1M4DA

Aminoglycoside 2'-n-acetyltransferase from mycobacterium tuberculosis-complex with coenzyme a and tobramycin
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
181
structure length
181
Chain Sequence
MHTQVHTARLVHTADLDSETRQDIRQMVTGAFAGDFTETDWEHTLGGMHALIWHHGAIIAHAAVIQRRLIYRGNALRCGYVEGVAVRADWRGQRLVSALLDAVEQVMRGAYQLGALSSSARARRLYASRGWLPWHGPTSVLAPTGPVRTPDDDGTVFVLPIDISLDTSAELMCDWRAGDVW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Aminoglycoside 2'-N-acetyltransferase from Mycobacterium tuberculosis in complex with coenzyme A and aminoglycoside substrates.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
molecule keywords Aminoglycoside 2'-N-acetyltransferase
total genus 51
structure length 181
sequence length 181
chains with identical sequence B
ec nomenclature ec 2.3.1.-:
pdb deposition date 2002-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13527 Acetyltransf_9 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1m4dA00
4NEXA 3FNCA 1IYKA 3NE7A 3FBUA 3GYAA 5FVJA 4YFJA 2Z0ZA 5GCNA 3KKWA 2ZW7A 2G3AA 3G3SA 2VXKA 3BJ7A 4MY3A 2A4NA 4H6UA 3CXSA 3F0AA 3GKRA 2GANA 2B4BA 2NMTA 1YVOA 3DR6A 2FIWA 4RS2A 3H4QA 1NSLA 3TE4A 2Q04A 5DWMA 2JLMA 3P2FA 2ZXVA 3PZJA 3VWDA 3FB3A 2HQYA 2PDOA 4I49A 1S5KA 4U5YA 5KTAA 2WPWA 1B6BA 2VQYA 4ORFA 4OAEA 1Y9KA 3CXPA 5J8FA 4JLYA 4CAXA 4AB7A 3DSBA 1WWZA 2CNSA 4HNWB 4KOSA 1XMTA 4CAWA 4GS4A 1Z4RA 4FD4A 3V8IA 1S7NA 3I9SA 5DWNA 4KOTA 3S6FA 4R87A 4CAVA 2D4OA 2FL4A 5ISVA 1YX0A 1L0CA 2Q7BA 4F6AA 3R9EA 3I3GA 2J8RA 1XIXA 4ZBGA 1QSTA 2Q4YA 2QECA 1V0CA 1IB1E 1QSMA 4EVYA 4PV6A 3MGDA 2ZW6A 3W91A 1M1DA 1QSRA 4E8OA 5JQ4A 2VEZA 2OZUA 1M4DA 2RC4A 4ONUA 4E2AA 3TT2A 2ZW5A 1RXTA 3UY5A 5EBVA 2O28A 2FT0A 3R9FA 1P0HA 1VHSA 2R1IA 3FXTA 4NXYA 1KZFA 5C82A 4B5OA 1PUAA 4KOYA 4CS0B 4PK2A 3R1KA 4MY0A 2ARHA 5F48A 3BJ8A 2HV2A 2FCKA 1QSNA 2CY2A 4M3SA 1GHEA 1YR0A 2FS5A 4XPDC 2OZGA 2B5GB 4Y49C 4R9MA 2REFA 2Q0YA 2PQ8A 3FIXA 2G0BA 4QC6A 1S7KA 3GY9A 4AG7A 2WPXA 2QMLA 4AVCA 4MHDA 3ZJ0A 3TOAA 2R8VA 1M4GA 4XNHB 2BL1A 4FD7A 1TIQA 2KCWA 5KTCA 2C27A 3R9GA 2B58A 1Q2CA 3QB8A 2X7BA 1BOBA 3JUWA 2Q44A 2B3UA 2GE3A 3P2HA 3D3SA 1MJAA 2OZHA 2FIAA 5IV0A 4XPKA 1WK4A 3F5BA 3DDDA 2F5IA 4KOWA 2P6EA 4KOXA 1FY7A 1Y7RA 3D8PA 1PU9A 2DXQA 3K9UA 2OB0A 1Q2YA 2Z11A 2FXFA 1YK3A 4KOVA 2Y0MA 1IICA 1IIDA 2FSRA 5J8CA 4UWIA 4KVME 2PSWA 1I21A 4LX9A 3TO9A 2I79A 4KVXA 2P6GA 4MBUA 3T90A 3T9YA 5JPHA 3RYOA 3E0KA 4QB9A 3IWGA 3ZZIA 2BUEA 4JJXA 2H5MA 4M85A 4U9ZA 1VKCA 4XPLA 1NE9A 4OLLA 4U9YA 2D4PA 1IYLA 2ATRA 4OADA 5EC4A 1B87A 4HNYB 4KORA 1YREA 1XF8A 3FRMA 1UFHA 1RO5A 3BLNA 4NF1A 4JWPA 1J4JA 4KOUA 1Q2DA 1YGHA 1SQHA 1MJ9A 3JVNA 3DNSA 2B3VA 4JXQA 3PGPA 2IL4A 2R7HA 1KUYA 2VZZA 5E96A 4L89A 1NMTA 4KZTA 2B4DA 1U6MA 1S60A 1K4JA 3LD2A 3EO4A 4X5KA 3TO6A 5F47A 4KLWA 4MJ8A 5F49A 2JDDA 3SXNA 4IF5A 2BSWA 3S6HA 2VZYA 3S6KA 4IUSA 2OH1A 4FD5A 4F0YA 4PSXA 2ZW4A 1MJBA 3TCVA 1ON0A 4MI4A 4UWJA 4NCZA 4HKFA 4LUAA 1CJWA 4CRYB 4AVBA 4YRHA 2PC1A 3TOBA 1XE4A 2I00A 5H84A 4Y49B 1S7LA 3SHPA 5IB0A 1N71A 1I1DA 4H89A 2REEA 3OWCA 1Y9WA 3N7ZA 1S3ZA 3TFYA 2FE7A 4QBJA 1BO4A 3CXQA 5H86A 1QSOA 4QUSA 4KVOE 4R3LA 4JD6A 4BMHA 4XNHC 3W6XA 4RI1A 1R57A 2J8MA 3EY5A 2GIVA 5KTDA 2R98A 4B5PB 3FYNA 1Z9UA 1S7FA 3B8GA 3C26A 4H6ZA 4DNCA 2J8NA 3R96A 2K5TA 1KUVA 1YVKA 4PSWA 4E0AA 2BEIA 4R57A 5IX3A 2HUZA 5C88A 3EC4A 1OZPA 4B5PA 3PP9A 2JDCA 2CNMA 2P0WA 3TTHA 2QIRA 4KUBA 3EXNA 1LRZA 1M44A 3IGRA 3G8WA 2EVNA 2OU2A 2PR1A 2B5GA 2P6FA 5HH1A 5F46A 4II9A 4UBRA 1KUXA 3QAHA 3D2MA 4XPDB 1YLEA 4AG9A 2Z10A 5I0CA 2EUIA 1P4NA 2VBQA 3LODA 2VI7A 1CM0A 2JEVA 5CNPA 4R3KA 1Z4EA 4AVAA 3D2PA 3S6GA 4KUAA 3WR7A 5HMNA 4QVTA 2Q4VA 4FD6A 4KLVA 4CRZB 3EFAA 1XEBA 4L8AA 3TO7A 2ZPAA 1I12A 4NSQA 1M4IA 2B4DB 3DR8A 4PK3A 3R95A 4UA3A 2CNTA 2PR8A 4K30A 4HNXB 1MK4A 3SXOA 4J3GA 2AJ6A 3VWEA 2AE6A 3F8KA 2G3TA 2PRBA 4JXRA 3W6SA 4YGOA
chains in the Genus database with same CATH superfamily
