1M35A

Aminopeptidase p from escherichia coli
Total Genus 160
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
160
sequence length
440
structure length
440
Chain Sequence
b'SEISRQEFQRRRQALVEQMQPGSAALIFAAPEVTRSADSEYPYRQNSDFWYFTGFNEPEAVLVLIKSDDTHNHSVLFNRVRDLTAEIWFGRRLGQDAAPEKLGVDRALAFSEINQQLYQLLNGLDVVYHAQGEYAYADVIVNSALEKLRKGSRQNLTAPATMIDWRPVVHEMRLFKSPEEIAVLRRAGEITAMAHTRAMEKCRPGMFEYHLEGEIHHEFNRHGARYPSYNTIVGSGENGCILHYTENECEMRDGDLVLIDAGCEYKGYAGDITRTFPVNGKFTQAQREIYDIVLESLETSLRLYRPGTSILEVTGEVVRIMVSGLVKLGILKGDVDELIAQNAHRPFFMHGLSHWLGLDVHDVGVYGQDRSRILEPGMVLTVEPGLYIAPDAEVPEQYRGIGIRIEDDIVITETGNENLTASVVKKPEEIEALMVAARKQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords AMINOPEPTIDASE P
publication title An orthorhombic form of Escherichia coli aminopeptidase P at 2.4 A resolution.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 160
structure length 440
sequence length 440
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.4.11.9: Xaa-Pro aminopeptidase.
pdb deposition date 2002-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF05195 AMP_N Aminopeptidase P, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 1m35A01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 1m35A02
2Q93A 2NQ7A 4IKSA 5D6FA 5CE6A 2GU6A 1WL9A 1YVMA 5FCFA 2V3YA 4ZNGA 2Q94A 2MATA 3IU8A 2OKNA 3CB5A 2GZ5A 2P9AA 4IKUA 4JUQA 5CDLA 1XNZA 1B59A 4FLKA 4FO7A 2GU5A 3BIPA 4S00A 4FUKA 3PKAA 4U6ZA 5JI6A 3L7GA 2Q92A 4U76A 1B6AA 1A16A 4FKCA 2Q95A 1YW8A 3BIQA 4FLIA 1R5HA 2BWVA 1QXYA 1WBQA 1WY2A 1N51A 1XGNA 2BWYA 5CNXA 3D27A 1XGSA 2EA4A 3RORA 5JHUA 1R5GA 1QXZA 4RZYA 3PEBA 3RVAA 1W2MA 2B3LA 2V3XA 4U1BA 4MATA 2BWXA 3PKBA 2IW2A 2GGBA 1MATA 2BH3A 4IF7A 4PNCA 5E5BA 3MR1A 3OVKA 4S01A 4ZWUA 4ZWPA 1WKMA 4IU6A 5CIKA 2BWSA 3L24A 4IKTA 4FLJA 2V6CA 2EVOA 1WN1A 4A6WA 2GTXA 1WL6A 3PN9A 1M35A 1KQ9A 2V3ZA 1YJ3A 2BHBA 2HOWA 2GA2A 2P99A 1KP0A 4FLLA 1O0XA 3CTZA 4U6CA 3IG4A 1BOAA 3BITA 4U6JA 1QZYA 4FO8A 