1M3AA

Solution structure of a circular form of the truncated n-terminal sh3 domain from oncogene protein c-crk.
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
57
structure length
57
Chain Sequence
CYVRALFDFNGNDEEDLPFKKGDILRIRDKPEEQWWNAEDSEGKRGMIPVPYVEKYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Changing protein backbone topology: Structural and dynamic consequences of the backbone cyclization in SH3 domain
rcsb
source organism Mus musculus
molecule tags Protein binding
molecule keywords Proto-oncogene C-crk
total genus 6
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2002-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1m3aA00
1BBZA 1UECA 1W6XA 1WDXA 1U3OA 4JZ4A 1M8MA 5I22A 2YUNA 2RQWA 2KRSA 2F2WA 4D8DA 2M0YA 2LNHB 1AZEA 2BZXA 2DBMA 1BU1A 1G83A 5L23A 2HDAA 1M27C 2W10A 2DL3A 3ZL7C 1UG1A 1S1NA 1E7OA 2EYWA 2GTJA 2DYBA 1T3LA 1K9AA 1M3CA 2QDLA 2DE0X 1GCQC 2JM9A 3H0HA 1NYFA 1JO8A 1I1JA 2DL5A 4GLMA 1AWWA 1FMKA 2H8HA 2VKNA 2DRKA 2LX7A 1WYXA 2E5KA 2KGTA 3VS1A 3VS3A 3M0UA 4Z8AA 1PRLC 2DRMA 2DL8A 1NLOC 1ABQA 1IO6A 1I07A 2A28A 3IQLA 1YCSB 1UJ0A 1X69A 2ECZA 2GGRA 1JXOA 3EHRA 2SEMA 3VS2A 1T0HA 2KYMA 5EC7A 3EGUA 2AZSA 2NUZA 2D8HA 3H0IA 2LJ3A 2KXDA 2GBQA 1HSQA 2EQIA 4JZ3A 4WCIA 2G6FX 1NG2A 2P4RA 2ENMA 1FYNA 2JMCA 1B07A 2CDTA 1QLYA 2JS0A 2K9GA 2VWFA 2EGAA 2CSQA 2ROTA 3EG1A 2MOXA 1X2KA 1ZUKA 2RQTA 3R6NA 1KIKA 1K76A 1W70A 2JT4A 3UA6A 4LNPA 3M0TA 1WFWA 1RI9A 2EVRA 1M3BA 2DL7A 2GQIA 1HJDA 1V1CA 3GBQA 2LMJA 2K6DA 1OPLA 4RTYA 1JQQA 4LUEA 2EPDA 2YUOA 2YSQA 2X3WD 3UATA 4DEYA 3M0QA 2FPFA 1EFNA 2PTKA 1H3HA 2F2XA 2FPDA 2GTOA 4J9CA 1K4US 4CC4B 1X6GA 1YN8A 3REBB 1PWTA 1T3SA 4DEXA 2CT3A 3M0SA 3UA7A 1VYVA 2BTTA 1GRIA 3I5RA 2O31A 1YWOA 2AKLA 1WXTA 2DJQA 2DMOA 4R0KA 4J9IA 4RTZA 1ZLMA 2LP5A 4OMOA 4HCKA 2HSPA 4OMMA 2HCKA 2HEQA 4M4ZA 1CKAA 1BK2A 1AWJA 1ZUYA 1BB9A 2ROLA 3NPFA 2YT6A 1G2BA 3A98A 5IHKA 4E6RA 1GFDA 2KXCA 3O5ZA 4AFQC 4EIKA 1AWXA 2O88A 1T0JA 3I35A 2LJ1A 3I9QA 3JV3A 3NMZC 5IH2A 1TG0A 4CC3A 2BZYA 2KROA 2DF6A 2DVJA 2AK5A 1QWEA 1K1ZA 5IHNA 2ED1A 2FRWA 3NHNA 2K7AA 2LJ0A 4X1VA 3TSWA 1GCPA 2K2MA 1GBQA 1RUWA 2FO0A 4OMNA 1WXBA 2RQVA 2OAWA 2EYXA 4OMPA 5FWBA 1M3AA 2O9VA 4HVWA 2J6OA 2C0IA 4D8KA 3QWXX 4J9FA 2EYZA 2YDLA 4J9DA 4J9GA 2L3PA 1JEGA 5GJWB 1VYUA 1ZSGA 3U23A 1JXMA 2KT8A 2CREA 1AOJA 1ZBJA 1H92A 2KT1A 2L3SA 1SSHA 2LQNA 2EKHA 4HVVA 2CT4A 3RNJA 1XOVA 1E6GA 1PNJA 4F16A 2DM1A 1RLPC 2GNCA 4IIOA 4AFSC 3H0FA 2OJ2A 4JJBA 1TUCA 2PZ1A 3UF4A 1KFZA 1NEGA 4FSSA 1SRLA 5I11A 1VYTA 4F14A 1WX6A 2DL4A 4ZNXA 2W0ZA 2JTEA 3LH5A 2MCNA 3EHQA 1PRMC 1PHTA 4OMQA 3VS6A 1NEBA 2FG0A 4JJDA 1AZGB 2KRNA 3THKA 2F2VA 4Y92A 1AVZC 2KE9A 3ULRB 2FEIA 3VRZA 3VS4A 1SPKA 1NYGA 4JPBW 2EW3A 1UHFA 2CUDA 4RTVA 2FPEA 2YUPA 2J05A 1GL5A 5FWCA 2LZ6B 1J3TA 4CC7A 2JW4A 2EGCA 2CH4A 4Z88A 2CSIA 2L3QA 1GCQA 1SHGA 2D8JA 1WXUA 3FJ5A 4IIMA 4LN2A 4J9BA 2KRMA 1ARKA 1AEYA 2FRYA 3QWYA 2I0NA 3RBBB 2DNUA 2O2OA 3NGPA 3PE0A 3EG2A 4OMLA 3H41A 1YNZA 2J6FA 4RTUA 2PNIA 2LCSA 4RTTA 2DBKA 1K0XA 4HXJA 1B3QA 2HBWA 5HCKA 1LCKA 2ED0A 3PVLA 2C0TA 2RN8A 3C0CA 1SRMA 2DILA 1QKXA 4Z89A 2V1QA 5ECAA 5IXBA 2JMAA 4CC2A 1ABOA 1PKTA 1SEMA 1VA7A 1Y57A 3SHWA 1WIEA 1WLPB 5IXFA 1U06A 2VVKA 1GBRA 1UE9A 1KSWA 2AKKA 4LE9A 1Z9QA 2AZVA 2IIMA 2RPNA 4RTXA 2RF0A 3EG3A 2BZ8A 1X6BA 2YUQA 4GBQA 1Y0MA 2J7IA 1X2QA 2KYBA 1I0CA 2DX1A 1K0SA 1A0NB 2J6KA 1UUEA 2X3XD 2M51A 2SRCA 5FW9A 2D0NA 4QT7A 1UFFA 3PVQA 2KNBB 4HVUA 1OV3A 2MIOA 4AFUC 2C0OA 1ZUUA 3SEMA 1E6HA 3EG0A 1MV0B 1QCFA 2EBPA 4F17A 4AG2C 1PKSA 1N5ZA 2JXBA 4KRTA 2EGEA 1TUDA 1JU5C 3CQTA 2L0AA 2NWMA 2ABLA 3VS0A 3VS5A 2V1RA 2CUBA 3I5SA 3TSZA 2KEAA 1AD5A 1OOTA 2O9SA 2K3BA 4LUDA 1M30A 2ESWA 1GFCA 1U5SA 4A63B 1CKBA 1H8KA 1UDLA 1QWFA 2J06A 2A08A 2KR3A 2RQRA 4AFZC 1Z9ZA 2D1XA 4J9HA 4ORZA 5IHIA 1UJYA 3TVTA 1YWPA 1W1FA 1UGVA 2DA9A 2JS2A 2B86A 3VRYA 1OEBA 1MV3A 1NLPC 3M0PA 3REAB 1MUZA 4JJCA 2JM8A 2OI3A 2RNAA 4RUGA 1YP5A 2EYYA 1UTIA 1ZX6A 2KBTA 3KFVA 1X27A 2DLPA 4RTWA 2L2PA 1WI7A 1X43A 3M0RA 2LQWA 1QKWA 1KJWA 2A37A 2RQUA 3VS7A 2K79A 1SHFA 1CSKA 1OPKA 1WA7A 2XMFA 1UHCA 4AG1C 4ESRA 2A36A 1HD3A 2CH4W 1NM7A 4J9EA 5GJVB 1RLQC 2RMOA 4K11A 1AWOA
chains in the Genus database with same CATH superfamily
3JCMd 4HT9A 1BCMA 1U3OA 3QJYA 3CC7Q 1M90C 3MEUA 1D0XA 5KYYB 2OTJQ 2RQWA 5DLQE 1V76A 1VQKA 5KYNA 4OF1A 4D8DA 2CZ6B 4E7SA 2LNHB 4P5NA 1BU1A 3HFOA 5L23A 4GY5A 2IG0A 1M27C 3I56Q 3META 4FSXA 1UG1A 4GLKA 2NYSA 1E7OA 3CMET 2EYWA 1T3LA 2KAFA 2QQBA 3KXTA 3PIPA 3LWHA 4PJOF 1NYFA 1VQ6T 3QKJA 2PQWA 5KH6A 4HCCA 2JN0A 3RKWA 4DA4A 5A0GA 5CIUA 3FLGA 1SKUB 4A4HA 3VS1A 3M0UA 1D09B 3CCQT 1ABQA 2A28A 2PUKB 1I5LA 3BY7A 4BDZA 5J26A 1X69A 1UGSB 2GGRA 1JXOA 3H9NA 4OB3B 1XQHA 4C5EA 2AZSA 2MYSA 2E4HA 4LXCA 3NTIA 1VQKT 4JZ3A 1RAGB 8AT1B 2G6FX 5A0DA 1Q81R 1VQ5Q 3JRZA 2CDTA 3PT9A 1UB4A 5D6YA 2VWFA 2MOXA 2RQTA 3R6NA 4CI0C 1YJ9A 1K76A 1W70A 2F5KA 4FT4A 1SG5A 5I2MA 1WFWA 5CQYA 1RI9A 2EVRA 3OW2A 2DD4A 2DL7A 1VQ8T 2OTLQ 3LYIA 1HJDA 1V1CA 3GBQA 2CP2A 4HKEA 2LMJA 2M02A 4QVZA 2R5MA 2YUOA 8ATCB 2LTOA 3JCMh 1OU9A 1K8AC 2DZCA 2YSQA 3UATA 2LQKA 3GIBA 2E5QA 2GF7A 5KCHA 2CZ1B 1QCNA 5CAIA 3H6ZA 2FPDA 1K4US 4C0GA 1EZZB 4N4HA 1ZSZA 3REBB 4B9XA 3UA7A 1VYVA 5LJ5f 2BTTA 3G6EQ 2CGHA 2LVMA 5GAOm 2AKLA 5GMKi 2QGFB 5FRNA 5GAMf 2RH2A 4HCKA 1RADB 2HSPA 4JS4A 4OMMA 4E7IA 1OQKA 1QVGS 1BB9A 3OYBA 1UGRB 2L3RA 3TQ7P 3NPFA 5DM7R 1G2BA 2FB7A 2AHJB 3VYGA 4MZPA 4E6RA 3V8JA 3G71T 2KXCA 3O5ZA 4EIKA 3CBOA 1I4K1 1WHLA 3I9QA 4M77F 4M75A 1RAIB 4KGXB 2BZYA 2O4XB 2E41A 2DF6A 4N0AC 2DVJA 1X01A 5KYUB 4M7AB 2FVUA 1RAHB 2ED1A 3VUZA 5GMKj 2FRWA 4FL6A 1Q82R 1O9SA 2LJ0A 4J8OA 1GCPA 4OMNA 1RUWA 2JJ9A 2EYXA 5FWBA 1M3AA 4FYYB 2O9VA 2XDDA 3CD6Q 4J9FA 4V2SA 2EYZA 2YDLA 4J9DA 2X4JA 5GJWB 3CCUA 3J81E 1VYUA 5LL6S 3FIFA 4OGCA 5C0MA 2KT8A 3JCMg 4C0ZA 5GANg 1ZBJA 4NL3A 3OS0A 2MWPA 2FL7A 2XDBA 1YHQQ 1RAAB 2EKHA 3I55A 2DAQA 1G5VA 4QKUA 1Q95G 1E6GA 2DM1A 3CMAQ 3NTKA 4BI8B 1VQ5A 1NZ9A 1SRLA 1VQPA 4C92D 3RDVA 4F14A 3FC3A 2L89A 4N4GA 2DL4A 3M59A 2VXFA 2O01E 1MGQA 1PHTA 4M77A 1R77A 3C94A 1AZGB 2VASA 3CCUT 3THKA 2F2VA 3M54A 5CK9A 2KE9A 3SWNA 3OMGA 5LJ3f 1RI0A 5AT1B 1NYGA 4JPBW 2EW3A 3RERA 1UHFA 