1M3AA

Solution structure of a circular form of the truncated n-terminal sh3 domain from oncogene protein c-crk.
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
57
structure length
57
Chain Sequence
b'CYVRALFDFNGNDEEDLPFKKGDILRIRDKPEEQWWNAEDSEGKRGMIPVPYVEKYG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Proto-oncogene C-crk
publication title Changing protein backbone topology: Structural and dynamic consequences of the backbone cyclization in SH3 domain
rcsb
source organism Mus musculus
molecule tags Protein binding
total genus 6
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2002-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1m3aA00
2DVJA 1G83A 3TSWA 3A98A 2JS0A 4J9FA 1KIKA 3VS5A 1UTIA 1NLPC 3VS4A 1WA7A 2SEMA 1H92A 2RQUA 2ECZA 1X6BA 4LUDA 3PVQA 1I07A 5HCKA 2LNHB 2KGTA 5I11A 2DE0X 1M30A 2RNAA 1T3LA 2FRWA 1GBQA 4RTXA 5FW9A 4HVWA 1ABQA 1OV3A 1M27C 4J9BA 4F14A 3RBBB 3I5RA 4JJBA 2K2MA 1AWJA 1WI7A 2KRMA 2E5KA 2BZYA 3EG3A 1VYVA 3UA7A 2LQNA 2DNUA 2F2WA 2GTJA 2HCKA 4IIMA 2FG0A 1K4US 2O9SA 1U5SA 1AWWA 2O88A 1SSHA 1UFFA 1YCSB 2NWMA 3VS1A 2AZSA 1QWFA 2KYMA 2BZ8A 4JZ4A 2CT3A 1H8KA 1UE9A 1OEBA 2K3BA 4CC2A 1N5ZA 1G2BA 4LNPA 2FEIA 2A08A 2JM9A 4RTYA 4J9DA 2KROA 2KRNA 1UECA 2VWFA 1UDLA 2KXDA 3H0HA 2JTEA 2O9VA 2CSQA 1PKSA 5EC7A 2BTTA 2BZXA 1WDXA 1NEBA 2DA9A 2L3QA 5ECAA 1HSQA 1Y0MA 2KR3A 3FJ5A 2MOXA 1SHFA 4RTZA 2EYXA 2YDLA 3GBQA 2B86A 4ZNXA 4RTTA 1EFNA 2KRSA 1JXMA 4OMPA 2RQTA 3O5ZA 2LMJA 1MV0B 1B3QA 3VS6A 2DL5A 1E7OA 3UATA 1W70A 2EKHA 1GBRA 3PE0A 2FPFA 2EGEA 1GFDA 3H0FA 3QWXX 2YUQA 4IIOA 2DJQA 2EBPA 2OI3A 1X2QA 2JW4A 3TVTA 4KRTA 2LJ1A 1AVZC 4CC7A 1M3CA 2AKLA 2K6DA 3IQLA 3R6NA 2AK5A 2RQVA 2X3WD 1UGVA 2DILA 3KFVA 1GCQA 5IHIA 1BU1A 2GBQA 3H41A 1M3BA 3THKA 2LJ3A 1UHCA 1AZEA 2DYBA 4AG2C 1KFZA 1RI9A 2LX7A 1MUZA 2O31A 1QKWA 5IH2A 2KEAA 1GCPA 2F2XA 2J05A 1X27A 3VRYA 1XOVA 3M0UA 2CDTA 2JS2A 2FPEA 2K9GA 2LP5A 2J6KA 1AOJA 1I1JA 2JMAA 2LQWA 4K11A 1YWPA 3NPFA 1U3OA 4QT7A 2CT4A 3EG0A 5L23A 2RQRA 5IXFA 2KT1A 1V1CA 4JJDA 2JMCA 1TUCA 4X1VA 4RTWA 2L3PA 1YP5A 4OMLA 4Z8AA 2LZ6B 2EPDA 4CC3A 2JT4A 2P4RA 1WFWA 1LCKA 1NEGA 1NG2A 1SRLA 3NHNA 4AFZC 2AZVA 2JM8A 1AWOA 2HEQA 3REBB 2V1RA 1HD3A 1JEGA 2DBMA 2MCNA 3TSZA 1BK2A 1Z9QA 1IO6A 1K0SA 1B07A 2HDAA 1SPKA 4J9CA 4R0KA 3ZL7C 3VS3A 1YN8A 2DMOA 1RUWA 4A63B 1HJDA 2AKKA 2RMOA 4AFUC 1MV3A 2EYZA 2FRYA 2CH4A 1OPLA 1M8MA 1ARKA 2DRKA 1ZSGA 3EHQA 3M0TA 4Z88A 2LJ0A 3EG1A 4Y92A 1WX6A 1GCQC 1KJWA 3M0QA 3H0IA 3PVLA 3I5SA 1W6XA 1K1ZA 2KBTA 1M3AA 1FYNA 1ZUKA 3EHRA 2M0YA 4ESRA 1QLYA 2X3XD 1ZX6A 4AFSC 2OJ2A 2K7AA 1SRMA 5FWBA 4RUGA 2ED0A 2G6FX 2L0AA 1K0XA 1ABOA 4JPBW 3UA6A 1T0HA 3I35A 5I22A 4RTVA 1SEMA 1JU5C 1GFCA 4JZ3A 2RPNA 3EG2A 3M0PA 1JQQA 2ROTA 4E6RA 1NLOC 4OMOA 2DLPA 1OOTA 2RN8A 1CSKA 1AEYA 2DX1A 3M0SA 2J6FA 4OMMA 4LE9A 3U23A 2L3SA 2RF0A 3I9QA 1ZBJA 2D0NA 4JJCA 5FWCA 1I0CA 4OMNA 2OAWA 2GNCA 2I0NA 2F2VA 1WYXA 4F16A 2DL7A 2D8HA 1RLPC 1ZUUA 1YWOA 1UG1A 1H3HA 4DEXA 3VS0A 3NGPA 2NUZA 2H8HA 2CUDA 5GJWB 1X69A 3M0RA 1W1FA 1GL5A 2QDLA 1RLQC 1VYTA 1E6HA 2LCSA 2A36A 3REAB 2DBKA 1WLPB 1VYUA 4F17A 4HCKA 4HVVA 4WCIA 1A0NB 1TG0A 1UUEA 1VA7A 1TUDA 2KNBB 1BB9A 4OMQA 4GBQA 2CUBA 2EW3A 2DL4A 2YSQA 1CKBA 2EGAA 2GGRA 1Z9ZA 2CSIA 2XMFA 2CH4W 2C0OA 3CQTA 2PZ1A 2C0TA 2ROLA 2RQWA 4D8KA 1FMKA 2EVRA 3RNJA 3JV3A 4J9HA 2W10A 3LH5A 4RTUA 4LUEA 3VS2A 1PKTA 2GQIA 2V1QA 1SHGA 3QWYA 1NYFA 2ENMA 2DL3A 3SEMA 4HXJA 3SHWA 1OPKA 2HSPA 1CKAA 2EYYA 1YNZA 1NM7A 2MIOA 1K76A 1AZGB 1J3TA 1KSWA 2SRCA 2J06A 3EGUA 3NMZC 4AG1C 1QWEA 2DL8A 2DF6A 4HVUA 1PRLC 4J9IA 2FPDA 2KXCA 5IXBA 4GLMA 1S1NA 2ESWA 2YUNA 1T0JA 4LN2A 3VS7A 1X6GA 2A28A 2M51A 2D8JA 2D1XA 3ULRB 4J9GA 4J9EA 1X2KA 1Y57A 1QKXA 4Z89A 1E6GA 2L2PA 3UF4A 2IIMA 3VRZA 2FO0A 2YT6A 2GTOA 1GRIA 2VKNA 4FSSA 1NYGA 1JXOA 1K9AA 2O2OA 1JO8A 2ED1A 1PNJA 2K79A 2KT8A 2DRMA 1T3SA 5IHNA 5IHKA 2W0ZA 5GJVB 1UJYA 2PNIA 2EYWA 2VVKA 2J7IA 4ORZA 2ABLA 1AWXA 1WIEA 4D8DA 4EIKA 2PTKA 1WXUA 2EQIA 2YUOA 1U06A 3C0CA 4M4ZA 1PHTA 4DEYA 2HBWA 2J6OA 1WXBA 1PWTA 1BBZA 1ZLMA 4AFQC 1WXTA 2C0IA 2JXBA 1PRMC 1ZUYA 1X43A 2CREA 2DM1A 1QCFA 2YUPA 1UJ0A 2KE9A 1UHFA 2KYBA 1AD5A 2A37A 4CC4B 2EGCA
chains in the Genus database with same CATH superfamily
1G83A 3EGXA 3TSWA 4DBRA 1Q7YU 4HCZA 2JS0A 4BI3A 2B8AA 3VS4A 1H92A 2RQUA 5FRMA 1SSFA 5FU6B 1M90U 4PK4A 1WZOA 1R0CB 2DE0X 2P84A 1M30A 4M7DG 4M7DE 2E4HA 2QQBA 2EQMA 2KK4A 4RTXA 3CMEQ 3CCET 1BCOA 1Q7YR 2M02A 4EMHA 2FZCB 1OV3A 1M27C 4C92F 4J9BA 3QBYA 2HQHA 4JJBA 3VUBA 1JRIA 2K2MA 1AWJA 2KRMA 1VYVA 3GP8A 2LQKA 4IUTA 2O01E 4DOVA 3O8VA 2F2WA 3G4SA 3RR6A 2HCKA 2HBPA 3DB4A 2FG0A 1TUGB 1VQKA 1K4US 3GLXA 3TCJA 1U5SA 1AWWA 2X4WA 4E7IA 1SSHA 1UEBA 1VQPQ 1YCSB 1VQ4T 2EIFA 4RMOA 4FIBA 1M9SA 3E19A 1NJIR 3UDCA 2MPXC 2KYMA 5FU7C 4JZ4A 1RAIB 1OEBA 4X9DA 1N5ZA 4JRKA 2VWFA 2CZ0B 3RUXA 3L2UA 3CMEA 3M59A 3H0HA 2O9VA 4MMKA 1ZSZB 3PMTA 4XU2A 2GFUA 1RADB 2BZXA 3RMQA 1WDXA 3ZFJA 3I55Q 4LD9K 3CMAQ 1K8AU 1NEBA 3M4YA 2DA9A 4DBQA 1HSQA 2YRDA 3M55A 1C6VX 3MKDA 2KI7A 2YDLA 3CC2Q 1G3YA 2B86A 3QUIA 4ZNXA 2QQSA 5LJ5g 2XDBA 3O5ZA 1MV0B 3VS6A 5DM7R 1OU8A 2ATCB 4FW1A 2VUBA 1VQPA 2ZGWA 4GLKA 4C8QB 1K8AR 3P8BB 1W70A 4R55A 2WSCE 1LVKA 4M75D 1N9SA 2YUQA 3OQ5A 2DJQA 1N8RC 2EBPA 1YJNT 2JW4A 1D1AA 2R57A 2CP7A 1BI2A 4KRTA 1M1KU 1M3CA 2DEUA 3SWNB 1IXDA 3KFVA 4M77D 2K5FA 1GCQA 4PLIA 5IHIA 1UB4A 3V8KA 3QZ9B 3CCQQ 1M3BA 5CKHA 3THKA 1RABB 4MZMA 1AZEA 4RG2A 4AG2C 4C92B 2K4YA 3CCUQ 1M1KR 3BDLA 3FIFA 2CP6A 4MDXA 1QKWA 3CC2A 3GNFB 5IH2A 2K3XA 3CBMA 3JB9F 4E7ZA 1XOVA 3M0UA 3J7AF 2JS2A 2FPEA 1I1JA 2JMAA 2VC8A 5GMKj 1U3OA 3M56A 5CVIA 1R77A 2RQRA 2KT1A 2JMCA 4V2SA 2GF7A 2RHYA 1U1TA 3JCMb 3OW2P 1OQKA 2LZ6B 3OS0A 4ATOA 3CCQA 1NG2A 3QDFA 4ME7A 1VQ6T 5IT9E 4AFZC 2AZVA 4NL3A 5LJ5j 4LDYA 4QVCA 3CCUA 1WGSA 1Q82U 3MEVA 4DA4A 2OTLT 1JEGA 2MCNA 2HNIA 5A0LA 3TQ7P 1BK2A 2D9TA 2R58A 2D6FA 3M58A 1Y07A 1K0SA 2P0QA 1B07A 2XKOC 2HDAA 4R0KA 4M7AG 4M7AE 4B9XA 1YN8A 1Q82R 1RUWA 2RK2A 3LX7A 1I4K1 2RMOA 4BDYA 3OBYA 2CH4A 2DRKA 4JLGA 4PL6A 1KHIA 3RIRA 1X01A 1XJWB 3RKXA 4BI4A 2LJ0A 1D0XA 2RO0A 5KYWA 1YJ9Q 5FLXE 7AT1B 2ZPFB 5GAMg 3PVLA 3I5SA 1WHLA 4JRQA 4MMLA 1MMNA 1KQ2A 2M0YA 4ESRA 