4WWVA 4C2YA 4C68A 3FX6A 2DEAA 3FNCA 4NEXA 3LWUA 5CPAA 1IYKA 3B3SA 4CAEA 3H5ZA 2RB7A 3NE7A 2PVWA 1HDUA 3QAYA 4UEFA 4OC2A 3FBUA 3GYAA 5FVJA 4YFJA 2Z0ZA 5GCNA 3FEDA 3KKWA 1ARLA 2GREA 4NJQA 1YW4A 2ZW7A 2YNEA 4A37A 3CDXA 5K8OA 2G3AA 3G3SA 2VXKA 3BJ7A 4AXVA 4MY3A 3PBBA 2A4NA 4UIBA 4H6UA 1ELMP 3WC5A 2C6GA 3KHZA 3CXSA 4F9VA 4H2KA 3F0AA 3GKRA 3WC6A 2GANA 3BI0A 2B4BA 2NMTA 1YVOA 2FIWA 3DR6A 4RS2A 3H4QA 1NSLA 4TNUA 5D29A 1FNOA 3TE4A 2Q04A 5DWMA 3CPAA 2PE3A 4OIDA 2JLMA 3P2FA 2ZXVA 2XEIA 4IAVA 2G9DA 3IEHA 3PZJA 3FB3A 1Z2LA 4NGNA 3VWDA 2HQYA 2PDOA 4I49A 1S5KA 4U5YA 4BBHA 5KTAA 1Z8WA 2WPWA 2YNCA 3FEEA 3PFOA 1B6BA 2PCUA 2PJ1A 4B14A 3VH9A 2VQYA 3DLJA 4ORFA 4OAEA 1Y9KA 3CXPA 5J8FA 4JLYA 1XOVA 2DPTA 2ZEHA 3ISXA 2PJBA 4CAXA 2F8HA 3KASA 4UFXA 3DSBA 1WWZA 4A32A 3KI9A 4AB7A 8CPAA 2CNSA 4HNWB 4TWEA 4KOSA 4X8IA 1XMTA 4CAWA 4GS4A 4CYPA 1Z4RA 4FD4A 3V8IA 1LAMA 1QQ9A 3RAMA 4CGOA 1S7NA 3I9SA 5DWNA 4KOTA 3S6FA 2PJ5A 3S9NA 2O53A 1CBXA 4R87A 4CAVA 5LYDA 1ARMA 5A28A 2D4OA 4NGMA 4CPAA 1X12A 2DPSA 3B2YA 4MHPA 4MFQA 1IY7A 2FL4A 4OC4A 5ISVA 3IWWA 4C2XA 1VIXA 1YX0A 1L0CA 2Q7BA 4F6AA 3R9EA 3I3GA 2J8RA 1XJOA 1XIXA 4MCPA 1NSAA 4EMEA 2CF4A 4ZBGA 4CGMA 4C7IA 1QSTA 3FF3A 4ZI6A 1VGYA 2Q4YA 2QECA 3ISZA 1V0CA 1IB1E 1QSMA 4RUHA 4O23A 2AFUA 4PV6A 3MGDA 2Z3NA 2ZW6A 3W91A 1M1DA 4EVYA 1QSRA 4E8OA 1AUGA 3H8GA 1LOKA 5JQ4A 1VHEA 3D7FA 5JM6A 2VEZA 2OZUA 3PBEA 1M4DA 3IO1A 2RC4A 4GXHA 4ONUA 1ELLP 4E2AA 3NH8A 3TT2A 2RFHA 2ZW5A 1RXTA 3UY5A 4ZX9A 5EBVA 4ZY0A 1IOIA 1XMBA 2NYQA 2O28A 2CTBA 1R43A 3B35A 2FT0A 3B3WA 3PEIA 3R9FA 5K8NA 1P0HA 4C7HA 1VHSA 2R1IA 3FXTA 4NXYA 1LFWA 1KZFA 3K2KA 5CBMA 1Z8XA 5C82A 1PCAA 4B5OA 6CPAA 1PUAA 3NH5A 4KOYA 3BI1A 4NGSA 4CS0B 4PK2A 1TF8A 1Z8TA 3R1KA 4MY0A 3VARA 3KR4A 2ARHA 1KWMA 2V8VA 4Q36A 5F48A 3B3CA 3BJ8A 4KS9A 5G22A 2HV2A 5BWAB 4BD9A 5K8MA 4NGTA 2FCKA 4IK2A 2WSAA 5AG4A 1QSNA 3H8EA 2ZEMA 2QJ8A 2CY2A 4M3SA 1F2OA 1GHEA 1YR0A 2FS5A 2PJ6A 4XPDC 2OZGA 1TF9A 3JRUA 4M6IA 5HVFA 2B5GB 4OKOA 4Y49C 4R9MA 2FVGA 2REFA 5DS0A 1XFOA 2Q0YA 2PQ8A 3FIXA 2PJ7A 2G0BA 3L2NA 4FWUA 4QC6A 3SJFA 1S7KA 4W9YA 3GY9A 2HC9A 2YNDA 4AG7A 4A2ZA 2WPXA 2QMLA 3IFEA 4CGNA 4AVCA 2BOAA 5G21A 3RNZA 4P4FA 4A30A 4A38A 3KQXA 3KHXA 4JZ0A 4P10A 4LQGA 1YQEA 1QMUA 3PB9X 4MHDA 3ZJ0A 3TOAA 2R8VA 2JBKA 1M4GA 4XNHB 1PYTB 2BL1A 4UIAA 2EO8A 4FD7A 1TIQA 2C6PA 3IJ3A 2KCWA 2VL1A 5KTCA 2C27A 3R9GA 5EMIA 2B58A 2PJ2A 2ZEFA 4M6GA 2OR4A 3NA6A 1Q2CA 2IJZA 3QB8A 3RBUA 2PJAA 1BOBA 2X7BA 3JUWA 4KSIA 1XRYA 2Q44A 2B3UA 3JTKA 1FT7A 4OIWA 2XEGA 5THWA 4DJLA 2GE3A 3P2HA 3D3SA 4A95A 5HVGA 1MJAA 3FH4A 1BPNA 2CIJA 2OZHA 2FIAA 5IV0A 4BINA 4XPKA 4UCMA 1WK4A 3F5BA 2EWBA 4UCNA 3DDDA 2F5IA 2GLJA 4KOWA 4P6YA 2PIZA 4P4DA 3TX8A 4P4JA 2P6EA 1FY7A 4KOXA 4YWYA 1Y7RA 3D8PA 1PU9A 2DXQA 3K9UA 4DYOA 4B6ZA 4F0XA 4B10A 5K8PA 2OB0A 5A27A 1Q2YA 2Z11A 2FXFA 2ZENA 1ZLHA 2ZOFA 4K3NA 4ONWA 3GIUA 2Q51A 4CYNA 1Z8LA 1YK3A 2JBJA 4KOVA 3S9MA 4FAIA 3NE8A 3IC1A 3A9LA 3FECA 4CGLA 2Y0MA 1IICA 1IIDA 2FSRA 5J8CA 4UWIA 4KVME 2PSWA 1I21A 2F7VA 4LX9A 3TO9A 2I79A 3IU2A 1RTQA 2ANPA 4KVXA 2P6GA 4MBUA 4PXDA 4R8FA 3T90A 3T9YA 5JPHA 4KSAA 2ZEEA 4NGQA 4M6HA 2GU2A 4Q7AA 3RYOA 3E0KA 1M4LA 4QB9A 2GFQA 3IWGA 3FVLA 3WC7A 1ZG8A 3ZZIA 2BUEA 1BPMA 1CG2A 1CPSA 4JJXA 1LANA 2H5MA 3N5FA 2V8HA 3H8FA 4MCQA 4M85A 4UCPA 4NGPA 1LCPA 1CX8A 1VKCA 4U9ZA 4XPLA 1NE9A 4OLLA 1IGBA 1R3NA 3IU1A 3DGVA 4U9YA 2D4PA 5LRJA 3WT4A 1IYLA 1ZO0A 2ATRA 4UFVA 3PFEA 2AFXA 3FJUA 4OADA 5EC4A 1B87A 2V8DA 4HNYB 4KORA 4A31A 1YREA 1XF8A 2PJCA 3FRMA 1UFHA 3HUVA 1RO5A 3BLNA 4FUUA 1YLOA 4NF1A 4ZGYB 3QNVA 2PJ4A 4JWPA 1Q7LA 2JEWA 1OBRA 3VATA 1J4JA 5JH9A 1JWQA 2XEFA 4KOUA 1Q2DA 1IU8A 3SJEA 1YGHA 1SQHA 1MJ9A 3JVNA 3DNSA 2B3VA 4JXQA 3KZWA 3PGPA 2J9AA 2GLFA 2V8GA 5LYLA 3B3VA 5LRGA 2ZEOA 2IL4A 2R7HA 1KUYA 2VZZA 3CZXA 3PB7X 2ZEPA 4YU9A 4NFRA 5E96A 5HXDA 4L89A 1NMTA 4MFJA 4KZTA 3SJGA 2B4DA 1U6MA 2Z3KA 1S60A 3K9TA 1K4JA 4P4BA 3LD2A 3EO4A 4X5KA 3TO6A 5F47A 4KLWA 2XEJA 4MJ8A 2JDDA 4PXEA 5F49A 3SXNA 4IF5A 2BSWA 3PB8X 3S6HA 2VZYA 3S6KA 1LAPA 2OH1A 4FD5A 4IUSA 4R7MA 4F0YA 4PSXA 2ZW4A 1MJBA 2ZELA 3TCVA 1BLLE 1ON0A 1JQGA 2AFOA 4MI4A 4Q38A 3KL9A 4UWJA 3TC8A 4LQ6A 2WZNA 4NCZA 4HKFA 4LUAA 2Z3OA 1CJWA 1TKFA 5J1QA 4CRYB 4AVBA 4YRHA 4EWTA 4OP4A 2PC1A 1HDQA 2WUUA 3TOBA 1XE4A 1CP7A 2I00A 5H84A 2AFMA 1VHOA 4A94A 4Y49B 3IIBA 1S7LA 2HB6A 