4PJOG 3X26B 3KUFA 2YUPA 2LZ6B 4DQ2A 2K2VA 1J3TA 4OMFB 2EGCA 1W4SA 2DXBA 3OMCA 3JB9J 1GCQA 5EG2A 1W2BP 4HT8A 4PJJA 4XQ3A 1SHGA 4M7DA 1WXUA 1PD1A 2DKGA 2OTJA 4J9BA 2M16A 2E6NA 3CCVT 2XKOC 3WVEB 2R5AA 2DXTA 2JTMA 3ME9A 1H641 2PNIA 1IHWA 4RTTA 1U1TA 2QTXA 1OX9A 2RJDA 4HXJA 3CBMA 4AT1B 1VQLQ 5GANe 1LCKA 2RN8A 2ZPHB 2E12A 3A8HB 3V7CA 2KK4A 3ZBDA 3MP8A 5GAN3 3SHWA 2QASA 4ZGJB 4N0AA 3EFOA 4M78D 4LE9A 1N8RC 4FYXB 4XTZA 2AZVA 2XK0A 2ZZDA 1AT1B 3CD6A 3LH0A 3L2QA 5LJ5e 2EWNA 3BFMA 2OTJT 4F04B 4NS5A 4ZTJA 2YUQA 2QA4Q 4GBQA 3CCVA 1VQNQ 3QO3A 1N8RU 3LX7A 1I0CA 4BUGA 2JTFA 1M8VA 2D0QB 2J6KA 4DOVA 2DEUA 1MMAA 2K57A 5FW9A 3OYCA 1Y96A 1LVKA 1K9MU 3PVQA 5A2QE 1YJNT 1YI2Q 2MIOA 2B8AA 5GMKm 3CCLA 3VKIA 4RMOA 1E6HA 3EG0A 1MV0B 3CC2A 2EGEA 2JZ2A 3CQTA 1G8XA 2NUPA 3VS5A 2V1RA 3HRTA 5KYWA 1VQ4A 3I5SA 2LCLA 4RG2A 1AD5A 1DJ7B 2O9SA 4LUDA 2ESWA 3CD6T 1WJQA 2M0OA 2V8IA 7AT1B 1U5SA 2QTVA 5M9OA 1PSEA 1QWFA 4FW2A 1KQ1A 4DOWA 4PJMA 3CXCP 1PD0A 1M9SA 5GAN6 1BI3A 3CCLT 2HZYA 4LDVA 3JB9G 1OEBA 1MV3A 2KMTA 4JJCA 2QA4T 1TWBA 3RUXA 2EYYA 4BE0A 1YITQ 1Q7YC 2JVVA 1VQMQ 1ZX6A 1X27A 3S3OA 2X9HA 1BCOA 3SFMA 4XU2A 1PC0A 1X43A 3EFOB 3M0RA 4XU1A 3QHSA 3VS7A 2P84A 1SHFA 1D1CA 2V8KA 4DBFA 4PFZA 2ZAEA 1HD3A 2NUTA 3LWIA 1MNEA 2M1HA 3OYHA 2RMOA 1YJWT 1AWOA 3L2VA 1BBZA 1UECA 4J7IA 3X24B 1LPLA 2XIDA 1V29B 1Q7YR 1JJ2P 2QA4A 1PSFA 2M0YA 1YJWQ 2HAXA 1N6AA 1AZEA 2BZXA 1M2VA 4J6XA 2W10A 1H3ZA 4C8QA 2VGMA 1S1NA 4M7DB 2DYBA 3MP1A 2LCCA 3EGDA 2H3JA 4XK8E 3J80E 1GCQC 3H0HA 2R58A 4M7DE 1SF9A 2DTHA 2M9UA 1QVPA 1FMKA 2V8JA 2VKNA 2DRKA 2LX7A 3OYAA 4MMLA 3MCAB 1JB0E 2KGTA 4E7ZA 1PRLC 2DL8A 1YJWA 1NLOC 1VQKQ 5CKBA 2K5LA 1ACMB 1YCSB 2SEMA 3VS2A 2KYMA 3HFNA 2WSFE 2NUZA 1IRXA 2D8HA 4BE1A 1ZA1B 2EQIA 3JCMV 3M4YA 3CBPA 3SWNC 2P4RA 4JLGA 2JMCA 2K5IA 3BDUA 3ZEHA 2K9GA 3EG1A 2FZKB 4KH1B 1X2KA 5GAMg 2JOYA 3ER0A 3UWNA 4M78C 4LNPA 4B6MA 2LT4A 1UGPB 1QCOA 2FZCB 2GQIA 3WVDB 1JQQA 4LUEA 1RACB 1NJIU 3CPWA 2PTKA 1H3HA 2F2XA 5CVIA 3CCUQ 4R55A 2KI7A 1N9SA 4M7AG 1X6GA 4A4GA 1FWZA 1PWTA 1KQSP 2E1HA 2RM4A 1KQSA 2O31A 4E7LA 4JJNK 4C0DC 2DIGA 2DMOA 2DD5A 3CPWP 1X6OA 2RI3A 1ZLMA 4OMOA 3G7ZA 4M7AA 1EX4A 2BE7D 5IN1A 1CKAA 3OYIA 1BK2A 5GMKe 1VQ8A 1VQNT 1BI2A 3OSVA 1C6VX 3PTAA 2CP5A 2ROLA 1K8AR 3A98A 1VQOQ 4XU0A 4BDYA 2X4XA 2CZ7B 2E3IA 3JCMQ 4AFQC 1AWXA 2EJFA 4X9CA 3I35A 2LJ1A 3E9GA 4E7HA 1NJIR 4CC3A 2KROA 4FYVB 3RIRA 4KUDK 3QYHB 4YTLA 1U8RA 2VUBA 3A1PA 4L6V5 5IHNA 4J6WA 3NHNA 3PMIA 2AT1B 4X1VA 4D6WA 2BIVA 2I2LA 2QG9B 1UGQB 4XTUA 2FO0A 3O8VA 2OAWA 1Q82U 2QK0A 1IHVA 1QVFA 3OBWA 2C0IA 2DIQA 5FU7C 3EGXB 1N8RR 3VYHB 4WF2A 1ZSGA 1VQNA 3U23A 3AHUA 5KCOA 1JXMA 1YFNA 4MZTA 3RKXA 2KT1A 4E7KA 3PIOA 3PMTA 5FLXE 2LQNA 2PVOB 4HVVA 2CT4A 3RNJA 2BE9B 5LJ5h 1FMWA 4M7DD 5KYYA 2GNCA 2E3HA 1OZ2A 4AFSC 3JCMf 1FX7A 1VIEA 1YCYA 2OJ2A 1WJSA 3UF4A 1WQ7A 1NEGA 3ASKA 3UPUA 1Q7YU 5I11A 3E1SA 3NTHA 4FM4B 1IGQA 2YRCA 1IXDA 1JJ2A 2MCNA 4RKUE 3EHQA 4PLIA 3V7RA 1NEBA 3OYYA 4KBMB 1AVZC 3MHXA 2QAZA 4L59A 1WNLA 2RK2A 3OBYA 4VUBA 3VRZA 5LJ5d 1SPKA 2HQXA 4M75C 3DLLA 4JDSA 4C8QG 3I55T 4PFOA 2MF2A 5AYFA 1JJ2S 4RTVA 1M1GA 3CCRQ 1GL5A 5FWCA 3GP8A 3M4GA 2EQJA 1NBEB 2DJZA 1Y7XA 3S3NA 2L3QA 5GAN2 2GCXA 2E65A 3OB9A 4KH0B 4Y91A 1VQPT 2D8JA 4C8QB 2LC4A 4EMGA 3L42A 1ARKA 1AEYA 2FRYA 3QWYA 1OI1A 3RBBB 2O2OA 2COWA 2HBPA 1D1AA 4PJOE 5GAN5 3HKSA 2J6FA 4RTUA 1TS9A 2LCSA 1KG1A 1B3QA 2HBWA 2V26A 4PFPA 2E6ZA 2ED0A 1M90R 4MZMA 4Z89A 5ECAA 5HY6A 5FU6C 4ZN1A 4QQDA 3VU3C 1OULA 2NUTB 1PKTA 4ELZC 1Y57A 1WIEA 4CRIA 4A4EA 2VVKA 2Y4YA 3CCJT 2Y90A 3CCMA 4M7AC 1UE9A 1KSWA 2AKKA 2QI2A 3PNWC 3FB9A 2RPNA 2BZ8A 3CC2Q 4NOYA 3HHTB 1Y0MA 1QVFP 2KYBA 4C0DB 2DX1A 1K9MR 1A0NB 2X3XD 2SRCA 5GAOq 4QT7A 1C1AA 3FRNA 2KNBB 2R57A 4N4IA 1OV3A 3SEMA 1TSFA 3INZA 1QCFA 2ZGWA 3QG1A 3OQ5A 1KD1R 4FCYA 2K3YA 2QEXT 4C92E 3OS5A 1PKSA 4IUTA 1JU5C 2RJEA 1BIAA 3G71Q 5GANh 3CCJA 4C8QF 4RCCA 2KEAA 3G4SQ 3CC4Q 5D6WA 4A4KA 1M30A 1GFCA 2QEXQ 5LJ3d 3HTRA 4KGVB 3EFSA 1MHNA 4NL2A 2J06A 4IUUA 1HK9A 3HRSA 3T9NA 4BI3A 3A8LB 1NPPA 2WACA 2RQRA 4J9HA 4F7UB 1VQ7Q 1WGSA 3TVTA 5I21A 1KC8R 4BY6C 1WHKA 3C4SA 4LDXA 5CR2A 1NLPC 2PVGB 3M0PA 4E47A 2YHTA 3QPHA 4M75E 1F1BB 2RNAA 2QEXA 3CC2T 5HK0A 1YP5A 2LDMA 3OYKA 3OSSC 1UTIA 3G1JA 2KBTA 2QQAA 3OYEA 3KFVA 3CCJQ 4M7DG 2CS7A 3JCMJ 3E19A 4RTWA 4OP0A 1M4ZA 2LQWA 1S72T 3CMAT 2A37A 3OW2P 1CSKA 3RESA 1WA7A 4O6JA 1UHCA 4A53A 4ESRA 5FRMA 3JB9I 2DPPB 1RLQC 2DETA 4OB2B 2AIRB 3L2RA 1WDXA 3JCMc 2RHYA 4JZ4A 3VJPA 1M8MA 4AMCA 2QYZA 2P4TA 3A5ZB 5I22A 1ZQ1A 2F2WA 2P0PA 5DY9A 3PFSA 3ZFJA 3JB9F 1PM3A 4C92G 1G83A 3UDCA 4PJOD 2HDAA 1EIFA 3ZL7C 4FYWB 1TU0B 3OY9A 1Y96B 1O75A 1M3CA 2QDLA 2VXEA 2DE0X 3MO8A 1S72A 1M5Q1 2XICA 3DKMA 1I1JA 4TVRA 1AWWA 2VB6A 2COYA 2X4YA 1WYXA 3QDRB 2DYIA 2HL3A 1QP3A 1LJOA 1LNXA 3IQLA 5CKFA 5GAMd 1UJ0A 3X25B 3EHRA 1T0HA 3EGUA 2MK5A 3VV0A 3H0IA 4DBQA 2GBQA 1HSQA 2HQEA 2RHIA 2DTIA 2GFUA 1OU8A 4QQ6A 4X9DA 4M75F 5FU6B 1ZHIA 3P8DA 1FYNA 2EGAA 2CSQA 2ROTA 1I5OB 1VQ7T 1WPYA 2IVWA 1KIKA 3CPFA 3F70A 2RA2A 2EFIA 5GMKh 5KE3A 2JT4A 3UT1A 4BACA 3M0TA 3JCMb 1B34B 1G3TA 1OPLA 1YHQA 1VQ9Q 3C12A 1ZSZB 4DEYA 1OZ3A 2LX9A 4JRQA 1EFNA 4MDWA 2GTOA 4J9CA 1G3SA 5CKDA 1YN8A 2XD0A 2G3RA 1T3SA 4Q5WA 3M0SA 2D9TA 4M78A 3I5RA 4C92B 4QW2A 3SWNB 4KGZB 1VQ7A 4MDXA 2VGNA 4PJNA 2LQ8A 3JB9H 3QJ6A 5HKCA 2HCKA 4FU6A 5CKEA 5KYUA 1QVFS 3A8OB 1ZUYA 4IKFA 2YT6A 4QVDA 3M55A 3L2WA 3EG9B 5GAOn 1T0JA 3JV3A 3NMZC 2F5TX 3CCEA 3QXEB 2YRDA 2AK5A 2K3XA 1QWEA 2KSSA 5LJ3h 1K1ZA 1OYXA 1IZ6A 4C5GA 2YRVA 5GAMj 2K7AA 1WHMA 2QXFA 1N27A 3LGLA 4B9WA 1GBQA 2JNGA 1MMNA 1TOVA 1WXBA 4EMHA 2J6OA 4D8KA 3QWXX 1QQJA 3RMQA 4J9GA 1TUGB 2KQWA 3VUBA 1D0YA 2RD1A 3CPWS 4PJOA 2RJCA 2WSEE 2VYTA 1M2VB 1H92A 4OB1B 4PK4A 3OYJA 2RHXA 1SSHA 4X34A 3HP9A 2CZ0B 2RHUA 1XOVA 1PNJA 1B34A 1YBYA 5GAN4 2HQHA 1VQLA 1RLPC 3CCET 2DEQA 2FYKA 1IB8A 4JRIA 1TUCA 4M77C 3EG9A 1KFZA 4FT2A 2DO3A 1WHHA 1BKBA 3I56A 4FSSA 4Y28E 1VYTA 1K73U 2COZA 3KBGA 5LJ5j 1WX6A 4ZNXA 2EKOA 2W0ZA 4M7AE 2C06A 2JTEA 3LH5A 5D6XA 1PRMC 2DXCA 5GAOp 1Q82C 4MMKA 2FG0A 1AHJB 4JJDA 2KRNA 3MPUB 4ZGDB 1YIJQ 4Y92A 2Z0WA 1W2BA 3ULRB 2FEIA 5GANj 2NLUA 2L8DA 2QQRA 4M78B 2OX7A 3DLMA 3JB9D 3A8MB 3VS4A 3V8KA 2CUDA 2J05A 4PJOC 