1M4DA

Aminoglycoside 2'-n-acetyltransferase from mycobacterium tuberculosis-complex with coenzyme a and tobramycin
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
181
structure length
181
Chain Sequence
MHTQVHTARLVHTADLDSETRQDIRQMVTGAFAGDFTETDWEHTLGGMHALIWHHGAIIAHAAVIQRRLIYRGNALRCGYVEGVAVRADWRGQRLVSALLDAVEQVMRGAYQLGALSSSARARRLYASRGWLPWHGPTSVLAPTGPVRTPDDDGTVFVLPIDISLDTSAELMCDWRAGDVW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aminoglycoside 2'-N-acetyltransferase
publication title Aminoglycoside 2'-N-acetyltransferase from Mycobacterium tuberculosis in complex with coenzyme A and aminoglycoside substrates.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 51
structure length 181
sequence length 181
chains with identical sequence B
ec nomenclature ec 2.3.1.-:
pdb deposition date 2002-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13527 Acetyltransf_9 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1m4dA00
2HV2A 3S6KA 3TTHA 4R87A 2FS5A 4KUBA 1QSNA 1I21A 3FRMA 4R3KA 5FVJA 4II9A 5KTCA 1M1DA 2FSRA 2JDDA 2PSWA 3GYAA 4YRHA 3FNCA 1IIDA 3NE7A 1KUXA 3H4QA 4U5YA 2WPWA 2BSWA 3T9YA 3VWDA 2VXKA 3ZZIA 4B5PB 5KTAA 4I49A 4CAVA 2FXFA 2HUZA 2G0BA 1ON0A 3CXQA 3PGPA 3I3GA 3PP9A 2VZZA 3TT2A 4AVCA 1S3ZA 5C82A 5ISVA 2VQYA 2VZYA 4JJXA 1PU9A 1S5KA 4KOXA 1TIQA 4U9YA 1U6MA 1Q2CA 1MJ9A 2ARHA 4B5OA 1YK3A 4GS4A 3KKWA 3DR6A 3EY5A 3TO7A 3UY5A 2FCKA 3TOAA 3F0AA 5IV0A 2GIVA 2QIRA 3R95A 3D2MA 2NMTA 4JWPA 2REFA 3LD2A 1FY7A 3SHPA 4JLYA 1IYLA 2BEIA 3IWGA 4QUSA 1NMTA 4MHDA 2CNSA 1B87A 2REEA 3E0KA 1S7NA 3SXNA 5JPHA 2AJ6A 4RS2A 4KOVA 1I1DA 4HKFA 4Y49B 3G3SA 4XPDC 2B4DA 4R57A 2P6GA 4MBUA 5F48A 2Q44A 3DDDA 2FT0A 2IL4A 3OWCA 4YGOA 3GKRA 3W6XA 5J8FA 4OADA 3S6GA 4KZTA 1Y9KA 3TOBA 1PUAA 4YFJA 3BJ8A 4XNHC 2OH1A 4DNCA 3MGDA 1XIXA 4L89A 4BMHA 4H6ZA 3D8PA 3BJ7A 2JEVA 1MJBA 3CXSA 4EVYA 2B4DB 2I79A 4PV6A 5IX3A 2OZUA 2G3TA 2ZXVA 3R9GA 2Z10A 1GHEA 2BUEA 2FE7A 4PK3A 3FYNA 3EXNA 4F6AA 1CM0A 4M85A 4KVME 4OLLA 3R9EA 1Z9UA 1V0CA 1N71A 4CS0B 4CAXA 5KTDA 3EC4A 4NF1A 3TO6A 5HMNA 1KZFA 2VI7A 2QMLA 2VEZA 5E96A 3V8IA 3W91A 5F49A 1WK4A 2B3VA 2O28A 2QECA 1J4JA 3EO4A 4Y49C 1S60A 4IF5A 3RYOA 4UA3A 2PDOA 4CRYB 4E2AA 2ATRA 1B6BA 2EUIA 2PR8A 4XPDB 1MJAA 4JXRA 4IUSA 3TO9A 1XF8A 1KUVA 4R9MA 3DNSA 1SQHA 4ORFA 1YR0A 4KOUA 1S7LA 4UWJA 1Q2YA 2RC4A 3I9SA 4FD7A 2OZGA 5CNPA 2OB0A 4QC6A 4XNHB 2B3UA 4QVTA 3WR7A 2Q4YA 2VBQA 3K9UA 3T90A 4JXQA 2Q04A 2WPXA 2A4NA 3G8WA 4AVAA 5GCNA 1QSMA 3VWEA 1M4GA 2OZHA 2P6FA 4M3SA 2JDCA 4KORA 1CJWA 2PQ8A 3JUWA 1YVKA 2R98A 3FIXA 2AE6A 3R9FA 1YX0A 2KCWA 3F8KA 4UBRA 3F5BA 1P4NA 4H89A 4PK2A 4CRZB 5I0CA 1XEBA 4XPKA 3P2FA 1P0HA 5EC4A 3CXPA 1XMTA 1K4JA 4ZBGA 1YVOA 1UFHA 4LX9A 4U9ZA 4QB9A 2GE3A 4HNYB 1XE4A 4CAWA 3DR8A 1R57A 4NXYA 2J8RA 4KOYA 5EBVA 2ZW6A 4KVOE 4RI1A 3W6SA 3N7ZA 4KUAA 1MK4A 2FL4A 4MY0A 1Z4RA 2R1IA 4KLVA 4OAEA 5F47A 2J8MA 3JVNA 1RXTA 4KOTA 4KLWA 3BLNA 2D4OA 2DXQA 3C26A 2EVNA 4NSQA 4LUAA 4J3GA 1BO4A 2P0WA 3D2PA 4NCZA 2B5GA 2R7HA 1IB1E 5H86A 5IB0A 4HNWB 2ZW5A 2P6EA 4XPLA 4L8AA 1QSTA 2ZW4A 3SXOA 3TFYA 4PSXA 4AB7A 2B4BA 1YGHA 4QBJA 2GANA 1OZPA 4AVBA 4H6UA 3QAHA 2FIWA 2I00A 3GY9A 2BL1A 2B5GB 2PR1A 2HQYA 2G3AA 2D4PA 3FB3A 2J8NA 1Y7RA 1VHSA 5H84A 2X7BA 1NSLA 3B8GA 4FD5A 5HH1A 4E0AA 2K5TA 4KOWA 4E8OA 3R96A 1YLEA 1S7FA 2CY2A 2Q4VA 1QSOA 4HNXB 2ZPAA 4MJ8A 4ONUA 2Q7BA 3EFAA 1I12A 4FD6A 1YREA 2CNMA 3FXTA 4X5KA 4R3LA 4JD6A 5DWNA 3S6FA 4AG7A 1KUYA 4UWIA 2CNTA 5DWMA 5F46A 3PZJA 4K30A 4NEXA 1LRZA 1Q2DA 1IICA 1RO5A 3FBUA 1BOBA 2B58A 2H5MA 4MI4A 1VKCA 1M44A 2PRBA 2Z11A 1L0CA 2Y0MA 3DSBA 3S6HA 2FIAA 2ZW7A 5J8CA 3TCVA 4PSWA 2OU2A 1WWZA 2R8VA 3IGRA 4MY3A 1M4DA 3D3SA 3R1KA 4KVXA 3ZJ0A 1Z4EA 5JQ4A 2PC1A 4AG9A 5C88A 1QSRA 2F5IA 1NE9A 4KOSA 3TE4A 1S7KA 2Z0ZA 4F0YA 1IYKA 3QB8A 1Y9WA 3LODA 4FD4A 1M4IA 2JLMA 2Q0YA 3P2HA 2C27A 4B5PA
chains in the Genus database with same CATH superfamily