2POKA 3SHPA 1AYEA 5IB0A 4FBEA 1N71A 3KR5A 4CYOA 4CYQA 1ZG7A 1I1DA 4H89A 4F9UA 5AG5A 2Z3LA 4ZY1A 2REEA 3CPXA 4MFKA 2WYRA 3OWCA 4KSFA 3FMCA 1Y9WA 3N7ZA 1S3ZA 2YGWA 3D4UA 3TFYA 1A2ZA 2FE7A 2PVVA 4QBJA 4PQAA 5IB9A 1BO4A 3CXQA 3D7DA 5H86A 1QSOA 4QUSA 1H8LA 4KVOE 4MFZA 4MHZA 1Y0YA 3NH4A 3B3TA 4R3LA 4JD6A 4BMHA 4XNHC 3RO0A 3SJXA 3W6XA 4Z65A 3PRTA 4RI1A 1R57A 2I3CA 4JYWA 2O4HA 2J8MA 3PB6X 3EY5A 3V38A 7CPAA 2GIVA 5KTDA 3GB0A 5LRKA 2R98A 4B5PB 2Q43A 4ZX8A 2ZEDA 3FYNA 1Z9UA 1S7FA 3HLPA 3B8GA 3C26A 4MXUA 5D8NA 4H6ZA 3KGQA 1TKHA 2EK8A 2V77A 4PXBA 3S9LA 3NFZA 4DNCA 2J8NA 3R96A 2K5TA 2NSMA 4MCSA 1KUVA 2PJ9A 2C1CA 1YVKA 3IWEA 4PSWA 3GUXA 2BEIA 1CPXA 4E0AA 3CT9A 5LYFA 5AGEA 4R57A 5IX3A 2HUZA 1HEEA 5C88A 1ZLIA 3EC4A 1OZPA 3LACA 4MRIA 4YGOA 1IOFA 5ELYA 3MN8A 2ZOGA 4EFDA 4MCRA 4B5PA 2DF5A 4X3RA 1X10A 3PP9A 3D66A 3RZAA 4C2ZA 4MHNA 2JDCA 5I4MA 2CNMA 1TKJA 4MHYA 2P0WA 2ODFA 2QYVA 3TTHA 2Q7SA 1EE3P 3T8WA 2EK9A 3D7GA 4CAFA 2QIRA 1BAVA 3SI2A 2AFZA 4KUBA 3EXNA 4MFPA 1LRZA 1M44A 4P4IA 1CP6A 1Y7EA 2YNCC 3IGRA 3G8WA 2EVNA 4P4EA 5G20A 4P44A 4OC1A 4B12A 1DE4C 2OU2A 2PJ3A 2PR1A 2B5GA 2P6FA 4OC0A 5HH1A 3SI0A 5F46A 4UEZA 4II9A 2Z3PA 4UBRA 4OMEA 1KUXA 3QAHA 3D2MA 4XPDB 2CXAA 1YLEA 3D7HA 5G1ZA 4AG9A 4B11A 3SI1A 2Z10A 5I0CA 2EUIA 1P4NA 2VBQA 3D67A 5AG7A 3LODA 5HVHA 4CGPA 2VI7A 1CM0A 4IHMA 4NGRA 1F57A 2JEVA 1XBUA 1Z5RA 1GYTA 5CNPA 4R3KA 4B13A 2C6CA 1Z4EA 5JGFA 3LMSA 4HPSA 4AVAA 3D2PA 1YW6A 1ZG9A 3S6GA 2Q4ZA 3PB4X 4KUAA 4OC3A 1YMEA 2AFSA 2EBJA 2QVPA 2AFWA 4QVTA 4UF4A 3WABA 3WR7A 4A39A 5HMNA 2Q4VA 4FD6A 4KLVA 4NJRA 2ZEGA 4GM5A 4UFWA 4A33A 4CRZB 3EFAA 4ZYQA 1XEBA 3KQZA 2BO9A 2IQ6A 2ABZA 4L8AA 4OC5A 2ZPAA 2IMOA 3TO7A 1I12A 2PIYA 4NSQA 2PJ0A 3MRUA 4ZY2A 1TXRA 4UEEA 4X2TA 2PJ8A 3D68A 2PRQA 4G1PA 4PPZA 2OOTA 4MFLA 1M4IA 4PXCA 2B4DB 2CTCA 3DR8A 4MMOA 4PK3A 5LYIA 3R95A 1YSJA 4DUKA 4UA3A 3V7ZA 2CNTA 2PR8A 3GLJA 4R6TA 1AMPA 1F2PA 2Z3MA 4K30A 4HNXB 1Y0RA 2BCOA 1MK4A 5AG6A 3SXOA 4J3GA 3BHXA 2AJ6A 5F09A 3BXMA 4P45A 4F8ZA 3VWEA 2AE6A 3B7IA 3I1UA 1UWYA 4R76A 3F8KA 4WJBA 4RN7A 2G3TA 2PRBA 4JXRA 3W6SA 1DTDA
chains in the Genus database with same CATH topology
4C2YA 4C68A 4NEXA 3FNCA 1IYKA 4CAEA 3H5ZA 3NE7A 3FBUA 3GYAA 5FVJA 4YFJA 2Z0ZA 5GCNA 3KKWA 2ZW7A 2YNEA 2G3AA 3G3SA 2VXKA 3BJ7A 4MY3A 2A4NA 4H6UA 3CXSA 3F0AA 3GKRA 2GANA 2B4BA 2NMTA 1YVOA 3DR6A 2FIWA 4RS2A 3H4QA 1NSLA 3TE4A 2Q04A 5DWMA 2JLMA 3P2FA 2ZXVA 3PZJA 3VWDA 3FB3A 2HQYA 2PDOA 4I49A 1S5KA 4U5YA 4BBHA 5KTAA 2WPWA 2YNCA 1B6BA 4B14A 2VQYA 4ORFA 4OAEA 1Y9KA 3CXPA 5J8FA 4JLYA 2DPTA 4CAXA 4AB7A 4UFXA 3DSBA 1WWZA 4A32A 2CNSA 4HNWB 4KOSA 1XMTA 4CAWA 4GS4A 4CYPA 1Z4RA 4FD4A 3V8IA 4CGOA 1S7NA 3I9SA 5DWNA 4KOTA 3S6FA 4R87A 4CAVA 5A28A 2D4OA 2DPSA 4MFQA 2FL4A 5ISVA 4C2XA 1YX0A 1L0CA 2Q7BA 4F6AA 3R9EA 3I3GA 2J8RA 1XIXA 4ZBGA 4CGMA 4C7IA 1QSTA 2Q4YA 2QECA 1V0CA 1IB1E 1QSMA 4EVYA 4PV6A 3MGDA 2Z3NA 2ZW6A 3W91A 1M1DA 1QSRA 4E8OA 5JQ4A 2VEZA 2OZUA 1M4DA 2RC4A 4ONUA 4E2AA 3TT2A 2ZW5A 1RXTA 3UY5A 5EBVA 2O28A 2FT0A 3R9FA 1P0HA 4C7HA 1VHSA 2R1IA 3FXTA 4NXYA 1KZFA 5C82A 4B5OA 1PUAA 4KOYA 4CS0B 4PK2A 3R1KA 4MY0A 2ARHA 4Q36A 5F48A 5G22A 3BJ8A 4KS9A 2HV2A 5BWAB 2FCKA 5AG4A 2WSAA 1QSNA 2CY2A 4M3SA 1GHEA 1YR0A 2FS5A 4XPDC 2OZGA 2B5GB 4Y49C 4R9MA 2REFA 2Q0YA 2PQ8A 3FIXA 2G0BA 4QC6A 1S7KA 3GY9A 2YNDA 4AG7A 4A2ZA 2WPXA 2QMLA 4CGNA 4AVCA 5G21A 4A30A 4MHDA 3ZJ0A 3TOAA 2R8VA 1M4GA 4XNHB 2BL1A 4FD7A 1TIQA 2KCWA 5KTCA 2C27A 3R9GA 2B58A 1Q2CA 3QB8A 2X7BA 1BOBA 3JUWA 2Q44A 2B3UA 3JTKA 2GE3A 3P2HA 3D3SA 4A95A 1MJAA 2OZHA 2FIAA 5IV0A 4XPKA 4UCMA 1WK4A 3F5BA 4UCNA 3DDDA 2F5IA 4KOWA 2P6EA 4KOXA 1FY7A 1Y7RA 3D8PA 1PU9A 2DXQA 3K9UA 4F0XA 4B10A 2OB0A 5A27A 1Q2YA 2Z11A 2FXFA 4CYNA 1YK3A 4KOVA 3A9LA 4CGLA 2Y0MA 1IICA 1IIDA 2FSRA 5J8CA 4UWIA 4KVME 2PSWA 1I21A 4LX9A 3TO9A 2I79A 3IU2A 4KVXA 2P6GA 4MBUA 3T90A 3T9YA 5JPHA 4KSAA 3RYOA 3E0KA 4QB9A 3IWGA 3ZZIA 2BUEA 4JJXA 2H5MA 4UCPA 4M85A 4U9ZA 1VKCA 4XPLA 1NE9A 4OLLA 3IU1A 4U9YA 2D4PA 1IYLA 1ZO0A 2ATRA 4UFVA 4OADA 5EC4A 1B87A 4HNYB 4KORA 4A31A 1YREA 1XF8A 3FRMA 1UFHA 1RO5A 3BLNA 4NF1A 4ZGYB 4JWPA 1J4JA 4KOUA 1Q2DA 1YGHA 1SQHA 1MJ9A 