1VQLT 5CQXA 4CC7A 3D7SB 4EMKC 2PUOB 2EQKA 1NJIC 2E64A 4R56A 1G3WA 4C8QD 4Z88A 2CSIA 2A7YA 1QMCA 3EGDB 5D7UA 4BB7A 1YIJT 2X51A 6AT1B 5FROA 3FJ5A 4LN2A 3OYMA 1XJWB 3LW5E 2I0NA 2DNUA 2H3EB 3CXCA 3NGPA 3PE0A 4OMLA 3J7AF 5I2SA 2QQSA 3G6ET 1M2OA 1QW1A 2NUPB 1BI0A 1K0XA 4ZGEB 3M56A 3CC7A 3DB3A 2DK3A 3PVLA 2ATCB 1B7TA 4ANJA 1QKXA 1FMVA 2V1QA 5CCAA 2BKDN 4EPCA 5IXBA 2F1LA 4CC2A 1K73C 4UC4A 1ABOA 4KULA 1I81A 1WLPB 2VV5A 4ATOA 5KYXA 1U06A 3JAME 1M1KR 4ELYC 1OX8A 2RK1A 3QYGB 2IIMA 1YIJA 5GAN7 2OTLT 3EG3A 4F7UG 2DTOA 4EMKB 3Q1JA 1X6BA 4JRKA 2J7IA 4M7AF 1X2QA 3GNFB 1VUBA 3RR6A 2M51A 2D0NA 3G6EA 1M1FA 2DXUA 4M7DC 9ATCB 4J6YA 1N9RA 4XTVA 4AFUC 3QZ9B 1ZUUA 4F7UA 4JRPA 4J83A 2EBPA 4IURA 3L2ZA 2KDSA 3PGGA 4XU3A 3TEEA 4KT0E 4KRTA 1VQOA 2MMPA 2PVDB 1Q86C 2L0AA 1WJRA 2ABLA 2NWMA 4C5IA 2CUBA 3V8LA 3CCMT 2A0FB 3TSZA 2GFAA 3X20B 1OOTA 2K3BA 4OGEA 5J3BA 2RJFA 2YXYA 2CYZB 3E2UA 1NE8A 1VQ4Q 3CCSA 5LJ5g 2XDPA 3FJPA 4JLIA 2KR3A 1M90U 3TU4K 4AFZC 1Z9ZA 4ORZA 1NPRA 1D0ZA 5IHIA 3CCLQ 1YWPA 1W1FA 1UGVA 1G3YA 2FZGB 2XG8D 3REAB 1MUZA 4M7AD 3EH1A 2OI3A 2CP6A 1WHJA 1UEBA 4EMKA 1R0BG 3RKYA 2K4YA 2DVEA 3CMEA 2KY9A 2CP0A 2L2PA 1QKWA 1RABB 3JCMP 2RQUA 2RO0A 3CCST 3DB4A 4M77E 2XMFA 1IREB 4C0FA 3JCMe 2A36A 2CH4W 1NM7A 4J9EA 2JUFA 3CXCS 3FDRA 2EIFA 3CCQA 1SSFA 1W6XA 3QBYA 4WTOB 3CEYA 3WXMB 1YJNQ 2QQ9A 2YUNA 4LD6A 1XTDA 4DBRA 3BE3A 2E10A 2KRSA 3BW1A 5CKHA 4BY6B 3QSUA 2DBMA 4LDUA 4PJOB 2DL3A 4LD9K 3OYNA 2HD0A 2GTJA 5GAN8 3CCRA 1K9AA 2HL5C 5A0LA 3JCMW 1YJ9T 3GLXA 2JM9A 3CMAA 4C92F 1JO8A 2DL5A 4FW1A 4E7JA 2GQVA 4GLMA 4BI4A 2H8HA 4LDYA 1VOMA 2E5KA 1D3BA 3TCJA 2RB6A 3VS3A 4Z8AA 2DRMA 5C6SA 1IO6A 1I07A 5DLOA 4DBHA 3RMSA 2ECZA 2A3LA 2VC8A 1Q81U 5EC7A 1KC8C 2LJ3A 2KXDA 4WCIA 3SD4A 5HK3A 1NG2A 2XU8A 3SDZA 2ENMA 3OA6A 3OYGA 1B07A 3L1AA 1QLYA 2JS0A 5IAYA 2MI6A 1ZUKA 3CCRT 2FHDA 1QVGP 2YLBA 4EDUA 1K73R 4OVAA 3UA6A 4C5HA 2QDYB 1RAEB 4M78G 1M3BA 3JCMX 3GOXA 1M1KU 4RG8A 1VQ6Q 2K6DA 1JRIA 2QGGA 4M75D 4PNOA 4RTYA 1XNIA 2EJGA 2EPDA 1MNDA 2L5QA 1ZBXA 3AT1B 3G71A 1M1KC 2X3WD 3OYFA 3CMEQ 3M0QA 3FEOA 2FPFA 2EAYA 4O5VA 1YI2T 2DZ9A 3M9QA 4J7FA 4CC4B 2CP7A 4DEXA 3S6WA 2CT3A 3HL8A 1GRIA 1YWOA 2RI5A 1WXTA 2DJQA 4E2FB 2P0QA 2HMAA 4R0KA 4J9IA 3OYDA 4RTZA 1LOJA 1Q86U 2LP5A 4M77B 2MPXC 2HEQA 4M4ZA 3I55Q 4M78F 3G4SA 3CCEQ 5CO7A 1AWJA 4M75B 4OB0B 3GNGA 4M77G 1WHGA 5GAOl 1WZOA 1VQ8Q 1YHQT 3MEAA 3MP6A 1PCXA 5IHKA 1GFDA 2O88A 5L8RE 3X28B 4LDWA 5IH2A 1TG0A 4XAXB 5KE2A 4C92A 1YI2A 4ZTFA 1KQSS 3V7SA 5FU7B 1YJ9Q 1X75C 1VQ5T 3TSWA 2CP3A 2K2MA 1D3BB 2EYQA 1FXXA 2RQVA 4OMPA 4HVWA 3EGXA 2L3PA 1JEGA 3G4ST 4M78E 1JBMA 1I8FA 3JSCA 2CREA 4ME7A 1AOJA 2X35A 3A8GB 2L3SA 5LJ3e 4QQGA 3EH2A 4QVCA 4J5YA 4PL6A 2O4XA 1IGUA 4FIBA 2PU9B 4F16A 3QZ5B 4IIOA 1KC8U 4Z02A 3H0FA 1KK7A 4F7UE 1Q81C 4JJBA 4PJLA 2PZ1A 1GXIE 5GANd 4IUQA 3HSBA 2YWWA 1BI1A 1KD1U 2RI2A 2XHCA 5GAOr 1U1SA 2ZCFB 4OMQA 3VS6A 1VIFA 4XTYA 3H8ZA 3CCMQ 1TXQA 1KHIA 3OYLA 1TH7A 1HXDA 2ZPIB 2D6FA 4M75G 1HYOA 1PG5B 2E70A 1P92A 3QUIA 1WQWA 1Y07A 2HKNA 1RL2A 3P8BB 2FPEA 2X4WA 3MEWA 4ZN3A 2JW4A 2CH4A 3OW2S 3LGFA 4XTWA 4IUVA 3N5BB 3I56T 3SB2A 3M58A 3MJXA 2HSEB 3P8HA 1TTHB 2IPOB 4IIMA 3QIIA 2KRMA 3NFCA 2WSCE 5GANf 1VQPQ 1BYMA 3EG2A 3H41A 1YNZA 4C92C 1K9MC 3EFRA 1ZSZC 2DBKA 4PLLA 1YJNA 2K5FA 4IUPA 5HCKA 2C0TA 3C0CA 1SRMA 2DILA 3CCQQ 3BDLA 3EAEA 4L5GA 3M53A 2JMAA 3LLRA 1SEMA 1S72Q 1VA7A 2ZPEB 1KD1C 1QP2A 5IXFA 1ZA2B 1VQMA 2YLCA 1GBRA 1VQ4T 4F7UF 1Q86R 2MAMA 5GAMe 2RHZA 1Z9QA 5GMKl 4PKCC 3QDFA 4RTXA 2RF0A 4II1A 3S3MA 1K8AU 2HNIA 4HCZA 5LJ3g 2DERA 1K0SA 3GPLA 1UUEA 1MMGA 4HCBA 1D1BA 2Y4XA 3GF5A 3URGA 3L2UA 1UFFA 4JUVA 3CC7T 4HVUA 4A54A 2C0OA 3CCSQ 5GAMh 2EJ9A 4F17A 3TREA 3MKDA 5LJ3j 2MWOA 1VQ9T 4AG2C 1N5ZA 2HKQB 2JXBA 4M7DF 1TUDA 3M57A 4JS5A 3CC4T 3VS0A 1VQMT 2P0KA 2LRQA 2LT1A 2EQMA 4RCBA 3MEVA 1YITA 1BIBA 5KYWB 2OTLA 4A63B 3M5AA 4BE2A 1CKBA 1H8KA 1UDLA 1R8OB 3OS2A 2A08A 2EQUA 3C95A 4XTXA 2ZPFB 3HRUA 2D1XA 5IT9E 1KQ2A 1UJYA 2ZPGB 1KHCA 2CKKA 2DA9A 2DFUA 2JS2A 2B86A 4C8QE 3VRYA 3OS1A 2JM8A 4RUGA 1VQ9A 1MMDA 1VQOT 4HA8A 3CCVQ 3CC4A 3R6OA 1Y71A 2F69A 2DLPA 1W2BS 2OAUA 1WI7A 2LNVA 1KJWA 1YITT 4C8QC 1R0CB 1VQ6A 2K79A 5KYXB 1OPKA 4A4FA 4BD3A 3HPWA 1C0MA 4KUIA 1QVGA 2ZPBB 5J39A 2XI9A 4M77D 4AG1C 1RAFB 2BUDA 2KVQG 3E9FA 5GJVB 4K11A
chains in the Genus database with same CATH topology
1BBZA 1UECA 1W6XA 1WDXA 1U3OA 4JZ4A 1M8MA 5I22A 2YUNA 2RQWA 2KRSA 2F2WA 4D8DA 2M0YA 2LNHB 1AZEA 2BZXA 2DBMA 1BU1A 1G83A 5L23A 2HDAA 1M27C 2W10A 2DL3A 3ZL7C 1UG1A 1S1NA 1E7OA 2EYWA 2GTJA 2DYBA 1T3LA 1K9AA 1M3CA 2QDLA 2DE0X 1GCQC 2JM9A 3H0HA 1NYFA 1JO8A 1I1JA 2DL5A 4GLMA 1AWWA 1FMKA 2H8HA 2VKNA 2DRKA 2LX7A 1WYXA 2E5KA 2KGTA 3VS1A 3VS3A 3M0UA 4Z8AA 1PRLC 2DRMA 2DL8A 1NLOC 1ABQA 1IO6A 1I07A 2A28A 3IQLA 1YCSB 1UJ0A 1X69A 2ECZA 2GGRA 1JXOA 3EHRA 2SEMA 3VS2A 1T0HA 2KYMA 5EC7A 3EGUA 2AZSA 2NUZA 2D8HA 3H0IA 2LJ3A 2KXDA 2GBQA 1HSQA 2EQIA 4JZ3A 4WCIA 2G6FX 1NG2A 2P4RA 2ENMA 1FYNA 2JMCA 1B07A 2CDTA 1QLYA 2JS0A 2K9GA 2VWFA 2EGAA 2CSQA 2ROTA 3EG1A 2MOXA 1X2KA 1ZUKA 2RQTA 3R6NA 1KIKA 1K76A 1W70A 2JT4A 3UA6A 4LNPA 3M0TA 1WFWA 1RI9A 2EVRA 1M3BA 2DL7A 2GQIA 1HJDA 1V1CA 3GBQA 2LMJA 2K6DA 1OPLA 4RTYA 1JQQA 4LUEA 2EPDA 2YUOA 2YSQA 2X3WD 3UATA 4DEYA 3M0QA 2FPFA 1EFNA 2PTKA 1H3HA 2F2XA 2FPDA 2GTOA 4J9CA 1K4US 4CC4B 1X6GA 1YN8A 3REBB 1PWTA 1T3SA 4DEXA 2CT3A 3M0SA 3UA7A 1VYVA 2BTTA 1GRIA 3I5RA 2O31A 1YWOA 2AKLA 1WXTA 2DJQA 2DMOA 4R0KA 4J9IA 4RTZA 1ZLMA 2LP5A 4OMOA 4HCKA 2HSPA 4OMMA 2HCKA 2HEQA 4M4ZA 1CKAA 1BK2A 1AWJA 1ZUYA 1BB9A 2ROLA 3NPFA 2YT6A 1G2BA 3A98A 5IHKA 4E6RA 1GFDA 2KXCA 3O5ZA 4AFQC 4EIKA 1AWXA 2O88A 1T0JA 3I35A 2LJ1A 3I9QA 3JV3A 3NMZC 5IH2A 1TG0A 4CC3A 2BZYA 2KROA 2DF6A 2DVJA 2AK5A 1QWEA 1K1ZA 5IHNA 2ED1A 2FRWA 3NHNA 2K7AA 2LJ0A 4X1VA 3TSWA 1GCPA 2K2MA 1GBQA 1RUWA 2FO0A 4OMNA 1WXBA 2RQVA 2OAWA 2EYXA 4OMPA 5FWBA 1M3AA 2O9VA 4HVWA 2J6OA 2C0IA 4D8KA 3QWXX 4J9FA 2EYZA 2YDLA 4J9DA 4J9GA 2L3PA 1JEGA 5GJWB 1VYUA 1ZSGA 3U23A 1JXMA 2KT8A 2CREA 1AOJA 1ZBJA 1H92A 2KT1A 2L3SA 1SSHA 2LQNA 2EKHA 4HVVA 2CT4A 3RNJA 1XOVA 1E6GA 1PNJA 4F16A 2DM1A 1RLPC 2GNCA 4IIOA 4AFSC 3H0FA 2OJ2A 4JJBA 1TUCA 2PZ1A 3UF4A 1KFZA 1NEGA 4FSSA 1SRLA 5I11A 