1M4GA

Aminoglycoside 2'-n-acetyltransferase from mycobacterium tuberculosis-complex with coenzyme a and ribostamycin
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
181
structure length
181
Chain Sequence
MHTQVHTARLVHTADLDSETRQDIRQMVTGAFAGDFTETDWEHTLGGMHALIWHHGAIIAHAAVIQRRLIYRGNALRCGYVEGVAVRADWRGQRLVSALLDAVEQVMRGAYQLGALSSSARARRLYASRGWLPWHGPTSVLAPTGPVRTPDDDGTVFVLPIDISLDTSAELMCDWRAGDVW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aminoglycoside 2'-N-acetyltransferase
publication title Aminoglycoside 2'-N-acetyltransferase from Mycobacterium tuberculosis in complex with coenzyme A and aminoglycoside substrates.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 54
structure length 181
sequence length 181
chains with identical sequence B
ec nomenclature ec 2.3.1.-:
pdb deposition date 2002-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13527 Acetyltransf_9 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1m4gA00
3D3SA 3R1KA 3BJ8A 3T9YA 4JD6A 1YLEA 4JXRA 2DXQA 4IF5A 4U9YA 3TOAA 2Z10A 4BMHA 3LODA 5H86A 2I00A 2PQ8A 3ZZIA 3VWDA 3NE7A 3G3SA 1YX0A 3EY5A 1Z4RA 3P2FA 1U6MA 1WWZA 2B3UA 2WPWA 4PSWA 4HKFA 4R57A 2B4DB 4KOUA 4M3SA 1OZPA 4OLLA 2D4PA 1M1DA 2GANA 2REFA 1BO4A 4AG9A 2HQYA 2Q0YA 4CS0B 4UA3A 5HMNA 2O28A 3EXNA 4KORA 3T90A 4AVAA 4NF1A 4R9MA 4IUSA 1VHSA 4CAVA 1IYKA 2FIWA 1KUYA 4MHDA 2G3AA 1NSLA 4KVXA 5HH1A 1QSRA 3BLNA 3IWGA 2ARHA 5DWMA 4KOSA 3GKRA 2I79A 4JJXA 1BOBA 2D4OA 2Q4YA 4NXYA 3N7ZA 2JDCA 3R95A 3MGDA 3TT2A 1I21A 2FE7A 3S6KA 3PP9A 2H5MA 3DR6A 2Q4VA 2B4BA 2B58A 3E0KA 2Q04A 5ISVA 5H84A 4E8OA 3DSBA 3RYOA 4MI4A 4MY3A 3TTHA 2F5IA 2VEZA 1IIDA 1M4IA 2QECA 1J4JA 4NSQA 5JPHA 2CY2A 4II9A 4ORFA 3CXPA 4AVCA 2BSWA 4FD5A 1KUVA 3SXOA 2J8NA 3FXTA 4MJ8A 2FL4A 4K30A 2PSWA 3B8GA 2Z11A 2Z0ZA 3TO7A 2J8RA 2C27A 