3I1UA 4WJBA 1LFWA 3PEIA 2JBJA 2HV2A 2I3CA 3S6KA 4R87A 3TTHA 4TNUA 5LRGA 2FS5A 2ZEHA 4KUBA 1QSNA 1I21A 5LRKA 4OC3A 4JYWA 2RFHA 4B14A 4ZX8A 2Q7SA 3FRMA 3D7DA 4R3KA 2PJ8A 1PYTB 5FVJA 2PJ5A 4ZI6A 2V8HA 2ZELA 4II9A 5KTCA 2GU2A 2WYRA 1M1DA 2FSRA 2JDDA 2PSWA 3FMCA 3GYAA 4NGSA 4YRHA 1XBUA 4F8ZA 3L2NA 3FNCA 2AFSA 1IIDA 3NE7A 4Q7AA 5G21A 1KUXA 2IJZA 3H4QA 3PB8X 4A38A 4U5YA 1FNOA 2WPWA 2BSWA 1ZG7A 3RNZA 3T9YA 3VWDA 2NSMA 2DPTA 2VXKA 3ZZIA 4W9YA 4KSAA 3WABA 4B5PB 5KTAA 5G1ZA 4I49A 1TF8A 2FXFA 4CAVA 2HUZA 2G0BA 3MN8A 1ON0A 3CXQA 3PGPA 3I3GA 3PP9A 2VZZA 3TT2A 4AVCA 1S3ZA 2Z3NA 3SJFA 5C82A 5ISVA 1RTQA 3KR5A 2VQYA 2VZYA 4X8IA 1ZG8A 2AFZA 3IO1A 4JJXA 4NGRA 1PU9A 4NJRA 1S5KA 3CZXA 4KOXA 4NFRA 1CG2A 4UCNA 5K8PA 3IWEA 4IK2A 4C7HA 2ZEDA 2Z3PA 4R76A 4OIDA 4ZX9A 2V77A 4MHPA 1LAPA 1TIQA 4U9YA 2PIZA 1U6MA 3JRUA 1X10A 2EWBA 1Q2CA 3K2KA 1VIXA 1MJ9A 4MCPA 2XEIA 4A30A 2ARHA 1A2ZA 4B5OA 1YK3A 2EBJA 3SJEA 4GS4A 4DYOA 1BAVA 3KKWA 1CX8A 3DR6A 3EY5A 4ONWA 2QJ8A 3BI0A 3TO7A 2G9DA 3UY5A 1LOKA 4PXBA 4CAEA 5JGFA 2FCKA 2XEGA 3IWWA 3TOAA 4ZY0A 3F0AA 4B10A 1NSAA 4Z65A 2HC9A 5IV0A 2ABZA 2GIVA 2QIRA 3D7GA 3R95A 3D2MA 5AG6A 2NMTA 4B11A 4JWPA 1TKHA 1YW4A 1VGYA 4MCRA 2REFA 3LD2A 1CP7A 1FY7A 3SHPA 4A33A 4JLYA 1IYLA 2BEIA 1BLLE 2ANPA 3IWGA 4NGQA 4QUSA 1NMTA 2WZNA 4MHDA 3B2YA 2CNSA 3LMSA 2PJ1A 1B87A 2REEA 3E0KA 1S7NA 3SXNA 2Z3MA 5JPHA 1YQEA 2PCUA 3FH4A 1DTDA 2Z3LA 5LYLA 2HB6A 2CF4A 2AJ6A 4RS2A 3B7IA 5J1QA 2PJ6A 5AGEA 3A9LA 4KOVA 3IIBA 1I1DA 4HKFA 4Y49B 1Y0YA 4P4BA 1AYEA 3S9LA 4LQGA 3G3SA 3PFOA 4XPDC 2DEAA 2B4DA 4IHMA 4R57A 1R43A 5HVGA 4OIWA 2P6GA 4MBUA 2Z3OA 2Q44A 3DDDA 2FT0A 2IL4A 2PIYA 3FECA 4MFPA 5F48A 4LQ6A 2PJ2A 3OWCA 4YGOA 4A39A 4OC5A 2PRQA 3GKRA 2QVPA 3SJGA 3W6XA 5J8FA 4OADA 1ZO0A 5LYDA 4YU9A 3S6GA 3BI1A 4KZTA 5JH9A 1Y9KA 3SI0A 4CGPA 4P4JA 2QYVA 3TOBA 3KZWA 1PUAA 4FWUA 1IU8A 4YFJA 2ZOFA 3BJ8A 3FJUA 4XNHC 4BD9A 2C1CA 2OH1A 4PXCA 4DNCA 3QNVA 4CGOA 3IFEA 3MGDA 4OC0A 1XIXA 4L89A 4BMHA 3SJXA 5D29A 4H6ZA 3D8PA 3BJ7A 2JEVA 1MJBA 3P2HA 3CXSA 4EVYA 2B4DB 2I79A 4P4FA 4PV6A 3FEDA 5AG5A 4CGNA 3FF3A 3HUVA 4M6IA 5IX3A 2OZUA 2Q43A 2G3TA 5CPAA 3WC5A 3PB4X 2ZXVA 3R9GA 4B12A 2Z10A 4PXDA 1GHEA 2BUEA 5AG7A 2FE7A 2PJ3A 1YW6A 4PK3A 3K9TA 3CPAA 2CXAA 3FYNA 3NFZA 3EXNA 4F6AA 1CM0A 4M85A 4KVME 3DGVA 4OLLA 3R9EA 5THWA 1Z9UA 1V0CA 1IY7A 1N71A 4R6TA 5HVHA 3KQXA 2PJBA 3PB7X 4CS0B 3GIUA 1Z8WA 2YGWA 4CAXA 5KTDA 4MCQA 3PBBA 4OC2A 2ZEPA 5D8NA 3EC4A 4NF1A 3TO6A 2PJ4A 1KZFA 4OC4A 5HMNA 2VI7A 2QMLA 2VEZA 5E96A 3V8IA 3W91A 4A2ZA 5F49A 1CP6A 4PPZA 1WK4A 2B3VA 2O28A 2QECA 2XEFA 1J4JA 1DE4C 3EO4A 1IGBA 4Y49C 1S60A 4IF5A 3RYOA 3SI1A 4CYQA 4UA3A 2PDOA 2RB7A 4CRYB 4E2AA 2ATRA 3KGQA 1B6BA 3ISXA 1IOIA 4RN7A 2EUIA 4CYNA 2PR8A 3TC8A 4XPDB 1MJAA 4JXRA 4IUSA 4KS9A 2ZEGA 4MXUA 4FAIA 2PJ9A 3TO9A 2PVWA 4UFWA 4CAFA 4R8FA 3PB9X 2C6GA 1H8LA 1XF8A 1KUVA 4R9MA 4AXVA 4P44A 3DNSA 1SQHA 2ODFA 4ORFA 1YR0A 4KOUA 3PB6X 2O4HA 1ZG9A 1S7LA 2PVVA 1HEEA 4NGTA 2V8GA 4UWJA 4A31A 1Q2YA 2V8VA 2RC4A 1BPMA 3I9SA 2CTCA 4FD7A 1XMBA 4NGPA 5HXDA 4KSFA 2OZGA 5CNPA 4K3NA 2OB0A 4NGMA 4QC6A 4XNHB 3ISZA 2B3UA 4B13A 3IEHA 4QVTA 3KI9A 3WR7A 2Q4YA 3VARA 5A28A 2VBQA 1ARMA 3H8EA 3K9UA 2YNDA 3B3SA 3T90A 3MRUA 4JXQA 2Q04A 2WPXA 4UEZA 2Q51A 3KASA 3D7FA 2ZEFA 4MFKA 2A4NA 3NE8A 3G8WA 4AVAA 4NJQA 3FX6A 3KQZA 5GCNA 1QSMA 4P6YA 3NH5A 5K8NA 1AUGA 1M4GA 2OZHA 4IAVA 4O23A 4X3RA 4OC1A 3VWEA 2P6FA 4ZYQA 4M3SA 4FUUA 2JDCA 4Q36A 1LANA 4KORA 1CJWA 2PQ8A 3H8GA 5AG4A 2C6CA 1TF9A 3JUWA 3IJ3A 3PRTA 1YMEA 2EK9A 1YVKA 1GYTA 2VL1A 3H5ZA 2R98A 3FIXA 2AE6A 3R9FA 1YX0A 2KCWA 3F8KA 5A27A 4A94A 1ELMP 2CIJA 7CPAA 4UBRA 4DUKA 2ZENA 3F5BA 5K8OA 1P4NA 4UCPA 4H89A 4PK2A 2GLJA 4CRZB 3CT9A 4OP4A 4CYOA 5I0CA 1YLOA 1XEBA 1Z2LA 4XPKA 3P2FA 1P0HA 4F9VA 5G20A 5EC4A 3CXPA 3IC1A 1XMTA 4UF4A 4UFVA 1K4JA 4ZBGA 1QMUA 3QAYA 1YVOA 1UFHA 4Q38A 5DS0A 4LX9A 3B3WA 4U9ZA 3LACA 2GE3A 4HNYB 4QB9A 2AFXA 3RO0A 1XE4A 4A32A 1M4LA 4CAWA 3DR8A 4P4IA 1R57A 2BCOA 4NXYA 1ZLHA 2Q4ZA 2J8RA 4KOYA 5EBVA 2WSAA 2ZW6A 4KVOE 3RBUA 2AFMA 2YNCA 4OKOA 2CTBA 1TKFA 4RI1A 1TKJA 3KL9A 3NH8A 3W6SA 3N7ZA 1F2PA 4KUAA 1MK4A 2FL4A 4MY0A 6CPAA 1Z4RA 1BPNA 2R1IA 3D66A 5CBMA 2F7VA 4KLVA 4OAEA 5F47A 4EWTA 2J8MA 4A37A 4CGMA 4ZGYB 4ZY1A 3JVNA 1RXTA 3DLJA 4KOTA 4KLWA 2WUUA 3D67A 4HPSA 3RZAA 3BLNA 2D4OA 3D68A 2DXQA 3C26A 4H2KA 4P45A 2DF5A 