1VYTA 4F14A 1WX6A 2DL4A 4ZNXA 2W0ZA 2JTEA 3LH5A 2MCNA 3EHQA 1PRMC 1PHTA 4OMQA 3VS6A 1NEBA 2FG0A 4JJDA 1AZGB 2KRNA 3THKA 2F2VA 4Y92A 1AVZC 2KE9A 3ULRB 2FEIA 3VRZA 3VS4A 1SPKA 1NYGA 4JPBW 2EW3A 1UHFA 2CUDA 4RTVA 2FPEA 2YUPA 2J05A 1GL5A 5FWCA 2LZ6B 1J3TA 4CC7A 2JW4A 2EGCA 2CH4A 4Z88A 2CSIA 2L3QA 1GCQA 1SHGA 2D8JA 1WXUA 3FJ5A 4IIMA 4LN2A 4J9BA 2KRMA 1ARKA 1AEYA 2FRYA 3QWYA 2I0NA 3RBBB 2DNUA 2O2OA 3NGPA 3PE0A 3EG2A 4OMLA 3H41A 1YNZA 2J6FA 4RTUA 2PNIA 2LCSA 4RTTA 2DBKA 1K0XA 4HXJA 1B3QA 2HBWA 5HCKA 1LCKA 2ED0A 3PVLA 2C0TA 2RN8A 3C0CA 1SRMA 2DILA 1QKXA 4Z89A 2V1QA 5ECAA 5IXBA 2JMAA 4CC2A 1ABOA 1PKTA 1SEMA 1VA7A 1Y57A 3SHWA 1WIEA 1WLPB 5IXFA 1U06A 2VVKA 1GBRA 1UE9A 1KSWA 2AKKA 4LE9A 1Z9QA 2AZVA 2IIMA 2RPNA 4RTXA 2RF0A 3EG3A 2BZ8A 1X6BA 2YUQA 4GBQA 1Y0MA 2J7IA 1X2QA 2KYBA 1I0CA 2DX1A 1K0SA 1A0NB 2J6KA 1UUEA 2X3XD 2M51A 2SRCA 5FW9A 2D0NA 4QT7A 1UFFA 3PVQA 2KNBB 4HVUA 1OV3A 2MIOA 4AFUC 2C0OA 1ZUUA 3SEMA 1E6HA 3EG0A 1MV0B 1QCFA 2EBPA 4F17A 4AG2C 1PKSA 1N5ZA 2JXBA 4KRTA 2EGEA 1TUDA 1JU5C 3CQTA 2L0AA 2NWMA 2ABLA 3VS0A 3VS5A 2V1RA 2CUBA 3I5SA 3TSZA 2KEAA 1AD5A 1OOTA 2O9SA 2K3BA 4LUDA 1M30A 2ESWA 1GFCA 1U5SA 4A63B 1CKBA 1H8KA 1UDLA 1QWFA 2J06A 2A08A 2KR3A 2RQRA 4AFZC 1Z9ZA 2D1XA 4J9HA 4ORZA 5IHIA 1UJYA 3TVTA 1YWPA 1W1FA 1UGVA 2DA9A 2JS2A 2B86A 3VRYA 1OEBA 1MV3A 1NLPC 3M0PA 3REAB 1MUZA 4JJCA 2JM8A 2OI3A 2RNAA 4RUGA 1YP5A 2EYYA 1UTIA 1ZX6A 2KBTA 3KFVA 1X27A 2DLPA 4RTWA 2L2PA 1WI7A 1X43A 3M0RA 2LQWA 1QKWA 1KJWA 2A37A 2RQUA 3VS7A 2K79A 1SHFA 1CSKA 1OPKA 1WA7A 2XMFA 1UHCA 4AG1C 4ESRA 2A36A 1HD3A 2CH4W 1NM7A 4J9EA 5GJVB 1RLQC 2RMOA 4K11A 1AWOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BBZ A;  1UEC A;  1W6X A;  1WDX A;  1U3O A;  4JZ4 A;  1M8M A;  5I22 A;  2YUN A;  2RQW A;  2KRS A;  2F2W A;  4D8D A;  2M0Y A;  2LNH B;  1AZE A;  2BZX A;  2DBM A;  1BU1 A;  1G83 A;  5L23 A;  2HDA A;  1M27 C;  2W10 A;  2DL3 A;  3ZL7 C;  1UG1 A;  1S1N A;  1E7O A;  2EYW A;  2GTJ A;  2DYB A;  1T3L A;  1K9A A;  1M3C A;  2QDL A;  2DE0 X;  1GCQ C;  2JM9 A;  3H0H A;  1NYF A;  1JO8 A;  1I1J A;  2DL5 A;  4GLM A;  1AWW A;  1FMK A;  2H8H A;  2VKN A;  2DRK A;  2LX7 A;  1WYX A;  2E5K A;  2KGT A;  3VS1 A;  3VS3 A;  3M0U A;  4Z8A A;  1PRL C;  2DRM A;  2DL8 A;  1NLO C;  1ABQ A;  1IO6 A;  1I07 A;  2A28 A;  3IQL A;  1YCS B;  1UJ0 A;  1X69 A;  2ECZ A;  2GGR A;  1JXO A;  3EHR A;  2SEM A;  3VS2 A;  1T0H A;  2KYM A;  5EC7 A;  3EGU A;  2AZS A;  2NUZ A;  2D8H A;  3H0I A;  2LJ3 A;  2KXD A;  2GBQ A;  1HSQ A;  2EQI A;  4JZ3 A;  4WCI A;  2G6F X;  1NG2 A;  2P4R A;  2ENM A;  1FYN A;  2JMC A;  1B07 A;  2CDT A;  1QLY A;  2JS0 A;  2K9G A;  2VWF A;  2EGA A;  2CSQ A;  2ROT A;  3EG1 A;  2MOX A;  1X2K A;  1ZUK A;  2RQT A;  3R6N A;  1KIK A;  1K76 A;  1W70 A;  2JT4 A;  3UA6 A;  4LNP A;  3M0T A;  1WFW A;  1RI9 A;  2EVR A;  1M3B A;  2DL7 A;  2GQI A;  1HJD A;  1V1C A;  3GBQ A;  2LMJ A;  2K6D A;  1OPL A;  4RTY A;  1JQQ A;  4LUE A;  2EPD A;  2YUO A;  2YSQ A;  2X3W D;  3UAT A;  4DEY A;  3M0Q A;  2FPF A;  1EFN A;  2PTK A;  1H3H A;  2F2X A;  2FPD A;  2GTO A;  4J9C A;  1K4U S;  4CC4 B;  1X6G A;  1YN8 A;  3REB B;  1PWT A;  1T3S A;  4DEX A;  2CT3 A;  3M0S A;  3UA7 A;  1VYV A;  2BTT A;  1GRI A;  3I5R A;  2O31 A;  1YWO A;  2AKL A;  1WXT A;  2DJQ A;  2DMO A;  4R0K A;  4J9I A;  4RTZ A;  1ZLM A;  2LP5 A;  4OMO A;  4HCK A;  2HSP A;  4OMM A;  2HCK A;  2HEQ A;  4M4Z A;  1CKA A;  1BK2 A;  1AWJ A;  1ZUY A;  1BB9 A;  2ROL A;  3NPF A;  2YT6 A;  1G2B A;  3A98 A;  5IHK A;  4E6R A;  1GFD A;  2KXC A;  3O5Z A;  4AFQ C;  4EIK A;  1AWX A;  2O88 A;  1T0J A;  3I35 A;  2LJ1 A;  3I9Q A;  3JV3 A;  3NMZ C;  5IH2 A;  1TG0 A;  4CC3 A;  2BZY A;  2KRO A;  2DF6 A;  2DVJ A;  2AK5 A;  1QWE A;  1K1Z A;  5IHN A;  2ED1 A;  2FRW A;  3NHN A;  2K7A A;  2LJ0 A;  4X1V A;  3TSW A;  1GCP A;  2K2M A;  1GBQ A;  1RUW A;  2FO0 A;  4OMN A;  1WXB A;  2RQV A;  2OAW A;  2EYX A;  4OMP A;  5FWB A;  1M3A A;  2O9V A;  4HVW A;  2J6O A;  2C0I A;  4D8K A;  3QWX X;  4J9F A;  2EYZ A;  2YDL A;  4J9D A;  4J9G A;  2L3P A;  1JEG A;  5GJW B;  1VYU A;  1ZSG A;  3U23 A;  1JXM A;  2KT8 A;  2CRE A;  1AOJ A;  1ZBJ A;  1H92 A;  2KT1 A;  2L3S A;  1SSH A;  2LQN A;  2EKH A;  4HVV A;  2CT4 A;  3RNJ A;  1XOV A;  1E6G A;  1PNJ A;  4F16 A;  2DM1 A;  1RLP C;  2GNC A;  4IIO A;  4AFS C;  3H0F A;  2OJ2 A;  4JJB A;  1TUC A;  2PZ1 A;  3UF4 A;  1KFZ A;  1NEG A;  4FSS A;  1SRL A;  5I11 A;  1VYT A;  4F14 A;  1WX6 A;  2DL4 A;  4ZNX A;  2W0Z A;  2JTE A;  3LH5 A;  2MCN A;  3EHQ A;  1PRM C;  1PHT A;  4OMQ A;  3VS6 A;  1NEB A;  2FG0 A;  4JJD A;  1AZG B;  2KRN A;  3THK A;  2F2V A;  4Y92 A;  1AVZ C;  2KE9 A;  3ULR B;  2FEI A;  3VRZ A;  3VS4 A;  1SPK A;  1NYG A;  4JPB W;  2EW3 A;  1UHF A;  2CUD A;  4RTV A;  2FPE A;  2YUP A;  2J05 A;  1GL5 A;  5FWC A;  2LZ6 B;  1J3T A;  4CC7 A;  2JW4 A;  2EGC A;  2CH4 A;  4Z88 A;  2CSI A;  2L3Q A;  1GCQ A;  1SHG A;  2D8J A;  1WXU A;  3FJ5 A;  4IIM A;  4LN2 A;  4J9B A;  2KRM A;  1ARK A;  1AEY A;  2FRY A;  3QWY A;  2I0N A;  3RBB B;  2DNU A;  2O2O A;  3NGP A;  3PE0 A;  3EG2 A;  4OML A;  3H41 A;  1YNZ A;  2J6F A;  4RTU A;  2PNI A;  2LCS A;  4RTT A;  2DBK A;  1K0X A;  4HXJ A;  1B3Q A;  2HBW A;  5HCK A;  1LCK A;  2ED0 A;  3PVL A;  2C0T A;  2RN8 A;  3C0C A;  1SRM A;  2DIL A;  1QKX A;  4Z89 A;  2V1Q A;  5ECA A;  5IXB A;  2JMA A;  4CC2 A;  1ABO A;  1PKT A;  1SEM A;  1VA7 A;  1Y57 A;  3SHW A;  1WIE A;  1WLP B;  5IXF A;  1U06 A;  2VVK A;  1GBR A;  1UE9 A;  1KSW A;  2AKK A;  4LE9 A;  1Z9Q A;  2AZV A;  2IIM A;  2RPN A;  4RTX A;  2RF0 A;  3EG3 A;  2BZ8 A;  1X6B A;  2YUQ A;  4GBQ A;  1Y0M A;  2J7I A;  1X2Q A;  2KYB A;  1I0C A;  2DX1 A;  1K0S A;  1A0N B;  2J6K A;  1UUE A;  2X3X D;  2M51 A;  2SRC A;  5FW9 A;  2D0N A;  4QT7 A;  1UFF A;  3PVQ A;  2KNB B;  4HVU A;  1OV3 A;  2MIO A;  4AFU C;  2C0O A;  1ZUU A;  3SEM A;  1E6H A;  3EG0 A;  1MV0 B;  1QCF A;  2EBP A;  4F17 A;  4AG2 C;  1PKS A;  1N5Z A;  2JXB A;  4KRT A;  2EGE A;  1TUD A;  1JU5 C;  3CQT A;  2L0A A;  2NWM A;  2ABL A;  3VS0 A;  3VS5 A;  2V1R A;  2CUB A;  3I5S A;  3TSZ A;  2KEA A;  1AD5 A;  1OOT A;  2O9S A;  2K3B A;  4LUD A;  1M30 A;  2ESW A;  1GFC A;  1U5S A;  4A63 B;  1CKB A;  1H8K A;  1UDL A;  1QWF A;  2J06 A;  2A08 A;  2KR3 A;  2RQR A;  4AFZ C;  1Z9Z A;  2D1X A;  4J9H A;  4ORZ A;  5IHI A;  1UJY A;  3TVT A;  1YWP A;  1W1F A;  1UGV A;  2DA9 A;  2JS2 A;  2B86 A;  3VRY A;  1OEB A;  1MV3 A;  1NLP C;  3M0P A;  3REA B;  1MUZ A;  4JJC A;  2JM8 A;  2OI3 A;  2RNA A;  4RUG A;  1YP5 A;  2EYY A;  1UTI A;  1ZX6 A;  2KBT A;  3KFV A;  1X27 A;  2DLP A;  4RTW A;  2L2P A;  1WI7 A;  1X43 A;  3M0R A;  2LQW A;  1QKW A;  1KJW A;  2A37 A;  2RQU A;  3VS7 A;  2K79 A;  1SHF A;  1CSK A;  1OPK A;  1WA7 A;  2XMF A;  1UHC A;  4AG1 C;  4ESR A;  2A36 A;  1HD3 A;  2CH4 W;  1NM7 A;  4J9E A;  5GJV B;  1RLQ C;  2RMO A;  4K11 A;  1AWO A; 