1YGHA 3QB8A 5IV0A 2G3TA 2B5GA 2JLMA 4EVYA 1MJ9A 3S6HA 3TE4A 1Y9KA 2IL4A 3GYAA 4XNHB 3S6GA 3D2MA 2WPXA 4HNWB 4XPLA 4KLWA 2PC1A 4R3KA 3TCVA 3S6FA 4PV6A 2BL1A 2OU2A 3R9GA 5FVJA 4DNCA 2GE3A 3JVNA 1RO5A 2P6EA 4KVOE 2ZXVA 1QSOA 2CNTA 4F0YA 5F46A 2EUIA 2Q7BA 3V8IA 1YVOA 4LUAA 5IX3A 4FD4A 4FD6A 3P2HA 1IICA 2R8VA 2B3VA 4HNXB 4PK3A 1B6BA 3TOBA 4CAXA 4Y49B 3LD2A 1Q2DA 2ZW5A 2FCKA 4B5OA 1XMTA 3C26A 4KLVA 2PR1A 1RXTA 1XEBA 3I9SA 4NCZA 4AVBA 3FBUA 2AE6A 3KKWA 2R1IA 4M85A 4QBJA 4XPDC 1QSTA 2HV2A 5J8FA 3H4QA 1Y9WA 4PSXA 3CXQA 3VWEA 2OZGA 3OWCA 3R9FA 1S7KA 2VQYA 5KTAA 4OAEA 4KOXA 4L8AA 4CAWA 3TO9A 4KZTA 3BJ7A 1VKCA 2OH1A 3SHPA 1YK3A 5J8CA 1R57A 1ON0A 1KZFA 2EVNA 1S7LA 4KOVA 1MJBA 1I12A 2FT0A 2ZPAA 3FNCA 3TO6A 2OZHA 4B5PB 4QUSA 1KUXA 4CRYB 2PRBA 4R3LA 3PGPA 4UWIA 3SXNA 5F47A 3G8WA 4QC6A 4X5KA 4FD7A 3W91A 2B5GB 3FYNA 4B5PA 4ONUA 3FIXA 1SQHA 3W6SA 1PU9A 1WK4A 1IB1E 4AB7A 1FY7A 2OB0A 4H89A 4MBUA 5E96A 4F6AA 1P4NA 3EFAA 2PDOA 4KOWA 1UFHA 3D8PA 4ZBGA 3UY5A 3F8KA 1I1DA 2ZW4A 4XPKA 2PR8A 2QIRA 2R98A 4QVTA 2FSRA 2OZUA 2P6FA 5C82A 3TFYA 5F49A 4U9ZA 1Q2YA 2CNSA 1L0CA 1MJAA 2X7BA 3GY9A 4OADA 3CXSA 3JUWA 5GCNA 1M4GA 5KTCA 2GIVA 2VXKA 2CNMA 4E0AA 1CJWA 2P0WA 4H6ZA 2Q44A 4MY0A 2JEVA 4NEXA 2BUEA 2J8MA 1Y7RA 4JWPA 4YFJA 4UBRA 2A4NA 4QB9A 2VI7A 5I0CA 1LRZA 4E2AA 1Z4EA 2R7HA 4XPDB 2VBQA 4LX9A 4XNHC 1Q2CA 3W6XA 2Y0MA 4KOTA 5IB0A 2FIAA 4HNYB 3FRMA 1S3ZA 4KUAA 1XF8A 4RS2A 4JLYA 4R87A 1XE4A 1XIXA 2HUZA 3WR7A 2K5TA 3PZJA 2B4DA 2ZW6A 3QAHA 1NE9A 2ATRA 1IYLA 2REEA 4GS4A 1TIQA 1GHEA 3EC4A 3F0AA 1YREA 2VZZA 3F5BA 4Y49C 4YGOA 4J3GA 5JQ4A 4H6UA 3DR8A 1CM0A 4CRZB 5EBVA 1B87A 3DNSA 1MK4A 1S5KA 1YR0A 3DDDA 3R9EA 4UWJA 2QMLA 1YVKA 1Z9UA 2AJ6A 4JXQA 1S7FA 2ZW7A 3D2PA 4U5YA 5F48A 5C88A 3EO4A 1N71A 3ZJ0A 2NMTA 3I3GA 4KOYA 4PK2A 1P0HA 1V0CA 2G0BA 4YRHA 5CNPA 4RI1A 2P6GA 2JDDA 4KVME 1QSMA 1S7NA 1M4DA 2RC4A 3FB3A 4I49A 5EC4A 4KUBA 1PUAA 2FS5A 1NMTA 2VZYA 5KTDA 2FXFA 1QSNA 1K4JA 4AG7A 3IGRA 3K9UA 1M44A 4L89A 2BEIA 2KCWA 3R96A 5DWNA 1S60A
