 3D27A 2IW2A 3PEBA 4RZZA 2BWSA 4IF7A 3BIQA 2GU5A 3IU8A 3PN9A 4IKSA 5CDVA 3PKDA 1C27A 4FLKA 1YW7A 5CIKA 2B3KA 1WBQA 1R58A 2EA4A 1A16A 5E2CA 1WKMA 4OOKA 4U75A 3IU7A 3MR1A 2HOWA 2ADUA 4RGZ1 1KQ0A 2GTXA 2BHDA 3FM3A 4S2TP 5FCFA 5D6FA 4S00A 2BWVA 4Z7MA 4U6EA 2BHCA 3Q6DA 4U6ZA 2GG8A 3IG4A 2Q96A 3S6BA 4IECA 4U6JA 1O0XA 2EVOA 4FO7A 1R5GA 2Q92A 4IKRA 2GGCA 3PKAA 4IDYA 1YW8A 3RORA 5JI6A 2P99A 3BIPA 4U69A 5CDEA 2GA2A 4ZWPA 3CB5A 5D6EA 1B59A 2GG5A 5JHUA 4IKUA 1KQ9A 2DFIA 2BWYA 4U70A 1YW9A 2G6PA 2V3ZA 2BB7A 3TAVA 3IL0A 3L7GA 1QXYA 2P9AA 4PV4A 2GU7A 2OAZA 3PKBA 4HXXA 4U6CA 1PV9A 1XNZA 2BN7A 2V3YA 2Q8KA 4S2RP 1KP0A 1N51A 3L24A 1B6AA 5CE6A 4FUKA 4U73A 5CNXA 1C21A 4FLJA 4FO8A 2BHAA 2NQ7A 3MATA 4JUQA 5CLSA 2GG7A 2GZ5A 1WL9A 3FMQA 4FLLA 2V6CA 1XGOA 1QXWA 1WN1A 1W2MA 3I7MA 1C24A 2BWUA 2MATA 4A6WA 1C23A 4IPAA 4U71A 3OVKA 2EA2A 1MATA 3PKEA 3FMRA 4FKCA 2NQ6A 4IKTA 4A6VA 2EVCA 3CB6A 2GG3A 4U1BA 1Y1NA 3O5VA 1XGSA 3MX6A 2EVMA 3PKCA
chains in the Genus database with same CATH superfamily
4ZWUA 4MATA 2BWWA 4FLIA 4R60A 2BWXA 3IU9A 4QR8A 2ZSGA 1YJ3A 4RZYA 5E5BA 4B28A 2OKNA 4EGEA 2GGBA 1CHMA 3QOCA 1BOAA 1QZYA 1R5HA 1XGNA 1W7VA 2BWTA 1BN5A 2B3HA 2GG2A 3OOOA 1WL6A 4KM3A 4IU6A 3CTZA 4U6WA 1XGMA 2P98A 1WLRA 1WY2A 4ZWOA 2Q93A 5JFRA 2Q94A 2GG9A 2GG0A 3RVAA 2V3XA 3BITA 5CDLA 5FCHA 4S01A 4ZNGA 1YVMA 1QXZA 1JAWA 2B3LA 2BH3A 2GU4A 2BHBA 4PNCA 3TB5A 1M35A 1C22A 2Q95A 4U76A 2GU6A 3D27A 2IW2A 3PEBA 4RZZA 2BWSA 4IF7A 3BIQA 2GU5A 3IU8A 3PN9A 4IKSA 5CDVA 3PKDA 1C27A 4FLKA 1YW7A 5CIKA 2B3KA 1WBQA 1R58A 2EA4A 1A16A 5E2CA 1WKMA 4OOKA 4U75A 3IU7A 3MR1A 2HOWA 2ADUA 4RGZ1 1KQ0A 2GTXA 2BHDA 3FM3A 4S2TP 5FCFA 5D6FA 4S00A 2BWVA 4Z7MA 4U6EA 2BHCA 3Q6DA 4U6ZA 2GG8A 3IG4A 2Q96A 3S6BA 4IECA 4U6JA 1O0XA 2EVOA 4FO7A 1R5GA 2Q92A 4IKRA 2GGCA 3PKAA 4IDYA 1YW8A 3RORA 5JI6A 2P99A 3BIPA 4U69A 5CDEA 2GA2A 4ZWPA 3CB5A 5D6EA 1B59A 2GG5A 5JHUA 4IKUA 1KQ9A 2DFIA 2BWYA 4U70A 1YW9A 2G6PA 2V3ZA 2BB7A 3TAVA 3IL0A 3L7GA 1QXYA 2P9AA 4PV4A 2GU7A 2OAZA 3PKBA 4HXXA 4U6CA 1PV9A 1XNZA 2BN7A 