3PBEA 4GXHA 3JTKA 2EVNA 4NSQA 4GM5A 4BBHA 4LUAA 4J3GA 1BO4A 2P0WA 3D2PA 1VHEA 4NCZA 2B5GA 2R7HA 4CGLA 1CPXA 4UIBA 1AMPA 1IB1E 2POKA 5H86A 4C7IA 4MMOA 4PXEA 1R3NA 3NA6A 4ZY2A 5IB0A 4YWYA 1F2OA 5EMIA 1ARLA 4HNWB 4EFDA 1TXRA 5F09A 1Z8LA 1XFOA 2ZW5A 3VH9A 2P6EA 4XPLA 5BWAB 4L8AA 1QSTA 2ZOGA 2ZW4A 3BHXA 5JM6A 1Y7EA 2NYQA 2PJ7A 4MHYA 4P4DA 3SXOA 3TFYA 2ZEOA 4PSXA 4AB7A 4DJLA 3LWUA 2B4BA 4MFLA 1YGHA 4QBJA 2GANA 1OZPA 1IOFA 2GFQA 4P4EA 4AVBA 2PJAA 1CPSA 4H6UA 4CYPA 5I4MA 3QAHA 2FIWA 2DPSA 3S9MA 2I00A 2OR4A 2Z3KA 3WC7A 4F9UA 2BL1A 3GY9A 4TWEA 2B5GB 3HLPA 3N5FA 2PR1A 1UWYA 2HQYA 1PCAA 2G3AA 2D4PA 3FB3A 2J8NA 1Y7RA 4X2TA 4BINA 1VHSA 3KHZA 1JQGA 5H84A 4C2ZA 3B35A 2X7BA 1NSLA 3B8GA 5G22A 1XRYA 3D4UA 1HDUA 2EK8A 5LRJA 2JBKA 4FD5A 5HH1A 4E0AA 2K5TA 1QQ9A 4KOWA 4E8OA 3R96A 4RUHA 1YLEA 3GB0A 3BXMA 1EE3P 1S7FA 2CY2A 1VHOA 2FVGA 2Q4VA 4JZ0A 5LYIA 1QSOA 4MFZA 4UFXA 4A95A 4C2YA 3S9NA 4B6ZA 4HNXB 2ZPAA 1F57A 4MJ8A 2IQ6A 4ONUA 3IU2A 3WC6A 2Q7BA 4PQAA 2YNEA 3GUXA 3EFAA 3VATA 1I12A 2IMOA 5ELYA 5LYFA 3D7HA 1XJOA 4FD6A 1YREA 2CNMA 3CDXA 3FXTA 4X5KA 4R3LA 8CPAA 4M6HA 4MHNA 4JD6A 3B3CA 2C6PA 4UCMA 5DWNA 3S6FA 4AG7A 2YNCC 3FVLA 1KUYA 4UWIA 1JWQA 3GLJA 2CNTA 3TX8A 4MFQA 4P10A 5DWMA 2OOTA 5F46A 1HDQA 1LCPA 1LAMA 1ELLP 3PZJA 3KHXA 4K30A 2EO8A 4NEXA 2AFOA 4WWVA 1KWMA 1LRZA 1IICA 1Q2DA 1RO5A 1BOBA 3FBUA 1CBXA 2B58A 2H5MA 4CPAA 4MI4A 1VKCA 4R7MA 4EMEA 1M44A 2BOAA 2PRBA 2BO9A 2V8DA 2Z11A 1L0CA 2GREA 1OBRA 2Y0MA 3FEEA 1Q7LA 2XEJA 3DSBA 5K8MA 3S6HA 2PE3A 2O53A 2FIAA 3T8WA 1Z8XA 2ZW7A 4MRIA 4F0XA 4MHZA 3NH4A 5J8CA 2JEWA 4UEEA 3TCVA 4UEFA 4NGNA 2OU2A 3PFEA 4PSWA 4G1PA 1WWZA 2R8VA 3IGRA 4MY3A 1M4DA 3D3SA 3R1KA 4KVXA 3ZJ0A 1Z4EA 1FT7A 4UIAA 2ZEEA 5JQ4A 2AFWA 4OMEA 2PC1A 1Y0RA 3KR4A 1Z8TA 1ZLIA 2ZEMA 3H8FA 4AG9A 3IU1A 5C88A 3CPXA 1QSRA 3V7ZA 2GLFA 2J9AA 2F5IA 1NE9A 2F8HA 4KOSA 2PJ0A 3SI2A 4C68A 2AFUA 3TE4A 1S7KA 2Z0ZA 1YSJA 3WT4A 4F0YA 1IYKA 4KSIA 5IB9A 3B3TA 3QB8A 4FBEA 1Y9WA 4M6GA 3LODA 5HVFA 4FD4A 4MFJA 1M4IA 4C2XA 3RAMA 2JLMA 2Q0YA 4MCSA 3V38A 1XOVA 1X12A 2PJCA 3B3VA 1Z5RA 2C27A 4B5PA
chains in the Genus database with same CATH topology
2HV2A 3S6KA 3TTHA 4R87A 2FS5A 4KUBA 1QSNA 1I21A 4B14A 3FRMA 4R3KA 5FVJA 4II9A 5KTCA 1M1DA 2FSRA 2JDDA 2PSWA 3GYAA 4YRHA 3FNCA 1IIDA 3NE7A 5G21A 1KUXA 3H4QA 4U5YA 2WPWA 2BSWA 3T9YA 3VWDA 2DPTA 2VXKA 3ZZIA 4KSAA 4B5PB 5KTAA 5G1ZA 4I49A 4CAVA 2FXFA 2HUZA 2G0BA 1ON0A 3CXQA 3PGPA 3I3GA 3PP9A 2VZZA 3TT2A 4AVCA 1S3ZA 2Z3NA 5C82A 5ISVA 2VQYA 2VZYA 4JJXA 1PU9A 1S5KA 4KOXA 4UCNA 3IWEA 4C7HA 2Z3PA 1TIQA 4U9YA 1U6MA 1Q2CA 1MJ9A 4A30A 2ARHA 4B5OA 1YK3A 4GS4A 3KKWA 3DR6A 3EY5A 3TO7A 3UY5A 4CAEA 2FCKA 3TOAA 3F0AA 4B10A 5IV0A 2GIVA 2QIRA 3R95A 3D2MA 5AG6A 2NMTA 4B11A 4JWPA 2REFA 3LD2A 4A33A 1FY7A 3SHPA 4JLYA 1IYLA 2BEIA 3IWGA 4QUSA 1NMTA 4MHDA 2CNSA 1B87A 2REEA 3E0KA 1S7NA 3SXNA 2Z3MA 5JPHA 2Z3LA 2AJ6A 4RS2A 5AGEA 3A9LA 4KOVA 1I1DA 4HKFA 4Y49B 3G3SA 4XPDC 2B4DA 4R57A 2P6GA 4MBUA 2Z3OA 2Q44A 3DDDA 2FT0A 2IL4A 4MFPA 5F48A 3OWCA 4YGOA 3GKRA 3W6XA 5J8FA 4OADA 1ZO0A 3S6GA 4KZTA 1Y9KA 4CGPA 3TOBA 1PUAA 4YFJA 3BJ8A 4XNHC 2OH1A 4DNCA 4CGOA 3MGDA 1XIXA 4L89A 4BMHA 4H6ZA 3D8PA 3BJ7A 2JEVA 1MJBA 3CXSA 4EVYA 2B4DB 2I79A 4PV6A 5AG5A 4CGNA 5IX3A 2OZUA 2G3TA 2ZXVA 3R9GA 4B12A 2Z10A 5AG7A 1GHEA 2BUEA 2FE7A 4PK3A 2CXAA 3FYNA 3EXNA 4F6AA 1CM0A 4M85A 4KVME 4OLLA 3R9EA 1Z9UA 1V0CA 1N71A 4CS0B 4CAXA 2YGWA 5KTDA 3EC4A 4NF1A 3TO6A 5HMNA 1KZFA 2VI7A 2QMLA 2VEZA 5E96A 3V8IA 3W91A 4A2ZA 5F49A 1WK4A 2B3VA 2O28A 2QECA 1J4JA 3EO4A 4Y49C 1S60A 4IF5A 3RYOA 4CYQA 4UA3A 2PDOA 4CRYB 4E2AA 2ATRA 1B6BA 2EUIA 4CYNA 2PR8A 4XPDB 1MJAA 4JXRA 4IUSA 4KS9A 3TO9A 4UFWA 4CAFA 1XF8A 1KUVA 4R9MA 3DNSA 1SQHA 4ORFA 1YR0A 4KOUA 1S7LA 4UWJA 4A31A 1Q2YA 2RC4A 3I9SA 4FD7A 4KSFA 2OZGA 5CNPA 2OB0A 4QC6A 4XNHB 2B3UA 4B13A 4QVTA 3WR7A 2Q4YA 5A28A 2VBQA 3K9UA 2YNDA 3T90A 4JXQA 2Q04A 2WPXA 4MFKA 2A4NA 3G8WA 4AVAA 5GCNA 1QSMA 3VWEA 1M4GA 2OZHA 2P6FA 4M3SA 2JDCA 4Q36A 4KORA 1CJWA 2PQ8A 5AG4A 3JUWA 1YVKA 3H5ZA 2R98A 3FIXA 2AE6A 3R9FA 1YX0A 2KCWA 3F8KA 5A27A 4UBRA 3F5BA 1P4NA 4UCPA 4H89A 4PK2A 4CRZB 4CYOA 5I0CA 1XEBA 