chains in the Genus database with same CATH superfamily
3D3SA 3NH5A 3R1KA 3BJ8A 5JM6A 4A94A 2ANPA 3T9YA 6CPAA 3QAYA 4JD6A 2V8GA 4UCPA 1CG2A 1YLEA 4CPAA 4JXRA 3H5ZA 1Y0YA 4NFRA 2DXQA 5BWAB 3B7IA 4IF5A 1VHOA 2JEWA 4MHZA 4CYNA 3SJEA 2PJ8A 4B6ZA 4U9YA 3VATA 1BAVA 2EK8A 3TOAA 3IU2A 2Z10A 4BMHA 3LODA 2Z3NA 2IMOA 4OMEA 3LACA 5H86A 2I00A 2PQ8A 3ZZIA 5LRKA 3VWDA 2PVVA 3SJXA 1FNOA 1XJOA 4GXHA 2WZNA 3CPAA 3B3TA 3HLPA 1QQ9A 3NE7A 4G1PA 1LANA 3G3SA 2QVPA 4UEFA 1YX0A 4RN7A 3EY5A 1Z4RA 4H2KA 4UFWA 3P2FA 2YNCC 5HVGA 1U6MA 1WWZA 3KGQA 3IFEA 3V38A 4P4FA 2B3UA 2WPWA 3DGVA 4PSWA 1VGYA 1IU8A 4HKFA 4R57A 2B4DB 4KOUA 2ZEEA 4M3SA 1ZLHA 1OZPA 2CIJA 2PE3A 4OLLA 2D4PA 2F8HA 3PBBA 3ISZA 4ZYQA 4HPSA 3NH4A 1M1DA 2GANA 2VL1A 3K9TA 2REFA 4DJLA 1BO4A 2DPTA 1LCPA 1F2PA 4AG9A 2HQYA 2Q0YA 4CS0B 4UA3A 4C68A 5HMNA 2C6GA 2EBJA 2O28A 3EXNA 5LRGA 4KORA 1LFWA 3T90A 4AVAA 4NF1A 4MCSA 4R9MA 4IUSA 1VHSA 3MN8A 4OC4A 4NGQA 4CAVA 1IYKA 5LYLA 2FIWA 2Z3KA 1KUYA 3NH8A 1IGBA 1TKJA 2PJ3A 4MHDA 4PXDA 2G3AA 4LQGA 1NSLA 4KVXA 3VH9A 5HH1A 1IOFA 1QSRA 2YGWA 3BLNA 3IWGA 2ARHA 3TT2A 5DWMA 4CGMA 4EWTA 2JBKA 4KOSA 4CGNA 2AFOA 1ARMA 4MMOA 4CYQA 2V8DA 4OKOA 3GKRA 3WC7A 2PJCA 2I79A 3FECA 4JJXA 3FEEA 1BOBA 2D4OA 1ZLIA 5I4MA 1Q7LA 2Q4YA 4OC5A 4NXYA 3N7ZA 5G20A 2JDCA 4X3RA 3R95A 4B12A 3A9LA 3MGDA 3D7FA 2QYVA 1I21A 2FE7A 2Q4ZA 3D4UA 3D7DA 3PP9A 4NGTA 2H5MA 4UCMA 3S6KA 3DR6A 2Q4VA 2B4BA 2B58A 3B2YA 3TX8A 5K8NA 3E0KA 2Q04A 3IJ3A 1IY7A 2AFWA 3PB9X 5ISVA 2C6CA 5LYDA 5H84A 4E8OA 1Z5RA 1DE4C 4C7HA 3DSBA 4FWUA 3RYOA 4IHMA 4MI4A 5F09A 2Q7SA 3NA6A 4MY3A 3TTHA 1Y0RA 4C7IA 4NGRA 2F5IA 2DEAA 2VEZA 1TKFA 8CPAA 1IIDA 4FBEA 