2QDYB 1ZX6A 3C94A 1SRMA 3JCMQ 5FWBA 4A4KA 2ED0A 3OSVA 3TEEA 1ABOA 2LX9A 2RM4A 2QASA 4XQ3A 3UA6A 4C92G 1I5OB 1T0HA 3X25B 3L2QA 4JZ3A 2DKGA 2QEXA 2RPNA 3M0PA 2ROTA 5GAN5 3N5BB 4QKUA 1QW1A 2DX1A 1WPYA 5J26A 4OMMA 4LE9A 3PIPA 2L3SA 3I9QA 1V29B 2K5LA 4FT2A 3WVDB 1YJ9A 2GNCA 1VQMT 3OYJA 1WYXA 3SDZA 4F16A 1MMAA 1VQOA 1RLPC 2E41A 2X51A 2EAYA 1VQLQ 1KQ1A 3QJYA 2OTLA 4BDZA 4ZN1A 4QQ6A 2DXUA 2QDLA 4BE0A 2JJ9A 3OYLA 3E9FA 1E6HA 1B7TA 3HHTB 3VYGA 2MAMA 1VYUA 4F17A 4HCKA 3V7RA 3EH1A 1VA7A 1PD0A 1TUDA 4BACA 2KNBB 2NUTA 4DOWA 3CCMT 1M5Q1 2PVOB 2DL4A 2EGAA 2GGRA 5GAMj 5GANd 1YBYA 5KE2A 5FRNA 2OAUA 5A0DA 2EVRA 3RNJA 5CIUA 4J9HA 1MMGA 4J6XA 2G3RA 3QDRB 2GQIA 4C0ZA 1VQ7T 3MCAB 3AT1B 2LVMA 3KUFA 4QQDA 1VQLA 1WQ7A 3EFOA 3SHWA 1Y96A 5L8RE 4E2FB 4A4HA 1YNZA 3V7CA 1VQ5Q 1AZGB 4E7LA 1Q86C 3NMZC 2DL8A 3M4GA 2KXCA 3OA6A 5CKBA 1H3ZA 1HK9A 4GLMA 1S1NA 4M78C 2YRCA 4LN2A 3VS7A 5FU7B 1GXIE 4OMFB 2LT4A 1JJ2A 1VQ8T 3ULRB 1QKXA 4BI8B 3VRZA 2FO0A 3A8MB 1GRIA 2EQKA 1VQNQ 3E9GA 3BY7A 2DD4A 1K9AA 1PNJA 1M1FA 3E2UA 1T3SA 2DO3A 1K73C 2D0QB 4M7AA 4EIKA 2OTJT 2F5KA 4M78A 3CCST 3LGFA 5KYXB 4MDWA 1U06A 3C0CA 4M4ZA 3EFSA 1VQ5A 4J8OA 3OSSC 2RHZA 2XK0A 2C0IA 3OS2A 3HPWA 2E70A 2RJEA 1QCFA 4M75G 4M75E 1UJ0A 3FDRA 2BKDN 2ZAEA 3P8DA 2EGCA 1KG1A 2DVJA 4J7IA 2DZCA 2HKQB 5GANg 2QA4Q 2H3EB 1VQ9Q 1YJWT 2XDDA 1KIKA 1MNDA 1QP3A 1UTIA 2E65A 1WA7A 4NOYA 3L2RA 1X6BA 4LDXA 2CGHA 4M77G 4M77E 3PVQA 3RDVA 2MK5A 2KGTA 4FYVB 1JJ2S 3EG9B 5LJ5e 4QVDA 2FRWA 3CBOA 3MEAA 4BE1A 2HKNA 3HKSA 4F14A 3RBBB 2XIDA 3I5RA 4KULA 2LDMA 3I56T 2BZYA 3EG3A 3MJXA 3G71Q 2LQNA 5LJ3f 5GMKl 3META 1YITT 2VASA 5AT1B 1EZZB 4XU1A 4C8QD 5CQYA 2VYTA 3G6EQ 2DJZA 1V76A 1UFFA 1VQ8A 2VXEA 3CCVQ 2QA4A 5M9OA 1VQ9A 5GAMh 4QW2A 1QWFA 1M2OA 2ZPBB 2BZ8A 4A4EA 1YIJT 3BDUA 2LRQA 2L3RA 1G2BA 4LNPA 3X28B 5KYYB 3FC3A 1U1SA 2VXFA 2JM9A 1TSFA 1ZHIA 2K3YA 3WXMB 3OW2S 1UECA 1UDLA 1PSEA 2LQ8A 2JTEA 3JCMJ 1SF9A 2CSQA 5GAOr 2E12A 5KYWB 5IN1A 2PUOB 2EKOA 1BI0A 1DJ7B 3TU4K 5KE3A 3C95A 3PGGA 2YWWA 4RTTA 2KMTA 4OMPA 2LMJA 4XTWA 2QGGA 1IRXA 4E7SA 1KHCA 3UATA 3CCVA 1SG5A 1GBRA 1YJWA 1ZQ1A 3NTIA 4MZPA 3LYIA 1GFDA 4J6WA 3H0FA 3QKJA 2KVQG 3A8LB 1G5VA 4KGZB 1X2QA 5D6XA 2DIQA 4XTXA 1G3SA 3QZ5B 3JCMV 4E7KA 2K6DA 2RHUA 2RQVA 2X3WD 1UGVA 1VQKQ 4LXCA 4KUIA 2M9UA 1BU1A 5LJ5d 3J80E 5I2MA 1P92A 1FXXA 4XU0A 3KXTA 4M78F 1D09B 4PJOC 2ZZDA 2LX7A 5HY6A 2HZYA 1YHQQ 1GCPA 2BE9B 5GAN2 5GAMe 4IUUA 4FW2A 3NTHA 2QAZA 2CDTA 5KYUB 2LP5A 2J6KA 1KD1C 2EQJA 4E7HA 3OYHA 4PJOA 4LDUA 1NJIU 1V1CA 1TUCA 4JS4A 4X1VA 3CBPA 4M75A 3A5ZB 2L3PA 1YP5A 4OMLA 1RAAB 2AT1B 4EMKA 2ZCFB 3HRUA 2JT4A 4Y91A 3V7SA 2E3IA 2MI6A 2NYSA 5DY9A 3EGDA 4WTOB 3OB9A 3JCMP 4PJLA 4JJNK 2QG9B 5GAN4 2DZ9A 1Y71A 2DXTA 1K9MC 1AWOA 3CCJT 3OY9A 2V1RA 4M77A 2DBMA 2KY9A 3TSZA 1YHQA 1RAEB 2PUKB 1OZ2A 2L89A 4MZTA 1N6AA 4J9CA 5AYFA 3JB9D 3CCEQ 3NFCA 2JVVA 2CKKA 5CKFA 3ZL7C 3TREA 2KQWA 3VS3A 1I8FA 3RKWA 2FB7A 2EYZA 2LT1A 4F7UG 4F7UE 2Y4YA 1AHJB 3CD6T 3EHQA 2AHJB 2IPOB 1PC0A 2E10A 5D7UA 1H641 4Y92A 3JCMf 1GCQC 2P0PA 2O4XA 1KJWA 3INZA 1M2VA 3OYFA 2QXFA 2R5MA 1W6XA 2XHCA 2KBTA 1M3AA 2Z0WA 1VQ4Q 3EHRA 2MYSA 5D6YA 1S72T 2EQUA 2OJ2A 4C0GA 4M78B 1K0XA 4JPBW 5GANh 3H8ZA 5I22A 4RTVA 1JJ2P 4XU3A 1GFCA 3CCEA 1BKBA 5GAMd 4J7FA 1JQQA 3BE3A 4KUDK 4QVZA 2DLPA 1CSKA 2HQEA 4L5GA 2RI2A 2NUPA 4FYYB 2VGMA 3U23A 2RF0A 4OGEA 2I2LA 3JAME 3GF5A 1I0CA 4Q5WA 2F2VA 3CCLT 1D3BA 4C5IA 3UPUA 1H3HA 3VYHB 1KC8C 2X35A 1VQ4A 2RHIA 3MEUA 4BY6C 4N4GA 2NUZA 2H8HA 5GJWB 2ZPGB 1W1FA 4OVAA 3RERA 2WSFE 5LJ3g 1YJNQ 4M7DC 1B34A 3CC7T 2F5TX 3X24B 3A1PA 2MMPA 3OYNA 3M5AA 5GAOl 4HVVA 4JRPA 1JBMA 1TG0A 1D1BA 3CCRT 1BB9A 4GBQA 2EW3A 1FMWA 2YLCA 5J39A 4ZGEB 2YSQA 2CZ7B 1MHNA 2HAXA 1Z9ZA 2CSIA 2XMFA 2Y90A 3CD6A 2CH4W 2V8JA 3OYAA 1YI2T 2RK1A 3BFMA 1YFNA 2DTOA 3LWIA 2EYQA 4M7DA 4PJOF 3PTAA 1MMDA 4RTUA 3LH0A 3ZEHA 2QYZA 1PKTA 3CC4T 2QEXQ 4NL2A 1SHGA 2YHTA 2ENMA 5GANe 2DL3A 1OPKA 2WSEE 1UGSB 1CKAA 1WHJA 3DLMA 1NM7A 1YJNA 1LJOA 1K76A 4C8QG 4C8QE 1Q81C 3EFRA 1KSWA 3S3NA 2SRCA 1QWEA 2COWA 4J9IA 1M8VA 3JRZA 2FPDA 5IXBA 2K2VA 2JTFA 2YUNA 4PJMA 2A28A 1VQOQ 2M51A 2D8JA 3OBWA 4J9GA 1VQ6Q 4J9EA 1X2KA 1Y57A 4Z89A 3HFOA 4OP0A 1BYMA 1FMVA 2OTLQ 2VKNA 4TVRA 1NYGA 5A0GA 3M57A 3CCLA 5IHNA 4C92E 5IHKA 4B9WA 5GJVB 1UJYA 3CXCA 2J7IA 4CI0C 1WIEA 4N0AA 2PTKA 5LJ3j 3PNWC 3KBGA 2FL7A 2YLBA 2M1HA 1AT1B 1PHTA 5GMKm 2J6OA 1WXBA 4IUVA 4AFQC 1BBZA 1QQJA 3JCMW 1RAGB 3EGXB 1PRMC 1ZUYA 1X43A 2KYBA 4O5VA 4KH1B 2A37A 4R56A 1RAFB 1VQ6A 2YRVA 1R8OB 4J9FA 3VS5A 2DXCA 4FSXA 4DBFA 1YI2A 1NZ9A 3L1AA 4XTVA 4LUDA 2L8DA 5I11A 2HL5C 1PSFA 2RNAA 1BI1A 4XAXB 4Z02A 2M0OA 4PLLA 5FW9A 1MGQA 3MHXA 3MP6A 2X4YA 4HVWA 1F1BB 4PJOB 2EWNA 2CP2A 4UC4A 1WI7A 3SD4A 5GMKh 1G3WA 3EAEA 5CK9A 1VQMQ 1TWBA 4II1A 1XNIA 3HP9A 2V8KA 2RH2A 1WQWA 2FHDA 3CPWA 1PCXA 2NWMA 3CEYA 5LJ5h 3S3OA 1OYXA 4ELZC 1N8RU 4OB2B 3OMGA 4FL6A 2CT3A 1H8KA 1Q7YC 2K3BA 2FEIA 4RTYA 3X20B 2ZPHB 1IB8A 1M90C 3JCMg 1UGPB 4M7AC 5GAOp 1N8RR 4M7DF 5EC7A 3HL8A 1KQSA 3CCMQ 2LCLA 1QVGA 4KH0B 2E64A 4LDWA 2LTOA 2RI5A 1ZSZA 1Y0MA 1C0MA 2KR3A 1SHFA 1WHHA 4ELYC 3JB9G 2EYXA 2XD0A 3BW1A 3GBQA 1VQMA 2DTIA 3L42A 1HYOA 2KRSA 2RQTA 4KGVB 1B3QA 2DL5A 3L2WA 4JRIA 3D7SB 4YTLA 2EJGA 3P8HA 3GNGA 2EKHA 3PE0A 3QHSA 8ATCB 3OYCA 3URGA 2EGEA 3VJPA 3FJPA 2BUDA 4C8QA 1O75A 1EX4A 2OI3A 3TVTA 3OYDA 4CC7A 5EG2A 3LW5E 2AKLA 3CPWS 2KAFA 2XI9A 3NTKA 3M53A 3R6NA 2AK5A 5GMKe 2CP3A 2GBQA 2NUPB 4AMCA 4B6MA 5GAN3 1BIAA 3SWNA 3CCMA 1UHCA 1VQ8Q 3HTRA 1ACMB 2NLUA 5CR2A 2KDSA 1D3BB 1KFZA 1MUZA 2O31A 1K8AC 2JTMA 1KQSS 4C92A 3QSUA 3QIIA 2J05A 1QVGS 4PFZA 2GQVA 3VRYA 1R0BG 1VQ7A 2OTJQ 1AOJA 2JOYA 3CCSQ 1YWPA 3NPFA 3JB9H 3S6WA 3RKYA 4QT7A 1M4ZA 3M9QA 5DLOA 3EG0A 8AT1B 2P4TA 5IXFA 3ZBDA 4E47A 2E3HA 1D1CA 1QVPA 2X4XA 4BY6B 3GPLA 1M1KC 3OMCA 4Z8AA 4VUBA 1BCMA 2EPDA 2P4RA 1SRLA 1NEGA 2BIVA 4XTZA 1VOMA 1TTHB 4M7DB 2QQAA 1YJWQ 4A4FA 2HEQA 1KK7A 2COYA 3REBB 4M78D 2K57A 5IAYA 1C1AA 2FVUA 1QMCA 3QJ6A 1Z9QA 2ZPIB 1IO6A 4GY5A 1SPKA 5HK0A 2E6ZA 2OTJA 5I21A 5CO7A 2RI3A 1RAHB 4IKFA 3CCSA 4A63B 1HJDA 2AKKA 4AFUC 1MV3A 1OPLA 3I56Q 4BB7A 2PQWA 1LOJA 2V26A 4X9CA 3G4ST 5LJ3e 2V8IA 4Z88A 1YITQ 1VQKT 1OX9A 3F70A 3M0QA 1BIBA 1IZ6A 2LNVA 