4XPKA 3P2FA 1P0HA 5G20A 5EC4A 3CXPA 1XMTA 4UFVA 1K4JA 4ZBGA 1YVOA 1UFHA 4Q38A 4LX9A 4U9ZA 4QB9A 2GE3A 4HNYB 1XE4A 4A32A 4CAWA 3DR8A 1R57A 4NXYA 2J8RA 4KOYA 5EBVA 2WSAA 2ZW6A 4KVOE 2YNCA 4RI1A 3W6SA 3N7ZA 4KUAA 1MK4A 2FL4A 4MY0A 1Z4RA 2R1IA 4KLVA 4OAEA 5F47A 2J8MA 4CGMA 4ZGYB 3JVNA 1RXTA 4KOTA 4KLWA 2WUUA 3BLNA 2D4OA 2DXQA 3C26A 3JTKA 2EVNA 4NSQA 4BBHA 4LUAA 4J3GA 1BO4A 2P0WA 3D2PA 4NCZA 2B5GA 2R7HA 4CGLA 1IB1E 5H86A 4C7IA 5IB0A 4HNWB 2ZW5A 2P6EA 4XPLA 5BWAB 4L8AA 1QSTA 2ZW4A 3SXOA 3TFYA 4PSXA 4AB7A 4MFLA 2B4BA 1YGHA 4QBJA 2GANA 1OZPA 4AVBA 4H6UA 4CYPA 3QAHA 2FIWA 2DPSA 2I00A 2Z3KA 3GY9A 2BL1A 2B5GB 2PR1A 2HQYA 2G3AA 2D4PA 3FB3A 2J8NA 1Y7RA 1VHSA 5H84A 4C2ZA 2X7BA 1NSLA 3B8GA 5G22A 4FD5A 5HH1A 4E0AA 2K5TA 4KOWA 4E8OA 3R96A 1YLEA 1S7FA 2CY2A 2Q4VA 4A95A 4C2YA 1QSOA 4MFZA 4UFXA 4HNXB 2ZPAA 4MJ8A 4ONUA 3IU2A 2Q7BA 2YNEA 3EFAA 1I12A 4FD6A 1YREA 2CNMA 3FXTA 4X5KA 4R3LA 4JD6A 4UCMA 5DWNA 3S6FA 4AG7A 2YNCC 1KUYA 4UWIA 2CNTA 4MFQA 5DWMA 5F46A 3PZJA 4K30A 4NEXA 1LRZA 1Q2DA 1IICA 1RO5A 3FBUA 1BOBA 2B58A 2H5MA 4MI4A 1VKCA 1M44A 2PRBA 2Z11A 1L0CA 2Y0MA 3DSBA 3S6HA 2FIAA 2ZW7A 4F0XA 5J8CA 3TCVA 4PSWA 2OU2A 1WWZA 2R8VA 3IGRA 4MY3A 1M4DA 3D3SA 3R1KA 4KVXA 3ZJ0A 1Z4EA 5JQ4A 2PC1A 4AG9A 5C88A 1QSRA 2F5IA 1NE9A 4C68A 4KOSA 3TE4A 1S7KA 2Z0ZA 4F0YA 1IYKA 3QB8A 1Y9WA 3LODA 4FD4A 4MFJA 1M4IA 4C2XA 2JLMA 2Q0YA 3P2HA 3IU1A 2C27A 4B5PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HV2 A;  3S6K A;  3TTH A;  4R87 A;  2FS5 A;  4KUB A;  1QSN A;  1I21 A;  3FRM A;  4R3K A;  5FVJ A;  4II9 A;  5KTC A;  1M1D A;  2FSR A;  2JDD A;  2PSW A;  3GYA A;  4YRH A;  3FNC A;  1IID A;  3NE7 A;  1KUX A;  3H4Q A;  4U5Y A;  2WPW A;  2BSW A;  3T9Y A;  3VWD A;  2VXK A;  3ZZI A;  4B5P B;  5KTA A;  4I49 A;  4CAV A;  2FXF A;  2HUZ A;  2G0B A;  1ON0 A;  3CXQ A;  3PGP A;  3I3G A;  3PP9 A;  2VZZ A;  3TT2 A;  4AVC A;  1S3Z A;  5C82 A;  5ISV A;  2VQY A;  2VZY A;  4JJX A;  1PU9 A;  1S5K A;  4KOX A;  1TIQ A;  4U9Y A;  1U6M A;  1Q2C A;  1MJ9 A;  2ARH A;  4B5O A;  1YK3 A;  4GS4 A;  3KKW A;  3DR6 A;  3EY5 A;  3TO7 A;  3UY5 A;  2FCK A;  3TOA A;  3F0A A;  5IV0 A;  2GIV A;  2QIR A;  3R95 A;  3D2M A;  2NMT A;  4JWP A;  2REF A;  3LD2 A;  1FY7 A;  3SHP A;  4JLY A;  1IYL A;  2BEI A;  3IWG A;  4QUS A;  1NMT A;  4MHD A;  2CNS A;  1B87 A;  2REE A;  3E0K A;  1S7N A;  3SXN A;  5JPH A;  2AJ6 A;  4RS2 A;  4KOV A;  1I1D A;  4HKF A;  4Y49 B;  3G3S A;  4XPD C;  2B4D A;  4R57 A;  2P6G A;  4MBU A;  5F48 A;  2Q44 A;  3DDD A;  2FT0 A;  2IL4 A;  3OWC A;  4YGO A;  3GKR A;  3W6X A;  5J8F A;  4OAD A;  3S6G A;  4KZT A;  1Y9K A;  3TOB A;  1PUA A;  4YFJ A;  3BJ8 A;  4XNH C;  2OH1 A;  4DNC A;  3MGD A;  1XIX A;  4L89 A;  4BMH A;  4H6Z A;  3D8P A;  3BJ7 A;  2JEV A;  1MJB A;  3CXS A;  4EVY A;  2B4D B;  2I79 A;  4PV6 A;  5IX3 A;  2OZU A;  2G3T A;  2ZXV A;  3R9G A;  2Z10 A;  1GHE A;  2BUE A;  2FE7 A;  4PK3 A;  3FYN A;  3EXN A;  4F6A A;  1CM0 A;  4M85 A;  4KVM E;  4OLL A;  3R9E A;  1Z9U A;  1V0C A;  1N71 A;  4CS0 B;  4CAX A;  5KTD A;  3EC4 A;  4NF1 A;  3TO6 A;  5HMN A;  1KZF A;  2VI7 A;  2QML A;  2VEZ A;  5E96 A;  3V8I A;  3W91 A;  5F49 A;  1WK4 A;  2B3V A;  2O28 A;  2QEC A;  1J4J A;  3EO4 A;  4Y49 C;  1S60 A;  4IF5 A;  3RYO A;  4UA3 A;  2PDO A;  4CRY B;  4E2A A;  2ATR A;  1B6B A;  2EUI A;  2PR8 A;  4XPD B;  1MJA A;  4JXR A;  4IUS A;  3TO9 A;  1XF8 A;  1KUV A;  4R9M A;  3DNS A;  1SQH A;  4ORF A;  1YR0 A;  4KOU A;  1S7L A;  4UWJ A;  1Q2Y A;  2RC4 A;  3I9S A;  4FD7 A;  2OZG A;  5CNP A;  2OB0 A;  4QC6 A;  4XNH B;  2B3U A;  4QVT A;  3WR7 A;  2Q4Y A;  2VBQ A;  3K9U A;  3T90 A;  4JXQ A;  2Q04 A;  2WPX A;  2A4N A;  3G8W A;  4AVA A;  5GCN A;  1QSM A;  3VWE A;  1M4G A;  2OZH A;  2P6F A;  4M3S A;  2JDC A;  4KOR A;  1CJW A;  2PQ8 A;  3JUW A;  1YVK A;  2R98 A;  3FIX A;  2AE6 A;  3R9F A;  1YX0 A;  2KCW A;  3F8K A;  4UBR A;  3F5B A;  1P4N A;  4H89 A;  4PK2 A;  4CRZ B;  5I0C A;  1XEB A;  4XPK A;  3P2F A;  1P0H A;  5EC4 A;  3CXP A;  1XMT A;  1K4J A;  4ZBG A;  1YVO A;  1UFH A;  4LX9 A;  4U9Z A;  4QB9 A;  2GE3 A;  4HNY B;  1XE4 A;  4CAW A;  3DR8 