5HVFA 4OC0A 4ZY1A 2BO9A 2BOAA 3D67A 1M4IA 2QECA 1J4JA 4OIWA 2XEGA 3KZWA 4NSQA 5JPHA 2CY2A 4EFDA 3ISXA 4II9A 2PJ1A 4B14A 3LMSA 2DPSA 2ZEOA 4ORFA 4CYPA 3CXPA 1JWQA 4AVCA 2BSWA 4FD5A 1KUVA 1Y7EA 3SXOA 2J8NA 3FXTA 4R7MA 4UEEA 1CPXA 2CTBA 1EE3P 3FEDA 3PB7X 4MJ8A 2FL4A 4K30A 4P4EA 2PSWA 1X12A 3B8GA 2Z11A 3GIUA 5G21A 3S9MA 4ZX9A 2C1CA 2Z0ZA 2J8RA 3TO7A 4DUKA 2C27A 1YGHA 1XFOA 3QB8A 2V77A 2ZOGA 5IV0A 2OOTA 2G3TA 2PJ9A 2B5GA 3BI1A 5JGFA 2JLMA 4EVYA 2EO8A 1MJ9A 2PJ6A 4NGSA 3B3VA 4OP4A 3S6HA 3TE4A 2ZENA 1Y9KA 2EWBA 3FH4A 4PPZA 4A31A 2ZEPA 4WJBA 2IL4A 2O4HA 2ZOFA 3T8WA 2YNEA 3GYAA 3S9NA 4XNHB 3S6GA 1CX8A 5J1QA 2G9DA 2GLJA 3GUXA 4LQ6A 3D2MA 2WPXA 4HNWB 4MHPA 4XPLA 1YW4A 2EK9A 3PBEA 2PC1A 3PB6X 2YNDA 4KLWA 4R3KA 3TCVA 2IJZA 4ONWA 1YW6A 4PV6A 3S6FA 1TF9A 2BL1A 5CPAA 2OU2A 4C2YA 2J9AA 3R9GA 3RO0A 3PFOA 4KSIA 5FVJA 2YNCA 4A95A 1LOKA 4DNCA 2GE3A 2PIZA 3JVNA 1RO5A 4MHYA 2P6EA 4TWEA 2ZEFA 1CP7A 4KVOE 2ZXVA 1QSOA 2CNTA 4ZY2A 4A2ZA 4F0YA 2C6PA 2EUIA 3H8EA 1BLLE 3RAMA 5F46A 3NE8A 2Q7BA 5D29A 3V8IA 1YVOA 4P4IA 4WWVA 2RB7A 4P44A 3SJGA 5HXDA 4LUAA 3N5FA 5IX3A 1CBXA 1TKHA 4FD4A 4FD6A 3IU1A 5A27A 4A37A 3P2HA 1TXRA 4R76A 2I3CA 3HUVA 2QJ8A 1IICA 1Z8XA 2R8VA 3IWWA 1YLOA 5D8NA 2RFHA 2B3VA 2PRQA 4HNXB 4PK3A 1B6BA 3CT9A 2OR4A 3TOBA 4BINA 4CAXA 2O53A 3PEIA 4MHNA 3LD2A 4Y49B 3VARA 1Q2DA 2ZW5A 4F9UA 5K8PA 2FCKA 3FF3A 2PJAA 3B3WA 3D66A 4B5OA 2Q43A 4EMEA 1XMTA 4MCQA 3C26A 2GFQA 3KR4A 4KLVA 1AMPA 3KHXA 2PR1A 3KR5A 1RXTA 1XEBA 3I9SA 4MCPA 4NCZA 4AVBA 2XEIA 5DS0A 5JH9A 3FBUA 5K8OA 2Z3LA 3BI0A 3LWUA 4OC2A 1R3NA 5LYIA 2AE6A 3KKWA 1R43A 2R1IA 4M85A 4CYOA 4NJQA 4YU9A 4QBJA 4XPDC 1QSTA 1JQGA 4X2TA 3K2KA 2HV2A 2JBJA 5J8FA 3H4QA 5AG7A 2PJBA 1Y9WA 4PSXA 3WABA 3WT4A 3CXQA 3VWEA 2OZGA 3OWCA 4MFKA 3R9FA 1S7KA 2VQYA 4P45A 1GYTA 5KTAA 2POKA 4OAEA 2PJ4A 2PVWA 4KOXA 