2V3YA 2Q8KA 4S2RP 1KP0A 1N51A 3L24A 1B6AA 5CE6A 4FUKA 4U73A 5CNXA 1C21A 4FLJA 4FO8A 2BHAA 2NQ7A 3MATA 4JUQA 5CLSA 2GG7A 2GZ5A 1WL9A 3FMQA 4FLLA 2V6CA 1XGOA 1QXWA 1WN1A 1W2MA 3I7MA 1C24A 2BWUA 2MATA 4A6WA 1C23A 4IPAA 4U71A 3OVKA 2EA2A 1MATA 3PKEA 3FMRA 4FKCA 2NQ6A 4IKTA 4A6VA 2EVCA 3CB6A 2GG3A 4U1BA 1Y1NA 3O5VA 1XGSA 3MX6A 2EVMA 3PKCA
chains in the Genus database with same CATH topology
4ZWUA 4MATA 2BWWA 4FLIA 4R60A 2BWXA 3IU9A 4QR8A 2ZSGA 1YJ3A 4RZYA 5E5BA 4B28A 2OKNA 4EGEA 2GGBA 1CHMA 3QOCA 1BOAA 1QZYA 1R5HA 1XGNA 1W7VA 2BWTA 1BN5A 2B3HA 2GG2A 3OOOA 1WL6A 4KM3A 4IU6A 3CTZA 4U6WA 1XGMA 2P98A 1WLRA 1WY2A 4ZWOA 2Q93A 5JFRA 2Q94A 2GG9A 2GG0A 3RVAA 2V3XA 3BITA 5CDLA 5FCHA 4S01A 4ZNGA 1YVMA 1QXZA 1JAWA 2B3LA 2BH3A 2GU4A 2BHBA 4PNCA 3TB5A 1M35A 1C22A 2Q95A 4U76A 2GU6A 3D27A 2IW2A 3PEBA 4RZZA 2BWSA 4IF7A 3BIQA 2GU5A 3IU8A 3PN9A 4IKSA 5CDVA 3PKDA 1C27A 4FLKA 1YW7A 5CIKA 2B3KA 1WBQA 1R58A 2EA4A 1A16A 5E2CA 1WKMA 4OOKA 4U75A 3IU7A 3MR1A 2HOWA 2ADUA 4RGZ1 1KQ0A 2GTXA 2BHDA 3FM3A 4S2TP 5FCFA 5D6FA 4S00A 2BWVA 4Z7MA 4U6EA 2BHCA 3Q6DA 4U6ZA 2GG8A 3IG4A 2Q96A 3S6BA 4IECA 4U6JA 1O0XA 2EVOA 4FO7A 1R5GA 2Q92A 4IKRA 2GGCA 3PKAA 4IDYA 1YW8A 3RORA 5JI6A 2P99A 3BIPA 4U69A 5CDEA 2GA2A 4ZWPA 3CB5A 5D6EA 1B59A 2GG5A 5JHUA 4IKUA 1KQ9A 2DFIA 2BWYA 4U70A 1YW9A 2G6PA 2V3ZA 2BB7A 3TAVA 3IL0A 3L7GA 1QXYA 2P9AA 4PV4A 2GU7A 2OAZA 3PKBA 4HXXA 4U6CA 1PV9A 1XNZA 2BN7A 2V3YA 2Q8KA 4S2RP 1KP0A 1N51A 3L24A 1B6AA 5CE6A 4FUKA 4U73A 5CNXA 1C21A 4FLJA 4FO8A 2BHAA 2NQ7A 3MATA 4JUQA 5CLSA 2GG7A 2GZ5A 1WL9A 3FMQA 4FLLA 2V6CA 1XGOA 1QXWA 1WN1A 1W2MA 3I7MA 1C24A 2BWUA 2MATA 4A6WA 1C23A 4IPAA 4U71A 3OVKA 2EA2A 1MATA 3PKEA 3FMRA 4FKCA 2NQ6A 4IKTA 4A6VA 2EVCA 3CB6A 2GG3A 4U1BA 1Y1NA 3O5VA 1XGSA 3MX6A 2EVMA 3PKCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZWU A;  4MAT A;  2BWW A;  4FLI A;  4R60 A;  2BWX A;  3IU9 A;  4QR8 A;  2ZSG A;  1YJ3 A;  4RZY A;  5E5B A;  4B28 A;  2OKN A;  4EGE A;  2GGB A;  1CHM A;  3QOC A;  1BOA A;  1QZY A;  1R5H A;  1XGN A;  