A;  1R57 A;  4NXY A;  2J8R A;  4KOY A;  5EBV A;  2ZW6 A;  4KVO E;  4RI1 A;  3W6S A;  3N7Z A;  4KUA A;  1MK4 A;  2FL4 A;  4MY0 A;  1Z4R A;  2R1I A;  4KLV A;  4OAE A;  5F47 A;  2J8M A;  3JVN A;  1RXT A;  4KOT A;  4KLW A;  3BLN A;  2D4O A;  2DXQ A;  3C26 A;  2EVN A;  4NSQ A;  4LUA A;  4J3G A;  1BO4 A;  2P0W A;  3D2P A;  4NCZ A;  2B5G A;  2R7H A;  1IB1 E;  5H86 A;  5IB0 A;  4HNW B;  2ZW5 A;  2P6E A;  4XPL A;  4L8A A;  1QST A;  2ZW4 A;  3SXO A;  3TFY A;  4PSX A;  4AB7 A;  2B4B A;  1YGH A;  4QBJ A;  2GAN A;  1OZP A;  4AVB A;  4H6U A;  3QAH A;  2FIW A;  2I00 A;  3GY9 A;  2BL1 A;  2B5G B;  2PR1 A;  2HQY A;  2G3A A;  2D4P A;  3FB3 A;  2J8N A;  1Y7R A;  1VHS A;  5H84 A;  2X7B A;  1NSL A;  3B8G A;  4FD5 A;  5HH1 A;  4E0A A;  2K5T A;  4KOW A;  4E8O A;  3R96 A;  1YLE A;  1S7F A;  2CY2 A;  2Q4V A;  1QSO A;  4HNX B;  2ZPA A;  4MJ8 A;  4ONU A;  2Q7B A;  3EFA A;  1I12 A;  4FD6 A;  1YRE A;  2CNM A;  3FXT A;  4X5K A;  4R3L A;  4JD6 A;  5DWN A;  3S6F A;  4AG7 A;  1KUY A;  4UWI A;  2CNT A;  5DWM A;  5F46 A;  3PZJ A;  4K30 A;  4NEX A;  1LRZ A;  1Q2D A;  1IIC A;  1RO5 A;  3FBU A;  1BOB A;  2B58 A;  2H5M A;  4MI4 A;  1VKC A;  1M44 A;  2PRB A;  2Z11 A;  1L0C A;  2Y0M A;  3DSB A;  3S6H A;  2FIA A;  2ZW7 A;  5J8C A;  3TCV A;  4PSW A;  2OU2 A;  1WWZ A;  2R8V A;  3IGR A;  4MY3 A;  1M4D A;  3D3S A;  3R1K A;  4KVX A;  3ZJ0 A;  1Z4E A;  5JQ4 A;  2PC1 A;  4AG9 A;  5C88 A;  1QSR A;  2F5I A;  1NE9 A;  4KOS A;  3TE4 A;  1S7K A;  2Z0Z A;  4F0Y A;  1IYK A;  3QB8 A;  1Y9W A;  3LOD A;  4FD4 A;  1M4I A;  2JLM A;  2Q0Y A;  3P2H A;  2C27 A;  4B5P A; 
#chains in the Genus database with same CATH topology
 3I1U A;  4WJB A;  1LFW A;  3PEI A;  2JBJ A;  2HV2 A;  2I3C A;  3S6K A;  4R87 A;  3TTH A;  4TNU A;  5LRG A;  2FS5 A;  2ZEH A;  4KUB A;  1QSN A;  1I21 A;  5LRK A;  4OC3 A;  4JYW A;  2RFH A;  4B14 A;  4ZX8 A;  2Q7S A;  3FRM A;  3D7D A;  4R3K A;  2PJ8 A;  1PYT B;  5FVJ A;  2PJ5 A;  4ZI6 A;  2V8H A;  2ZEL A;  4II9 A;  5KTC A;  2GU2 A;  2WYR A;  1M1D A;  2FSR A;  2JDD A;  2PSW A;  3FMC A;  3GYA A;  4NGS A;  4YRH A;  1XBU A;  4F8Z A;  3L2N A;  3FNC A;  2AFS A;  1IID A;  3NE7 A;  4Q7A A;  5G21 A;  1KUX A;  2IJZ A;  3H4Q A;  3PB8 X;  4A38 A;  4U5Y A;  1FNO A;  2WPW A;  2BSW A;  1ZG7 A;  3RNZ A;  3T9Y A;  3VWD A;  2NSM A;  2DPT A;  2VXK A;  3ZZI A;  4W9Y A;  4KSA A;  3WAB A;  4B5P B;  5KTA A;  5G1Z A;  4I49 A;  1TF8 A;  2FXF A;  4CAV A;  2HUZ A;  2G0B A;  3MN8 A;  1ON0 A;  3CXQ A;  3PGP A;  3I3G A;  3PP9 A;  2VZZ A;  3TT2 A;  4AVC A;  1S3Z A;  2Z3N A;  3SJF A;  5C82 A;  5ISV A;  1RTQ A;  3KR5 A;  2VQY A;  2VZY A;  4X8I A;  1ZG8 A;  2AFZ A;  3IO1 A;  4JJX A;  4NGR A;  1PU9 A;  4NJR A;  1S5K A;  3CZX A;  4KOX A;  4NFR A;  1CG2 A;  4UCN A;  5K8P A;  3IWE A;  4IK2 A;  4C7H A;  2ZED A;  2Z3P A;  4R76 A;  4OID A;  4ZX9 A;  2V77 A;  4MHP A;  1LAP A;  1TIQ A;  4U9Y A;  2PIZ A;  1U6M A;  3JRU A;  1X10 A;  2EWB A;  1Q2C A;  3K2K A;  1VIX A;  1MJ9 A;  4MCP A;  2XEI A;  4A30 A;  2ARH A;  1A2Z A;  4B5O A;  1YK3 A;  2EBJ A;  3SJE A;  4GS4 A;  4DYO A;  1BAV A;  3KKW A;  1CX8 A;  3DR6 A;  3EY5 A;  4ONW A;  2QJ8 A;  3BI0 A;  3TO7 A;  2G9D A;  3UY5 A;  1LOK A;  4PXB A;  4CAE A;  5JGF A;  2FCK A;  2XEG A;  3IWW A;  3TOA A;  4ZY0 A;  3F0A A;  4B10 A;  1NSA A;  4Z65 A;  2HC9 A;  5IV0 A;  2ABZ A;  2GIV A;  2QIR A;  3D7G A;  3R95 A;  3D2M A;  5AG6 A;  2NMT A;  4B11 A;  4JWP A;  1TKH A;  1YW4 A;  1VGY A;  4MCR A;  2REF A;  3LD2 A;  1CP7 A;  1FY7 A;  3SHP A;  4A33 A;  4JLY A;  1IYL A;  2BEI A;  1BLL E;  2ANP A;  3IWG A;  4NGQ A;  4QUS A;  1NMT A;  2WZN A;  4MHD A;  3B2Y A;  2CNS A;  3LMS A;  2PJ1 A;  1B87 A;  2REE A;  3E0K A;  1S7N A;  3SXN A;  2Z3M A;  5JPH A;  1YQE A;  2PCU A;  3FH4 A;  1DTD A;  2Z3L A;  5LYL A;  2HB6 A;  2CF4 A;  2AJ6 A;  4RS2 A;  3B7I A;  5J1Q A;  2PJ6 A;  5AGE A;  3A9L A;  4KOV A;  3IIB A;  1I1D A;  4HKF A;  4Y49 B;  1Y0Y A;  4P4B A;  1AYE A;  3S9L A;  4LQG A;  3G3S A;  3PFO A;  4XPD C;  2DEA A;  2B4D A;  4IHM A;  4R57 A;  1R43 A;  5HVG A;  4OIW A;  2P6G A;  4MBU A;  2Z3O A;  2Q44 A;  