3JVNA 3DNSA 2B3VA 4JXQA 3PGPA 2IL4A 2R7HA 1KUYA 2VZZA 5E96A 4L89A 1NMTA 4MFJA 4KZTA 2B4DA 1U6MA 2Z3KA 1S60A 1K4JA 3LD2A 3EO4A 4X5KA 3TO6A 5F47A 4KLWA 4MJ8A 5F49A 2JDDA 3SXNA 4IF5A 2BSWA 3S6HA 2VZYA 3S6KA 4IUSA 2OH1A 4FD5A 4F0YA 4PSXA 2ZW4A 1MJBA 3TCVA 1ON0A 4MI4A 4UWJA 4Q38A 4NCZA 4HKFA 4LUAA 2Z3OA 1CJWA 4CRYB 4AVBA 4YRHA 2PC1A 2WUUA 3TOBA 1XE4A 2I00A 5H84A 4Y49B 1S7LA 3SHPA 5IB0A 1N71A 4CYOA 4CYQA 1I1DA 4H89A 5AG5A 2Z3LA 2REEA 4MFKA 3OWCA 4KSFA 1Y9WA 3N7ZA 1S3ZA 2YGWA 3TFYA 2FE7A 4QBJA 1BO4A 3CXQA 5H86A 1QSOA 4QUSA 4MFZA 4KVOE 4R3LA 4JD6A 4BMHA 4XNHC 3W6XA 4RI1A 1R57A 2J8MA 3EY5A 2GIVA 5KTDA 2R98A 4B5PB 3FYNA 1Z9UA 1S7FA 3B8GA 3C26A 4H6ZA 4DNCA 2J8NA 3R96A 2K5TA 1KUVA 1YVKA 3IWEA 4PSWA 4E0AA 2BEIA 5AGEA 4R57A 5IX3A 2HUZA 5C88A 3EC4A 1OZPA 4B5PA 3PP9A 4C2ZA 2JDCA 2CNMA 2P0WA 3TTHA 4CAFA 2QIRA 4KUBA 3EXNA 4MFPA 1LRZA 1M44A 2YNCC 3IGRA 3G8WA 2EVNA 5G20A 4B12A 2OU2A 2PR1A 2B5GA 2P6FA 5HH1A 5F46A 4II9A 2Z3PA 4UBRA 1KUXA 3QAHA 3D2MA 4XPDB 2CXAA 1YLEA 5G1ZA 4AG9A 4B11A 2Z10A 5I0CA 2EUIA 1P4NA 2VBQA 5AG7A 3LODA 4CGPA 2VI7A 1CM0A 2JEVA 5CNPA 4R3KA 4B13A 1Z4EA 4AVAA 3D2PA 3S6GA 4KUAA 3WR7A 5HMNA 4QVTA 2Q4VA 4FD6A 4KLVA 4UFWA 4A33A 4CRZB 3EFAA 1XEBA 4L8AA 3TO7A 2ZPAA 1I12A 4NSQA 4MFLA 1M4IA 2B4DB 3DR8A 4PK3A 3R95A 4UA3A 2CNTA 2PR8A 2Z3MA 4K30A 4HNXB 1MK4A 5AG6A 3SXOA 4J3GA 2AJ6A 3VWEA 2AE6A 3F8KA 2G3TA 2PRBA 4JXRA 3W6SA 4YGOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NEX A;  3FNC A;  1IYK A;  3NE7 A;  3FBU A;  3GYA A;  5FVJ A;  4YFJ A;  2Z0Z A;  5GCN A;  3KKW A;  2ZW7 A;  2G3A A;  3G3S A;  2VXK A;  3BJ7 A;  4MY3 A;  2A4N A;  4H6U A;  3CXS A;  3F0A A;  3GKR A;  2GAN A;  2B4B A;  2NMT A;  1YVO A;  3DR6 A;  2FIW A;  4RS2 A;  3H4Q A;  1NSL A;  3TE4 A;  2Q04 A;  5DWM A;  2JLM A;  3P2F A;  2ZXV A;  3PZJ A;  3VWD A;  3FB3 A;  2HQY A;  2PDO A;  4I49 A;  1S5K A;  4U5Y A;  5KTA A;  2WPW A;  1B6B A;  2VQY A;  4ORF A;  4OAE A;  1Y9K A;  3CXP A;  5J8F A;  4JLY A;  4CAX A;  4AB7 A;  3DSB A;  1WWZ A;  2CNS A;  4HNW B;  4KOS A;  1XMT A;  4CAW A;  4GS4 A;  1Z4R A;  4FD4 A;  3V8I A;  1S7N A;  3I9S A;  5DWN A;  4KOT A;  3S6F A;  4R87 A;  4CAV A;  2D4O A;  2FL4 A;  5ISV A;  1YX0 A;  1L0C A;  2Q7B A;  4F6A A;  3R9E A;  3I3G A;  2J8R A;  1XIX A;  4ZBG A;  1QST A;  2Q4Y A;  2QEC A;  1V0C A;  1IB1 E;  1QSM A;  4EVY A;  4PV6 A;  3MGD A;  2ZW6 A;  3W91 A;  1M1D A;  1QSR A;  4E8O A;  5JQ4 A;  2VEZ A;  2OZU A;  1M4D A;  2RC4 A;  4ONU A;  4E2A A;  3TT2 A;  2ZW5 A;  1RXT A;  3UY5 A;  5EBV A;  2O28 A;  2FT0 A;  3R9F A;  1P0H A;  1VHS A;  2R1I A;  3FXT A;  4NXY A;  1KZF A;  5C82 A;  4B5O A;  1PUA A;  4KOY A;  4CS0 B;  4PK2 A;  3R1K A;  4MY0 A;  2ARH A;  5F48 A;  3BJ8 A;  2HV2 A;  2FCK A;  1QSN A;  2CY2 A;  4M3S A;  1GHE A;  1YR0 A;  2FS5 A;  4XPD C;  2OZG A;  2B5G B;  4Y49 C;  4R9M A;  2REF A;  2Q0Y A;  2PQ8 A;  3FIX A;  2G0B A;  4QC6 A;  1S7K A;  3GY9 A;  4AG7 A;  2WPX A;  2QML A;  4AVC A;  4MHD A;  3ZJ0 A;  3TOA A;  2R8V A;  1M4G A;  4XNH B;  2BL1 A;  4FD7 A;  1TIQ A;  2KCW A;  5KTC A;  2C27 A;  3R9G A;  2B58 A;  1Q2C A;  3QB8 A;  2X7B A;  1BOB A;  3JUW A;  2Q44 A;  2B3U A;  2GE3 A;  3P2H A;  3D3S A;  1MJA A;  2OZH A;  2FIA A;  5IV0 A;  4XPK A;  1WK4 A;  3F5B A;  3DDD A;  2F5I A;  4KOW A;  2P6E A;  4KOX A;  1FY7 A;  1Y7R A;  3D8P A;  1PU9 A;  2DXQ A;  3K9U A;  2OB0 A;  1Q2Y A;  2Z11 A;  2FXF A;  1YK3 A;  4KOV A;  2Y0M A;  1IIC A;  1IID A;  2FSR A;  5J8C A;  4UWI A;  4KVM E;  2PSW A;  1I21 A;  4LX9 A;  3TO9 A;  2I79 A;  4KVX A;  2P6G A;  4MBU A;  3T90 A;  3T9Y A;  5JPH A;  3RYO A;  3E0K A;  4QB9 A;  3IWG A;  3ZZI A;  2BUE A;  4JJX A;  2H5M A;  4M85 A;  4U9Z A;  1VKC A;  4XPL A;  1NE9 A;  4OLL A;  4U9Y A;  2D4P A;  1IYL A;  2ATR A;  4OAD A;  5EC4 A;  1B87 A;  4HNY B;  4KOR A;  1YRE A;  1XF8 A;  3FRM A;  1UFH A;  1RO5 A;  3BLN A;  4NF1 A;  4JWP A;  1J4J A;  4KOU A;  1Q2D A;  1YGH A;  1SQH A;  1MJ9 A;  3JVN A;  3DNS A;  2B3V A;  4JXQ A;  3PGP A;  2IL4 A;  2R7H A;  1KUY A;  2VZZ A;  5E96 A;  4L89 A;  1NMT A;  4KZT A;  2B4D A;  1U6M A;  1S60 A;  1K4J A;  3LD2 A;  3EO4 A;  