#chains in the Genus database with same CATH topology
 3JCM d;  4HT9 A;  1BCM A;  1U3O A;  3QJY A;  3CC7 Q;  1M90 C;  3MEU A;  1D0X A;  5KYY B;  2OTJ Q;  2RQW A;  5DLQ E;  1V76 A;  1VQK A;  5KYN A;  4OF1 A;  4D8D A;  2CZ6 B;  4E7S A;  2LNH B;  4P5N A;  1BU1 A;  3HFO A;  5L23 A;  4GY5 A;  2IG0 A;  1M27 C;  3I56 Q;  3MET A;  4FSX A;  1UG1 A;  4GLK A;  2NYS A;  1E7O A;  3CME T;  2EYW A;  1T3L A;  2KAF A;  2QQB A;  3KXT A;  3PIP A;  3LWH A;  4PJO F;  1NYF A;  1VQ6 T;  3QKJ A;  2PQW A;  5KH6 A;  4HCC A;  2JN0 A;  3RKW A;  4DA4 A;  5A0G A;  5CIU A;  3FLG A;  1SKU B;  4A4H A;  3VS1 A;  3M0U A;  1D09 B;  3CCQ T;  1ABQ A;  2A28 A;  2PUK B;  1I5L A;  3BY7 A;  4BDZ A;  5J26 A;  1X69 A;  1UGS B;  2GGR A;  1JXO A;  3H9N A;  4OB3 B;  1XQH A;  4C5E A;  2AZS A;  2MYS A;  2E4H A;  4LXC A;  3NTI A;  1VQK T;  4JZ3 A;  1RAG B;  8AT1 B;  2G6F X;  5A0D A;  1Q81 R;  1VQ5 Q;  3JRZ A;  2CDT A;  3PT9 A;  1UB4 A;  5D6Y A;  2VWF A;  2MOX A;  2RQT A;  3R6N A;  4CI0 C;  1YJ9 A;  1K76 A;  1W70 A;  2F5K A;  4FT4 A;  1SG5 A;  5I2M A;  1WFW A;  5CQY A;  1RI9 A;  2EVR A;  3OW2 A;  2DD4 A;  2DL7 A;  1VQ8 T;  2OTL Q;  3LYI A;  1HJD A;  1V1C A;  3GBQ A;  2CP2 A;  4HKE A;  2LMJ A;  2M02 A;  4QVZ A;  2R5M A;  2YUO A;  8ATC B;  2LTO A;  3JCM h;  1OU9 A;  1K8A C;  2DZC A;  2YSQ A;  3UAT A;  2LQK A;  3GIB A;  2E5Q A;  2GF7 A;  5KCH A;  2CZ1 B;  1QCN A;  5CAI A;  3H6Z A;  2FPD A;  1K4U S;  4C0G A;  1EZZ B;  4N4H A;  1ZSZ A;  3REB B;  4B9X A;  3UA7 A;  1VYV A;  5LJ5 f;  2BTT A;  3G6E Q;  2CGH A;  2LVM A;  5GAO m;  2AKL A;  5GMK i;  2QGF B;  5FRN A;  5GAM f;  2RH2 A;  4HCK A;  1RAD B;  2HSP A;  4JS4 A;  4OMM A;  4E7I A;  1OQK A;  1QVG S;  1BB9 A;  3OYB A;  1UGR B;  2L3R A;  3TQ7 P;  3NPF A;  5DM7 R;  1G2B A;  2FB7 A;  2AHJ B;  3VYG A;  4MZP A;  4E6R A;  3V8J A;  3G71 T;  2KXC A;  3O5Z A;  4EIK A;  3CBO A;  1I4K 1;  1WHL A;  3I9Q A;  4M77 F;  4M75 A;  1RAI B;  4KGX B;  2BZY A;  2O4X B;  2E41 A;  2DF6 A;  4N0A C;  2DVJ A;  1X01 A;  5KYU B;  4M7A B;  2FVU A;  1RAH B;  2ED1 A;  3VUZ A;  5GMK j;  2FRW A;  4FL6 A;  1Q82 R;  1O9S A;  2LJ0 A;  4J8O A;  1GCP A;  4OMN A;  1RUW A;  2JJ9 A;  2EYX A;  5FWB A;  1M3A A;  4FYY B;  2O9V A;  2XDD A;  3CD6 Q;  4J9F A;  4V2S A;  2EYZ A;  2YDL A;  4J9D A;  2X4J A;  5GJW B;  3CCU A;  3J81 E;  1VYU A;  5LL6 S;  3FIF A;  4OGC A;  5C0M A;  2KT8 A;  3JCM g;  4C0Z A;  5GAN g;  1ZBJ A;  4NL3 A;  3OS0 A;  2MWP A;  2FL7 A;  2XDB A;  1YHQ Q;  1RAA B;  2EKH A;  3I55 A;  2DAQ A;  1G5V A;  4QKU A;  1Q95 G;  1E6G A;  2DM1 A;  3CMA Q;  3NTK A;  4BI8 B;  1VQ5 A;  1NZ9 A;  1SRL A;  1VQP A;  4C92 D;  3RDV A;  4F14 A;  3FC3 A;  2L89 A;  4N4G A;  2DL4 A;  3M59 A;  2VXF A;  2O01 E;  1MGQ A;  1PHT A;  4M77 A;  1R77 A;  3C94 A;  1AZG B;  2VAS A;  3CCU T;  3THK A;  2F2V A;  3M54 A;  5CK9 A;  2KE9 A;  3SWN A;  3OMG A;  5LJ3 f;  1RI0 A;  5AT1 B;  1NYG A;  4JPB W;  2EW3 A;  3RER A;  1UHF A;  4PJO G;  3X26 B;  3KUF A;  2YUP A;  2LZ6 B;  4DQ2 A;  2K2V A;  1J3T A;  4OMF B;  2EGC A;  1W4S A;  2DXB A;  3OMC A;  3JB9 J;  1GCQ A;  5EG2 A;  1W2B P;  4HT8 A;  4PJJ A;  4XQ3 A;  1SHG A;  4M7D A;  1WXU A;  1PD1 A;  2DKG A;  2OTJ A;  4J9B A;  2M16 A;  2E6N A;  3CCV T;  2XKO C;  3WVE B;  2R5A A;  2DXT A;  2JTM A;  3ME9 A;  1H64 1;  2PNI A;  1IHW A;  4RTT A;  1U1T A;  2QTX A;  1OX9 A;  2RJD A;  4HXJ A;  3CBM A;  4AT1 B;  1VQL Q;  5GAN e;  1LCK A;  2RN8 A;  2ZPH B;  2E12 A;  3A8H B;  3V7C A;  2KK4 A;  3ZBD A;  3MP8 A;  5GAN 3;  3SHW A;  2QAS A;  4ZGJ B;  4N0A A;  3EFO A;  4M78 D;  4LE9 A;  1N8R C;  4FYX B;  4XTZ A;  2AZV A;  2XK0 A;  2ZZD A;  1AT1 B;  3CD6 A;  3LH0 A;  3L2Q A;  5LJ5 e;  2EWN A;  3BFM A;  2OTJ T;  4F04 B;  4NS5 A;  4ZTJ A;  2YUQ A;  2QA4 Q;  4GBQ A;  3CCV A;  1VQN Q;  3QO3 A;  1N8R U;  3LX7 A;  1I0C A;  4BUG A;  2JTF A;  1M8V A;  2D0Q B;  2J6K A;  4DOV A;  2DEU A;  1MMA A;  2K57 A;  5FW9 A;  3OYC A;  1Y96 A;  1LVK A;  1K9M U;  3PVQ A;  5A2Q E;  1YJN T;  1YI2 Q;  2MIO A;  2B8A A;  5GMK m;  3CCL A;  3VKI A;  4RMO A;  1E6H A;  3EG0 A;  1MV0 B;  3CC2 A;  2EGE A;  2JZ2 A;  3CQT A;  1G8X A;  2NUP A;  3VS5 A;  2V1R A;  3HRT A;  5KYW A;  1VQ4 A;  3I5S A;  2LCL A;  4RG2 A;  1AD5 A;  1DJ7 B;  2O9S A;  4LUD A;  2ESW A;  3CD6 T;  1WJQ A;  2M0O A;  2V8I A;  7AT1 B;  1U5S A;  2QTV A;  5M9O A;  1PSE A;  1QWF A;  4FW2 A;  1KQ1 A;  4DOW A;  4PJM A;  3CXC P;  1PD0 A;  1M9S A;  5GAN 6;  1BI3 A;  3CCL T;  2HZY A;  4LDV A;  3JB9 G;  1OEB A;  1MV3 A;  2KMT A;  4JJC A;  2QA4 T;  1TWB A;  3RUX A;  2EYY A;  4BE0 A;  1YIT Q;  1Q7Y C;  2JVV A;  1VQM Q;  1ZX6 A;  1X27 A;  3S3O A;  2X9H A;  1BCO A;  3SFM A;  4XU2 A;  1PC0 A;  1X43 A;  3EFO B;  3M0R A;  4XU1 A;  3QHS A;  3VS7 A;  2P84 A;  1SHF A;  1D1C A;  2V8K A;  4DBF A;  4PFZ A;  2ZAE A;  1HD3 A;  2NUT A;  3LWI A;  1MNE A;  2M1H A;  3OYH A;  2RMO A;  1YJW T;  1AWO A;  3L2V A;  1BBZ A;  1UEC A;  4J7I A;  3X24 B;  1LPL A;  2XID A;  1V29 B;  1Q7Y R;  1JJ2 P;  2QA4 A;  1PSF A;  2M0Y A;  1YJW Q;  2HAX A;  1N6A A;  1AZE A;  2BZX A;  1M2V A;  4J6X A;  2W10 A;  1H3Z A;  4C8Q A;  2VGM A;  1S1N A;  4M7D B;  2DYB A;  3MP1 A;  2LCC A;  3EGD A;  2H3J A;  4XK8 E;  3J80 E;  1GCQ C;  3H0H A;  2R58 A;  4M7D E;  1SF9 A;  2DTH A;  2M9U A;  1QVP A;  1FMK A;  2V8J A;  2VKN A;  2DRK A;  2LX7 A;  3OYA A;  4MML A;  3MCA B;  1JB0 E;  2KGT A;  4E7Z A;  1PRL C;  2DL8 A;  1YJW A;  1NLO C;  1VQK Q;  