1W7V A;  2BWT A;  1BN5 A;  2B3H A;  2GG2 A;  3OOO A;  1WL6 A;  4KM3 A;  4IU6 A;  3CTZ A;  4U6W A;  1XGM A;  2P98 A;  1WLR A;  1WY2 A;  4ZWO A;  2Q93 A;  5JFR A;  2Q94 A;  2GG9 A;  2GG0 A;  3RVA A;  2V3X A;  3BIT A;  5CDL A;  5FCH A;  4S01 A;  4ZNG A;  1YVM A;  1QXZ A;  1JAW A;  2B3L A;  2BH3 A;  2GU4 A;  2BHB A;  4PNC A;  3TB5 A;  1M35 A;  1C22 A;  2Q95 A;  4U76 A;  2GU6 A;  3D27 A;  2IW2 A;  3PEB A;  4RZZ A;  2BWS A;  4IF7 A;  3BIQ A;  2GU5 A;  3IU8 A;  3PN9 A;  4IKS A;  5CDV A;  3PKD A;  1C27 A;  4FLK A;  1YW7 A;  5CIK A;  2B3K A;  1WBQ A;  1R58 A;  2EA4 A;  1A16 A;  5E2C A;  1WKM A;  4OOK A;  4U75 A;  3IU7 A;  3MR1 A;  2HOW A;  2ADU A;  4RGZ 1;  1KQ0 A;  2GTX A;  2BHD A;  3FM3 A;  4S2T P;  5FCF A;  5D6F A;  4S00 A;  2BWV A;  4Z7M A;  4U6E A;  2BHC A;  3Q6D A;  4U6Z A;  2GG8 A;  3IG4 A;  2Q96 A;  3S6B A;  4IEC A;  4U6J A;  1O0X A;  2EVO A;  4FO7 A;  1R5G A;  2Q92 A;  4IKR A;  2GGC A;  3PKA A;  4IDY A;  1YW8 A;  3ROR A;  5JI6 A;  2P99 A;  3BIP A;  4U69 A;  5CDE A;  2GA2 A;  4ZWP A;  3CB5 A;  5D6E A;  1B59 A;  2GG5 A;  5JHU A;  4IKU A;  1KQ9 A;  2DFI A;  2BWY A;  4U70 A;  1YW9 A;  2G6P A;  2V3Z A;  2BB7 A;  3TAV A;  3IL0 A;  3L7G A;  1QXY A;  2P9A A;  4PV4 A;  2GU7 A;  2OAZ A;  3PKB A;  4HXX A;  4U6C A;  1PV9 A;  1XNZ A;  2BN7 A;  2V3Y A;  2Q8K A;  4S2R P;  1KP0 A;  1N51 A;  3L24 A;  1B6A A;  5CE6 A;  4FUK A;  4U73 A;  5CNX A;  1C21 A;  4FLJ A;  4FO8 A;  2BHA A;  2NQ7 A;  3MAT A;  4JUQ A;  5CLS A;  2GG7 A;  2GZ5 A;  1WL9 A;  3FMQ A;  4FLL A;  2V6C A;  1XGO A;  1QXW A;  1WN1 A;  1W2M A;  3I7M A;  1C24 A;  2BWU A;  2MAT A;  4A6W A;  1C23 A;  4IPA A;  4U71 A;  3OVK A;  2EA2 A;  1MAT A;  3PKE A;  3FMR A;  4FKC A;  2NQ6 A;  4IKT A;  4A6V A;  2EVC A;  3CB6 A;  2GG3 A;  4U1B A;  1Y1N A;  3O5V A;  1XGS A;  3MX6 A;  2EVM A;  3PKC A; 
#chains in the Genus database with same CATH topology