1JAWA 2GG9A 4RZZA 4RGZ1 3CB6A 4HXXA 2BHCA 1Y1NA 3IU7A 4U70A 3FMQA 1CHMA 5E2CA 1YW7A 2BHDA 3QOCA 4U69A 5CDEA 4IDYA 1C27A 4U73A 2OAZA 4IKRA 2G6PA 3I7MA 1KQ0A 2BN7A 4U75A 5FCHA 3Q6DA 4R60A 2BWUA 2BWWA 2B3HA 4U71A 2Q8KA 4ZWOA 1QXWA 4OOKA 4U6EA 4S2TP 4IECA 1C21A 3IL0A 2ADUA 2BB7A 2BHAA 3MATA 2GG3A 2ZSGA 3FMRA 2EA2A 3TB5A 5CLSA 3S6BA 3FM3A 3O5VA 2NQ6A 1XGOA 3MX6A 1W7VA 1C24A 2DFIA 2GG8A 4EGEA 3PKEA 2GG5A 4IPAA 2GU4A 3PKDA 1R58A 4S2RP 1PV9A 2BWTA 1C22A 1C23A 1YW9A 2GG2A 4PV4A 3TAVA 4Z7MA 5D6EA 5JFRA 5CDVA 2GU7A 3IU9A 2EVCA 2EVMA 2B3KA 1WLRA 1BN5A 2GG7A 4KM3A 4QR8A 2P98A 4A6VA 4U6WA 4B28A 3OOOA 1XGMA 2GG0A 2Q96A 2GGCA 3PKCA
chains in the Genus database with same CATH superfamily
2Q93A 2NQ7A 4IKSA 5D6FA 5CE6A 2GU6A 1WL9A 1YVMA 5FCFA 2V3YA 4ZNGA 2Q94A 2MATA 3IU8A 2OKNA 3CB5A 2GZ5A 2P9AA 4IKUA 4JUQA 5CDLA 1XNZA 1B59A 4FLKA 4FO7A 2GU5A 3BIPA 4S00A 4FUKA 3PKAA 4U6ZA 5JI6A 3L7GA 2Q92A 4U76A 1B6AA 1A16A 4FKCA 2Q95A 1YW8A 3BIQA 4FLIA 1R5HA 2BWVA 1QXYA 1WBQA 1WY2A 1N51A 1XGNA 2BWYA 5CNXA 3D27A 1XGSA 2EA4A 3RORA 5JHUA 1R5GA 1QXZA 4RZYA 3PEBA 3RVAA 1W2MA 2B3LA 2V3XA 4U1BA 4MATA 2BWXA 3PKBA 2IW2A 2GGBA 1MATA 2BH3A 4IF7A 4PNCA 5E5BA 3MR1A 3OVKA 4S01A 4ZWUA 4ZWPA 1WKMA 4IU6A 5CIKA 2BWSA 3L24A 4IKTA 4FLJA 2V6CA 2EVOA 1WN1A 4A6WA 2GTXA 1WL6A 3PN9A 1M35A 1KQ9A 2V3ZA 1YJ3A 2BHBA 2HOWA 2GA2A 2P99A 1KP0A 4FLLA 1O0XA 3CTZA 4U6CA 3IG4A 1BOAA 3BITA 4U6JA 1QZYA 4FO8A 1JAWA 2GG9A 4RZZA 4RGZ1 3CB6A 4HXXA 2BHCA 1Y1NA 3IU7A 4U70A 3FMQA 1CHMA 5E2CA 1YW7A 2BHDA 3QOCA 4U69A 5CDEA 4IDYA 1C27A 4U73A 2OAZA 4IKRA 2G6PA 3I7MA 1KQ0A 2BN7A 4U75A 5FCHA 3Q6DA 4R60A 2BWUA 2BWWA 2B3HA 4U71A 2Q8KA 4ZWOA 1QXWA 4OOKA 4U6EA 4S2TP 4IECA 1C21A 3IL0A 2ADUA 2BB7A 2BHAA 3MATA 2GG3A 2ZSGA 3FMRA 2EA2A 3TB5A 5CLSA 3S6BA 3FM3A 3O5VA 2NQ6A 1XGOA 3MX6A 1W7VA 1C24A 2DFIA 2GG8A 4EGEA 3PKEA 2GG5A 4IPAA 2GU4A 3PKDA 1R58A 4S2RP 1PV9A 2BWTA 1C22A 1C23A 1YW9A 2GG2A 4PV4A 3TAVA 4Z7MA 5D6EA 5JFRA 5CDVA 2GU7A 3IU9A 2EVCA 2EVMA 2B3KA 1WLRA 1BN5A 2GG7A 4KM3A 4QR8A 2P98A 4A6VA 4U6WA 4B28A 3OOOA 1XGMA 2GG0A 2Q96A 2GGCA 3PKCA