5I2SA 1M1GA 4EDUA 1K1ZA 1IHWA 4C5HA 2E5QA 3OS5A 1QLYA 4C0DC 4AFSC 2P0KA 4RUGA 2G6FX 1Q82C 2L0AA 2AIRB 5GAOm 4OB0B 3CMET 1O9SA 2DFUA 3EG2A 1QP2A 4XK8E 2C06A 1OX8A 4HKEA 4OMOA 2RD1A 4M7AF 3I56A 4QQGA 2RHXA 9ATCB 3DB3A 1ZBJA 3CXCP 4JJCA 2L5QA 2QQ9A 4M75C 1YITA 2I0NA 5LL6S 4PFPA 4EMKC 2D8HA 4RCCA 1VQPT 1YWOA 1UG1A 1TS9A 2XG8D 3NGPA 5KYNA 1IGQA 2MWOA 2CUDA 4P5NA 3M0RA 1EIFA 4M77C 3DKMA 2CZ6B 1Q86U 1YIJA 4ZTFA 2F1LA 2NUTB 2LCSA 2A36A 2HL3A 3REAB 3J81E 3MO8A 1IGUA 4WCIA 3C4SA 3VV0A 2DERA 2XU8A 2QQRA 1OU9A 4OMQA 5GMKi 3S3MA 1JB0E 2CUBA 1Q86R 3JCMh 3I55T 1M90R 1FX7A 1CKBA 3CMAT 1QVFA 3JSCA 2C0OA 1WJRA 2PZ1A 3CC2T 3L2ZA 1K73U 4ZGDB 3JV3A 5LJ3d 4FYXB 4IURA 2DVEA 3EFOB 2IG0A 1Y96B 2HMAA 2V1QA 2XICA 4J5YA 4A4GA 3QYGB 1K73R 2EYYA 3RESA 1J3TA 1ZA2B 2K5IA 3EGUA 2DF6A 4HVUA 1PRLC 4C5EA 2JZ2A 4L6V5 3CPWP 2CP5A 2DD5A 5KCHA 1T0JA 1WHGA 1X6GA 3CCQT 2A3LA 3GOXA 1E6GA 3CCUT 3UF4A 4BE2A 2IIMA 2YT6A 3CCJQ 2GTOA 4FSSA 4M7AB 4HT8A 1JXOA 2O2OA 3SB2A 2CS7A 2JN0A 2QGFB 3MP1A 1W2BP 2W0ZA 1KQSP 4J6YA 1QVFS 2PNIA 2EYWA 2VVKA 1QVGP 4PJOD 4KGXB 2ABLA 4JS5A 1WXUA 2YUOA 2XDPA 2HQXA 1PG5B 3OYEA 3WVEB 4EMGA 3LWHA 1D0YA 4DEYA 2HBWA 4OB1B 1ZLMA 3CD6Q 3VKIA 1WXTA 1UGRB 5KYXA 2A0FB 2ZPEB 5KH6A 2PVGB 4JUVA 2MF2A 2RB6A 2CREA 2EFIA 3JCMe 2DYIA 3ASKA 1XTDA 4CRIA 3I55A 4OF1A 3RMSA 3CMAA 3A98A 2RJDA 2QK0A 3CCJA 1NLPC 2SEMA 2OX7A 2ECZA 1S72Q 1I07A 5HCKA 2LNHB 4N4HA 4JLIA 2COZA 2LCCA 4BD3A 1T3LA 1IREB 1GBQA 2CYZB 2QEXT 1ABQA 1LNXA 1QCNA 4KBMB 3PIOA 5GANf 2DAQA 2MWPA 3EG9A 4DQ2A 5KCOA 5GAN6 2E5KA 3QO3A 4PNOA 3QPHA 3UA7A 3AHUA 2DNUA 1VIEA 2GTJA 5GAN8 1TU0B 3VU3C 4IIMA 2BE7D 1YJ9T 2RJCA 2O9SA 3CCLQ 4FM4B 4FCYA 2O88A 1VQOT 3JB9J 4L59A 4M75F 3DLLA 3VS1A 2AZSA 2DIGA 3GIBA 3ME9A 3FEOA 1Q95G 1S72A 4HCBA 1UE9A 2JUFA 4CC2A 2FZGB 5FROA 4A53A 3CC7Q 2A08A 3HSBA 4J9DA 2KROA 2KRNA 4M77F 1X6OA 4HCCA 1SKUB 2FYKA 4N0AC 2DXBA 2KXDA 4XTUA 1YCYA 1PKSA 1G3TA 5KYYA 2BTTA 4M78G 4M78E 4D6WA 5GAN7 3CCRQ 3MP8A 2X9HA 2CZ1B 5HK3A 2L3QA 5ECAA 4IUPA 3FJ5A 3EH2A 3PMIA 2MOXA 4RTZA 1YI2Q 2DEQA 5DLQE 1OULA 3A8GB 1XQHA 2QI2A 1EFNA 1JXMA 1OZ3A 1E7OA 3JCMd 3OYMA 1KD1U 3CC4Q 2M16A 4FYWB 4ANJA 1FWZA 2RA2A 1VQLT 4ZN3A 2FPFA 2H3JA 3QWXX 4IIOA 4F7UA 3SFMA 1NPPA 3CC7A 2LJ1A 1AVZC 5HKCA 3G1JA 1WHKA 2GCXA 3IQLA 1KD1R 5FU6C 2EJ9A 2DILA 4ZTJA 3CCRA 3H41A 4C0DB 1K9MU 4M7DD 2LJ3A 2DYBA 1WJQA 3FB9A 1RI9A 3PFSA 4FU6A 3JB9I 1D0ZA 1PM3A 2WACA 3L2VA 4KT0E 2KEAA 3UT1A 2F2XA 2HSEB 1K9MR 1X27A 2VB6A 3CC4A 2K9GA 4WF2A 1W4SA 2LQWA 4K11A 3T9NA 3H9NA 4M75B 1VQ5T 2CT4A 5KYUA 4EMKB 5L23A 1UGQB 2R5AA 3CXCS 4JJDA 3EGDB 4C0FA 4J83A 1ZA1B 3OYYA 4RTWA 1RACB 1TOVA 1MNEA 4CC3A 1RL2A 4M77B 1WFWA 1LCKA 3NHNA 1WJSA 1N9RA 5CKDA 1TXQA 2JM8A 1ZSZC 3FLGA 1VQNT 3V8JA 1HD3A 3HRTA 3HFNA 3X26B 5GAOn 3QYHB 4PKCC 1ZBXA 4X34A 1QVFP 2KSSA 4OGCA 1W2BA 2QTXA 2DMOA 3V8LA 2FRYA 4C8QC 1M8MA 3UWNA 1ARKA 1TH7A 2O4XB 1ZSGA 1M2VB 3MEWA 3M0TA 2E1HA 4N4IA 2E6NA 3EG1A 1WX6A 1NJIC 1KC8U 1LPLA 3VUZA 3M54A 1HXDA 2YXYA 3H0IA 3SWNC 1VQ7Q 2RJFA 2QA4T 4PJNA 3H6ZA 2F69A 1VQ9T 1FYNA 1ZUKA 3OYGA 3QG1A 2X3XD 4E7JA 2K7AA 1KC8R 1NPRA 4C92C 5LJ5f 2Y4XA 3I35A 4A54A 1SEMA 2JNGA 1JU5C 3CPFA 1NE8A 5LJ3h 4IUQA 2CP0A 2DPPB 1I81A 2PVDB 4C5GA 4E6RA 2EJFA 1NLOC 2RN8A 1OOTA 1AEYA 3LGLA 3G71T 4JDSA 3M0SA 2J6FA 3Q1JA 4PJOG 4PJOE 5C0MA 2D0NA 3QXEB 5FWCA 4DBHA 4OMNA 2OAWA 4F7UF 1W2BS 4RKUE 3G6ET 3R6OA 1NBEB 2DL7A 3E1SA 3C12A 1ZUUA 4DEXA 3VS0A 3CCVT 3OW2A 1B34B 5J3BA 4RG8A 1X69A 4PFOA 2IVWA 3PT9A 1Q81U 5GAOq 1VQNA 5CKEA 1GL5A 3A8HB 1IHVA 1I5LA 1RLQC 3HRSA 4HT9A 3A8OB 1VYTA 1U8RA 3ER0A 5C6SA 2DBKA 1WLPB 2FZKB 1A0NB 4Y28E 1UUEA 3JCMc 3FRNA 1WHMA 4O6JA 5CCAA 1Q81R 4BUGA 2DETA 4M7AD 3CQTA 2C0TA 2ROLA 2RQWA 2DK3A 4D8KA 1FMKA 4LDVA 1OI1A 2W10A 3LH5A 4AT1B 4LUEA 3VS2A 1BI3A 3MPUB 2HD0A 3QWYA 1NYFA 2DTHA 2VV5A 1Y7XA 4RCBA 3SEMA 4HXJA 1X75C 2HSPA 3OYBA 3OYIA 3G7ZA 2QTVA 4FT4A 2MIOA 4EPCA 2A7YA 2PU9B 3JCMX 2J06A 4AG1C 1PD1A 2ESWA 5CQXA 1QCOA 4C92D 2D1XA 1G8XA 5A2QE 3G71A 2L2PA 3LLRA 1VUBA 1YIJQ 2LC4A 1YHQT 1JO8A 2ED1A 5GANj 2K79A 2KT8A 2DRMA 1VIFA 5GAMf 3G6EA 4F04B 4XTYA 6AT1B 4ORZA 4F7UB 1AWXA 4D8DA 4OB3B 2EQIA 4HA8A 2GFAA 2VGNA 5CAIA 1PWTA 1WNLA 1N27A 4ZGJB 3OYKA 3G4SQ 3OS1A 2JXBA 4C8QF 2X4JA 2DM1A 5D6WA 4PJJA 2YUPA 2KE9A 4NS5A 1UHFA 4LD6A 1AD5A 4CC4B 1RI0A
chains in the Genus database with same CATH topology
2DVJA 1G83A 3TSWA 3A98A 2JS0A 4J9FA 1KIKA 3VS5A 1UTIA 1NLPC 3VS4A 1WA7A 2SEMA 1H92A 2RQUA 2ECZA 1X6BA 4LUDA 3PVQA 1I07A 5HCKA 2LNHB 2KGTA 5I11A 2DE0X 1M30A 2RNAA 1T3LA 2FRWA 1GBQA 4RTXA 5FW9A 4HVWA 1ABQA 1OV3A 1M27C 4J9BA 4F14A 3RBBB 3I5RA 4JJBA 2K2MA 1AWJA 1WI7A 2KRMA 2E5KA 2BZYA 3EG3A 1VYVA 3UA7A 2LQNA 2DNUA 2F2WA 2GTJA 2HCKA 4IIMA 2FG0A 1K4US 2O9SA 1U5SA 1AWWA 2O88A 1SSHA 1UFFA 1YCSB 2NWMA 3VS1A 2AZSA 1QWFA 2KYMA 2BZ8A 4JZ4A 2CT3A 1H8KA 1UE9A 1OEBA 2K3BA 4CC2A 1N5ZA 1G2BA 4LNPA 2FEIA 2A08A 2JM9A 4RTYA 4J9DA 2KROA 2KRNA 1UECA 2VWFA 1UDLA 2KXDA 3H0HA 2JTEA 2O9VA 2CSQA 1PKSA 5EC7A 2BTTA 2BZXA 1WDXA 1NEBA 2DA9A 2L3QA 5ECAA 1HSQA 1Y0MA 2KR3A 3FJ5A 2MOXA 1SHFA 4RTZA 2EYXA 2YDLA 3GBQA 2B86A 4ZNXA 4RTTA 1EFNA 2KRSA 1JXMA 4OMPA 2RQTA 3O5ZA 2LMJA 1MV0B 1B3QA 3VS6A 2DL5A 1E7OA 3UATA 1W70A 2EKHA 1GBRA 3PE0A 2FPFA 2EGEA 1GFDA 3H0FA 3QWXX 2YUQA 4IIOA 2DJQA 2EBPA 2OI3A 1X2QA 2JW4A 3TVTA 4KRTA 2LJ1A 1AVZC 4CC7A 1M3CA 2AKLA 2K6DA 3IQLA 3R6NA 2AK5A 2RQVA 2X3WD 1UGVA 2DILA 3KFVA 1GCQA 5IHIA 1BU1A 2GBQA 3H41A 1M3BA 3THKA 2LJ3A 1UHCA 1AZEA 2DYBA 4AG2C 1KFZA 1RI9A 2LX7A 1MUZA 2O31A 1QKWA 5IH2A 2KEAA 1GCPA 2F2XA 2J05A 1X27A 3VRYA 1XOVA 3M0UA 2CDTA 2JS2A 2FPEA 2K9GA 2LP5A 2J6KA 1AOJA 1I1JA 2JMAA 2LQWA 4K11A 1YWPA 3NPFA 1U3OA 4QT7A 2CT4A 3EG0A 5L23A 2RQRA 5IXFA 2KT1A 1V1CA 4JJDA 2JMCA 1TUCA 4X1VA 4RTWA 2L3PA 1YP5A 4OMLA 4Z8AA 2LZ6B 2EPDA 4CC3A 2JT4A 2P4RA 1WFWA 1LCKA 1NEGA 1NG2A 1SRLA 3NHNA 4AFZC 2AZVA 2JM8A 1AWOA 2HEQA 3REBB 2V1RA 1HD3A 1JEGA 2DBMA 2MCNA 3TSZA 1BK2A 1Z9QA 1IO6A 1K0SA 1B07A 2HDAA 1SPKA 4J9CA 4R0KA 3ZL7C 3VS3A 1YN8A 2DMOA 1RUWA 4A63B 1HJDA 2AKKA 2RMOA 4AFUC 1MV3A 2EYZA 2FRYA 2CH4A 1OPLA 1M8MA 1ARKA 2DRKA 1ZSGA 3EHQA 3M0TA 4Z88A 2LJ0A 3EG1A 4Y92A 1WX6A 1GCQC 1KJWA 3M0QA 3H0IA 3PVLA 3I5SA 1W6XA 1K1ZA 2KBTA 1M3AA 