3DDD A;  2FT0 A;  2IL4 A;  2PIY A;  3FEC A;  4MFP A;  5F48 A;  4LQ6 A;  2PJ2 A;  3OWC A;  4YGO A;  4A39 A;  4OC5 A;  2PRQ A;  3GKR A;  2QVP A;  3SJG A;  3W6X A;  5J8F A;  4OAD A;  1ZO0 A;  5LYD A;  4YU9 A;  3S6G A;  3BI1 A;  4KZT A;  5JH9 A;  1Y9K A;  3SI0 A;  4CGP A;  4P4J A;  2QYV A;  3TOB A;  3KZW A;  1PUA A;  4FWU A;  1IU8 A;  4YFJ A;  2ZOF A;  3BJ8 A;  3FJU A;  4XNH C;  4BD9 A;  2C1C A;  2OH1 A;  4PXC A;  4DNC A;  3QNV A;  4CGO A;  3IFE A;  3MGD A;  4OC0 A;  1XIX A;  4L89 A;  4BMH A;  3SJX A;  5D29 A;  4H6Z A;  3D8P A;  3BJ7 A;  2JEV A;  1MJB A;  3P2H A;  3CXS A;  4EVY A;  2B4D B;  2I79 A;  4P4F A;  4PV6 A;  3FED A;  5AG5 A;  4CGN A;  3FF3 A;  3HUV A;  4M6I A;  5IX3 A;  2OZU A;  2Q43 A;  2G3T A;  5CPA A;  3WC5 A;  3PB4 X;  2ZXV A;  3R9G A;  4B12 A;  2Z10 A;  4PXD A;  1GHE A;  2BUE A;  5AG7 A;  2FE7 A;  2PJ3 A;  1YW6 A;  4PK3 A;  3K9T A;  3CPA A;  2CXA A;  3FYN A;  3NFZ A;  3EXN A;  4F6A A;  1CM0 A;  4M85 A;  4KVM E;  3DGV A;  4OLL A;  3R9E A;  5THW A;  1Z9U A;  1V0C A;  1IY7 A;  1N71 A;  4R6T A;  5HVH A;  3KQX A;  2PJB A;  3PB7 X;  4CS0 B;  3GIU A;  1Z8W A;  2YGW A;  4CAX A;  5KTD A;  4MCQ A;  3PBB A;  4OC2 A;  2ZEP A;  5D8N A;  3EC4 A;  4NF1 A;  3TO6 A;  2PJ4 A;  1KZF A;  4OC4 A;  5HMN A;  2VI7 A;  2QML A;  2VEZ A;  5E96 A;  3V8I A;  3W91 A;  4A2Z A;  5F49 A;  1CP6 A;  4PPZ A;  1WK4 A;  2B3V A;  2O28 A;  2QEC A;  2XEF A;  1J4J A;  1DE4 C;  3EO4 A;  1IGB A;  4Y49 C;  1S60 A;  4IF5 A;  3RYO A;  3SI1 A;  4CYQ A;  4UA3 A;  2PDO A;  2RB7 A;  4CRY B;  4E2A A;  2ATR A;  3KGQ A;  1B6B A;  3ISX A;  1IOI A;  4RN7 A;  2EUI A;  4CYN A;  2PR8 A;  3TC8 A;  4XPD B;  1MJA A;  4JXR A;  4IUS A;  4KS9 A;  2ZEG A;  4MXU A;  4FAI A;  2PJ9 A;  3TO9 A;  2PVW A;  4UFW A;  4CAF A;  4R8F A;  3PB9 X;  2C6G A;  1H8L A;  1XF8 A;  1KUV A;  4R9M A;  4AXV A;  4P44 A;  3DNS A;  1SQH A;  2ODF A;  4ORF A;  1YR0 A;  4KOU A;  3PB6 X;  2O4H A;  1ZG9 A;  1S7L A;  2PVV A;  1HEE A;  4NGT A;  2V8G A;  4UWJ A;  4A31 A;  1Q2Y A;  2V8V A;  2RC4 A;  1BPM A;  3I9S A;  2CTC A;  4FD7 A;  1XMB A;  4NGP A;  5HXD A;  4KSF A;  2OZG A;  5CNP A;  4K3N A;  2OB0 A;  4NGM A;  4QC6 A;  4XNH B;  3ISZ A;  2B3U A;  4B13 A;  3IEH A;  4QVT A;  3KI9 A;  3WR7 A;  2Q4Y A;  3VAR A;  5A28 A;  2VBQ A;  1ARM A;  3H8E A;  3K9U A;  2YND A;  3B3S A;  3T90 A;  3MRU A;  4JXQ A;  2Q04 A;  2WPX A;  4UEZ A;  2Q51 A;  3KAS A;  3D7F A;  2ZEF A;  4MFK A;  2A4N A;  3NE8 A;  3G8W A;  4AVA A;  4NJQ A;  3FX6 A;  3KQZ A;  5GCN A;  1QSM A;  4P6Y A;  3NH5 A;  5K8N A;  1AUG A;  1M4G A;  2OZH A;  4IAV A;  4O23 A;  4X3R A;  4OC1 A;  3VWE A;  2P6F A;  4ZYQ A;  4M3S A;  4FUU A;  2JDC A;  4Q36 A;  1LAN A;  4KOR A;  1CJW A;  2PQ8 A;  3H8G A;  5AG4 A;  2C6C A;  1TF9 A;  3JUW A;  3IJ3 A;  3PRT A;  1YME A;  2EK9 A;  1YVK A;  1GYT A;  2VL1 A;  3H5Z A;  2R98 A;  3FIX A;  2AE6 A;  3R9F A;  1YX0 A;  2KCW A;  3F8K A;  5A27 A;  4A94 A;  1ELM P;  2CIJ A;  7CPA A;  4UBR A;  4DUK A;  2ZEN A;  3F5B A;  5K8O A;  1P4N A;  4UCP A;  4H89 A;  4PK2 A;  2GLJ A;  4CRZ B;  3CT9 A;  4OP4 A;  4CYO A;  5I0C A;  1YLO A;  1XEB A;  1Z2L A;  4XPK A;  3P2F A;  1P0H A;  4F9V A;  5G20 A;  5EC4 A;  3CXP A;  3IC1 A;  1XMT A;  4UF4 A;  4UFV A;  1K4J A;  4ZBG A;  1QMU A;  3QAY A;  1YVO A;  1UFH A;  4Q38 A;  5DS0 A;  4LX9 A;  3B3W A;  4U9Z A;  3LAC A;  2GE3 A;  4HNY B;  4QB9 A;  2AFX A;  3RO0 A;  1XE4 A;  4A32 A;  1M4L A;  4CAW A;  3DR8 A;  4P4I A;  1R57 A;  2BCO A;  4NXY A;  1ZLH A;  2Q4Z A;  2J8R A;  4KOY A;  5EBV A;  2WSA A;  2ZW6 A;  4KVO E;  3RBU A;  2AFM A;  2YNC A;  4OKO A;  2CTB A;  1TKF A;  4RI1 A;  1TKJ A;  3KL9 A;  3NH8 A;  3W6S A;  3N7Z A;  1F2P A;  4KUA A;  1MK4 A;  2FL4 A;  4MY0 A;  6CPA A;  1Z4R A;  1BPN A;  2R1I A;  3D66 A;  5CBM A;  2F7V A;  4KLV A;  4OAE A;  5F47 A;  4EWT A;  2J8M A;  4A37 A;  4CGM A;  4ZGY B;  4ZY1 A;  3JVN A;  1RXT A;  3DLJ A;  4KOT A;  4KLW A;  2WUU A;  3D67 A;  4HPS A;  3RZA A;  3BLN A;  2D4O A;  3D68 A;  2DXQ A;  3C26 A;  4H2K A;  4P45 A;  2DF5 A;  3PBE A;  4GXH A;  3JTK A;  2EVN A;  4NSQ A;  4GM5 A;  4BBH A;  4LUA A;  