4L8AA 4CAWA 3TO9A 4RUHA 4KZTA 4K3NA 3PRTA 4UIAA 3BJ7A 3WC5A 1Z8TA 1VKCA 2PIYA 4B13A 2OH1A 3SHPA 1HDUA 1YK3A 4UFVA 5J8CA 1R57A 1ON0A 4Q7AA 1KZFA 2EVNA 4P6YA 3RBUA 1S7LA 4KOVA 1MJBA 1I12A 1ZG7A 2FT0A 3CDXA 4P4DA 2ZPAA 3FNCA 4A30A 3TO6A 2OZHA 4B5PB 4QUSA 5LYFA 3IIBA 1KUXA 4CRYB 5LRJA 4C2ZA 4GM5A 5A28A 2PRBA 4R3LA 3RNZA 5IB9A 1TF8A 3PGPA 4R6TA 4UWIA 3SXNA 4ZGYB 1CP6A 5F47A 4A32A 1PYTB 2WUUA 3G8WA 4MFJA 4FD7A 3JTKA 4QC6A 2CXAA 4X5KA 3W91A 3L2NA 2B5GB 3FYNA 4B5PA 3CZXA 4ONUA 3GB0A 3FVLA 2ZEMA 3FIXA 1DTDA 1SQHA 3W6SA 1PU9A 1WK4A 4MFPA 1IB1E 4AB7A 1FY7A 1XMBA 2Z3MA 2OB0A 3IO1A 4H89A 4MBUA 4P10A 5E96A 2AFXA 5AGEA 4F6AA 1P4NA 4OC3A 3EFAA 2PDOA 4KOWA 1UFHA 1BPMA 3D8PA 4ZBGA 3UY5A 3F8KA 4MCRA 1AUGA 3DLJA 1YSJA 4KSAA 1I1DA 1A2ZA 2AFUA 2ZW4A 4XPKA 3IWEA 2ZELA 2PR8A 2QIRA 2R98A 4QVTA 2FSRA 2OZUA 1RTQA 2P6FA 5C82A 2NYQA 3TFYA 5F49A 2HB6A 4U9ZA 1Q2YA 2CF4A 3IC1A 2ZEDA 2CNSA 4R8FA 1ZG8A 3D7HA 1L0CA 3JRUA 1MJAA 2X7BA 4F9VA 1YMEA 1Z2LA 3GY9A 4OADA 3CXSA 3JUWA 5GCNA 1M4GA 1XBUA 2ABZA 3H8GA 4ZX8A 4B10A 4A33A 5AG6A 5KTCA 2GIVA 2VXKA 2XEJA 2CNMA 4NGNA 5ELYA 4E0AA 4YWYA 1CJWA 1QMUA 1VIXA 2P0WA 2Q44A 4H6ZA 1HEEA 2PCUA 4MY0A 2JEVA 4NEXA 4MXUA 4W9YA 2BUEA 2J8MA 1IOIA 1Y7RA 4C2XA 4OC1A 4JWPA 4AXVA 4MFLA 3GLJA 2AFSA 4NJRA 1PCAA 4YFJA 1OBRA 3B3CA 2PJ5A 4UBRA 3S9LA 4P4JA 2A4NA 4QB9A 2VI7A 5I0CA 3CPXA 1LRZA 1Z8LA 3SJFA 4KSFA 4E2AA 1KWMA 1Z4EA 3PB4X 4NGPA 2R7HA 4PXBA 4XPDB 2VBQA 4LX9A 4XNHC 4PQAA 1F2OA 4NGMA 1Q2CA 4M6IA 5AG5A 3W6XA 4CGOA 3WC6A 4PXEA 3QNVA 2Y0MA 1LAMA 4KOTA 4TNUA 2FIAA 4HNYB 5IB0A 3FRMA 1S3ZA 4KUAA 1XF8A 2FVGA 3KQXA 4RS2A 4JLYA 1XOVA 4R87A 1XE4A 4M6GA 1M4LA 1XIXA 3D68A 4A39A 4O23A 4CGPA 4JYWA 3BHXA 1X10A 2XEFA 5HVHA 2HUZA 3KHZA 4FAIA 3WR7A 2K5TA 3PZJA 2IQ6A 1VHEA 3KL9A 4OIDA 3BXMA 4Q38A 1ZG9A 2B4DA 2ZW6A 3QAHA 4IAVA 4A38A 1HDQA 