chains in the Genus database with same CATH topology
2Q93A 2NQ7A 4IKSA 5D6FA 5CE6A 2GU6A 1WL9A 1YVMA 5FCFA 2V3YA 4ZNGA 2Q94A 2MATA 3IU8A 2OKNA 3CB5A 2GZ5A 2P9AA 4IKUA 4JUQA 5CDLA 1XNZA 1B59A 4FLKA 4FO7A 2GU5A 3BIPA 4S00A 4FUKA 3PKAA 4U6ZA 5JI6A 3L7GA 2Q92A 4U76A 1B6AA 1A16A 4FKCA 2Q95A 1YW8A 3BIQA 4FLIA 1R5HA 2BWVA 1QXYA 1WBQA 1WY2A 1N51A 1XGNA 2BWYA 5CNXA 3D27A 1XGSA 2EA4A 3RORA 5JHUA 1R5GA 1QXZA 4RZYA 3PEBA 3RVAA 1W2MA 2B3LA 2V3XA 4U1BA 4MATA 2BWXA 3PKBA 2IW2A 2GGBA 1MATA 2BH3A 4IF7A 4PNCA 5E5BA 3MR1A 3OVKA 4S01A 4ZWUA 4ZWPA 1WKMA 4IU6A 5CIKA 2BWSA 3L24A 4IKTA 4FLJA 2V6CA 2EVOA 1WN1A 4A6WA 2GTXA 1WL6A 3PN9A 1M35A 1KQ9A 2V3ZA 1YJ3A 2BHBA 2HOWA 2GA2A 2P99A 1KP0A 4FLLA 1O0XA 3CTZA 4U6CA 3IG4A 1BOAA 3BITA 4U6JA 1QZYA 4FO8A 1JAWA 2GG9A 4RZZA 4RGZ1 3CB6A 4HXXA 2BHCA 1Y1NA 3IU7A 4U70A 3FMQA 1CHMA 5E2CA 1YW7A 2BHDA 3QOCA 4U69A 5CDEA 4IDYA 1C27A 4U73A 2OAZA 4IKRA 2G6PA 3I7MA 1KQ0A 2BN7A 4U75A 5FCHA 3Q6DA 4R60A 2BWUA 2BWWA 2B3HA 4U71A 2Q8KA 4ZWOA 1QXWA 4OOKA 4U6EA 4S2TP 4IECA 1C21A 3IL0A 2ADUA 2BB7A 2BHAA 3MATA 2GG3A 2ZSGA 3FMRA 2EA2A 3TB5A 5CLSA 3S6BA 3FM3A 3O5VA 2NQ6A 1XGOA 3MX6A 1W7VA 1C24A 2DFIA 2GG8A 4EGEA 3PKEA 2GG5A 4IPAA 2GU4A 3PKDA 1R58A 4S2RP 1PV9A 2BWTA 1C22A 1C23A 1YW9A 2GG2A 4PV4A 3TAVA 4Z7MA 5D6EA 5JFRA 5CDVA 2GU7A 3IU9A 2EVCA 2EVMA 2B3KA 1WLRA 1BN5A 2GG7A 4KM3A 4QR8A 2P98A 4A6VA 4U6WA 4B28A 3OOOA 1XGMA 2GG0A 2Q96A 2GGCA 3PKCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q93 A;  2NQ7 A;  4IKS A;  5D6F A;  5CE6 A;  2GU6 A;  1WL9 A;  1YVM A;  5FCF A;  2V3Y A;  4ZNG A;  2Q94 A;  2MAT A;  3IU8 A;  2OKN A;  3CB5 A;  2GZ5 A;  2P9A A;  4IKU A;  4JUQ A;  5CDL A;  1XNZ A;  1B59 A;  4FLK A;  4FO7 A;  2GU5 A;  3BIP A;  4S00 A;  4FUK A;  3PKA A;  4U6Z A;  5JI6 A;  3L7G A;  2Q92 A;  4U76 A;  1B6A A;  1A16 A;  4FKC A;  2Q95 A;  1YW8 A;  3BIQ A;  4FLI