4X5K A;  3TO6 A;  5F47 A;  4KLW A;  4MJ8 A;  5F49 A;  2JDD A;  3SXN A;  4IF5 A;  2BSW A;  3S6H A;  2VZY A;  3S6K A;  4IUS A;  2OH1 A;  4FD5 A;  4F0Y A;  4PSX A;  2ZW4 A;  1MJB A;  3TCV A;  1ON0 A;  4MI4 A;  4UWJ A;  4NCZ A;  4HKF A;  4LUA A;  1CJW A;  4CRY B;  4AVB A;  4YRH A;  2PC1 A;  3TOB A;  1XE4 A;  2I00 A;  5H84 A;  4Y49 B;  1S7L A;  3SHP A;  5IB0 A;  1N71 A;  1I1D A;  4H89 A;  2REE A;  3OWC A;  1Y9W A;  3N7Z A;  1S3Z A;  3TFY A;  2FE7 A;  4QBJ A;  1BO4 A;  3CXQ A;  5H86 A;  1QSO A;  4QUS A;  4KVO E;  4R3L A;  4JD6 A;  4BMH A;  4XNH C;  3W6X A;  4RI1 A;  1R57 A;  2J8M A;  3EY5 A;  2GIV A;  5KTD A;  2R98 A;  4B5P B;  3FYN A;  1Z9U A;  1S7F A;  3B8G A;  3C26 A;  4H6Z A;  4DNC A;  2J8N A;  3R96 A;  2K5T A;  1KUV A;  1YVK A;  4PSW A;  4E0A A;  2BEI A;  4R57 A;  5IX3 A;  2HUZ A;  5C88 A;  3EC4 A;  1OZP A;  4B5P A;  3PP9 A;  2JDC A;  2CNM A;  2P0W A;  3TTH A;  2QIR A;  4KUB A;  3EXN A;  1LRZ A;  1M44 A;  3IGR A;  3G8W A;  2EVN A;  2OU2 A;  2PR1 A;  2B5G A;  2P6F A;  5HH1 A;  5F46 A;  4II9 A;  4UBR A;  1KUX A;  3QAH A;  3D2M A;  4XPD B;  1YLE A;  4AG9 A;  2Z10 A;  5I0C A;  2EUI A;  1P4N A;  2VBQ A;  3LOD A;  2VI7 A;  1CM0 A;  2JEV A;  5CNP A;  4R3K A;  1Z4E A;  4AVA A;  3D2P A;  3S6G A;  4KUA A;  3WR7 A;  5HMN A;  4QVT A;  2Q4V A;  4FD6 A;  4KLV A;  4CRZ B;  3EFA A;  1XEB A;  4L8A A;  3TO7 A;  2ZPA A;  1I12 A;  4NSQ A;  1M4I A;  2B4D B;  3DR8 A;  4PK3 A;  3R95 A;  4UA3 A;  2CNT A;  2PR8 A;  4K30 A;  4HNX B;  1MK4 A;  3SXO A;  4J3G A;  2AJ6 A;  3VWE A;  2AE6 A;  3F8K A;  2G3T A;  2PRB A;  4JXR A;  3W6S A;  4YGO A; 
#chains in the Genus database with same CATH topology
 4WWV A;  4C2Y A;  4C68 A;  3FX6 A;  2DEA A;  3FNC A;  4NEX A;  3LWU A;  5CPA A;  1IYK A;  3B3S A;  4CAE A;  3H5Z A;  2RB7 A;  3NE7 A;  2PVW A;  1HDU A;  3QAY A;  4UEF A;  4OC2 A;  3FBU A;  3GYA A;  5FVJ A;  4YFJ A;  2Z0Z A;  5GCN A;  3FED A;  3KKW A;  1ARL A;  2GRE A;  4NJQ A;  1YW4 A;  2ZW7 A;  2YNE A;  4A37 A;  3CDX A;  5K8O A;  2G3A A;  3G3S A;  2VXK A;  3BJ7 A;  4AXV A;  4MY3 A;  3PBB A;  2A4N A;  4UIB A;  4H6U A;  1ELM P;  3WC5 A;  2C6G A;  3KHZ A;  3CXS A;  4F9V A;  4H2K A;  3F0A A;  3GKR A;  3WC6 A;  2GAN A;  3BI0 A;  2B4B A;  2NMT A;  1YVO A;  2FIW A;  3DR6 A;  4RS2 A;  3H4Q A;  1NSL A;  4TNU A;  5D29 A;  1FNO A;  3TE4 A;  2Q04 A;  5DWM A;  3CPA A;  2PE3 A;  4OID A;  2JLM A;  3P2F A;  2ZXV A;  2XEI A;  4IAV A;  2G9D A;  3IEH A;  3PZJ A;  3FB3 A;  1Z2L A;  4NGN A;  3VWD A;  2HQY A;  2PDO A;  4I49 A;  1S5K A;  4U5Y A;  4BBH A;  5KTA A;  1Z8W A;  2WPW A;  2YNC A;  3FEE A;  3PFO A;  1B6B A;  2PCU A;  2PJ1 A;  4B14 A;  3VH9 A;  2VQY A;  3DLJ A;  4ORF A;  4OAE A;  1Y9K A;  3CXP A;  5J8F A;  4JLY A;  1XOV A;  2DPT A;  2ZEH A;  3ISX A;  2PJB A;  4CAX A;  2F8H A;  3KAS A;  4UFX A;  3DSB A;  1WWZ A;  4A32 A;  3KI9 A;  4AB7 A;  8CPA A;  2CNS A;  4HNW B;  4TWE A;  4KOS A;  4X8I A;  1XMT A;  4CAW A;  4GS4 A;  4CYP A;  1Z4R A;  4FD4 A;  3V8I A;  1LAM A;  1QQ9 A;  3RAM A;  4CGO A;  1S7N A;  3I9S A;  5DWN A;  4KOT A;  3S6F A;  2PJ5 A;  3S9N A;  2O53 A;  1CBX A;  4R87 A;  4CAV A;  5LYD A;  1ARM A;  5A28 A;  2D4O A;  4NGM A;  4CPA A;  1X12 A;  2DPS A;  3B2Y A;  4MHP A;  4MFQ A;  1IY7 A;  2FL4 A;  4OC4 A;  5ISV A;  3IWW A;  4C2X A;  1VIX A;  1YX0 A;  1L0C A;  2Q7B A;  4F6A A;  3R9E A;  3I3G A;  2J8R A;  1XJO A;  1XIX A;  4MCP A;  1NSA A;  4EME A;  2CF4 A;  4ZBG A;  4CGM A;  4C7I A;  1QST A;  3FF3 A;  4ZI6 A;  1VGY A;  2Q4Y A;  2QEC A;  3ISZ A;  1V0C A;  1IB1 E;  1QSM A;  4RUH A;  4O23 A;  2AFU A;  4PV6 A;  3MGD A;  2Z3N A;  2ZW6 A;  3W91 A;  1M1D A;  4EVY A;  1QSR A;  4E8O A;  1AUG A;  3H8G A;  1LOK A;  5JQ4 A;  1VHE A;  3D7F A;  5JM6 A;  2VEZ A;  2OZU A;  3PBE A;  1M4D A;  3IO1 A;  2RC4 A;  4GXH A;  4ONU A;  1ELL P;  4E2A A;  3NH8 A;  3TT2 A;  2RFH A;  2ZW5 A;  1RXT A;  3UY5 A;  4ZX9 A;  5EBV A;  4ZY0 A;  1IOI A;  1XMB A;  2NYQ A;  2O28 A;  2CTB A;  1R43 A;  3B35 A;  2FT0 A;  3B3W A;  3PEI A;  3R9F A;  5K8N A;  1P0H A;  4C7H A;  1VHS A;  2R1I A;  3FXT A;  4NXY A;  1LFW A;  1KZF