1FYNA 1ZUKA 3EHRA 2M0YA 4ESRA 1QLYA 2X3XD 1ZX6A 4AFSC 2OJ2A 2K7AA 1SRMA 5FWBA 4RUGA 2ED0A 2G6FX 2L0AA 1K0XA 1ABOA 4JPBW 3UA6A 1T0HA 3I35A 5I22A 4RTVA 1SEMA 1JU5C 1GFCA 4JZ3A 2RPNA 3EG2A 3M0PA 1JQQA 2ROTA 4E6RA 1NLOC 4OMOA 2DLPA 1OOTA 2RN8A 1CSKA 1AEYA 2DX1A 3M0SA 2J6FA 4OMMA 4LE9A 3U23A 2L3SA 2RF0A 3I9QA 1ZBJA 2D0NA 4JJCA 5FWCA 1I0CA 4OMNA 2OAWA 2GNCA 2I0NA 2F2VA 1WYXA 4F16A 2DL7A 2D8HA 1RLPC 1ZUUA 1YWOA 1UG1A 1H3HA 4DEXA 3VS0A 3NGPA 2NUZA 2H8HA 2CUDA 5GJWB 1X69A 3M0RA 1W1FA 1GL5A 2QDLA 1RLQC 1VYTA 1E6HA 2LCSA 2A36A 3REAB 2DBKA 1WLPB 1VYUA 4F17A 4HCKA 4HVVA 4WCIA 1A0NB 1TG0A 1UUEA 1VA7A 1TUDA 2KNBB 1BB9A 4OMQA 4GBQA 2CUBA 2EW3A 2DL4A 2YSQA 1CKBA 2EGAA 2GGRA 1Z9ZA 2CSIA 2XMFA 2CH4W 2C0OA 3CQTA 2PZ1A 2C0TA 2ROLA 2RQWA 4D8KA 1FMKA 2EVRA 3RNJA 3JV3A 4J9HA 2W10A 3LH5A 4RTUA 4LUEA 3VS2A 1PKTA 2GQIA 2V1QA 1SHGA 3QWYA 1NYFA 2ENMA 2DL3A 3SEMA 4HXJA 3SHWA 1OPKA 2HSPA 1CKAA 2EYYA 1YNZA 1NM7A 2MIOA 1K76A 1AZGB 1J3TA 1KSWA 2SRCA 2J06A 3EGUA 3NMZC 4AG1C 1QWEA 2DL8A 2DF6A 4HVUA 1PRLC 4J9IA 2FPDA 2KXCA 5IXBA 4GLMA 1S1NA 2ESWA 2YUNA 1T0JA 4LN2A 3VS7A 1X6GA 2A28A 2M51A 2D8JA 2D1XA 3ULRB 4J9GA 4J9EA 1X2KA 1Y57A 1QKXA 4Z89A 1E6GA 2L2PA 3UF4A 2IIMA 3VRZA 2FO0A 2YT6A 2GTOA 1GRIA 2VKNA 4FSSA 1NYGA 1JXOA 1K9AA 2O2OA 1JO8A 2ED1A 1PNJA 2K79A 2KT8A 2DRMA 1T3SA 5IHNA 5IHKA 2W0ZA 5GJVB 1UJYA 2PNIA 2EYWA 2VVKA 2J7IA 4ORZA 2ABLA 1AWXA 1WIEA 4D8DA 4EIKA 2PTKA 1WXUA 2EQIA 2YUOA 1U06A 3C0CA 4M4ZA 1PHTA 4DEYA 2HBWA 2J6OA 1WXBA 1PWTA 1BBZA 1ZLMA 4AFQC 1WXTA 2C0IA 2JXBA 1PRMC 1ZUYA 1X43A 2CREA 2DM1A 1QCFA 2YUPA 1UJ0A 2KE9A 1UHFA 2KYBA 1AD5A 2A37A 4CC4B 2EGCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DVJ A;  1G83 A;  3TSW A;  3A98 A;  2JS0 A;  4J9F A;  1KIK A;  3VS5 A;  1UTI A;  1NLP C;  3VS4 A;  1WA7 A;  2SEM A;  1H92 A;  2RQU A;  2ECZ A;  1X6B A;  4LUD A;  3PVQ A;  1I07 A;  5HCK A;  2LNH B;  2KGT A;  5I11 A;  2DE0 X;  1M30 A;  2RNA A;  1T3L A;  2FRW A;  1GBQ A;  4RTX A;  5FW9 A;  4HVW A;  1ABQ A;  1OV3 A;  1M27 C;  4J9B A;  4F14 A;  3RBB B;  3I5R A;  4JJB A;  2K2M A;  1AWJ A;  1WI7 A;  2KRM A;  2E5K A;  2BZY A;  3EG3 A;  1VYV A;  3UA7 A;  2LQN A;  2DNU A;  2F2W A;  2GTJ A;  2HCK A;  4IIM A;  2FG0 A;  1K4U S;  2O9S A;  1U5S A;  1AWW A;  2O88 A;  1SSH A;  1UFF A;  1YCS B;  2NWM A;  3VS1 A;  2AZS A;  1QWF A;  2KYM A;  2BZ8 A;  4JZ4 A;  2CT3 A;  1H8K A;  1UE9 A;  1OEB A;  2K3B A;  4CC2 A;  1N5Z A;  1G2B A;  4LNP A;  2FEI A;  2A08 A;  2JM9 A;  4RTY A;  4J9D A;  2KRO A;  2KRN A;  1UEC A;  2VWF A;  1UDL A;  2KXD A;  3H0H A;  2JTE A;  2O9V A;  2CSQ A;  1PKS A;  5EC7 A;  2BTT A;  2BZX A;  1WDX A;  1NEB A;  2DA9 A;  2L3Q A;  5ECA A;  1HSQ A;  1Y0M A;  2KR3 A;  3FJ5 A;  2MOX A;  1SHF A;  4RTZ A;  2EYX A;  2YDL A;  3GBQ A;  2B86 A;  4ZNX A;  4RTT A;  1EFN A;  2KRS A;  1JXM A;  4OMP A;  2RQT A;  3O5Z A;  2LMJ A;  1MV0 B;  1B3Q A;  3VS6 A;  2DL5 A;  1E7O A;  3UAT A;  1W70 A;  2EKH A;  1GBR A;  3PE0 A;  2FPF A;  2EGE A;  1GFD A;  3H0F A;  3QWX X;  2YUQ A;  4IIO A;  2DJQ A;  2EBP A;  2OI3 A;  1X2Q A;  2JW4 A;  3TVT A;  4KRT A;  2LJ1 A;  1AVZ C;  4CC7 A;  1M3C A;  2AKL A;  2K6D A;  3IQL A;  3R6N A;  2AK5 A;  2RQV A;  2X3W D;  1UGV A;  2DIL A;  3KFV A;  1GCQ A;  5IHI A;  1BU1 A;  2GBQ A;  3H41 A;  1M3B A;  3THK A;  2LJ3 A;  1UHC A;  1AZE A;  2DYB A;  4AG2 C;  1KFZ A;  1RI9 A;  2LX7 A;  1MUZ A;  2O31 A;  1QKW A;  5IH2 A;  2KEA A;  1GCP A;  2F2X A;  2J05 A;  1X27 A;  3VRY A;  1XOV A;  3M0U A;  2CDT A;  2JS2 A;  2FPE A;  2K9G A;  2LP5 A;  2J6K A;  1AOJ A;  1I1J A;  2JMA A;  2LQW A;  4K11 A;  1YWP A;  3NPF A;  1U3O A;  4QT7 A;  2CT4 A;  3EG0 A;  5L23 A;  2RQR A;  5IXF A;  2KT1 A;  1V1C A;  4JJD A;  2JMC A;  1TUC A;  4X1V A;  4RTW A;  2L3P A;  1YP5 A;  4OML A;  4Z8A A;  2LZ6 B;  2EPD A;  4CC3 A;  2JT4 A;  2P4R A;  1WFW A;  1LCK A;  1NEG A;  1NG2 A;  1SRL A;  3NHN A;  4AFZ C;  2AZV A;  2JM8 A;  1AWO A;  2HEQ A;  3REB B;  2V1R A;  1HD3 A;  1JEG A;  2DBM A;  2MCN A;  3TSZ A;  1BK2 A;  1Z9Q A;  1IO6 A;  1K0S A;  1B07 A;  2HDA A;  1SPK A;  4J9C A;  4R0K A;  3ZL7 C;  3VS3 A;  1YN8 A;  2DMO A;  1RUW A;  4A63 B;  1HJD A;  2AKK A;  2RMO A;  4AFU C;  1MV3 A;  2EYZ A;  2FRY A;  2CH4 A;  1OPL A;  1M8M A;  1ARK A;  2DRK A;  1ZSG A;  3EHQ A;  3M0T A;  4Z88 A;  2LJ0 A;  3EG1 A;  4Y92 A;  1WX6 A;  1GCQ C;  1KJW A;  3M0Q A;  3H0I A;  3PVL A;  3I5S A;  1W6X A;  1K1Z A;  2KBT A;  1M3A A;  1FYN A;  1ZUK A;  3EHR A;  2M0Y A;  4ESR A;  1QLY A;  2X3X D;  1ZX6 A;  4AFS C;  2OJ2 A;  2K7A A;  1SRM A;  5FWB A;  4RUG A;  2ED0 A;  2G6F X;  2L0A A;  1K0X A;  1ABO A;  4JPB W;  3UA6 A;  1T0H A;  3I35 A;  5I22 A;  4RTV A;  1SEM A;  1JU5 C;  1GFC A;  4JZ3 A;  2RPN A;  3EG2 A;  3M0P A;  1JQQ A;  2ROT A;  4E6R A;  1NLO C;  4OMO A;  2DLP A;  1OOT A;  2RN8 A;  1CSK A;  1AEY A;  2DX1 A;  3M0S A;  2J6F A;  4OMM A;  4LE9 A;  3U23 A;  2L3S A;  2RF0 A;  3I9Q A;  1ZBJ A;  2D0N A;  4JJC A;  5FWC A;  1I0C A;  4OMN A;  2OAW A;  2GNC A;  2I0N A;  2F2V A;  1WYX A;  4F16 A;  2DL7 A;  2D8H A;  1RLP C;  1ZUU A;  1YWO A;  1UG1 A;  1H3H A;  4DEX A;  3VS0 A;  3NGP A;  2NUZ A;  2H8H A;  2CUD A;  5GJW B;  1X69 A;  3M0R A;  1W1F A;  1GL5 A;  2QDL A;  1RLQ C;  1VYT A;  1E6H A;  2LCS A;  2A36 A;  3REA B;  2DBK A;  1WLP B;  1VYU A;  4F17 A;  4HCK A;  4HVV A;  4WCI A;  1A0N B;  1TG0 A;  1UUE A;  1VA7 A;  1TUD A;  2KNB B;  1BB9 A;  4OMQ A;  4GBQ A;  2CUB A;  2EW3 A;  2DL4 A;  2YSQ A;  1CKB A;  2EGA A;  2GGR A;  1Z9Z A;  2CSI A;  2XMF A;  2CH4 W;  2C0O A;  3CQT A;  2PZ1 A;  2C0T A;  2ROL A;  2RQW A;  4D8K A;  1FMK A;  2EVR A;  3RNJ A;  3JV3 A;  4J9H A;  2W10 A;  3LH5 A;  4RTU A;  4LUE A;  3VS2 A;  1PKT A;  2GQI A;  2V1Q A;  1SHG A;  3QWY A;  1NYF A;  2ENM A;  2DL3 A;  3SEM A;  4HXJ A;  3SHW A;  1OPK A;  2HSP A;  1CKA A;  2EYY A;  1YNZ A;  1NM7 A;  2MIO A;  1K76 A;  1AZG B;  1J3T A;  1KSW A;  2SRC A;  2J06 A;  3EGU A;  3NMZ C;  4AG1 C;  1QWE A;  2DL8 A;  2DF6 A;  4HVU A;  1PRL C;  4J9I A;  2FPD A;  2KXC A;  5IXB A;  4GLM A;  1S1N A;  2ESW A;  2YUN A;  1T0J A;  4LN2 A;  3VS7 A;  1X6G A;  2A28 A;  2M51 A;  2D8J A;  2D1X A;  3ULR B;  4J9G A;  4J9E A;  1X2K A;  1Y57 A;  1QKX A;  4Z89 A;  1E6G A;  2L2P A;  3UF4 A;  2IIM A;  3VRZ A;  2FO0 A;  2YT6 A;  2GTO A;  1GRI A;  2VKN A;  4FSS A;  1NYG A;  1JXO A;  1K9A A;  2O2O A;  1JO8 A;  2ED1 A;  1PNJ A;  2K79 A;  2KT8 A;  2DRM A;  1T3S A;  5IHN A;  5IHK A;  2W0Z A;  5GJV B;  1UJY A;  2PNI A;  2EYW A;  2VVK A;  2J7I A;  4ORZ A;  2ABL A;  1AWX A;  1WIE A;  4D8D A;  4EIK A;  2PTK A;  1WXU A;  2EQI A;  2YUO A;  1U06 A;  3C0C A;  4M4Z A;  1PHT A;  4DEY A;  2HBW A;  2J6O A;  1WXB A;  1PWT A;  1BBZ A;  1ZLM A;  4AFQ C;  1WXT A;  2C0I A;  2JXB A;  1PRM C;  1ZUY A;  1X43 A;  2CRE A;  2DM1 A;  1QCF A;  2YUP A;  1UJ0 A;  2KE9 A;  1UHF A;  2KYB A;  1AD5 A;  2A37 A;  4CC4 B;  2EGC A; 
#chains in the Genus database with same CATH topology
 1G83 A;  3EGX A;  3TSW A;  4DBR A;  1Q7Y U;  4HCZ A;  2JS0 A;  4BI3 A;  2B8A A;  3VS4 A;  1H92 A;  2RQU A;  5FRM A;  1SSF A;  5FU6 B;  1M90 U;  4PK4 A;  1WZO A;  1R0C B;  2DE0 X;  2P84 A;  1M30 A;  4M7D G;  4M7D E;  2E4H A;  2QQB A;  2EQM A;  2KK4 A;  4RTX A;  3CME Q;  3CCE T;  1BCO A;  1Q7Y R;  2M02 A;  4EMH A;  2FZC B;  1OV3 A;  1M27 C;  4C92 F;  4J9B A;  3QBY A;  2HQH A;  4JJB A;  3VUB A;  1JRI A;  2K2M A;  1AWJ A;  2KRM A;  1VYV A;  3GP8 A;  2LQK A;  4IUT A;  2O01 E;  4DOV A;  3O8V A;  2F2W A;  3G4S A;  3RR6 A;  2HCK A;  2HBP A;  3DB4 A;  2FG0 A;  1TUG B;  1VQK A;  1K4U S;  3GLX A;  3TCJ A;  1U5S A;  1AWW A;  2X4W A;  4E7I A;  1SSH A;  1UEB A;  1VQP Q;  1YCS B;  1VQ4 T;  2EIF A;  4RMO A;  4FIB A;  1M9S A;  3E19 A;  1NJI R;  3UDC A;  2MPX C;  2KYM A;  5FU7 C;  4JZ4 A;  1RAI B;  1OEB A;  4X9D A;  1N5Z A;  4JRK A;  2VWF A;  2CZ0 B;  3RUX A;  3L2U A;  3CME A;  3M59 A;  3H0H A;  2O9V A;  4MMK A;  1ZSZ B;  3PMT A;  4XU2 A;  2GFU A;  1RAD B;  2BZX A;  3RMQ A;  1WDX A;  3ZFJ A;  3I55 Q;  4LD9 K;  3CMA Q;  1K8A U;  1NEB A;  3M4Y A;  2DA9 A;  4DBQ A;  1HSQ A;  2YRD A;  3M55 A;  1C6V X;  3MKD A;  2KI7 A;  2YDL A;  3CC2 Q;  1G3Y A;  2B86 A;  3QUI A;  4ZNX A;  2QQS A;  5LJ5 g;  2XDB A;  3O5Z A;  1MV0 B;  3VS6 A;  5DM7 R;  1OU8 A;  2ATC B;  4FW1 A;  2VUB A;  1VQP A;  2ZGW A;  4GLK A;  4C8Q B;  1K8A R;  3P8B B;  1W70 A;  4R55 A;  2WSC E;  1LVK A;  4M75 D;  1N9S A;  2YUQ A;  3OQ5 A;  2DJQ A;  1N8R C;  2EBP A;  1YJN T;  2JW4 A;  1D1A A;  2R57 A;  2CP7 A;  1BI2 A;  4KRT A;  1M1K U;  1M3C A;  2DEU A;  3SWN B;  1IXD A;  3KFV A;  4M77 D;  2K5F A;  1GCQ A;  4PLI A;  5IHI A;  1UB4 A;  3V8K A;  3QZ9 B;  3CCQ Q;  1M3B A;  5CKH A;  3THK A;  1RAB B;  4MZM A;  1AZE A;  4RG2 A;  4AG2 C;  4C92 B;  2K4Y A;  3CCU Q;  1M1K R;  3BDL A;  3FIF A;  2CP6 A;  4MDX A;  1QKW A;  3CC2 A;  3GNF B;  5IH2 A;  2K3X A;  3CBM A;  3JB9 F;  4E7Z A;  1XOV A;  3M0U A;  3J7A F;  2JS2 A;  2FPE A;  1I1J A;  2JMA A;  2VC8 A;  5GMK j;  1U3O A;  3M56 A;  5CVI A;  1R77 A;  2RQR A;  2KT1 A;  2JMC A;  4V2S A;  2GF7 A;  2RHY A;  1U1T A;  3JCM b;  3OW2 P;  1OQK A;  2LZ6 B;  3OS0 A;  4ATO A;  3CCQ A;  1NG2 A;  3QDF A;  4ME7 A;  1VQ6 T;  5IT9 E;  4AFZ C;  2AZV A;  4NL3 A;  5LJ5 j;  4LDY A;  4QVC A;  3CCU A;  1WGS A;  1Q82 U;  3MEV A;  4DA4 A;  2OTL T;  1JEG A;  2MCN A;  2HNI A;  5A0L A;  3TQ7 P;  1BK2 A;  2D9T A;  2R58 A;  2D6F A;  3M58 A;  1Y07 A;  1K0S A;  2P0Q A;  1B07 A;  2XKO C;  2HDA A;  4R0K A;  4M7A G;  4M7A E;  4B9X A;  1YN8 A;  1Q82 R;  1RUW A;  2RK2 A;  3LX7 A;  1I4K 1;  2RMO A;  4BDY A;  3OBY A;  2CH4 A;  2DRK A;  4JLG A;  4PL6 A;  1KHI A;  3RIR A;  1X01 A;  1XJW B;  3RKX A;  4BI4 A;  2LJ0 A;  1D0X A;  2RO0 A;  5KYW A;  1YJ9 Q;  5FLX E;  7AT1 B;  2ZPF B;  5GAM g;  3PVL A;  3I5S A;  1WHL A;  4JRQ A;  4MML A;  1MMN A;  1KQ2 A;  2M0Y A;  4ESR A;  2QDY B;  1ZX6 A;  3C94 A;  1SRM A;  3JCM Q;  5FWB A;  4A4K A;  2ED0 A;  3OSV A;  3TEE A;  1ABO A;  2LX9 A;  2RM4 A;  2QAS A;  4XQ3 A;  3UA6 A;  4C92 G;  1I5O B;  1T0H A;  3X25 B;  3L2Q A;  4JZ3 A;  2DKG A;  2QEX A;  2RPN A;  3M0P A;  2ROT A;  5GAN 5;  3N5B B;  4QKU A;  1QW1 A;  2DX1 A;  1WPY A;  5J26 A;  4OMM A;  4LE9 A;  3PIP A;  2L3S A;  3I9Q A;  1V29 B;  2K5L A;  4FT2 A;  3WVD B;  1YJ9 A;  2GNC A;  1VQM T;  3OYJ A;  1WYX A;  3SDZ A;  4F16 A;  1MMA A;  1VQO A;  1RLP C;  2E41 A;  2X51 A;  2EAY A;  1VQL Q;  1KQ1 A;  3QJY A;  2OTL A;  4BDZ A;  4ZN1 A;  4QQ6 A;  2DXU A;  2QDL A;  4BE0 A;  2JJ9 A;  3OYL A;  3E9F A;  1E6H A;  1B7T A;  3HHT B;  3VYG A;  2MAM A;  1VYU A;  4F17 A;  4HCK A;  3V7R A;  3EH1 A;  1VA7 A;  1PD0 A;  1TUD A;  4BAC A;  2KNB B;  2NUT A;  4DOW A;  3CCM T;  1M5Q 1;  2PVO B;  2DL4 A;  2EGA A;  2GGR A;  5GAM j;  5GAN d;  1YBY A;  5KE2 A;  5FRN A;  2OAU A;  5A0D A;  2EVR A;  3RNJ A;  5CIU A;  4J9H A;  1MMG A;  4J6X A;  2G3R A;  3QDR B;  2GQI A;  4C0Z A;  1VQ7 T;  3MCA B;  3AT1 B;  2LVM A;  3KUF A;  4QQD A;  1VQL A;  1WQ7 A;  3EFO A;  3SHW A;  1Y96 A;  5L8R E;  4E2F B;  4A4H A;  1YNZ A;  3V7C A;  1VQ5 Q;  1AZG B;  4E7L A;  1Q86 C;  3NMZ C;  2DL8 A;  3M4G A;  2KXC A;  3OA6 A;  5CKB A;  1H3Z A;  1HK9 A;  4GLM A;  1S1N A;  4M78 C;  2YRC A;  4LN2 A;  3VS7 A;  5FU7 B;  1GXI E;  4OMF B;  2LT4 A;  1JJ2 A;  1VQ8 T;  3ULR B;  1QKX A;  4BI8 B;  3VRZ A;  2FO0 A;  3A8M B;  1GRI A;  2EQK A;  1VQN Q;  3E9G A;  3BY7 A;  2DD4 A;  1K9A A;  1PNJ A;  1M1F A;  3E2U A;  1T3S A;  2DO3 A;  1K73 C;  2D0Q B;  4M7A A;  4EIK A;  2OTJ T;  2F5K A;  4M78 A;  3CCS T;  3LGF A;  5KYX B;  4MDW A;  1U06 A;  3C0C A;  4M4Z A;  3EFS A;  1VQ5 A;  4J8O A;  3OSS C;  2RHZ A;  2XK0 A;  2C0I A;  3OS2 A;  3HPW A;  2E70 A;  2RJE A;  1QCF A;  4M75 G;  4M75 E;  1UJ0 A;  3FDR A;  2BKD N;  2ZAE A;  3P8D A;  2EGC A;  1KG1 A;  2DVJ A;  4J7I A;  2DZC A;  2HKQ B;  5GAN g;  2QA4 Q;  2H3E B;  1VQ9 Q;  1YJW T;  2XDD A;  1KIK A;  1MND A;  1QP3 A;  1UTI A;  2E65 A;  1WA7 A;  4NOY A;  3L2R A;  1X6B A;  4LDX A;  2CGH A;  4M77 G;  4M77 E;  3PVQ A;  3RDV A;  2MK5 A;  2KGT A;  4FYV B;  1JJ2 S;  3EG9 B;  5LJ5 e;  4QVD A;  2FRW A;  3CBO A;  3MEA A;  4BE1 A;  2HKN A;  3HKS A;  4F14 A;  3RBB B;  2XID A;  3I5R A;  4KUL A;  2LDM A;  3I56 T;  2BZY A;  3EG3 A;  3MJX A;  3G71 Q;  2LQN A;  5LJ3 f;  5GMK l;  3MET A;  1YIT T;  2VAS A;  5AT1 B;  1EZZ B;  4XU1 A;  4C8Q D;  