A;  1R5H A;  2BWV A;  1QXY A;  1WBQ A;  1WY2 A;  1N51 A;  1XGN A;  2BWY A;  5CNX A;  3D27 A;  1XGS A;  2EA4 A;  3ROR A;  5JHU A;  1R5G A;  1QXZ A;  4RZY A;  3PEB A;  3RVA A;  1W2M A;  2B3L A;  2V3X A;  4U1B A;  4MAT A;  2BWX A;  3PKB A;  2IW2 A;  2GGB A;  1MAT A;  2BH3 A;  4IF7 A;  4PNC A;  5E5B A;  3MR1 A;  3OVK A;  4S01 A;  4ZWU A;  4ZWP A;  1WKM A;  4IU6 A;  5CIK A;  2BWS A;  3L24 A;  4IKT A;  4FLJ A;  2V6C A;  2EVO A;  1WN1 A;  4A6W A;  2GTX A;  1WL6 A;  3PN9 A;  1M35 A;  1KQ9 A;  2V3Z A;  1YJ3 A;  2BHB A;  2HOW A;  2GA2 A;  2P99 A;  1KP0 A;  4FLL A;  1O0X A;  3CTZ A;  4U6C A;  3IG4 A;  1BOA A;  3BIT A;  4U6J A;  1QZY A;  4FO8 A;  1JAW A;  2GG9 A;  4RZZ A;  4RGZ 1;  3CB6 A;  4HXX A;  2BHC A;  1Y1N A;  3IU7 A;  4U70 A;  3FMQ A;  1CHM A;  5E2C A;  1YW7 A;  2BHD A;  3QOC A;  4U69 A;  5CDE A;  4IDY A;  1C27 A;  4U73 A;  2OAZ A;  4IKR A;  2G6P A;  3I7M A;  1KQ0 A;  2BN7 A;  4U75 A;  5FCH A;  3Q6D A;  4R60 A;  2BWU A;  2BWW A;  2B3H A;  4U71 A;  2Q8K A;  4ZWO A;  1QXW A;  4OOK A;  4U6E A;  4S2T P;  4IEC A;  1C21 A;  3IL0 A;  2ADU A;  2BB7 A;  2BHA A;  3MAT A;  2GG3 A;  2ZSG A;  3FMR A;  2EA2 A;  3TB5 A;  5CLS A;  3S6B A;  3FM3 A;  3O5V A;  2NQ6 A;  1XGO A;  3MX6 A;  1W7V A;  1C24 A;  2DFI A;  2GG8 A;  4EGE A;  3PKE A;  2GG5 A;  4IPA A;  2GU4 A;  3PKD A;  1R58 A;  4S2R P;  1PV9 A;  2BWT A;  1C22 A;  1C23 A;  1YW9 A;  2GG2 A;  4PV4 A;  3TAV A;  4Z7M A;  5D6E A;  5JFR A;  5CDV A;  2GU7 A;  3IU9 A;  2EVC A;  2EVM A;  2B3K A;  1WLR A;  1BN5 A;  2GG7 A;  4KM3 A;  4QR8 A;  2P98 A;  4A6V A;  4U6W A;  4B28 A;  3OOO A;  1XGM A;  2GG0 A;  2Q96 A;  2GGC A;  3PKC A; 
#chains in the Genus database with same CATH topology