A;  3K2K A;  5CBM A;  1Z8X A;  5C82 A;  1PCA A;  4B5O A;  6CPA A;  1PUA A;  3NH5 A;  4KOY A;  3BI1 A;  4NGS A;  4CS0 B;  4PK2 A;  1TF8 A;  1Z8T A;  3R1K A;  4MY0 A;  3VAR A;  3KR4 A;  2ARH A;  1KWM A;  2V8V A;  4Q36 A;  5F48 A;  3B3C A;  3BJ8 A;  4KS9 A;  5G22 A;  2HV2 A;  5BWA B;  4BD9 A;  5K8M A;  4NGT A;  2FCK A;  4IK2 A;  2WSA A;  5AG4 A;  1QSN A;  3H8E A;  2ZEM A;  2QJ8 A;  2CY2 A;  4M3S A;  1F2O A;  1GHE A;  1YR0 A;  2FS5 A;  2PJ6 A;  4XPD C;  2OZG A;  1TF9 A;  3JRU A;  4M6I A;  5HVF A;  2B5G B;  4OKO A;  4Y49 C;  4R9M A;  2FVG A;  2REF A;  5DS0 A;  1XFO A;  2Q0Y A;  2PQ8 A;  3FIX A;  2PJ7 A;  2G0B A;  3L2N A;  4FWU A;  4QC6 A;  3SJF A;  1S7K A;  4W9Y A;  3GY9 A;  2HC9 A;  2YND A;  4AG7 A;  4A2Z A;  2WPX A;  2QML A;  3IFE A;  4CGN A;  4AVC A;  2BOA A;  5G21 A;  3RNZ A;  4P4F A;  4A30 A;  4A38 A;  3KQX A;  3KHX A;  4JZ0 A;  4P10 A;  4LQG A;  1YQE A;  1QMU A;  3PB9 X;  4MHD A;  3ZJ0 A;  3TOA A;  2R8V A;  2JBK A;  1M4G A;  4XNH B;  1PYT B;  2BL1 A;  4UIA A;  2EO8 A;  4FD7 A;  1TIQ A;  2C6P A;  3IJ3 A;  2KCW A;  2VL1 A;  5KTC A;  2C27 A;  3R9G A;  5EMI A;  2B58 A;  2PJ2 A;  2ZEF A;  4M6G A;  2OR4 A;  3NA6 A;  1Q2C A;  2IJZ A;  3QB8 A;  3RBU A;  2PJA A;  1BOB A;  2X7B A;  3JUW A;  4KSI A;  1XRY A;  2Q44 A;  2B3U A;  3JTK A;  1FT7 A;  4OIW A;  2XEG A;  5THW A;  4DJL A;  2GE3 A;  3P2H A;  3D3S A;  4A95 A;  5HVG A;  1MJA A;  3FH4 A;  1BPN A;  2CIJ A;  2OZH A;  2FIA A;  5IV0 A;  4BIN A;  4XPK A;  4UCM A;  1WK4 A;  3F5B A;  2EWB A;  4UCN A;  3DDD A;  2F5I A;  2GLJ A;  4KOW A;  4P6Y A;  2PIZ A;  4P4D A;  3TX8 A;  4P4J A;  2P6E A;  1FY7 A;  4KOX A;  4YWY A;  1Y7R A;  3D8P A;  1PU9 A;  2DXQ A;  3K9U A;  4DYO A;  4B6Z A;  4F0X A;  4B10 A;  5K8P A;  2OB0 A;  5A27 A;  1Q2Y A;  2Z11 A;  2FXF A;  2ZEN A;  1ZLH A;  2ZOF A;  4K3N A;  4ONW A;  3GIU A;  2Q51 A;  4CYN A;  1Z8L A;  1YK3 A;  2JBJ A;  4KOV A;  3S9M A;  4FAI A;  3NE8 A;  3IC1 A;  3A9L A;  3FEC A;  4CGL A;  2Y0M A;  1IIC A;  1IID A;  2FSR A;  5J8C A;  4UWI A;  4KVM E;  2PSW A;  1I21 A;  2F7V A;  4LX9 A;  3TO9 A;  2I79 A;  3IU2 A;  1RTQ A;  2ANP A;  4KVX A;  2P6G A;  4MBU A;  4PXD A;  4R8F A;  3T90 A;  3T9Y A;  5JPH A;  4KSA A;  2ZEE A;  4NGQ A;  4M6H A;  2GU2 A;  4Q7A A;  3RYO A;  3E0K A;  1M4L A;  4QB9 A;  2GFQ A;  3IWG A;  3FVL A;  3WC7 A;  1ZG8 A;  3ZZI A;  2BUE A;  1BPM A;  1CG2 A;  1CPS A;  4JJX A;  1LAN A;  2H5M A;  3N5F A;  2V8H A;  3H8F A;  4MCQ A;  4M85 A;  4UCP A;  4NGP A;  1LCP A;  1CX8 A;  1VKC A;  4U9Z A;  4XPL A;  1NE9 A;  4OLL A;  1IGB A;  1R3N A;  3IU1 A;  3DGV A;  4U9Y A;  2D4P A;  5LRJ A;  3WT4 A;  1IYL A;  1ZO0 A;  2ATR A;  4UFV A;  3PFE A;  2AFX A;  3FJU A;  4OAD A;  5EC4 A;  1B87 A;  2V8D A;  4HNY B;  4KOR A;  4A31 A;  1YRE A;  1XF8 A;  2PJC A;  3FRM A;  1UFH A;  3HUV A;  1RO5 A;  3BLN A;  4FUU A;  1YLO A;  4NF1 A;  4ZGY B;  3QNV A;  2PJ4 A;  4JWP A;  1Q7L A;  2JEW A;  1OBR A;  3VAT A;  1J4J A;  5JH9 A;  1JWQ A;  2XEF A;  4KOU A;  1Q2D A;  1IU8 A;  3SJE A;  1YGH A;  1SQH A;  1MJ9 A;  3JVN A;  3DNS A;  2B3V A;  4JXQ A;  3KZW A;  3PGP A;  2J9A A;  2GLF A;  2V8G A;  5LYL A;  3B3V A;  5LRG A;  2ZEO A;  2IL4 A;  2R7H A;  1KUY A;  2VZZ A;  3CZX A;  3PB7 X;  2ZEP A;  4YU9 A;  4NFR A;  5E96 A;  5HXD A;  4L89 A;  1NMT A;  4MFJ A;  4KZT A;  3SJG A;  2B4D A;  1U6M A;  2Z3K A;  1S60 A;  3K9T A;  1K4J A;  4P4B A;  3LD2 A;  3EO4 A;  4X5K A;  3TO6 A;  5F47 A;  4KLW A;  2XEJ A;  4MJ8 A;  2JDD A;  4PXE A;  5F49 A;  3SXN A;  4IF5 A;  2BSW A;  3PB8 X;  3S6H A;  2VZY A;  3S6K A;  1LAP A;  2OH1 A;  4FD5 A;  4IUS A;  4R7M A;  4F0Y A;  4PSX A;  2ZW4 A;  1MJB A;  2ZEL A;  3TCV A;  1BLL E;  1ON0 A;  1JQG A;  2AFO A;  4MI4 A;  4Q38 A;  3KL9 A;  4UWJ A;  3TC8 A;  4LQ6 A;  2WZN A;  4NCZ A;  4HKF A;  4LUA A;  2Z3O A;  1CJW A;  1TKF A;  5J1Q A;  4CRY B;  4AVB A;  4YRH A;  4EWT A;  4OP4 A;  2PC1 A;  1HDQ A;  2WUU A;  3TOB A;  1XE4 A;  1CP7 A;  2I00 A;  5H84 A;  2AFM A;  1VHO A;  4A94 A;  4Y49 B;  3IIB A;  1S7L A;  2HB6 A;  2POK A;  3SHP A;  1AYE A;  5IB0 A;  4FBE A;  1N71 A;  3KR5 A;  4CYO A;  4CYQ A;  1ZG7 A;  1I1D A;  4H89 A;  4F9U A;  5AG5 A;  2Z3L A;  4ZY1 A;  2REE A;  3CPX A;  4MFK A;  2WYR A;  3OWC A;  4KSF A;  3FMC A;  1Y9W A;  3N7Z A;  1S3Z A;  2YGW A;  3D4U A;  3TFY A;  1A2Z A;  2FE7 A;  2PVV A;  4QBJ A;  4PQA A;  5IB9 A;  1BO4 A;  3CXQ A;  3D7D A;  5H86 A;  1QSO A;  4QUS A;  1H8L A;  4KVO E;  4MFZ A;  4MHZ A;  1Y0Y A;  3NH4 A;  3B3T A;  4R3L A;  4JD6 A;  4BMH A;  4XNH C;  3RO0 A;  3SJX A;  3W6X A;  4Z65 A;  3PRT A;  4RI1 A;  1R57 A;  2I3C A;  4JYW A;  2O4H A;  2J8M A;  3PB6 X;  3EY5 A;  3V38 A;  7CPA A;  2GIV A;  5KTD A;  3GB0 A;  5LRK A;  2R98 A;  4B5P B;  2Q43 A;  4ZX8 A;  2ZED A;  3FYN A;  1Z9U A;  1S7F A;  3HLP A;  3B8G A;  3C26 A;  4MXU A;  5D8N A;  4H6Z A;  3KGQ A;  1TKH A;  2EK8 A;  2V77 A;  4PXB A;  3S9L A;  3NFZ A;  4DNC A;  2J8N A;  3R96 A;  2K5T A;  2NSM A;  4MCS A;  1KUV A;  2PJ9 A;  2C1C A;  1YVK A;  3IWE A;  4PSW A;  3GUX A;  2BEI A;  1CPX A;  4E0A A;  3CT9 A;  5LYF A;  5AGE A;  4R57 A;  5IX3 A;  2HUZ A;  1HEE A;  5C88 A;  1ZLI A;  3EC4 A;  1OZP A;  3LAC A;  4MRI A;  4YGO A;  1IOF A;  5ELY A;  3MN8 A;  2ZOG A;  4EFD A;  4MCR A;  4B5P A;  2DF5 A;  4X3R A;  1X10 A;  3PP9 A;  3D66 A;  3RZA A;  4C2Z A;  4MHN A;  2JDC A;  5I4M A;  2CNM A;  1TKJ A;  4MHY A;  2P0W A;  2ODF A;  2QYV A;  3TTH A;  2Q7S A;  1EE3 P;  3T8W A;  2EK9 A;  3D7G A;  4CAF A;  2QIR A;  1BAV A;  3SI2 A;  2AFZ A;  4KUB A;  3EXN A;  4MFP A;  1LRZ A;  1M44 A;  4P4I A;  1CP6 A;  1Y7E A;  2YNC C;  3IGR A;  3G8W A;  2EVN A;  4P4E A;  5G20 A;  4P44 A;  4OC1 A;  4B12 A;  1DE4 C;  2OU2 A;  2PJ3 A;  2PR1 A;  2B5G A;  2P6F A;  4OC0 A;  5HH1 A;  3SI0 A;  5F46 A;  4UEZ A;  4II9 A;  2Z3P A;  4UBR A;  4OME A;  1KUX A;  3QAH A;  3D2M A;  4XPD B;  2CXA A;  1YLE A;  3D7H A;  5G1Z A;  4AG9 A;  4B11 A;  3SI1 A;  2Z10 A;  5I0C A;  2EUI A;  1P4N A;  2VBQ A;  3D67 A;  5AG7 A;  3LOD A;  5HVH A;  4CGP A;  2VI7 A;  1CM0 A;  4IHM A;  4NGR A;  1F57 A;  2JEV A;  1XBU A;  1Z5R A;  1GYT A;  5CNP A;  4R3K A;  4B13 A;  2C6C A;  1Z4E A;  5JGF A;  3LMS A;  4HPS A;  4AVA A;  3D2P A;  1YW6 A;  1ZG9 A;  3S6G A;  2Q4Z A;  3PB4 X;  4KUA A;  4OC3 A;  1YME A;  2AFS A;  2EBJ A;  2QVP A;  2AFW A;  4QVT A;  4UF4 A;  3WAB A;  3WR7 A;  4A39 A;  5HMN A;  2Q4V A;  4FD6 A;  4KLV A;  4NJR A;  2ZEG A;  4GM5 A;  4UFW A;  4A33 A;  4CRZ B;  3EFA A;  4ZYQ A;  1XEB A;  3KQZ A;  2BO9 A;  2IQ6 A;  2ABZ A;  4L8A A;  4OC5 A;  2ZPA A;  2IMO A;  3TO7 A;  1I12 A;  2PIY A;  4NSQ A;  2PJ0 A;  3MRU A;  4ZY2 A;  1TXR A;  4UEE A;  4X2T A;  2PJ8 A;  3D68 A;  2PRQ A;  4G1P A;  4PPZ A;  2OOT A;  4MFL A;  1M4I A;  4PXC A;  2B4D B;  2CTC A;  3DR8 A;  4MMO A;  4PK3 A;  5LYI A;  3R95 A;  1YSJ A;  4DUK A;  4UA3 A;  3V7Z A;  2CNT A;  2PR8 A;  3GLJ A;  4R6T A;  1AMP A;  1F2P A;  2Z3M A;  4K30 A;  4HNX B;  1Y0R A;  2BCO A;  1MK4 A;  5AG6 A;  3SXO A;  4J3G A;  3BHX A;  2AJ6 A;  5F09 A;  3BXM A;  4P45 A;  4F8Z A;  3VWE A;  2AE6 A;  3B7I A;  3I1U A;  1UWY A;  4R76 A;  3F8K A;  4WJB A;  4RN7 A;  2G3T A;  2PRB A;  4JXR A;  3W6S A;  1DTD A; 
#chains in the Genus database with same CATH homology
 4C2Y A;  4C68 A;  4NEX A;  3FNC A;  1IYK A;  4CAE A;  3H5Z A;  3NE7 A;  3FBU A;  3GYA A;  5FVJ A;  4YFJ A;  2Z0Z A;  5GCN A;  3KKW A;  2ZW7 A;  2YNE A;  2G3A A;  3G3S A;  2VXK A;  3BJ7 A;  4MY3 A;  2A4N A;  4H6U A;  3CXS A;  3F0A A;  3GKR A;  2GAN A;  2B4B A;  2NMT A;  1YVO A;  3DR6 A;  2FIW A;  4RS2 A;  3H4Q A;  1NSL A;  3TE4 A;  2Q04 A;  5DWM A;  2JLM A;  3P2F A;  2ZXV A;  3PZJ A;  3VWD A;  3FB3 A;  2HQY A;  2PDO A;  4I49 A;  1S5K A;  4U5Y A;  4BBH A;  5KTA A;  2WPW A;  2YNC A;  1B6B A;  4B14 A;  2VQY A;  4ORF A;  4OAE A;  1Y9K A;  3CXP A;  5J8F A;  4JLY A;  2DPT A;  4CAX A;  4AB7 A;  4UFX A;  3DSB A;  1WWZ A;  4A32 A;  2CNS A;  4HNW B;  4KOS A;  1XMT A;  4CAW A;  4GS4 A;  4CYP A;  1Z4R A;  4FD4 A;  3V8I A;  4CGO A;  1S7N A;  3I9S A;  5DWN A;  4KOT A;  3S6F A;  4R87 A;  4CAV A;  5A28 A;  2D4O A;  2DPS A;  4MFQ A;  2FL4 A;  5ISV A;  4C2X A;  1YX0 A;  1L0C A;  2Q7B A;  4F6A A;  3R9E A;  3I3G A;  2J8R A;  1XIX A;  4ZBG A;  4CGM A;  4C7I