4KS9A 1NE9A 2ATRA 3B35A 4F8ZA 1IYLA 2REEA 4GS4A 1TIQA 3FMCA 1BPNA 1XRYA 3PFEA 4Z65A 3D7GA 1GHEA 3EC4A 3F0AA 3V7ZA 5K8MA 1YREA 2ODFA 2VZZA 4X8IA 3F5BA 4Y49C 2GLFA 2GREA 2PJ0A 4J3GA 4YGOA 5JQ4A 4H6UA 3DR8A 1ARLA 1CM0A 3MRUA 5EMIA 5EBVA 3KASA 4CRZB 1B87A 3DNSA 2CTCA 1MK4A 1S5KA 1YR0A 3DDDA 2F7VA 4PXCA 1F57A 4JZ0A 3R9EA 2WSAA 2GU2A 2WYRA 2ZEHA 2QMLA 4UWJA 2Z3OA 2BCOA 1YVKA 1Z9UA 2AJ6A 4JXQA 3B3SA 4MRIA 3SI2A 4ZI6A 1S7FA 2ZW7A 3D2PA 3KI9A 4U5YA 4UF4A 5F48A 5C88A 3EO4A 1N71A 2HC9A 3ZJ0A 1YQEA 2DF5A 2AFZA 5THWA 2NMTA 3PB8X 3I3GA 1H8LA 1Z8WA 4KOYA 4BBHA 4M6HA 3SI0A 5AG4A 4PK2A 4B11A 4F0XA 1P0HA 1V0CA 2G0BA 4YRHA 5CNPA 4RI1A 2P6GA 3I1UA 2JDDA 4KVME 1QSMA 2Q51A 2Z3PA 1ZO0A 1S7NA 4DYOA 4CGLA 4CAEA 1M4DA 2RC4A 3FB3A 4I49A 5G1ZA 3KQZA 2PJ7A 3IEHA 4FUUA 7CPAA 5EC4A 4MFZA 4KUBA 5G22A 4MFQA 4UCNA 3SI1A 3TC8A 1PUAA 2FS5A 1NMTA 3FJUA 1UWYA 3RZAA 2VZYA 2V8VA 4P4BA 1ELMP 4CAFA 4IK2A 2ZEGA 4Q36A 1NSAA 5KTDA 2FXFA 1FT7A 1QSNA 3H8FA 1K4JA 2NSMA 3IGRA 4AG7A 1CPSA 3NFZA 2AFMA 4UFXA 4UIBA 1ELLP 5CBMA 1LAPA 3K9UA 4UEZA 1M44A 2PJ2A 4ZY0A 4L89A 2BEIA 4BD9A 2KCWA 3R96A 5DWNA 1S60A 2V8HA 1AYEA 3FX6A
chains in the Genus database with same CATH topology
3D3SA 3R1KA 3BJ8A 3T9YA 4JD6A 4UCPA 1YLEA 4JXRA 3H5ZA 2DXQA 5BWAB 4IF5A 4CYNA 4U9YA 3TOAA 3IU2A 2Z10A 4BMHA 3LODA 2Z3NA 5H86A 2I00A 2PQ8A 3ZZIA 3VWDA 3NE7A 3G3SA 1YX0A 3EY5A 1Z4RA 4UFWA 3P2FA 2YNCC 1U6MA 1WWZA 2B3UA 2WPWA 4PSWA 4HKFA 4R57A 2B4DB 4KOUA 4M3SA 1OZPA 4OLLA 2D4PA 1M1DA 2GANA 2REFA 1BO4A 2DPTA 4AG9A 2HQYA 2Q0YA 4CS0B 4UA3A 4C68A 5HMNA 2O28A 3EXNA 4KORA 3T90A 4AVAA 4NF1A 4R9MA 4IUSA 1VHSA 4CAVA 1IYKA 2FIWA 2Z3KA 1KUYA 4MHDA 2G3AA 1NSLA 4KVXA 5HH1A 1QSRA 2YGWA 3BLNA 3IWGA 2ARHA 5DWMA 4CGMA 4KOSA 4CGNA 4CYQA 3GKRA 2I79A 4JJXA 1BOBA 2D4OA 2Q4YA 4NXYA 3N7ZA 5G20A 2JDCA 3R95A 4B12A 3MGDA 