 2Q93 A;  2NQ7 A;  4IKS A;  5D6F A;  5CE6 A;  2GU6 A;  1WL9 A;  1YVM A;  5FCF A;  2V3Y A;  4ZNG A;  2Q94 A;  2MAT A;  3IU8 A;  2OKN A;  3CB5 A;  2GZ5 A;  2P9A A;  4IKU A;  4JUQ A;  5CDL A;  1XNZ A;  1B59 A;  4FLK A;  4FO7 A;  2GU5 A;  3BIP A;  4S00 A;  4FUK A;  3PKA A;  4U6Z A;  5JI6 A;  3L7G A;  2Q92 A;  4U76 A;  1B6A A;  1A16 A;  4FKC A;  2Q95 A;  1YW8 A;  3BIQ A;  4FLI A;  1R5H A;  2BWV A;  1QXY A;  1WBQ A;  1WY2 A;  1N51 A;  1XGN A;  2BWY A;  5CNX A;  3D27 A;  1XGS A;  2EA4 A;  3ROR A;  5JHU A;  1R5G A;  1QXZ A;  4RZY A;  3PEB A;  3RVA A;  1W2M A;  2B3L A;  2V3X A;  4U1B A;  4MAT A;  2BWX A;  3PKB A;  2IW2 A;  2GGB A;  1MAT A;  2BH3 A;  4IF7 A;  4PNC A;  5E5B A;  3MR1 A;  3OVK A;  4S01 A;  4ZWU A;  4ZWP A;  1WKM A;  4IU6 A;  5CIK A;  2BWS A;  3L24 A;  4IKT A;  4FLJ A;  2V6C A;  2EVO A;  1WN1 A;  4A6W A;  2GTX A;  1WL6 A;  3PN9 A;  1M35 A;  1KQ9 A;  2V3Z A;  1YJ3 A;  2BHB A;  2HOW A;  2GA2 A;  2P99 A;  1KP0 A;  4FLL A;  1O0X A;  3CTZ A;  4U6C A;  3IG4 A;  1BOA A;  3BIT A;  4U6J A;  1QZY A;  4FO8 A;  1JAW A;  2GG9 A;  4RZZ A;  4RGZ 1;  3CB6 A;  4HXX A;  2BHC A;  1Y1N A;  3IU7 A;  4U70 A;  3FMQ A;  1CHM A;  5E2C A;  1YW7 A;  2BHD A;  3QOC A;  4U69 A;  5CDE A;  4IDY A;  1C27 A;  4U73 A;  2OAZ A;  4IKR A;  2G6P A;  3I7M A;  1KQ0 A;  2BN7 A;  4U75 A;  5FCH A;  3Q6D A;  4R60 A;  2BWU A;  2BWW A;  2B3H A;  4U71 A;  2Q8K A;  4ZWO A;  1QXW A;  4OOK A;  4U6E A;  4S2T P;  4IEC A;  1C21 A;  3IL0 A;  2ADU A;  2BB7 A;  2BHA A;  3MAT A;  2GG3 A;  2ZSG A;  3FMR A;  2EA2 A;  3TB5 A;  5CLS A;  3S6B A;  3FM3 A;  3O5V A;  2NQ6 A;  1XGO A;  3MX6 A;  1W7V A;  1C24 A;  2DFI A;  2GG8 A;  4EGE A;  3PKE A;  2GG5 A;  4IPA A;  2GU4 A;  3PKD A;  1R58 A;  4S2R P;  1PV9 A;  2BWT A;  1C22 A;  1C23 A;  1YW9 A;  2GG2 A;  4PV4 A;  3TAV A;  4Z7M A;  5D6E A;  5JFR A;  5CDV A;  2GU7 A;  3IU9 A;  2EVC A;  2EVM A;  2B3K A;  1WLR A;  1BN5 A;  2GG7 A;  4KM3 A;  4QR8 A;  2P98 A;  4A6V A;  4U6W A;  4B28 A;  3OOO A;  1XGM A;  2GG0 A;  2Q96 A;  2GGC A;  3PKC A; 
#chains in the Genus database with same CATH homology