4J3G A;  1BO4 A;  2P0W A;  3D2P A;  1VHE A;  4NCZ A;  2B5G A;  2R7H A;  4CGL A;  1CPX A;  4UIB A;  1AMP A;  1IB1 E;  2POK A;  5H86 A;  4C7I A;  4MMO A;  4PXE A;  1R3N A;  3NA6 A;  4ZY2 A;  5IB0 A;  4YWY A;  1F2O A;  5EMI A;  1ARL A;  4HNW B;  4EFD A;  1TXR A;  5F09 A;  1Z8L A;  1XFO A;  2ZW5 A;  3VH9 A;  2P6E A;  4XPL A;  5BWA B;  4L8A A;  1QST A;  2ZOG A;  2ZW4 A;  3BHX A;  5JM6 A;  1Y7E A;  2NYQ A;  2PJ7 A;  4MHY A;  4P4D A;  3SXO A;  3TFY A;  2ZEO A;  4PSX A;  4AB7 A;  4DJL A;  3LWU A;  2B4B A;  4MFL A;  1YGH A;  4QBJ A;  2GAN A;  1OZP A;  1IOF A;  2GFQ A;  4P4E A;  4AVB A;  2PJA A;  1CPS A;  4H6U A;  4CYP A;  5I4M A;  3QAH A;  2FIW A;  2DPS A;  3S9M A;  2I00 A;  2OR4 A;  2Z3K A;  3WC7 A;  4F9U A;  2BL1 A;  3GY9 A;  4TWE A;  2B5G B;  3HLP A;  3N5F A;  2PR1 A;  1UWY A;  2HQY A;  1PCA A;  2G3A A;  2D4P A;  3FB3 A;  2J8N A;  1Y7R A;  4X2T A;  4BIN A;  1VHS A;  3KHZ A;  1JQG A;  5H84 A;  4C2Z A;  3B35 A;  2X7B A;  1NSL A;  3B8G A;  5G22 A;  1XRY A;  3D4U A;  1HDU A;  2EK8 A;  5LRJ A;  2JBK A;  4FD5 A;  5HH1 A;  4E0A A;  2K5T A;  1QQ9 A;  4KOW A;  4E8O A;  3R96 A;  4RUH A;  1YLE A;  3GB0 A;  3BXM A;  1EE3 P;  1S7F A;  2CY2 A;  1VHO A;  2FVG A;  2Q4V A;  4JZ0 A;  5LYI A;  1QSO A;  4MFZ A;  4UFX A;  4A95 A;  4C2Y A;  3S9N A;  4B6Z A;  4HNX B;  2ZPA A;  1F57 A;  4MJ8 A;  2IQ6 A;  4ONU A;  3IU2 A;  3WC6 A;  2Q7B A;  4PQA A;  2YNE A;  3GUX A;  3EFA A;  3VAT A;  1I12 A;  2IMO A;  5ELY A;  5LYF A;  3D7H A;  1XJO A;  4FD6 A;  1YRE A;  2CNM A;  3CDX A;  3FXT A;  4X5K A;  4R3L A;  8CPA A;  4M6H A;  4MHN A;  4JD6 A;  3B3C A;  2C6P A;  4UCM A;  5DWN A;  3S6F A;  4AG7 A;  2YNC C;  3FVL A;  1KUY A;  4UWI A;  1JWQ A;  3GLJ A;  2CNT A;  3TX8 A;  4MFQ A;  4P10 A;  5DWM A;  2OOT A;  5F46 A;  1HDQ A;  1LCP A;  1LAM A;  1ELL P;  3PZJ A;  3KHX A;  4K30 A;  2EO8 A;  4NEX A;  2AFO A;  4WWV A;  1KWM A;  1LRZ A;  1IIC A;  1Q2D A;  1RO5 A;  1BOB A;  3FBU A;  1CBX A;  2B58 A;  2H5M A;  4CPA A;  4MI4 A;  1VKC A;  4R7M A;  4EME A;  1M44 A;  2BOA A;  2PRB A;  2BO9 A;  2V8D A;  2Z11 A;  1L0C A;  2GRE A;  1OBR A;  2Y0M A;  3FEE A;  1Q7L A;  2XEJ A;  3DSB A;  5K8M A;  3S6H A;  2PE3 A;  2O53 A;  2FIA A;  3T8W A;  1Z8X A;  2ZW7 A;  4MRI A;  4F0X A;  4MHZ A;  3NH4 A;  5J8C A;  2JEW A;  4UEE A;  3TCV A;  4UEF A;  4NGN A;  2OU2 A;  3PFE A;  4PSW A;  4G1P A;  1WWZ A;  2R8V A;  3IGR A;  4MY3 A;  1M4D A;  3D3S A;  3R1K A;  4KVX A;  3ZJ0 A;  1Z4E A;  1FT7 A;  4UIA A;  2ZEE A;  5JQ4 A;  2AFW A;  4OME A;  2PC1 A;  1Y0R A;  3KR4 A;  1Z8T A;  1ZLI A;  2ZEM A;  3H8F A;  4AG9 A;  3IU1 A;  5C88 A;  3CPX A;  1QSR A;  3V7Z A;  2GLF A;  2J9A A;  2F5I A;  1NE9 A;  2F8H A;  4KOS A;  2PJ0 A;  3SI2 A;  4C68 A;  2AFU A;  3TE4 A;  1S7K A;  2Z0Z A;  1YSJ A;  3WT4 A;  4F0Y A;  1IYK A;  4KSI A;  5IB9 A;  3B3T A;  3QB8 A;  4FBE A;  1Y9W A;  4M6G A;  3LOD A;  5HVF A;  4FD4 A;  4MFJ A;  1M4I A;  4C2X A;  3RAM A;  2JLM A;  2Q0Y A;  4MCS A;  3V38 A;  1XOV A;  1X12 A;  2PJC A;  3B3V A;  1Z5R A;  2C27 A;  4B5P A; 
#chains in the Genus database with same CATH homology
 2HV2 A;  3S6K A;  3TTH A;  4R87 A;  2FS5 A;  4KUB A;  1QSN A;  1I21 A;  4B14 A;  3FRM A;  4R3K A;  5FVJ A;  4II9 A;  5KTC A;  1M1D A;  2FSR A;  2JDD A;  2PSW A;  3GYA A;  4YRH A;  3FNC A;  1IID A;  3NE7 A;  5G21 A;  1KUX A;  3H4Q A;  4U5Y A;  2WPW A;  2BSW A;  3T9Y A;  3VWD A;  2DPT A;  2VXK A;  3ZZI A;  4KSA A;  4B5P B;  5KTA A;  5G1Z A;  4I49 A;  4CAV A;  2FXF A;  2HUZ A;  2G0B A;  1ON0 A;  3CXQ A;  3PGP A;  3I3G A;  3PP9 A;  2VZZ A;  3TT2 A;  4AVC A;  1S3Z A;  2Z3N A;  5C82 A;  5ISV A;  2VQY A;  2VZY A;  4JJX A;  1PU9 A;  1S5K A;  4KOX A;  4UCN A;  3IWE A;  4C7H A;  2Z3P A;  1TIQ A;  4U9Y A;  1U6M A;  1Q2C A;  1MJ9 A;  4A30 A;  2ARH A;  4B5O A;  1YK3 A;  4GS4 A;  3KKW A;  3DR6 A;  3EY5 A;  3TO7 A;  3UY5 A;  4CAE A;  2FCK A;  3TOA A;  3F0A A;  4B10 A;  5IV0 A;  2GIV A;  2QIR A;  3R95 A;  3D2M A;  5AG6 A;  2NMT A;  4B11 A;  4JWP A;  2REF A;  3LD2 A;  4A33 A;  1FY7 A;  3SHP A;  4JLY A;  1IYL A;  2BEI A;  3IWG A;  4QUS A;  1NMT A;  4MHD A;  