A;  1QST A;  2Q4Y A;  2QEC A;  1V0C A;  1IB1 E;  1QSM A;  4EVY A;  4PV6 A;  3MGD A;  2Z3N A;  2ZW6 A;  3W91 A;  1M1D A;  1QSR A;  4E8O A;  5JQ4 A;  2VEZ A;  2OZU A;  1M4D A;  2RC4 A;  4ONU A;  4E2A A;  3TT2 A;  2ZW5 A;  1RXT A;  3UY5 A;  5EBV A;  2O28 A;  2FT0 A;  3R9F A;  1P0H A;  4C7H A;  1VHS A;  2R1I A;  3FXT A;  4NXY A;  1KZF A;  5C82 A;  4B5O A;  1PUA A;  4KOY A;  4CS0 B;  4PK2 A;  3R1K A;  4MY0 A;  2ARH A;  4Q36 A;  5F48 A;  5G22 A;  3BJ8 A;  4KS9 A;  2HV2 A;  5BWA B;  2FCK A;  5AG4 A;  2WSA A;  1QSN A;  2CY2 A;  4M3S A;  1GHE A;  1YR0 A;  2FS5 A;  4XPD C;  2OZG A;  2B5G B;  4Y49 C;  4R9M A;  2REF A;  2Q0Y A;  2PQ8 A;  3FIX A;  2G0B A;  4QC6 A;  1S7K A;  3GY9 A;  2YND A;  4AG7 A;  4A2Z A;  2WPX A;  2QML A;  4CGN A;  4AVC A;  5G21 A;  4A30 A;  4MHD A;  3ZJ0 A;  3TOA A;  2R8V A;  1M4G A;  4XNH B;  2BL1 A;  4FD7 A;  1TIQ A;  2KCW A;  5KTC A;  2C27 A;  3R9G A;  2B58 A;  1Q2C A;  3QB8 A;  2X7B A;  1BOB A;  3JUW A;  2Q44 A;  2B3U A;  3JTK A;  2GE3 A;  3P2H A;  3D3S A;  4A95 A;  1MJA A;  2OZH A;  2FIA A;  5IV0 A;  4XPK A;  4UCM A;  1WK4 A;  3F5B A;  4UCN A;  3DDD A;  2F5I A;  4KOW A;  2P6E A;  4KOX A;  1FY7 A;  1Y7R A;  3D8P A;  1PU9 A;  2DXQ A;  3K9U A;  4F0X A;  4B10 A;  2OB0 A;  5A27 A;  1Q2Y A;  2Z11 A;  2FXF A;  4CYN A;  1YK3 A;  4KOV A;  3A9L A;  4CGL A;  2Y0M A;  1IIC A;  1IID A;  2FSR A;  5J8C A;  4UWI A;  4KVM E;  2PSW A;  1I21 A;  4LX9 A;  3TO9 A;  2I79 A;  3IU2 A;  4KVX A;  2P6G A;  4MBU A;  3T90 A;  3T9Y A;  5JPH A;  4KSA A;  3RYO A;  3E0K A;  4QB9 A;  3IWG A;  3ZZI A;  2BUE A;  4JJX A;  2H5M A;  4UCP A;  4M85 A;  4U9Z A;  1VKC A;  4XPL A;  1NE9 A;  4OLL A;  3IU1 A;  4U9Y A;  2D4P A;  1IYL A;  1ZO0 A;  2ATR A;  4UFV A;  4OAD A;  5EC4 A;  1B87 A;  4HNY B;  4KOR A;  4A31 A;  1YRE A;  1XF8 A;  3FRM A;  1UFH A;  1RO5 A;  3BLN A;  4NF1 A;  4ZGY B;  4JWP A;  1J4J A;  4KOU A;  1Q2D A;  1YGH A;  1SQH A;  1MJ9 A;  3JVN A;  3DNS A;  2B3V A;  4JXQ A;  3PGP A;  2IL4 A;  2R7H A;  1KUY A;  2VZZ A;  5E96 A;  4L89 A;  1NMT A;  4MFJ A;  4KZT A;  2B4D A;  1U6M A;  2Z3K A;  1S60 A;  1K4J A;  3LD2 A;  3EO4 A;  4X5K A;  3TO6 A;  5F47 A;  4KLW A;  4MJ8 A;  5F49 A;  2JDD A;  3SXN A;  4IF5 A;  2BSW A;  3S6H A;  2VZY A;  3S6K A;  4IUS A;  2OH1 A;  4FD5 A;  4F0Y A;  4PSX A;  2ZW4 A;  1MJB A;  3TCV A;  1ON0 A;  4MI4 A;  4UWJ A;  4Q38 A;  4NCZ A;  4HKF A;  4LUA A;  2Z3O A;  1CJW A;  4CRY B;  4AVB A;  4YRH A;  2PC1 A;  2WUU A;  3TOB A;  1XE4 A;  2I00 A;  5H84 A;  4Y49 B;  1S7L A;  3SHP A;  5IB0 A;  1N71 A;  4CYO A;  4CYQ A;  1I1D A;  4H89 A;  5AG5 A;  2Z3L A;  2REE A;  4MFK A;  3OWC A;  4KSF A;  1Y9W A;  3N7Z A;  1S3Z A;  2YGW A;  3TFY A;  2FE7 A;  4QBJ A;  1BO4 A;  3CXQ A;  5H86 A;  1QSO A;  4QUS A;  4MFZ A;  4KVO E;  4R3L A;  4JD6 A;  4BMH A;  4XNH C;  3W6X A;  4RI1 A;  1R57 A;  2J8M A;  3EY5 A;  2GIV A;  5KTD A;  2R98 A;  4B5P B;  3FYN A;  1Z9U A;  1S7F A;  3B8G A;  3C26 A;  4H6Z A;  4DNC A;  2J8N A;  3R96 A;  2K5T A;  1KUV A;  1YVK A;  3IWE A;  4PSW A;  4E0A A;  2BEI A;  5AGE A;  4R57 A;  5IX3 A;  2HUZ A;  5C88 A;  3EC4 A;  1OZP A;  4B5P A;  3PP9 A;  4C2Z A;  2JDC A;  2CNM A;  2P0W A;  3TTH A;  4CAF A;  2QIR A;  4KUB A;  3EXN A;  4MFP A;  1LRZ A;  1M44 A;  2YNC C;  3IGR A;  3G8W A;  2EVN A;  5G20 A;  4B12 A;  2OU2 A;  2PR1 A;  2B5G A;  2P6F A;  5HH1 A;  5F46 A;  4II9 A;  2Z3P A;  4UBR A;  1KUX A;  3QAH A;  3D2M A;  4XPD B;  2CXA A;  1YLE A;  5G1Z A;  4AG9 A;  4B11 A;  2Z10 A;  5I0C A;  2EUI A;  1P4N A;  2VBQ A;  5AG7 A;  3LOD A;  4CGP A;  2VI7 A;  1CM0 A;  2JEV A;  5CNP A;  4R3K A;  4B13 A;  1Z4E A;  4AVA A;  3D2P A;  3S6G A;  4KUA A;  3WR7 A;  5HMN A;  4QVT A;  2Q4V A;  4FD6 A;  4KLV A;  4UFW A;  4A33 A;  4CRZ B;  3EFA A;  1XEB A;  4L8A A;  3TO7 A;  2ZPA A;  1I12 A;  4NSQ A;  4MFL A;  1M4I A;  2B4D B;  3DR8 A;  4PK3 A;  3R95 A;  4UA3 A;  2CNT A;  2PR8 A;  2Z3M A;  4K30 A;  4HNX B;  1MK4 A;  5AG6 A;  3SXO A;  4J3G A;  2AJ6 A;  3VWE A;  2AE6 A;  3F8K A;  2G3T A;  2PRB A;  4JXR A;  3W6S A;  4YGO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...