5CKB A;  2K5L A;  1ACM B;  1YCS B;  2SEM A;  3VS2 A;  2KYM A;  3HFN A;  2WSF E;  2NUZ A;  1IRX A;  2D8H A;  4BE1 A;  1ZA1 B;  2EQI A;  3JCM V;  3M4Y A;  3CBP A;  3SWN C;  2P4R A;  4JLG A;  2JMC A;  2K5I A;  3BDU A;  3ZEH A;  2K9G A;  3EG1 A;  2FZK B;  4KH1 B;  1X2K A;  5GAM g;  2JOY A;  3ER0 A;  3UWN A;  4M78 C;  4LNP A;  4B6M A;  2LT4 A;  1UGP B;  1QCO A;  2FZC B;  2GQI A;  3WVD B;  1JQQ A;  4LUE A;  1RAC B;  1NJI U;  3CPW A;  2PTK A;  1H3H A;  2F2X A;  5CVI A;  3CCU Q;  4R55 A;  2KI7 A;  1N9S A;  4M7A G;  1X6G A;  4A4G A;  1FWZ A;  1PWT A;  1KQS P;  2E1H A;  2RM4 A;  1KQS A;  2O31 A;  4E7L A;  4JJN K;  4C0D C;  2DIG A;  2DMO A;  2DD5 A;  3CPW P;  1X6O A;  2RI3 A;  1ZLM A;  4OMO A;  3G7Z A;  4M7A A;  1EX4 A;  2BE7 D;  5IN1 A;  1CKA A;  3OYI A;  1BK2 A;  5GMK e;  1VQ8 A;  1VQN T;  1BI2 A;  3OSV A;  1C6V X;  3PTA A;  2CP5 A;  2ROL A;  1K8A R;  3A98 A;  1VQO Q;  4XU0 A;  4BDY A;  2X4X A;  2CZ7 B;  2E3I A;  3JCM Q;  4AFQ C;  1AWX A;  2EJF A;  4X9C A;  3I35 A;  2LJ1 A;  3E9G A;  4E7H A;  1NJI R;  4CC3 A;  2KRO A;  4FYV B;  3RIR A;  4KUD K;  3QYH B;  4YTL A;  1U8R A;  2VUB A;  3A1P A;  4L6V 5;  5IHN A;  4J6W A;  3NHN A;  3PMI A;  2AT1 B;  4X1V A;  4D6W A;  2BIV A;  2I2L A;  2QG9 B;  1UGQ B;  4XTU A;  2FO0 A;  3O8V A;  2OAW A;  1Q82 U;  2QK0 A;  1IHV A;  1QVF A;  3OBW A;  2C0I A;  2DIQ A;  5FU7 C;  3EGX B;  1N8R R;  3VYH B;  4WF2 A;  1ZSG A;  1VQN A;  3U23 A;  3AHU A;  5KCO A;  1JXM A;  1YFN A;  4MZT A;  3RKX A;  2KT1 A;  4E7K A;  3PIO A;  3PMT A;  5FLX E;  2LQN A;  2PVO B;  4HVV A;  2CT4 A;  3RNJ A;  2BE9 B;  5LJ5 h;  1FMW A;  4M7D D;  5KYY A;  2GNC A;  2E3H A;  1OZ2 A;  4AFS C;  3JCM f;  1FX7 A;  1VIE A;  1YCY A;  2OJ2 A;  1WJS A;  3UF4 A;  1WQ7 A;  1NEG A;  3ASK A;  3UPU A;  1Q7Y U;  5I11 A;  3E1S A;  3NTH A;  4FM4 B;  1IGQ A;  2YRC A;  1IXD A;  1JJ2 A;  2MCN A;  4RKU E;  3EHQ A;  4PLI A;  3V7R A;  1NEB A;  3OYY A;  4KBM B;  1AVZ C;  3MHX A;  2QAZ A;  4L59 A;  1WNL A;  2RK2 A;  3OBY A;  4VUB A;  3VRZ A;  5LJ5 d;  1SPK A;  2HQX A;  4M75 C;  3DLL A;  4JDS A;  4C8Q G;  3I55 T;  4PFO A;  2MF2 A;  5AYF A;  1JJ2 S;  4RTV A;  1M1G A;  3CCR Q;  1GL5 A;  5FWC A;  3GP8 A;  3M4G A;  2EQJ A;  1NBE B;  2DJZ A;  1Y7X A;  3S3N A;  2L3Q A;  5GAN 2;  2GCX A;  2E65 A;  3OB9 A;  4KH0 B;  4Y91 A;  1VQP T;  2D8J A;  4C8Q B;  2LC4 A;  4EMG A;  3L42 A;  1ARK A;  1AEY A;  2FRY A;  3QWY A;  1OI1 A;  3RBB B;  2O2O A;  2COW A;  2HBP A;  1D1A A;  4PJO E;  5GAN 5;  3HKS A;  2J6F A;  4RTU A;  1TS9 A;  2LCS A;  1KG1 A;  1B3Q A;  2HBW A;  2V26 A;  4PFP A;  2E6Z A;  2ED0 A;  1M90 R;  4MZM A;  4Z89 A;  5ECA A;  5HY6 A;  5FU6 C;  4ZN1 A;  4QQD A;  3VU3 C;  1OUL A;  2NUT B;  1PKT A;  4ELZ C;  1Y57 A;  1WIE A;  4CRI A;  4A4E A;  2VVK A;  2Y4Y A;  3CCJ T;  2Y90 A;  3CCM A;  4M7A C;  1UE9 A;  1KSW A;  2AKK A;  2QI2 A;  3PNW C;  3FB9 A;  2RPN A;  2BZ8 A;  3CC2 Q;  4NOY A;  3HHT B;  1Y0M A;  1QVF P;  2KYB A;  4C0D B;  2DX1 A;  1K9M R;  1A0N B;  2X3X D;  2SRC A;  5GAO q;  4QT7 A;  1C1A A;  3FRN A;  2KNB B;  2R57 A;  4N4I A;  1OV3 A;  3SEM A;  1TSF A;  3INZ A;  1QCF A;  2ZGW A;  3QG1 A;  3OQ5 A;  1KD1 R;  4FCY A;  2K3Y A;  2QEX T;  4C92 E;  3OS5 A;  1PKS A;  4IUT A;  1JU5 C;  2RJE A;  1BIA A;  3G71 Q;  5GAN h;  3CCJ A;  4C8Q F;  4RCC A;  2KEA A;  3G4S Q;  3CC4 Q;  5D6W A;  4A4K A;  1M30 A;  1GFC A;  2QEX Q;  5LJ3 d;  3HTR A;  4KGV B;  3EFS A;  1MHN A;  4NL2 A;  2J06 A;  4IUU A;  1HK9 A;  3HRS A;  3T9N A;  4BI3 A;  3A8L B;  1NPP A;  2WAC A;  2RQR A;  4J9H A;  4F7U B;  1VQ7 Q;  1WGS A;  3TVT A;  5I21 A;  1KC8 R;  4BY6 C;  1WHK A;  3C4S A;  4LDX A;  5CR2 A;  1NLP C;  2PVG B;  3M0P A;  4E47 A;  2YHT A;  3QPH A;  4M75 E;  1F1B B;  2RNA A;  2QEX A;  3CC2 T;  5HK0 A;  1YP5 A;  2LDM A;  3OYK A;  3OSS C;  1UTI A;  3G1J A;  2KBT A;  2QQA A;  3OYE A;  3KFV A;  3CCJ Q;  4M7D G;  2CS7 A;  3JCM J;  3E19 A;  4RTW A;  4OP0 A;  1M4Z A;  2LQW A;  1S72 T;  3CMA T;  2A37 A;  3OW2 P;  1CSK A;  3RES A;  1WA7 A;  4O6J A;  1UHC A;  4A53 A;  4ESR A;  5FRM A;  3JB9 I;  2DPP B;  1RLQ C;  2DET A;  4OB2 B;  2AIR B;  3L2R A;  1WDX A;  3JCM c;  2RHY A;  4JZ4 A;  3VJP A;  1M8M A;  4AMC A;  2QYZ A;  2P4T A;  3A5Z B;  5I22 A;  1ZQ1 A;  2F2W A;  2P0P A;  5DY9 A;  3PFS A;  3ZFJ A;  3JB9 F;  1PM3 A;  4C92 G;  1G83 A;  3UDC A;  4PJO D;  2HDA A;  1EIF A;  3ZL7 C;  4FYW B;  1TU0 B;  3OY9 A;  1Y96 B;  1O75 A;  1M3C A;  2QDL A;  2VXE A;  2DE0 X;  3MO8 A;  1S72 A;  1M5Q 1;  2XIC A;  3DKM A;  1I1J A;  4TVR A;  1AWW A;  2VB6 A;  2COY A;  2X4Y A;  1WYX A;  3QDR B;  2DYI A;  2HL3 A;  1QP3 A;  1LJO A;  1LNX A;  3IQL A;  5CKF A;  5GAM d;  1UJ0 A;  3X25 B;  3EHR A;  1T0H A;  3EGU A;  2MK5 A;  3VV0 A;  3H0I A;  4DBQ A;  2GBQ A;  1HSQ A;  2HQE A;  2RHI A;  2DTI A;  2GFU A;  1OU8 A;  4QQ6 A;  4X9D A;  4M75 F;  5FU6 B;  1ZHI A;  3P8D A;  1FYN A;  2EGA A;  2CSQ A;  2ROT A;  1I5O B;  1VQ7 T;  1WPY A;  2IVW A;  1KIK A;  3CPF A;  3F70 A;  2RA2 A;  2EFI A;  5GMK h;  5KE3 A;  2JT4 A;  3UT1 A;  4BAC A;  3M0T A;  3JCM b;  1B34 B;  1G3T A;  1OPL A;  1YHQ A;  1VQ9 Q;  3C12 A;  1ZSZ B;  4DEY A;  1OZ3 A;  2LX9 A;  4JRQ A;  1EFN A;  4MDW A;  2GTO A;  4J9C A;  1G3S A;  5CKD A;  1YN8 A;  2XD0 A;  2G3R A;  1T3S A;  4Q5W A;  3M0S A;  2D9T A;  4M78 A;  3I5R A;  4C92 B;  4QW2 A;  3SWN B;  4KGZ B;  1VQ7 A;  4MDX A;  2VGN A;  4PJN A;  2LQ8 A;  3JB9 H;  3QJ6 A;  5HKC A;  2HCK A;  4FU6 A;  5CKE A;  5KYU A;  1QVF S;  3A8O B;  1ZUY A;  4IKF A;  2YT6 A;  4QVD A;  3M55 A;  3L2W A;  3EG9 B;  5GAO n;  1T0J A;  3JV3 A;  3NMZ C;  2F5T X;  3CCE A;  3QXE B;  2YRD A;  2AK5 A;  2K3X A;  1QWE A;  2KSS A;  5LJ3 h;  1K1Z A;  1OYX A;  1IZ6 A;  4C5G A;  2YRV A;  5GAM j;  2K7A A;  1WHM A;  2QXF A;  1N27 A;  3LGL A;  4B9W A;  1GBQ A;  2JNG A;  1MMN A;  1TOV A;  1WXB A;  4EMH A;  2J6O A;  4D8K A;  3QWX X;  1QQJ A;  3RMQ A;  4J9G A;  1TUG B;  2KQW A;  3VUB A;  1D0Y A;  2RD1 A;  3CPW S;  4PJO A;  2RJC A;  2WSE E;  2VYT A;  1M2V B;  1H92 A;  4OB1 B;  4PK4 A;  3OYJ A;  2RHX A;  1SSH A;  4X34 A;  3HP9 A;  2CZ0 B;  2RHU A;  1XOV A;  1PNJ A;  1B34 A;  1YBY A;  5GAN 4;  