3A9LA 3TT2A 1I21A 2FE7A 3S6KA 3PP9A 4UCMA 2H5MA 3DR6A 2Q4VA 2B4BA 2B58A 3E0KA 2Q04A 5ISVA 5H84A 4E8OA 4C7HA 3DSBA 3RYOA 4MI4A 4MY3A 3TTHA 4C7IA 2F5IA 2VEZA 1IIDA 1M4IA 2QECA 1J4JA 4NSQA 5JPHA 2CY2A 4II9A 4B14A 2DPSA 4ORFA 4CYPA 3CXPA 4AVCA 2BSWA 4FD5A 1KUVA 3SXOA 2J8NA 3FXTA 4MJ8A 2FL4A 4K30A 2PSWA 3B8GA 2Z11A 5G21A 2Z0ZA 3TO7A 2J8RA 2C27A 1YGHA 3QB8A 5IV0A 2G3TA 2B5GA 2JLMA 4EVYA 1MJ9A 3S6HA 3TE4A 1Y9KA 4A31A 2IL4A 2YNEA 3GYAA 4XNHB 3S6GA 3D2MA 2WPXA 4HNWB 4XPLA 4KLWA 2PC1A 4R3KA 2YNDA 3TCVA 3S6FA 4PV6A 2BL1A 2OU2A 4C2YA 3R9GA 5FVJA 2YNCA 4A95A 4DNCA 2GE3A 3JVNA 1RO5A 2P6EA 4KVOE 2ZXVA 1QSOA 2CNTA 4A2ZA 4F0YA 5F46A 2EUIA 2Q7BA 3V8IA 1YVOA 4LUAA 5IX3A 4FD4A 4FD6A 5A27A 3IU1A 3P2HA 1IICA 2R8VA 2B3VA 4HNXB 4PK3A 1B6BA 3TOBA 4CAXA 4Y49B 3LD2A 1Q2DA 2ZW5A 2FCKA 4B5OA 1XMTA 3C26A 4KLVA 2PR1A 1RXTA 1XEBA 3I9SA 4NCZA 4AVBA 3FBUA 2Z3LA 2AE6A 3KKWA 2R1IA 4M85A 4CYOA 4QBJA 4XPDC 1QSTA 2HV2A 5J8FA 3H4QA 5AG7A 1Y9WA 4PSXA 3CXQA 3VWEA 2OZGA 3OWCA 4MFKA 3R9FA 1S7KA 2VQYA 5KTAA 4OAEA 4KOXA 4L8AA 4CAWA 3TO9A 4KZTA 3BJ7A 1VKCA 4B13A 2OH1A 3SHPA 1YK3A 4UFVA 5J8CA 1R57A 1ON0A 1KZFA 2EVNA 1S7LA 4KOVA 1MJBA 1I12A 2FT0A 2ZPAA 3FNCA 4A30A 3TO6A 2OZHA 4B5PB 4QUSA 1KUXA 4CRYB 4C2ZA 5A28A 2PRBA 4R3LA 3PGPA 4UWIA 3SXNA 4ZGYB 5F47A 4A32A 2WUUA 3G8WA 4MFJA 4FD7A 3JTKA 4QC6A 2CXAA 4X5KA 3W91A 2B5GB 3FYNA 4B5PA 4ONUA 3FIXA 1SQHA 3W6SA 1PU9A 1WK4A 4MFPA 1IB1E 4AB7A 1FY7A 2Z3MA 2OB0A 4H89A 4MBUA 5E96A 5AGEA 4F6AA 1P4NA 3EFAA 2PDOA 4KOWA 1UFHA 3D8PA 4ZBGA 3UY5A 3F8KA 4KSAA 1I1DA 2ZW4A 4XPKA 3IWEA 2PR8A 2QIRA 2R98A 4QVTA 2FSRA 2OZUA 2P6FA 5C82A 3TFYA 5F49A 4U9ZA 1Q2YA 2CNSA 1L0CA 1MJAA 2X7BA 3GY9A 4OADA 3CXSA 3JUWA 5GCNA 1M4GA 4B10A 4A33A 5AG6A 5KTCA 2GIVA 2VXKA 2CNMA 4E0AA 1CJWA 2P0WA 4H6ZA 2Q44A 4MY0A 2JEVA 4NEXA 2BUEA 2J8MA 1Y7RA 4C2XA 4JWPA 