 4ZWU A;  4MAT A;  2BWW A;  4FLI A;  4R60 A;  2BWX A;  3IU9 A;  4QR8 A;  2ZSG A;  1YJ3 A;  4RZY A;  5E5B A;  4B28 A;  2OKN A;  4EGE A;  2GGB A;  1CHM A;  3QOC A;  1BOA A;  1QZY A;  1R5H A;  1XGN A;  1W7V A;  2BWT A;  1BN5 A;  2B3H A;  2GG2 A;  3OOO A;  1WL6 A;  4KM3 A;  4IU6 A;  3CTZ A;  4U6W A;  1XGM A;  2P98 A;  1WLR A;  1WY2 A;  4ZWO A;  2Q93 A;  5JFR A;  2Q94 A;  2GG9 A;  2GG0 A;  3RVA A;  2V3X A;  3BIT A;  5CDL A;  5FCH A;  4S01 A;  4ZNG A;  1YVM A;  1QXZ A;  1JAW A;  2B3L A;  2BH3 A;  2GU4 A;  2BHB A;  4PNC A;  3TB5 A;  1M35 A;  1C22 A;  2Q95 A;  4U76 A;  2GU6 A;  3D27 A;  2IW2 A;  3PEB A;  4RZZ A;  2BWS A;  4IF7 A;  3BIQ A;  2GU5 A;  3IU8 A;  3PN9 A;  4IKS A;  5CDV A;  3PKD A;  1C27 A;  4FLK A;  1YW7 A;  5CIK A;  2B3K A;  1WBQ A;  1R58 A;  2EA4 A;  1A16 A;  5E2C A;  1WKM A;  4OOK A;  4U75 A;  3IU7 A;  3MR1 A;  2HOW A;  2ADU A;  4RGZ 1;  1KQ0 A;  2GTX A;  2BHD A;  3FM3 A;  4S2T P;  5FCF A;  5D6F A;  4S00 A;  2BWV A;  4Z7M A;  4U6E A;  2BHC A;  3Q6D A;  4U6Z A;  2GG8 A;  3IG4 A;  2Q96 A;  3S6B A;  4IEC A;  4U6J A;  1O0X A;  2EVO A;  4FO7 A;  1R5G A;  2Q92 A;  4IKR A;  2GGC A;  3PKA A;  4IDY A;  1YW8 A;  3ROR A;  5JI6 A;  2P99 A;  3BIP A;  4U69 A;  5CDE A;  2GA2 A;  4ZWP A;  3CB5 A;  5D6E A;  1B59 A;  2GG5 A;  5JHU A;  4IKU A;  1KQ9 A;  2DFI A;  2BWY A;  4U70 A;  1YW9 A;  2G6P A;  2V3Z A;  2BB7 A;  3TAV A;  3IL0 A;  3L7G A;  1QXY A;  2P9A A;  4PV4 A;  2GU7 A;  2OAZ A;  3PKB A;  4HXX A;  4U6C A;  1PV9 A;  1XNZ A;  2BN7 A;  2V3Y A;  2Q8K A;  4S2R P;  1KP0 A;  1N51 A;  3L24 A;  1B6A A;  5CE6 A;  4FUK A;  4U73 A;  5CNX A;  1C21 A;  4FLJ A;  4FO8 A;  2BHA A;  2NQ7 A;  3MAT A;  4JUQ A;  5CLS A;  2GG7 A;  2GZ5 A;  1WL9 A;  3FMQ A;  4FLL A;  2V6C A;  1XGO A;  1QXW A;  1WN1 A;  1W2M A;  3I7M A;  1C24 A;  2BWU A;  2MAT A;  4A6W A;  1C23 A;  4IPA A;  4U71 A;  3OVK A;  2EA2 A;  1MAT A;  3PKE A;  3FMR A;  4FKC A;  2NQ6 A;  4IKT A;  4A6V A;  2EVC A;  3CB6 A;  2GG3 A;  4U1B A;  1Y1N A;  3O5V A;  1XGS A;  3MX6 A;  2EVM A;  3PKC A; 
#chains in the Genus database with same CATH homology