 2Q93 A;  2NQ7 A;  4IKS A;  5D6F A;  5CE6 A;  2GU6 A;  1WL9 A;  1YVM A;  5FCF A;  2V3Y A;  4ZNG A;  2Q94 A;  2MAT A;  3IU8 A;  2OKN A;  3CB5 A;  2GZ5 A;  2P9A A;  4IKU A;  4JUQ A;  5CDL A;  1XNZ A;  1B59 A;  4FLK A;  4FO7 A;  2GU5 A;  3BIP A;  4S00 A;  4FUK A;  3PKA A;  4U6Z A;  5JI6 A;  3L7G A;  2Q92 A;  4U76 A;  1B6A A;  1A16 A;  4FKC A;  2Q95 A;  1YW8 A;  3BIQ A;  4FLI A;  1R5H A;  2BWV A;  1QXY A;  1WBQ A;  1WY2 A;  1N51 A;  1XGN A;  2BWY A;  5CNX A;  3D27 A;  1XGS A;  2EA4 A;  3ROR A;  5JHU A;  1R5G A;  1QXZ A;  4RZY A;  3PEB A;  3RVA A;  1W2M A;  2B3L A;  2V3X A;  4U1B A;  4MAT A;  2BWX A;  3PKB A;  2IW2 A;  2GGB A;  1MAT A;  2BH3 A;  4IF7 A;  4PNC A;  5E5B A;  3MR1 A;  3OVK A;  4S01 A;  4ZWU A;  4ZWP A;  1WKM A;  4IU6 A;  5CIK A;  2BWS A;  3L24 A;  4IKT A;  4FLJ A;  2V6C A;  2EVO A;  1WN1 A;  4A6W A;  2GTX A;  1WL6 A;  3PN9 A;  1M35 A;  1KQ9 A;  2V3Z A;  1YJ3 A;  2BHB A;  2HOW A;  2GA2 A;  2P99 A;  1KP0 A;  4FLL A;  1O0X A;  3CTZ A;  4U6C A;  3IG4 A;  1BOA A;  3BIT A;  4U6J A;  1QZY A;  4FO8 A;  1JAW A;  2GG9 A;  4RZZ A;  4RGZ 1;  3CB6 A;  4HXX A;  2BHC A;  1Y1N A;  3IU7 A;  4U70 A;  3FMQ A;  1CHM A;  5E2C A;  1YW7 A;  2BHD A;  3QOC A;  4U69 A;  5CDE A;  4IDY A;  1C27 A;  4U73 A;  2OAZ A;  4IKR A;  2G6P A;  3I7M A;  1KQ0 A;  2BN7 A;  4U75 A;  5FCH A;  3Q6D A;  4R60 A;  2BWU A;  2BWW A;  2B3H A;  4U71 A;  2Q8K A;  4ZWO A;  1QXW A;  4OOK A;  4U6E A;  4S2T P;  4IEC A;  1C21 A;  3IL0 A;  2ADU A;  2BB7 A;  2BHA A;  3MAT A;  2GG3 A;  2ZSG A;  3FMR A;  2EA2 A;  3TB5 A;  5CLS A;  3S6B A;  3FM3 A;  3O5V A;  2NQ6 A;  1XGO A;  3MX6 A;  1W7V A;  1C24 A;  2DFI A;  2GG8 A;  4EGE A;  3PKE A;  2GG5 A;  4IPA A;  2GU4 A;  3PKD A;  1R58 A;  4S2R P;  1PV9 A;  2BWT A;  1C22 A;  1C23 A;  1YW9 A;  2GG2 A;  4PV4 A;  3TAV A;  4Z7M A;  5D6E A;  5JFR A;  5CDV A;  2GU7 A;  3IU9 A;  2EVC A;  2EVM A;  2B3K A;  1WLR A;  1BN5 A;  2GG7 A;  4KM3 A;  4QR8 A;  2P98 A;  4A6V A;  4U6W A;  4B28 A;  3OOO A;  1XGM A;  2GG0 A;  2Q96 A;  2GGC A;  3PKC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...