5CQY A;  2VYT A;  3G6E Q;  2DJZ A;  1V76 A;  1UFF A;  1VQ8 A;  2VXE A;  3CCV Q;  2QA4 A;  5M9O A;  1VQ9 A;  5GAM h;  4QW2 A;  1QWF A;  1M2O A;  2ZPB B;  2BZ8 A;  4A4E A;  1YIJ T;  3BDU A;  2LRQ A;  2L3R A;  1G2B A;  4LNP A;  3X28 B;  5KYY B;  3FC3 A;  1U1S A;  2VXF A;  2JM9 A;  1TSF A;  1ZHI A;  2K3Y A;  3WXM B;  3OW2 S;  1UEC A;  1UDL A;  1PSE A;  2LQ8 A;  2JTE A;  3JCM J;  1SF9 A;  2CSQ A;  5GAO r;  2E12 A;  5KYW B;  5IN1 A;  2PUO B;  2EKO A;  1BI0 A;  1DJ7 B;  3TU4 K;  5KE3 A;  3C95 A;  3PGG A;  2YWW A;  4RTT A;  2KMT A;  4OMP A;  2LMJ A;  4XTW A;  2QGG A;  1IRX A;  4E7S A;  1KHC A;  3UAT A;  3CCV A;  1SG5 A;  1GBR A;  1YJW A;  1ZQ1 A;  3NTI A;  4MZP A;  3LYI A;  1GFD A;  4J6W A;  3H0F A;  3QKJ A;  2KVQ G;  3A8L B;  1G5V A;  4KGZ B;  1X2Q A;  5D6X A;  2DIQ A;  4XTX A;  1G3S A;  3QZ5 B;  3JCM V;  4E7K A;  2K6D A;  2RHU A;  2RQV A;  2X3W D;  1UGV A;  1VQK Q;  4LXC A;  4KUI A;  2M9U A;  1BU1 A;  5LJ5 d;  3J80 E;  5I2M A;  1P92 A;  1FXX A;  4XU0 A;  3KXT A;  4M78 F;  1D09 B;  4PJO C;  2ZZD A;  2LX7 A;  5HY6 A;  2HZY A;  1YHQ Q;  1GCP A;  2BE9 B;  5GAN 2;  5GAM e;  4IUU A;  4FW2 A;  3NTH A;  2QAZ A;  2CDT A;  5KYU B;  2LP5 A;  2J6K A;  1KD1 C;  2EQJ A;  4E7H A;  3OYH A;  4PJO A;  4LDU A;  1NJI U;  1V1C A;  1TUC A;  4JS4 A;  4X1V A;  3CBP A;  4M75 A;  3A5Z B;  2L3P A;  1YP5 A;  4OML A;  1RAA B;  2AT1 B;  4EMK A;  2ZCF B;  3HRU A;  2JT4 A;  4Y91 A;  3V7S A;  2E3I A;  2MI6 A;  2NYS A;  5DY9 A;  3EGD A;  4WTO B;  3OB9 A;  3JCM P;  4PJL A;  4JJN K;  2QG9 B;  5GAN 4;  2DZ9 A;  1Y71 A;  2DXT A;  1K9M C;  1AWO A;  3CCJ T;  3OY9 A;  2V1R A;  4M77 A;  2DBM A;  2KY9 A;  3TSZ A;  1YHQ A;  1RAE B;  2PUK B;  1OZ2 A;  2L89 A;  4MZT A;  1N6A A;  4J9C A;  5AYF A;  3JB9 D;  3CCE Q;  3NFC A;  2JVV A;  2CKK A;  5CKF A;  3ZL7 C;  3TRE A;  2KQW A;  3VS3 A;  1I8F A;  3RKW A;  2FB7 A;  2EYZ A;  2LT1 A;  4F7U G;  4F7U E;  2Y4Y A;  1AHJ B;  3CD6 T;  3EHQ A;  2AHJ B;  2IPO B;  1PC0 A;  2E10 A;  5D7U A;  1H64 1;  4Y92 A;  3JCM f;  1GCQ C;  2P0P A;  2O4X A;  1KJW A;  3INZ A;  1M2V A;  3OYF A;  2QXF A;  2R5M A;  1W6X A;  2XHC A;  2KBT A;  1M3A A;  2Z0W A;  1VQ4 Q;  3EHR A;  2MYS A;  5D6Y A;  1S72 T;  2EQU A;  2OJ2 A;  4C0G A;  4M78 B;  1K0X A;  4JPB W;  5GAN h;  3H8Z A;  5I22 A;  4RTV A;  1JJ2 P;  4XU3 A;  1GFC A;  3CCE A;  1BKB A;  5GAM d;  4J7F A;  1JQQ A;  3BE3 A;  4KUD K;  4QVZ A;  2DLP A;  1CSK A;  2HQE A;  4L5G A;  2RI2 A;  2NUP A;  4FYY B;  2VGM A;  3U23 A;  2RF0 A;  4OGE A;  2I2L A;  3JAM E;  3GF5 A;  1I0C A;  4Q5W A;  2F2V A;  3CCL T;  1D3B A;  4C5I A;  3UPU A;  1H3H A;  3VYH B;  1KC8 C;  2X35 A;  1VQ4 A;  2RHI A;  3MEU A;  4BY6 C;  4N4G A;  2NUZ A;  2H8H A;  5GJW B;  2ZPG B;  1W1F A;  4OVA A;  3RER A;  2WSF E;  5LJ3 g;  1YJN Q;  4M7D C;  1B34 A;  3CC7 T;  2F5T X;  3X24 B;  3A1P A;  2MMP A;  3OYN A;  3M5A A;  5GAO l;  4HVV A;  4JRP A;  1JBM A;  1TG0 A;  1D1B A;  3CCR T;  1BB9 A;  4GBQ A;  2EW3 A;  1FMW A;  2YLC A;  5J39 A;  4ZGE B;  2YSQ A;  2CZ7 B;  1MHN A;  2HAX A;  1Z9Z A;  2CSI A;  2XMF A;  2Y90 A;  3CD6 A;  2CH4 W;  2V8J A;  3OYA A;  1YI2 T;  2RK1 A;  3BFM A;  1YFN A;  2DTO A;  3LWI A;  2EYQ A;  4M7D A;  4PJO F;  3PTA A;  1MMD A;  4RTU A;  3LH0 A;  3ZEH A;  2QYZ A;  1PKT A;  3CC4 T;  2QEX Q;  4NL2 A;  1SHG A;  2YHT A;  2ENM A;  5GAN e;  2DL3 A;  1OPK A;  2WSE E;  1UGS B;  1CKA A;  1WHJ A;  3DLM A;  1NM7 A;  1YJN A;  1LJO A;  1K76 A;  4C8Q G;  4C8Q E;  1Q81 C;  3EFR A;  1KSW A;  3S3N A;  2SRC A;  1QWE A;  2COW A;  4J9I A;  1M8V A;  3JRZ A;  2FPD A;  5IXB A;  2K2V A;  2JTF A;  2YUN A;  4PJM A;  2A28 A;  1VQO Q;  2M51 A;  2D8J A;  3OBW A;  4J9G A;  1VQ6 Q;  4J9E A;  1X2K A;  1Y57 A;  4Z89 A;  3HFO A;  4OP0 A;  1BYM A;  1FMV A;  2OTL Q;  2VKN A;  4TVR A;  1NYG A;  5A0G A;  3M57 A;  3CCL A;  5IHN A;  4C92 E;  5IHK A;  4B9W A;  5GJV B;  1UJY A;  3CXC A;  2J7I A;  4CI0 C;  1WIE A;  4N0A A;  2PTK A;  5LJ3 j;  3PNW C;  3KBG A;  2FL7 A;  2YLB A;  2M1H A;  1AT1 B;  1PHT A;  5GMK m;  2J6O A;  1WXB A;  4IUV A;  4AFQ C;  1BBZ A;  1QQJ A;  3JCM W;  1RAG B;  3EGX B;  1PRM C;  1ZUY A;  1X43 A;  2KYB A;  4O5V A;  4KH1 B;  2A37 A;  4R56 A;  1RAF B;  1VQ6 A;  2YRV A;  1R8O B;  4J9F A;  3VS5 A;  2DXC A;  4FSX A;  4DBF A;  1YI2 A;  1NZ9 A;  3L1A A;  4XTV A;  4LUD A;  2L8D A;  5I11 A;  2HL5 C;  1PSF A;  2RNA A;  1BI1 A;  4XAX B;  4Z02 A;  2M0O A;  4PLL A;  5FW9 A;  1MGQ A;  3MHX A;  3MP6 A;  2X4Y A;  4HVW A;  1F1B B;  4PJO B;  2EWN A;  2CP2 A;  4UC4 A;  1WI7 A;  3SD4 A;  5GMK h;  1G3W A;  3EAE A;  5CK9 A;  1VQM Q;  1TWB A;  4II1 A;  1XNI A;  3HP9 A;  2V8K A;  2RH2 A;  1WQW A;  2FHD A;  3CPW A;  1PCX A;  2NWM A;  3CEY A;  5LJ5 h;  3S3O A;  1OYX A;  4ELZ C;  1N8R U;  4OB2 B;  3OMG A;  4FL6 A;  2CT3 A;  1H8K A;  1Q7Y C;  2K3B A;  2FEI A;  4RTY A;  3X20 B;  2ZPH B;  1IB8 A;  1M90 C;  3JCM g;  1UGP B;  4M7A C;  5GAO p;  1N8R R;  4M7D F;  5EC7 A;  3HL8 A;  1KQS A;  3CCM Q;  2LCL A;  1QVG A;  4KH0 B;  2E64 A;  4LDW A;  2LTO A;  2RI5 A;  1ZSZ A;  1Y0M A;  1C0M A;  2KR3 A;  1SHF A;  1WHH A;  4ELY C;  3JB9 G;  2EYX A;  2XD0 A;  3BW1 A;  3GBQ A;  1VQM A;  2DTI A;  3L42 A;  1HYO A;  2KRS A;  2RQT A;  4KGV B;  1B3Q A;  2DL5 A;  3L2W A;  4JRI A;  3D7S B;  4YTL A;  2EJG A;  3P8H A;  3GNG A;  2EKH A;  3PE0 A;  3QHS A;  8ATC B;  3OYC A;  3URG A;  2EGE A;  3VJP A;  3FJP A;  2BUD A;  4C8Q A;  1O75 A;  1EX4 A;  2OI3 A;  3TVT A;  3OYD A;  4CC7 A;  5EG2 A;  3LW5 E;  2AKL A;  3CPW S;  2KAF A;  2XI9 A;  3NTK A;  3M53 A;  3R6N A;  2AK5 A;  5GMK e;  2CP3 A;  2GBQ A;  2NUP B;  4AMC A;  4B6M A;  5GAN 3;  1BIA A;  3SWN A;  3CCM A;  1UHC A;  1VQ8 Q;  3HTR A;  1ACM B;  2NLU A;  5CR2 A;  2KDS A;  1D3B B;  1KFZ A;  1MUZ A;  2O31 A;  1K8A C;  2JTM A;  1KQS S;  4C92 A;  3QSU A;  3QII A;  2J05 A;  1QVG S;  4PFZ A;  2GQV A;  3VRY A;  1R0B G;  1VQ7 A;  2OTJ Q;  1AOJ A;  2JOY A;  3CCS Q;  1YWP A;  3NPF A;  3JB9 H;  3S6W A;  3RKY A;  4QT7 A;  1M4Z A;  3M9Q A;  5DLO A;  3EG0 A;  8AT1 B;  2P4T A;  5IXF A;  3ZBD A;  4E47 A;  2E3H A;  1D1C A;  1QVP A;  2X4X A;  4BY6 B;  3GPL A;  1M1K C;  3OMC A;  4Z8A A;  