 4ZWU A;  4MAT A;  2BWW A;  4FLI A;  4R60 A;  2BWX A;  3IU9 A;  4QR8 A;  2ZSG A;  1YJ3 A;  4RZY A;  5E5B A;  4B28 A;  2OKN A;  4EGE A;  2GGB A;  1CHM A;  3QOC A;  1BOA A;  1QZY A;  1R5H A;  1XGN A;  1W7V A;  2BWT A;  1BN5 A;  2B3H A;  2GG2 A;  3OOO A;  1WL6 A;  4KM3 A;  4IU6 A;  3CTZ A;  4U6W A;  1XGM A;  2P98 A;  1WLR A;  1WY2 A;  4ZWO A;  2Q93 A;  5JFR A;  2Q94 A;  2GG9 A;  2GG0 A;  3RVA A;  2V3X A;  3BIT A;  5CDL A;  5FCH A;  4S01 A;  4ZNG A;  1YVM A;  1QXZ A;  1JAW A;  2B3L A;  2BH3 A;  2GU4 A;  2BHB A;  4PNC A;  3TB5 A;  1M35 A;  1C22 A;  2Q95 A;  4U76 A;  2GU6 A;  3D27 A;  2IW2 A;  3PEB A;  4RZZ A;  2BWS A;  4IF7 A;  3BIQ A;  2GU5 A;  3IU8 A;  3PN9 A;  4IKS A;  5CDV A;  3PKD A;  1C27 A;  4FLK A;  1YW7 A;  5CIK A;  2B3K A;  1WBQ A;  1R58 A;  2EA4 A;  1A16 A;  5E2C A;  1WKM A;  4OOK A;  4U75 A;  3IU7 A;  3MR1 A;  2HOW A;  2ADU A;  4RGZ 1;  1KQ0 A;  2GTX A;  2BHD A;  3FM3 A;  4S2T P;  5FCF A;  5D6F A;  4S00 A;  2BWV A;  4Z7M A;  4U6E A;  2BHC A;  3Q6D A;  4U6Z A;  2GG8 A;  3IG4 A;  2Q96 A;  3S6B A;  4IEC A;  4U6J A;  1O0X A;  2EVO A;  4FO7 A;  1R5G A;  2Q92 A;  4IKR A;  2GGC A;  3PKA A;  4IDY A;  1YW8 A;  3ROR A;  5JI6 A;  2P99 A;  3BIP A;  4U69 A;  5CDE A;  2GA2 A;  4ZWP A;  3CB5 A;  5D6E A;  1B59 A;  2GG5 A;  5JHU A;  4IKU A;  1KQ9 A;  2DFI A;  2BWY A;  4U70 A;  1YW9 A;  2G6P A;  2V3Z A;  2BB7 A;  3TAV A;  3IL0 A;  3L7G A;  1QXY A;  2P9A A;  4PV4 A;  2GU7 A;  2OAZ A;  3PKB A;  4HXX A;  4U6C A;  1PV9 A;  1XNZ A;  2BN7 A;  2V3Y A;  2Q8K A;  4S2R P;  1KP0 A;  1N51 A;  3L24 A;  1B6A A;  5CE6 A;  4FUK A;  4U73 A;  5CNX A;  1C21 A;  4FLJ A;  4FO8 A;  2BHA A;  2NQ7 A;  3MAT A;  4JUQ A;  5CLS A;  2GG7 A;  2GZ5 A;  1WL9 A;  3FMQ A;  4FLL A;  2V6C A;  1XGO A;  1QXW A;  1WN1 A;  1W2M A;  3I7M A;  1C24 A;  2BWU A;  2MAT A;  4A6W A;  1C23 A;  4IPA A;  4U71 A;  3OVK A;  2EA2 A;  1MAT A;  3PKE A;  3FMR A;  4FKC A;  2NQ6 A;  4IKT A;  4A6V A;  2EVC A;  3CB6 A;  2GG3 A;  4U1B A;  1Y1N A;  3O5V A;  1XGS A;  3MX6 A;  2EVM A;  3PKC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...