2HQH A;  1VQL A;  1RLP C;  3CCE T;  2DEQ A;  2FYK A;  1IB8 A;  4JRI A;  1TUC A;  4M77 C;  3EG9 A;  1KFZ A;  4FT2 A;  2DO3 A;  1WHH A;  1BKB A;  3I56 A;  4FSS A;  4Y28 E;  1VYT A;  1K73 U;  2COZ A;  3KBG A;  5LJ5 j;  1WX6 A;  4ZNX A;  2EKO A;  2W0Z A;  4M7A E;  2C06 A;  2JTE A;  3LH5 A;  5D6X A;  1PRM C;  2DXC A;  5GAO p;  1Q82 C;  4MMK A;  2FG0 A;  1AHJ B;  4JJD A;  2KRN A;  3MPU B;  4ZGD B;  1YIJ Q;  4Y92 A;  2Z0W A;  1W2B A;  3ULR B;  2FEI A;  5GAN j;  2NLU A;  2L8D A;  2QQR A;  4M78 B;  2OX7 A;  3DLM A;  3JB9 D;  3A8M B;  3VS4 A;  3V8K A;  2CUD A;  2J05 A;  4PJO C;  1VQL T;  5CQX A;  4CC7 A;  3D7S B;  4EMK C;  2PUO B;  2EQK A;  1NJI C;  2E64 A;  4R56 A;  1G3W A;  4C8Q D;  4Z88 A;  2CSI A;  2A7Y A;  1QMC A;  3EGD B;  5D7U A;  4BB7 A;  1YIJ T;  2X51 A;  6AT1 B;  5FRO A;  3FJ5 A;  4LN2 A;  3OYM A;  1XJW B;  3LW5 E;  2I0N A;  2DNU A;  2H3E B;  3CXC A;  3NGP A;  3PE0 A;  4OML A;  3J7A F;  5I2S A;  2QQS A;  3G6E T;  1M2O A;  1QW1 A;  2NUP B;  1BI0 A;  1K0X A;  4ZGE B;  3M56 A;  3CC7 A;  3DB3 A;  2DK3 A;  3PVL A;  2ATC B;  1B7T A;  4ANJ A;  1QKX A;  1FMV A;  2V1Q A;  5CCA A;  2BKD N;  4EPC A;  5IXB A;  2F1L A;  4CC2 A;  1K73 C;  4UC4 A;  1ABO A;  4KUL A;  1I81 A;  1WLP B;  2VV5 A;  4ATO A;  5KYX A;  1U06 A;  3JAM E;  1M1K R;  4ELY C;  1OX8 A;  2RK1 A;  3QYG B;  2IIM A;  1YIJ A;  5GAN 7;  2OTL T;  3EG3 A;  4F7U G;  2DTO A;  4EMK B;  3Q1J A;  1X6B A;  4JRK A;  2J7I A;  4M7A F;  1X2Q A;  3GNF B;  1VUB A;  3RR6 A;  2M51 A;  2D0N A;  3G6E A;  1M1F A;  2DXU A;  4M7D C;  9ATC B;  4J6Y A;  1N9R A;  4XTV A;  4AFU C;  3QZ9 B;  1ZUU A;  4F7U A;  4JRP A;  4J83 A;  2EBP A;  4IUR A;  3L2Z A;  2KDS A;  3PGG A;  4XU3 A;  3TEE A;  4KT0 E;  4KRT A;  1VQO A;  2MMP A;  2PVD B;  1Q86 C;  2L0A A;  1WJR A;  2ABL A;  2NWM A;  4C5I A;  2CUB A;  3V8L A;  3CCM T;  2A0F B;  3TSZ A;  2GFA A;  3X20 B;  1OOT A;  2K3B A;  4OGE A;  5J3B A;  2RJF A;  2YXY A;  2CYZ B;  3E2U A;  1NE8 A;  1VQ4 Q;  3CCS A;  5LJ5 g;  2XDP A;  3FJP A;  4JLI A;  2KR3 A;  1M90 U;  3TU4 K;  4AFZ C;  1Z9Z A;  4ORZ A;  1NPR A;  1D0Z A;  5IHI A;  3CCL Q;  1YWP A;  1W1F A;  1UGV A;  1G3Y A;  2FZG B;  2XG8 D;  3REA B;  1MUZ A;  4M7A D;  3EH1 A;  2OI3 A;  2CP6 A;  1WHJ A;  1UEB A;  4EMK A;  1R0B G;  3RKY A;  2K4Y A;  2DVE A;  3CME A;  2KY9 A;  2CP0 A;  2L2P A;  1QKW A;  1RAB B;  3JCM P;  2RQU A;  2RO0 A;  3CCS T;  3DB4 A;  4M77 E;  2XMF A;  1IRE B;  4C0F A;  3JCM e;  2A36 A;  2CH4 W;  1NM7 A;  4J9E A;  2JUF A;  3CXC S;  3FDR A;  2EIF A;  3CCQ A;  1SSF A;  1W6X A;  3QBY A;  4WTO B;  3CEY A;  3WXM B;  1YJN Q;  2QQ9 A;  2YUN A;  4LD6 A;  1XTD A;  4DBR A;  3BE3 A;  2E10 A;  2KRS A;  3BW1 A;  5CKH A;  4BY6 B;  3QSU A;  2DBM A;  4LDU A;  4PJO B;  2DL3 A;  4LD9 K;  3OYN A;  2HD0 A;  2GTJ A;  5GAN 8;  3CCR A;  1K9A A;  2HL5 C;  5A0L A;  3JCM W;  1YJ9 T;  3GLX A;  2JM9 A;  3CMA A;  4C92 F;  1JO8 A;  2DL5 A;  4FW1 A;  4E7J A;  2GQV A;  4GLM A;  4BI4 A;  2H8H A;  4LDY A;  1VOM A;  2E5K A;  1D3B A;  3TCJ A;  2RB6 A;  3VS3 A;  4Z8A A;  2DRM A;  5C6S A;  1IO6 A;  1I07 A;  5DLO A;  4DBH A;  3RMS A;  2ECZ A;  2A3L A;  2VC8 A;  1Q81 U;  5EC7 A;  1KC8 C;  2LJ3 A;  2KXD A;  4WCI A;  3SD4 A;  5HK3 A;  1NG2 A;  2XU8 A;  3SDZ A;  2ENM A;  3OA6 A;  3OYG A;  1B07 A;  3L1A A;  1QLY A;  2JS0 A;  5IAY A;  2MI6 A;  1ZUK A;  3CCR T;  2FHD A;  1QVG P;  2YLB A;  4EDU A;  1K73 R;  4OVA A;  3UA6 A;  4C5H A;  2QDY B;  1RAE B;  4M78 G;  1M3B A;  3JCM X;  3GOX A;  1M1K U;  4RG8 A;  1VQ6 Q;  2K6D A;  1JRI A;  2QGG A;  4M75 D;  4PNO A;  4RTY A;  1XNI A;  2EJG A;  2EPD A;  1MND A;  2L5Q A;  1ZBX A;  3AT1 B;  3G71 A;  1M1K C;  2X3W D;  3OYF A;  3CME Q;  3M0Q A;  3FEO A;  2FPF A;  2EAY A;  4O5V A;  1YI2 T;  2DZ9 A;  3M9Q A;  4J7F A;  4CC4 B;  2CP7 A;  4DEX A;  3S6W A;  2CT3 A;  3HL8 A;  1GRI A;  1YWO A;  2RI5 A;  1WXT A;  2DJQ A;  4E2F B;  2P0Q A;  2HMA A;  4R0K A;  4J9I A;  3OYD A;  4RTZ A;  1LOJ A;  1Q86 U;  2LP5 A;  4M77 B;  2MPX C;  2HEQ A;  4M4Z A;  3I55 Q;  4M78 F;  3G4S A;  3CCE Q;  5CO7 A;  1AWJ A;  4M75 B;  4OB0 B;  3GNG A;  4M77 G;  1WHG A;  5GAO l;  1WZO A;  1VQ8 Q;  1YHQ T;  3MEA A;  3MP6 A;  1PCX A;  5IHK A;  1GFD A;  2O88 A;  5L8R E;  3X28 B;  4LDW A;  5IH2 A;  1TG0 A;  4XAX B;  5KE2 A;  4C92 A;  1YI2 A;  4ZTF A;  1KQS S;  3V7S A;  5FU7 B;  1YJ9 Q;  1X75 C;  1VQ5 T;  3TSW A;  2CP3 A;  2K2M A;  1D3B B;  2EYQ A;  1FXX A;  2RQV A;  4OMP A;  4HVW A;  3EGX A;  2L3P A;  1JEG A;  3G4S T;  4M78 E;  1JBM A;  1I8F A;  3JSC A;  2CRE A;  4ME7 A;  1AOJ A;  2X35 A;  3A8G B;  2L3S A;  5LJ3 e;  4QQG A;  3EH2 A;  4QVC A;  4J5Y A;  4PL6 A;  2O4X A;  1IGU A;  4FIB A;  2PU9 B;  4F16 A;  3QZ5 B;  4IIO A;  1KC8 U;  4Z02 A;  3H0F A;  1KK7 A;  4F7U E;  1Q81 C;  4JJB A;  4PJL A;  2PZ1 A;  1GXI E;  5GAN d;  4IUQ A;  3HSB A;  2YWW A;  1BI1 A;  1KD1 U;  2RI2 A;  2XHC A;  5GAO r;  1U1S A;  2ZCF B;  4OMQ A;  3VS6 A;  1VIF A;  4XTY A;  3H8Z A;  3CCM Q;  1TXQ A;  1KHI A;  3OYL A;  1TH7 A;  1HXD A;  2ZPI B;  2D6F A;  4M75 G;  1HYO A;  1PG5 B;  2E70 A;  1P92 A;  3QUI A;  1WQW A;  1Y07 A;  2HKN A;  1RL2 A;  3P8B B;  2FPE A;  2X4W A;  3MEW A;  4ZN3 A;  2JW4 A;  2CH4 A;  3OW2 S;  3LGF A;  4XTW A;  4IUV A;  3N5B B;  3I56 T;  3SB2 A;  3M58 A;  3MJX A;  2HSE B;  3P8H A;  1TTH B;  2IPO B;  4IIM A;  3QII A;  2KRM A;  3NFC A;  2WSC E;  5GAN f;  1VQP Q;  1BYM A;  3EG2 A;  3H41 A;  1YNZ A;  4C92 C;  1K9M C;  3EFR A;  1ZSZ C;  2DBK A;  4PLL A;  1YJN A;  2K5F A;  4IUP A;  5HCK A;  2C0T A;  3C0C A;  1SRM A;  2DIL A;  3CCQ Q;  3BDL A;  3EAE A;  4L5G A;  3M53 A;  2JMA A;  3LLR A;  1SEM A;  1S72 Q;  1VA7 A;  2ZPE B;  1KD1 C;  1QP2 A;  5IXF A;  1ZA2 B;  1VQM A;  2YLC A;  1GBR A;  1VQ4 T;  4F7U F;  1Q86 R;  2MAM A;  5GAM e;  2RHZ A;  1Z9Q A;  5GMK l;  4PKC C;  3QDF A;  4RTX A;  2RF0 A;  4II1 A;  3S3M A;  1K8A U;  2HNI A;  4HCZ A;  5LJ3 g;  2DER A;  1K0S A;  3GPL A;  1UUE A;  1MMG A;  4HCB A;  1D1B A;  2Y4X A;  3GF5 A;  3URG A;  3L2U A;  1UFF A;  4JUV A;  3CC7 T;  4HVU A;  4A54 A;  2C0O A;  3CCS Q;  5GAM h;  2EJ9 A;  4F17 A;  3TRE A;  3MKD A;  5LJ3 j;  2MWO A;  1VQ9 T;  4AG2 C;  1N5Z A;  2HKQ B;  2JXB A;  4M7D F;  1TUD A;  3M57 A;  4JS5 A;  3CC4 T;  3VS0 A;  1VQM T;  2P0K A;  2LRQ A;  2LT1 A;  2EQM A;  4RCB A;  3MEV A;  1YIT A;  1BIB A;  5KYW B;  2OTL A;  4A63 B;  3M5A A;  4BE2 A;  1CKB A;  1H8K A;  1UDL A;  1R8O B;  3OS2 A;  2A08 A;  2EQU A;  3C95 A;  4XTX A;  2ZPF B;  3HRU A;  2D1X A;  5IT9 E;  1KQ2 A;  1UJY A;  2ZPG B;  1KHC A;  2CKK A;  2DA9 A;  2DFU A;  2JS2 A;  2B86 A;  4C8Q E;  3VRY A;  3OS1 A;  2JM8 A;  4RUG A;  1VQ9 A;  1MMD A;  1VQO T;  4HA8 A;  3CCV Q;  3CC4 A;  3R6O A;  1Y71 A;  2F69 A;  2DLP A;  1W2B S;  2OAU A;  1WI7 A;  2LNV A;  1KJW A;  1YIT T;  4C8Q C;  1R0C B;  1VQ6 A;  2K79 A;  5KYX B;  1OPK A;  4A4F A;  4BD3 A;  3HPW A;  1C0M A;  4KUI A;  1QVG A;  2ZPB B;  5J39 A;  2XI9 A;  4M77 D;  4AG1 C;  1RAF B;  2BUD A;  2KVQ G;  3E9F A;  5GJV B;  4K11 A; 