4VUB A;  1BCM A;  2EPD A;  2P4R A;  1SRL A;  1NEG A;  2BIV A;  4XTZ A;  1VOM A;  1TTH B;  4M7D B;  2QQA A;  1YJW Q;  4A4F A;  2HEQ A;  1KK7 A;  2COY A;  3REB B;  4M78 D;  2K57 A;  5IAY A;  1C1A A;  2FVU A;  1QMC A;  3QJ6 A;  1Z9Q A;  2ZPI B;  1IO6 A;  4GY5 A;  1SPK A;  5HK0 A;  2E6Z A;  2OTJ A;  5I21 A;  5CO7 A;  2RI3 A;  1RAH B;  4IKF A;  3CCS A;  4A63 B;  1HJD A;  2AKK A;  4AFU C;  1MV3 A;  1OPL A;  3I56 Q;  4BB7 A;  2PQW A;  1LOJ A;  2V26 A;  4X9C A;  3G4S T;  5LJ3 e;  2V8I A;  4Z88 A;  1YIT Q;  1VQK T;  1OX9 A;  3F70 A;  3M0Q A;  1BIB A;  1IZ6 A;  2LNV A;  5I2S A;  1M1G A;  4EDU A;  1K1Z A;  1IHW A;  4C5H A;  2E5Q A;  3OS5 A;  1QLY A;  4C0D C;  4AFS C;  2P0K A;  4RUG A;  2G6F X;  1Q82 C;  2L0A A;  2AIR B;  5GAO m;  4OB0 B;  3CME T;  1O9S A;  2DFU A;  3EG2 A;  1QP2 A;  4XK8 E;  2C06 A;  1OX8 A;  4HKE A;  4OMO A;  2RD1 A;  4M7A F;  3I56 A;  4QQG A;  2RHX A;  9ATC B;  3DB3 A;  1ZBJ A;  3CXC P;  4JJC A;  2L5Q A;  2QQ9 A;  4M75 C;  1YIT A;  2I0N A;  5LL6 S;  4PFP A;  4EMK C;  2D8H A;  4RCC A;  1VQP T;  1YWO A;  1UG1 A;  1TS9 A;  2XG8 D;  3NGP A;  5KYN A;  1IGQ A;  2MWO A;  2CUD A;  4P5N A;  3M0R A;  1EIF A;  4M77 C;  3DKM A;  2CZ6 B;  1Q86 U;  1YIJ A;  4ZTF A;  2F1L A;  2NUT B;  2LCS A;  2A36 A;  2HL3 A;  3REA B;  3J81 E;  3MO8 A;  1IGU A;  4WCI A;  3C4S A;  3VV0 A;  2DER A;  2XU8 A;  2QQR A;  1OU9 A;  4OMQ A;  5GMK i;  3S3M A;  1JB0 E;  2CUB A;  1Q86 R;  3JCM h;  3I55 T;  1M90 R;  1FX7 A;  1CKB A;  3CMA T;  1QVF A;  3JSC A;  2C0O A;  1WJR A;  2PZ1 A;  3CC2 T;  3L2Z A;  1K73 U;  4ZGD B;  3JV3 A;  5LJ3 d;  4FYX B;  4IUR A;  2DVE A;  3EFO B;  2IG0 A;  1Y96 B;  2HMA A;  2V1Q A;  2XIC A;  4J5Y A;  4A4G A;  3QYG B;  1K73 R;  2EYY A;  3RES A;  1J3T A;  1ZA2 B;  2K5I A;  3EGU A;  2DF6 A;  4HVU A;  1PRL C;  4C5E A;  2JZ2 A;  4L6V 5;  3CPW P;  2CP5 A;  2DD5 A;  5KCH A;  1T0J A;  1WHG A;  1X6G A;  3CCQ T;  2A3L A;  3GOX A;  1E6G A;  3CCU T;  3UF4 A;  4BE2 A;  2IIM A;  2YT6 A;  3CCJ Q;  2GTO A;  4FSS A;  4M7A B;  4HT8 A;  1JXO A;  2O2O A;  3SB2 A;  2CS7 A;  2JN0 A;  2QGF B;  3MP1 A;  1W2B P;  2W0Z A;  1KQS P;  4J6Y A;  1QVF S;  2PNI A;  2EYW A;  2VVK A;  1QVG P;  4PJO D;  4KGX B;  2ABL A;  4JS5 A;  1WXU A;  2YUO A;  2XDP A;  2HQX A;  1PG5 B;  3OYE A;  3WVE B;  4EMG A;  3LWH A;  1D0Y A;  4DEY A;  2HBW A;  4OB1 B;  1ZLM A;  3CD6 Q;  3VKI A;  1WXT A;  1UGR B;  5KYX A;  2A0F B;  2ZPE B;  5KH6 A;  2PVG B;  4JUV A;  2MF2 A;  2RB6 A;  2CRE A;  2EFI A;  3JCM e;  2DYI A;  3ASK A;  1XTD A;  4CRI A;  3I55 A;  4OF1 A;  3RMS A;  3CMA A;  3A98 A;  2RJD A;  2QK0 A;  3CCJ A;  1NLP C;  2SEM A;  2OX7 A;  2ECZ A;  1S72 Q;  1I07 A;  5HCK A;  2LNH B;  4N4H A;  4JLI A;  2COZ A;  2LCC A;  4BD3 A;  1T3L A;  1IRE B;  1GBQ A;  2CYZ B;  2QEX T;  1ABQ A;  1LNX A;  1QCN A;  4KBM B;  3PIO A;  5GAN f;  2DAQ A;  2MWP A;  3EG9 A;  4DQ2 A;  5KCO A;  5GAN 6;  2E5K A;  3QO3 A;  4PNO A;  3QPH A;  3UA7 A;  3AHU A;  2DNU A;  1VIE A;  2GTJ A;  5GAN 8;  1TU0 B;  3VU3 C;  4IIM A;  2BE7 D;  1YJ9 T;  2RJC A;  2O9S A;  3CCL Q;  4FM4 B;  4FCY A;  2O88 A;  1VQO T;  3JB9 J;  4L59 A;  4M75 F;  3DLL A;  3VS1 A;  2AZS A;  2DIG A;  3GIB A;  3ME9 A;  3FEO A;  1Q95 G;  1S72 A;  4HCB A;  1UE9 A;  2JUF A;  4CC2 A;  2FZG B;  5FRO A;  4A53 A;  3CC7 Q;  2A08 A;  3HSB A;  4J9D A;  2KRO A;  2KRN A;  4M77 F;  1X6O A;  4HCC A;  1SKU B;  2FYK A;  4N0A C;  2DXB A;  2KXD A;  4XTU A;  1YCY A;  1PKS A;  1G3T A;  5KYY A;  2BTT A;  4M78 G;  4M78 E;  4D6W A;  5GAN 7;  3CCR Q;  3MP8 A;  2X9H A;  2CZ1 B;  5HK3 A;  2L3Q A;  5ECA A;  4IUP A;  3FJ5 A;  3EH2 A;  3PMI A;  2MOX A;  4RTZ A;  1YI2 Q;  2DEQ A;  5DLQ E;  1OUL A;  3A8G B;  1XQH A;  2QI2 A;  1EFN A;  1JXM A;  1OZ3 A;  1E7O A;  3JCM d;  3OYM A;  1KD1 U;  3CC4 Q;  2M16 A;  4FYW B;  4ANJ A;  1FWZ A;  2RA2 A;  1VQL T;  4ZN3 A;  2FPF A;  2H3J A;  3QWX X;  4IIO A;  4F7U A;  3SFM A;  1NPP A;  3CC7 A;  2LJ1 A;  1AVZ C;  5HKC A;  3G1J A;  1WHK A;  2GCX A;  3IQL A;  1KD1 R;  5FU6 C;  2EJ9 A;  2DIL A;  4ZTJ A;  3CCR A;  3H41 A;  4C0D B;  1K9M U;  4M7D D;  2LJ3 A;  2DYB A;  1WJQ A;  3FB9 A;  1RI9 A;  3PFS A;  4FU6 A;  3JB9 I;  1D0Z A;  1PM3 A;  2WAC A;  3L2V A;  4KT0 E;  2KEA A;  3UT1 A;  2F2X A;  2HSE B;  1K9M R;  1X27 A;  2VB6 A;  3CC4 A;  2K9G A;  4WF2 A;  1W4S A;  2LQW A;  4K11 A;  3T9N A;  3H9N A;  4M75 B;  1VQ5 T;  2CT4 A;  5KYU A;  4EMK B;  5L23 A;  1UGQ B;  2R5A A;  3CXC S;  4JJD A;  3EGD B;  4C0F A;  4J83 A;  1ZA1 B;  3OYY A;  4RTW A;  1RAC B;  1TOV A;  1MNE A;  4CC3 A;  1RL2 A;  4M77 B;  1WFW A;  1LCK A;  3NHN A;  1WJS A;  1N9R A;  5CKD A;  1TXQ A;  2JM8 A;  1ZSZ C;  3FLG A;  1VQN T;  3V8J A;  1HD3 A;  3HRT A;  3HFN A;  3X26 B;  5GAO n;  3QYH B;  4PKC C;  1ZBX A;  4X34 A;  1QVF P;  2KSS A;  4OGC A;  1W2B A;  2QTX A;  2DMO A;  3V8L A;  2FRY A;  4C8Q C;  1M8M A;  3UWN A;  1ARK A;  1TH7 A;  2O4X B;  1ZSG A;  1M2V B;  3MEW A;  3M0T A;  2E1H A;  4N4I A;  2E6N A;  3EG1 A;  1WX6 A;  1NJI C;  1KC8 U;  1LPL A;  3VUZ A;  3M54 A;  1HXD A;  2YXY A;  3H0I A;  3SWN C;  1VQ7 Q;  2RJF A;  2QA4 T;  4PJN A;  3H6Z A;  2F69 A;  1VQ9 T;  1FYN A;  1ZUK A;  3OYG A;  3QG1 A;  2X3X D;  4E7J A;  2K7A A;  1KC8 R;  1NPR A;  4C92 C;  5LJ5 f;  2Y4X A;  3I35 A;  4A54 A;  1SEM A;  2JNG A;  1JU5 C;  3CPF A;  1NE8 A;  5LJ3 h;  4IUQ A;  2CP0 A;  2DPP B;  1I81 A;  2PVD B;  4C5G A;  4E6R A;  2EJF A;  1NLO C;  2RN8 A;  1OOT A;  1AEY A;  3LGL A;  3G71 T;  4JDS A;  3M0S A;  2J6F A;  3Q1J A;  4PJO G;  4PJO E;  5C0M A;  2D0N A;  3QXE B;  5FWC A;  4DBH A;  4OMN A;  2OAW A;  4F7U F;  1W2B S;  4RKU E;  3G6E T;  3R6O A;  1NBE B;  2DL7 A;  3E1S A;  3C12 A;  1ZUU A;  4DEX A;  3VS0 A;  3CCV T;  3OW2 A;  1B34 B;  5J3B A;  4RG8 A;  1X69 A;  4PFO A;  2IVW A;  3PT9 A;  1Q81 U;  5GAO q;  1VQN A;  5CKE A;  1GL5 A;  3A8H B;  1IHV A;  1I5L A;  1RLQ C;  3HRS A;  4HT9 A;  3A8O B;  1VYT A;  1U8R A;  3ER0 A;  5C6S A;  2DBK A;  1WLP B;  2FZK B;  1A0N B;  4Y28 E;  1UUE A;  3JCM c;  3FRN A;  1WHM A;  4O6J A;  5CCA A;  1Q81 R;  4BUG A;  2DET A;  4M7A D;  3CQT A;  2C0T A;  2ROL A;  2RQW A;  2DK3 A;  4D8K A;  1FMK A;  4LDV A;  1OI1 A;  2W10 A;  3LH5 A;  4AT1 B;  4LUE A;  3VS2 A;  1BI3 A;  3MPU B;  2HD0 A;  3QWY A;  1NYF A;  2DTH A;  2VV5 A;  1Y7X A;  4RCB A;  3SEM A;  4HXJ A;  1X75 C;  2HSP A;  3OYB A;  3OYI A;  3G7Z A;  2QTV A;  4FT4 A;  2MIO A;  4EPC A;  2A7Y A;  2PU9 B;  3JCM X;  2J06 A;  4AG1 C;  1PD1 A;  2ESW A;  5CQX A;  1QCO A;  4C92 D;  2D1X A;  1G8X A;  5A2Q E;  3G71 A;  2L2P A;  3LLR A;  1VUB A;  1YIJ Q;  2LC4 A;  1YHQ T;  1JO8 A;  2ED1 A;  5GAN j;  2K79 A;  2KT8 A;  2DRM A;  1VIF A;  5GAM f;  3G6E A;  4F04 B;  4XTY A;  6AT1 B;  4ORZ A;  4F7U B;  1AWX A;  4D8D A;  4OB3 B;  2EQI A;  4HA8 A;  2GFA A;  2VGN A;  5CAI A;  1PWT A;  1WNL A;  1N27 A;  4ZGJ B;  3OYK A;  3G4S Q;  3OS1 A;  2JXB A;  4C8Q F;  2X4J A;  2DM1 A;  5D6W A;  4PJJ A;  2YUP A;  2KE9 A;  4NS5 A;  1UHF A;  4LD6 A;  1AD5 A;  4CC4 B;  1RI0 A; 