2CNS A;  1B87 A;  2REE A;  3E0K A;  1S7N A;  3SXN A;  2Z3M A;  5JPH A;  2Z3L A;  2AJ6 A;  4RS2 A;  5AGE A;  3A9L A;  4KOV A;  1I1D A;  4HKF A;  4Y49 B;  3G3S A;  4XPD C;  2B4D A;  4R57 A;  2P6G A;  4MBU A;  2Z3O A;  2Q44 A;  3DDD A;  2FT0 A;  2IL4 A;  4MFP A;  5F48 A;  3OWC A;  4YGO A;  3GKR A;  3W6X A;  5J8F A;  4OAD A;  1ZO0 A;  3S6G A;  4KZT A;  1Y9K A;  4CGP A;  3TOB A;  1PUA A;  4YFJ A;  3BJ8 A;  4XNH C;  2OH1 A;  4DNC A;  4CGO A;  3MGD A;  1XIX A;  4L89 A;  4BMH A;  4H6Z A;  3D8P A;  3BJ7 A;  2JEV A;  1MJB A;  3CXS A;  4EVY A;  2B4D B;  2I79 A;  4PV6 A;  5AG5 A;  4CGN A;  5IX3 A;  2OZU A;  2G3T A;  2ZXV A;  3R9G A;  4B12 A;  2Z10 A;  5AG7 A;  1GHE A;  2BUE A;  2FE7 A;  4PK3 A;  2CXA A;  3FYN A;  3EXN A;  4F6A A;  1CM0 A;  4M85 A;  4KVM E;  4OLL A;  3R9E A;  1Z9U A;  1V0C A;  1N71 A;  4CS0 B;  4CAX A;  2YGW A;  5KTD A;  3EC4 A;  4NF1 A;  3TO6 A;  5HMN A;  1KZF A;  2VI7 A;  2QML A;  2VEZ A;  5E96 A;  3V8I A;  3W91 A;  4A2Z A;  5F49 A;  1WK4 A;  2B3V A;  2O28 A;  2QEC A;  1J4J A;  3EO4 A;  4Y49 C;  1S60 A;  4IF5 A;  3RYO A;  4CYQ A;  4UA3 A;  2PDO A;  4CRY B;  4E2A A;  2ATR A;  1B6B A;  2EUI A;  4CYN A;  2PR8 A;  4XPD B;  1MJA A;  4JXR A;  4IUS A;  4KS9 A;  3TO9 A;  4UFW A;  4CAF A;  1XF8 A;  1KUV A;  4R9M A;  3DNS A;  1SQH A;  4ORF A;  1YR0 A;  4KOU A;  1S7L A;  4UWJ A;  4A31 A;  1Q2Y A;  2RC4 A;  3I9S A;  4FD7 A;  4KSF A;  2OZG A;  5CNP A;  2OB0 A;  4QC6 A;  4XNH B;  2B3U A;  4B13 A;  4QVT A;  3WR7 A;  2Q4Y A;  5A28 A;  2VBQ A;  3K9U A;  2YND A;  3T90 A;  4JXQ A;  2Q04 A;  2WPX A;  4MFK A;  2A4N A;  3G8W A;  4AVA A;  5GCN A;  1QSM A;  3VWE A;  1M4G A;  2OZH A;  2P6F A;  4M3S A;  2JDC A;  4Q36 A;  4KOR A;  1CJW A;  2PQ8 A;  5AG4 A;  3JUW A;  1YVK A;  3H5Z A;  2R98 A;  3FIX A;  2AE6 A;  3R9F A;  1YX0 A;  2KCW A;  3F8K A;  5A27 A;  4UBR A;  3F5B A;  1P4N A;  4UCP A;  4H89 A;  4PK2 A;  4CRZ B;  4CYO A;  5I0C A;  1XEB A;  4XPK A;  3P2F A;  1P0H A;  5G20 A;  5EC4 A;  3CXP A;  1XMT A;  4UFV A;  1K4J A;  4ZBG A;  1YVO A;  1UFH A;  4Q38 A;  4LX9 A;  4U9Z A;  4QB9 A;  2GE3 A;  4HNY B;  1XE4 A;  4A32 A;  4CAW A;  3DR8 A;  1R57 A;  4NXY A;  2J8R A;  4KOY A;  5EBV A;  2WSA A;  2ZW6 A;  4KVO E;  2YNC A;  4RI1 A;  3W6S A;  3N7Z A;  4KUA A;  1MK4 A;  2FL4 A;  4MY0 A;  1Z4R A;  2R1I A;  4KLV A;  4OAE A;  5F47 A;  2J8M A;  4CGM A;  4ZGY B;  3JVN A;  1RXT A;  4KOT A;  4KLW A;  2WUU A;  3BLN A;  2D4O A;  2DXQ A;  3C26 A;  3JTK A;  2EVN A;  4NSQ A;  4BBH A;  4LUA A;  4J3G A;  1BO4 A;  2P0W A;  3D2P A;  4NCZ A;  2B5G A;  2R7H A;  4CGL A;  1IB1 E;  5H86 A;  4C7I A;  5IB0 A;  4HNW B;  2ZW5 A;  2P6E A;  4XPL A;  5BWA B;  4L8A A;  1QST A;  2ZW4 A;  3SXO A;  3TFY A;  4PSX A;  4AB7 A;  4MFL A;  2B4B A;  1YGH A;  4QBJ A;  2GAN A;  1OZP A;  4AVB A;  4H6U A;  4CYP A;  3QAH A;  2FIW A;  2DPS A;  2I00 A;  2Z3K A;  3GY9 A;  2BL1 A;  2B5G B;  2PR1 A;  2HQY A;  2G3A A;  2D4P A;  3FB3 A;  2J8N A;  1Y7R A;  1VHS A;  5H84 A;  4C2Z A;  2X7B A;  1NSL A;  3B8G A;  5G22 A;  4FD5 A;  5HH1 A;  4E0A A;  2K5T A;  4KOW A;  4E8O A;  3R96 A;  1YLE A;  1S7F A;  2CY2 A;  2Q4V A;  4A95 A;  4C2Y A;  1QSO A;  4MFZ A;  4UFX A;  4HNX B;  2ZPA A;  4MJ8 A;  4ONU A;  3IU2 A;  2Q7B A;  2YNE A;  3EFA A;  1I12 A;  4FD6 A;  1YRE A;  2CNM A;  3FXT A;  4X5K A;  4R3L A;  4JD6 A;  4UCM A;  5DWN A;  3S6F A;  4AG7 A;  2YNC C;  1KUY A;  4UWI A;  2CNT A;  4MFQ A;  5DWM A;  5F46 A;  3PZJ A;  4K30 A;  4NEX A;  1LRZ A;  1Q2D A;  1IIC A;  1RO5 A;  3FBU A;  1BOB A;  2B58 A;  2H5M A;  4MI4 A;  1VKC A;  1M44 A;  2PRB A;  2Z11 A;  1L0C A;  2Y0M A;  3DSB A;  3S6H A;  2FIA A;  2ZW7 A;  4F0X A;  5J8C A;  3TCV A;  4PSW A;  2OU2 A;  1WWZ A;  2R8V A;  3IGR A;  4MY3 A;  1M4D A;  3D3S A;  3R1K A;  4KVX A;  3ZJ0 A;  1Z4E A;  5JQ4 A;  2PC1 A;  4AG9 A;  5C88 A;  1QSR A;  2F5I A;  1NE9 A;  4C68 A;  4KOS A;  3TE4 A;  1S7K A;  2Z0Z A;  4F0Y A;  1IYK A;  3QB8 A;  1Y9W A;  3LOD A;  4FD4 A;  4MFJ A;  1M4I A;  4C2X A;  2JLM A;  2Q0Y A;  3P2H A;  3IU1 A;  2C27 A;  4B5P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...