#chains in the Genus database with same CATH homology
 1BBZ A;  1UEC A;  1W6X A;  1WDX A;  1U3O A;  4JZ4 A;  1M8M A;  5I22 A;  2YUN A;  2RQW A;  2KRS A;  2F2W A;  4D8D A;  2M0Y A;  2LNH B;  1AZE A;  2BZX A;  2DBM A;  1BU1 A;  1G83 A;  5L23 A;  2HDA A;  1M27 C;  2W10 A;  2DL3 A;  3ZL7 C;  1UG1 A;  1S1N A;  1E7O A;  2EYW A;  2GTJ A;  2DYB A;  1T3L A;  1K9A A;  1M3C A;  2QDL A;  2DE0 X;  1GCQ C;  2JM9 A;  3H0H A;  1NYF A;  1JO8 A;  1I1J A;  2DL5 A;  4GLM A;  1AWW A;  1FMK A;  2H8H A;  2VKN A;  2DRK A;  2LX7 A;  1WYX A;  2E5K A;  2KGT A;  3VS1 A;  3VS3 A;  3M0U A;  4Z8A A;  1PRL C;  2DRM A;  2DL8 A;  1NLO C;  1ABQ A;  1IO6 A;  1I07 A;  2A28 A;  3IQL A;  1YCS B;  1UJ0 A;  1X69 A;  2ECZ A;  2GGR A;  1JXO A;  3EHR A;  2SEM A;  3VS2 A;  1T0H A;  2KYM A;  5EC7 A;  3EGU A;  2AZS A;  2NUZ A;  2D8H A;  3H0I A;  2LJ3 A;  2KXD A;  2GBQ A;  1HSQ A;  2EQI A;  4JZ3 A;  4WCI A;  2G6F X;  1NG2 A;  2P4R A;  2ENM A;  1FYN A;  2JMC A;  1B07 A;  2CDT A;  1QLY A;  2JS0 A;  2K9G A;  2VWF A;  2EGA A;  2CSQ A;  2ROT A;  3EG1 A;  2MOX A;  1X2K A;  1ZUK A;  2RQT A;  3R6N A;  1KIK A;  1K76 A;  1W70 A;  2JT4 A;  3UA6 A;  4LNP A;  3M0T A;  1WFW A;  1RI9 A;  2EVR A;  1M3B A;  2DL7 A;  2GQI A;  1HJD A;  1V1C A;  3GBQ A;  2LMJ A;  2K6D A;  1OPL A;  4RTY A;  1JQQ A;  4LUE A;  2EPD A;  2YUO A;  2YSQ A;  2X3W D;  3UAT A;  4DEY A;  3M0Q A;  2FPF A;  1EFN A;  2PTK A;  1H3H A;  2F2X A;  2FPD A;  2GTO A;  4J9C A;  1K4U S;  4CC4 B;  1X6G A;  1YN8 A;  3REB B;  1PWT A;  1T3S A;  4DEX A;  2CT3 A;  3M0S A;  3UA7 A;  1VYV A;  2BTT A;  1GRI A;  3I5R A;  2O31 A;  1YWO A;  2AKL A;  1WXT A;  2DJQ A;  2DMO A;  4R0K A;  4J9I A;  4RTZ A;  1ZLM A;  2LP5 A;  4OMO A;  4HCK A;  2HSP A;  4OMM A;  2HCK A;  2HEQ A;  4M4Z A;  1CKA A;  1BK2 A;  1AWJ A;  1ZUY A;  1BB9 A;  2ROL A;  3NPF A;  2YT6 A;  1G2B A;  3A98 A;  5IHK A;  4E6R A;  1GFD A;  2KXC A;  3O5Z A;  4AFQ C;  4EIK A;  1AWX A;  2O88 A;  1T0J A;  3I35 A;  2LJ1 A;  3I9Q A;  3JV3 A;  3NMZ C;  5IH2 A;  1TG0 A;  4CC3 A;  2BZY A;  2KRO A;  2DF6 A;  2DVJ A;  2AK5 A;  1QWE A;  1K1Z A;  5IHN A;  2ED1 A;  2FRW A;  3NHN A;  2K7A A;  2LJ0 A;  4X1V A;  3TSW A;  1GCP A;  2K2M A;  1GBQ A;  1RUW A;  2FO0 A;  4OMN A;  1WXB A;  2RQV A;  2OAW A;  2EYX A;  4OMP A;  5FWB A;  1M3A A;  2O9V A;  4HVW A;  2J6O A;  2C0I A;  4D8K A;  3QWX X;  4J9F A;  2EYZ A;  2YDL A;  4J9D A;  4J9G A;  2L3P A;  1JEG A;  5GJW B;  1VYU A;  1ZSG A;  3U23 A;  1JXM A;  2KT8 A;  2CRE A;  1AOJ A;  1ZBJ A;  1H92 A;  2KT1 A;  2L3S A;  1SSH A;  2LQN A;  2EKH A;  4HVV A;  2CT4 A;  3RNJ A;  1XOV A;  1E6G A;  1PNJ A;  4F16 A;  2DM1 A;  1RLP C;  2GNC A;  4IIO A;  4AFS C;  3H0F A;  2OJ2 A;  4JJB A;  1TUC A;  2PZ1 A;  3UF4 A;  1KFZ A;  1NEG A;  4FSS A;  1SRL A;  5I11 A;  1VYT A;  4F14 A;  1WX6 A;  2DL4 A;  4ZNX A;  2W0Z A;  2JTE A;  3LH5 A;  2MCN A;  3EHQ A;  1PRM C;  1PHT A;  4OMQ A;  3VS6 A;  1NEB A;  2FG0 A;  4JJD A;  1AZG B;  2KRN A;  3THK A;  2F2V A;  4Y92 A;  1AVZ C;  2KE9 A;  3ULR B;  2FEI A;  3VRZ A;  3VS4 A;  1SPK A;  1NYG A;  4JPB W;  2EW3 A;  1UHF A;  2CUD A;  4RTV A;  2FPE A;  2YUP A;  2J05 A;  1GL5 A;  5FWC A;  2LZ6 B;  1J3T A;  4CC7 A;  2JW4 A;  2EGC A;  2CH4 A;  4Z88 A;  2CSI A;  2L3Q A;  1GCQ A;  1SHG A;  2D8J A;  1WXU A;  3FJ5 A;  4IIM A;  4LN2 A;  4J9B A;  2KRM A;  1ARK A;  1AEY A;  2FRY A;  3QWY A;  2I0N A;  3RBB B;  2DNU A;  2O2O A;  3NGP A;  3PE0 A;  3EG2 A;  4OML A;  3H41 A;  1YNZ A;  2J6F A;  4RTU A;  2PNI A;  2LCS A;  4RTT A;  2DBK A;  1K0X A;  4HXJ A;  1B3Q A;  2HBW A;  5HCK A;  1LCK A;  2ED0 A;  3PVL A;  2C0T A;  2RN8 A;  3C0C A;  1SRM A;  2DIL A;  1QKX A;  4Z89 A;  2V1Q A;  5ECA A;  5IXB A;  2JMA A;  4CC2 A;  1ABO A;  1PKT A;  1SEM A;  1VA7 A;  1Y57 A;  3SHW A;  1WIE A;  1WLP B;  5IXF A;  1U06 A;  2VVK A;  1GBR A;  1UE9 A;  1KSW A;  2AKK A;  4LE9 A;  1Z9Q A;  2AZV A;  2IIM A;  2RPN A;  4RTX A;  2RF0 A;  3EG3 A;  2BZ8 A;  1X6B A;  2YUQ A;  4GBQ A;  1Y0M A;  2J7I A;  1X2Q A;  2KYB A;  1I0C A;  2DX1 A;  1K0S A;  1A0N B;  2J6K A;  1UUE A;  2X3X D;  2M51 A;  2SRC A;  5FW9 A;  2D0N A;  4QT7 A;  1UFF A;  3PVQ A;  2KNB B;  4HVU A;  1OV3 A;  2MIO A;  4AFU C;  2C0O A;  1ZUU A;  3SEM A;  1E6H A;  3EG0 A;  1MV0 B;  1QCF A;  2EBP A;  4F17 A;  4AG2 C;  1PKS A;  1N5Z A;  2JXB A;  4KRT A;  2EGE A;  1TUD A;  1JU5 C;  3CQT A;  2L0A A;  2NWM A;  2ABL A;  3VS0 A;  3VS5 A;  2V1R A;  2CUB A;  3I5S A;  3TSZ A;  2KEA A;  1AD5 A;  1OOT A;  2O9S A;  2K3B A;  4LUD A;  1M30 A;  2ESW A;  1GFC A;  1U5S A;  4A63 B;  1CKB A;  1H8K A;  1UDL A;  1QWF A;  2J06 A;  2A08 A;  2KR3 A;  2RQR A;  4AFZ C;  1Z9Z A;  2D1X A;  4J9H A;  4ORZ A;  5IHI A;  1UJY A;  3TVT A;  1YWP A;  1W1F A;  1UGV A;  2DA9 A;  2JS2 A;  2B86 A;  3VRY A;  1OEB A;  1MV3 A;  1NLP C;  3M0P A;  3REA B;  1MUZ A;  4JJC A;  2JM8 A;  2OI3 A;  2RNA A;  4RUG A;  1YP5 A;  2EYY A;  1UTI A;  1ZX6 A;  2KBT A;  3KFV A;  1X27 A;  2DLP A;  4RTW A;  2L2P A;  1WI7 A;  1X43 A;  3M0R A;  2LQW A;  1QKW A;  1KJW A;  2A37 A;  2RQU A;  3VS7 A;  2K79 A;  1SHF A;  1CSK A;  1OPK A;  1WA7 A;  2XMF A;  1UHC A;  4AG1 C;  4ESR A;  2A36 A;  1HD3 A;  2CH4 W;  1NM7 A;  4J9E A;  5GJV B;  1RLQ C;  2RMO A;  4K11 A;  1AWO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...