#chains in the Genus database with same CATH homology
 2DVJ A;  1G83 A;  3TSW A;  3A98 A;  2JS0 A;  4J9F A;  1KIK A;  3VS5 A;  1UTI A;  1NLP C;  3VS4 A;  1WA7 A;  2SEM A;  1H92 A;  2RQU A;  2ECZ A;  1X6B A;  4LUD A;  3PVQ A;  1I07 A;  5HCK A;  2LNH B;  2KGT A;  5I11 A;  2DE0 X;  1M30 A;  2RNA A;  1T3L A;  2FRW A;  1GBQ A;  4RTX A;  5FW9 A;  4HVW A;  1ABQ A;  1OV3 A;  1M27 C;  4J9B A;  4F14 A;  3RBB B;  3I5R A;  4JJB A;  2K2M A;  1AWJ A;  1WI7 A;  2KRM A;  2E5K A;  2BZY A;  3EG3 A;  1VYV A;  3UA7 A;  2LQN A;  2DNU A;  2F2W A;  2GTJ A;  2HCK A;  4IIM A;  2FG0 A;  1K4U S;  2O9S A;  1U5S A;  1AWW A;  2O88 A;  1SSH A;  1UFF A;  1YCS B;  2NWM A;  3VS1 A;  2AZS A;  1QWF A;  2KYM A;  2BZ8 A;  4JZ4 A;  2CT3 A;  1H8K A;  1UE9 A;  1OEB A;  2K3B A;  4CC2 A;  1N5Z A;  1G2B A;  4LNP A;  2FEI A;  2A08 A;  2JM9 A;  4RTY A;  4J9D A;  2KRO A;  2KRN A;  1UEC A;  2VWF A;  1UDL A;  2KXD A;  3H0H A;  2JTE A;  2O9V A;  2CSQ A;  1PKS A;  5EC7 A;  2BTT A;  2BZX A;  1WDX A;  1NEB A;  2DA9 A;  2L3Q A;  5ECA A;  1HSQ A;  1Y0M A;  2KR3 A;  3FJ5 A;  2MOX A;  1SHF A;  4RTZ A;  2EYX A;  2YDL A;  3GBQ A;  2B86 A;  4ZNX A;  4RTT A;  1EFN A;  2KRS A;  1JXM A;  4OMP A;  2RQT A;  3O5Z A;  2LMJ A;  1MV0 B;  1B3Q A;  3VS6 A;  2DL5 A;  1E7O A;  3UAT A;  1W70 A;  2EKH A;  1GBR A;  3PE0 A;  2FPF A;  2EGE A;  1GFD A;  3H0F A;  3QWX X;  2YUQ A;  4IIO A;  2DJQ A;  2EBP A;  2OI3 A;  1X2Q A;  2JW4 A;  3TVT A;  4KRT A;  2LJ1 A;  1AVZ C;  4CC7 A;  1M3C A;  2AKL A;  2K6D A;  3IQL A;  3R6N A;  2AK5 A;  2RQV A;  2X3W D;  1UGV A;  2DIL A;  3KFV A;  1GCQ A;  5IHI A;  1BU1 A;  2GBQ A;  3H41 A;  1M3B A;  3THK A;  2LJ3 A;  1UHC A;  1AZE A;  2DYB A;  4AG2 C;  1KFZ A;  1RI9 A;  2LX7 A;  1MUZ A;  2O31 A;  1QKW A;  5IH2 A;  2KEA A;  1GCP A;  2F2X A;  2J05 A;  1X27 A;  3VRY A;  1XOV A;  3M0U A;  2CDT A;  2JS2 A;  2FPE A;  2K9G A;  2LP5 A;  2J6K A;  1AOJ A;  1I1J A;  2JMA A;  2LQW A;  4K11 A;  1YWP A;  3NPF A;  1U3O A;  4QT7 A;  2CT4 A;  3EG0 A;  5L23 A;  2RQR A;  5IXF A;  2KT1 A;  1V1C A;  4JJD A;  2JMC A;  1TUC A;  4X1V A;  4RTW A;  2L3P A;  1YP5 A;  4OML A;  4Z8A A;  2LZ6 B;  2EPD A;  4CC3 A;  2JT4 A;  2P4R A;  1WFW A;  1LCK A;  1NEG A;  1NG2 A;  1SRL A;  3NHN A;  4AFZ C;  2AZV A;  2JM8 A;  1AWO A;  2HEQ A;  3REB B;  2V1R A;  1HD3 A;  1JEG A;  2DBM A;  2MCN A;  3TSZ A;  1BK2 A;  1Z9Q A;  1IO6 A;  1K0S A;  1B07 A;  2HDA A;  1SPK A;  4J9C A;  4R0K A;  3ZL7 C;  3VS3 A;  1YN8 A;  2DMO A;  1RUW A;  4A63 B;  1HJD A;  2AKK A;  2RMO A;  4AFU C;  1MV3 A;  2EYZ A;  2FRY A;  2CH4 A;  1OPL A;  1M8M A;  1ARK A;  2DRK A;  1ZSG A;  3EHQ A;  3M0T A;  4Z88 A;  2LJ0 A;  3EG1 A;  4Y92 A;  1WX6 A;  1GCQ C;  1KJW A;  3M0Q A;  3H0I A;  3PVL A;  3I5S A;  1W6X A;  1K1Z A;  2KBT A;  1M3A A;  1FYN A;  1ZUK A;  3EHR A;  2M0Y A;  4ESR A;  1QLY A;  2X3X D;  1ZX6 A;  4AFS C;  2OJ2 A;  2K7A A;  1SRM A;  5FWB A;  4RUG A;  2ED0 A;  2G6F X;  2L0A A;  1K0X A;  1ABO A;  4JPB W;  3UA6 A;  1T0H A;  3I35 A;  5I22 A;  4RTV A;  1SEM A;  1JU5 C;  1GFC A;  4JZ3 A;  2RPN A;  3EG2 A;  3M0P A;  1JQQ A;  2ROT A;  4E6R A;  1NLO C;  4OMO A;  2DLP A;  1OOT A;  2RN8 A;  1CSK A;  1AEY A;  2DX1 A;  3M0S A;  2J6F A;  4OMM A;  4LE9 A;  3U23 A;  2L3S A;  2RF0 A;  3I9Q A;  1ZBJ A;  2D0N A;  4JJC A;  5FWC A;  1I0C A;  4OMN A;  2OAW A;  2GNC A;  2I0N A;  2F2V A;  1WYX A;  4F16 A;  2DL7 A;  2D8H A;  1RLP C;  1ZUU A;  1YWO A;  1UG1 A;  1H3H A;  4DEX A;  3VS0 A;  3NGP A;  2NUZ A;  2H8H A;  2CUD A;  5GJW B;  1X69 A;  3M0R A;  1W1F A;  1GL5 A;  2QDL A;  1RLQ C;  1VYT A;  1E6H A;  2LCS A;  2A36 A;  3REA B;  2DBK A;  1WLP B;  1VYU A;  4F17 A;  4HCK A;  4HVV A;  4WCI A;  1A0N B;  1TG0 A;  1UUE A;  1VA7 A;  1TUD A;  2KNB B;  1BB9 A;  4OMQ A;  4GBQ A;  2CUB A;  2EW3 A;  2DL4 A;  2YSQ A;  1CKB A;  2EGA A;  2GGR A;  1Z9Z A;  2CSI A;  2XMF A;  2CH4 W;  2C0O A;  3CQT A;  2PZ1 A;  2C0T A;  2ROL A;  2RQW A;  4D8K A;  1FMK A;  2EVR A;  3RNJ A;  3JV3 A;  4J9H A;  2W10 A;  3LH5 A;  4RTU A;  4LUE A;  3VS2 A;  1PKT A;  2GQI A;  2V1Q A;  1SHG A;  3QWY A;  1NYF A;  2ENM A;  2DL3 A;  3SEM A;  4HXJ A;  3SHW A;  1OPK A;  2HSP A;  1CKA A;  2EYY A;  1YNZ A;  1NM7 A;  2MIO A;  1K76 A;  1AZG B;  1J3T A;  1KSW A;  2SRC A;  2J06 A;  3EGU A;  3NMZ C;  4AG1 C;  1QWE A;  2DL8 A;  2DF6 A;  4HVU A;  1PRL C;  4J9I A;  2FPD A;  2KXC A;  5IXB A;  4GLM A;  1S1N A;  2ESW A;  2YUN A;  1T0J A;  4LN2 A;  3VS7 A;  1X6G A;  2A28 A;  2M51 A;  2D8J A;  2D1X A;  3ULR B;  4J9G A;  4J9E A;  1X2K A;  1Y57 A;  1QKX A;  4Z89 A;  1E6G A;  2L2P A;  3UF4 A;  2IIM A;  3VRZ A;  2FO0 A;  2YT6 A;  2GTO A;  1GRI A;  2VKN A;  4FSS A;  1NYG A;  1JXO A;  1K9A A;  2O2O A;  1JO8 A;  2ED1 A;  1PNJ A;  2K79 A;  2KT8 A;  2DRM A;  1T3S A;  5IHN A;  5IHK A;  2W0Z A;  5GJV B;  1UJY A;  2PNI A;  2EYW A;  2VVK A;  2J7I A;  4ORZ A;  2ABL A;  1AWX A;  1WIE A;  4D8D A;  4EIK A;  2PTK A;  1WXU A;  2EQI A;  2YUO A;  1U06 A;  3C0C A;  4M4Z A;  1PHT A;  4DEY A;  2HBW A;  2J6O A;  1WXB A;  1PWT A;  1BBZ A;  1ZLM A;  4AFQ C;  1WXT A;  2C0I A;  2JXB A;  1PRM C;  1ZUY A;  1X43 A;  2CRE A;  2DM1 A;  1QCF A;  2YUP A;  1UJ0 A;  2KE9 A;  1UHF A;  2KYB A;  1AD5 A;  2A37 A;  4CC4 B;  2EGC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...