4MFLA 4YFJA 4UBRA 2A4NA 4QB9A 2VI7A 5I0CA 1LRZA 4KSFA 4E2AA 1Z4EA 2R7HA 4XPDB 2VBQA 4LX9A 4XNHC 1Q2CA 5AG5A 3W6XA 4CGOA 2Y0MA 4KOTA 5IB0A 2FIAA 4HNYB 3FRMA 1S3ZA 4KUAA 1XF8A 4RS2A 4JLYA 4R87A 1XE4A 1XIXA 4CGPA 2HUZA 3WR7A 2K5TA 3PZJA 4Q38A 2B4DA 2ZW6A 3QAHA 4KS9A 1NE9A 2ATRA 1IYLA 2REEA 4GS4A 1TIQA 1GHEA 3EC4A 3F0AA 1YREA 2VZZA 3F5BA 4Y49C 4YGOA 4J3GA 5JQ4A 4H6UA 3DR8A 1CM0A 4CRZB 5EBVA 1B87A 3DNSA 1MK4A 1S5KA 1YR0A 3DDDA 3R9EA 2WSAA 4UWJA 2QMLA 2Z3OA 1YVKA 1Z9UA 2AJ6A 4JXQA 1S7FA 2ZW7A 3D2PA 4U5YA 5F48A 5C88A 3EO4A 1N71A 3ZJ0A 2NMTA 3I3GA 4KOYA 4BBHA 5AG4A 4PK2A 4B11A 4F0XA 1P0HA 1V0CA 2G0BA 4YRHA 5CNPA 4RI1A 2P6GA 2JDDA 4KVME 1QSMA 2Z3PA 1ZO0A 1S7NA 4CGLA 4CAEA 1M4DA 2RC4A 3FB3A 4I49A 5G1ZA 5EC4A 4MFZA 4KUBA 5G22A 4MFQA 4UCNA 1PUAA 2FS5A 1NMTA 2VZYA 4CAFA 4Q36A 5KTDA 2FXFA 1QSNA 1K4JA 4AG7A 3IGRA 4UFXA 3K9UA 1M44A 4L89A 2BEIA 2KCWA 3R96A 5DWNA 1S60A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D3S A;  3R1K A;  3BJ8 A;  3T9Y A;  4JD6 A;  1YLE A;  4JXR A;  2DXQ A;  4IF5 A;  4U9Y A;  3TOA A;  2Z10 A;  4BMH A;  3LOD A;  5H86 A;  2I00 A;  2PQ8 A;  3ZZI A;  3VWD A;  3NE7 A;  3G3S A;  1YX0 A;  3EY5 A;  1Z4R A;  3P2F A;  1U6M A;  1WWZ A;  2B3U A;  2WPW A;  4PSW A;  4HKF A;  4R57 A;  2B4D B;  4KOU A;  4M3S A;  1OZP A;  4OLL A;  2D4P A;  1M1D A;  2GAN A;  2REF A;  1BO4 A;  4AG9 A;  2HQY A;  2Q0Y A;  4CS0 B;  4UA3 A;  5HMN A;  2O28 A;  3EXN A;  4KOR A;  3T90 A;  4AVA A;  4NF1 A;  4R9M A;  4IUS A;  1VHS A;  4CAV A;  1IYK A;  2FIW A;  1KUY A;  4MHD A;  2G3A A;  1NSL A;  4KVX A;  5HH1 A;  1QSR A;  3BLN A;  3IWG A;  2ARH A;  5DWM A;  4KOS A;  3GKR A;  2I79 A;  4JJX A;  1BOB A;  2D4O A;  2Q4Y A;  4NXY A;  3N7Z A;  2JDC A;  3R95 A;  3MGD A;  3TT2 A;  1I21 A;  2FE7 A;  3S6K A;  3PP9 A;  2H5M A;  3DR6 A;  2Q4V A;  2B4B A;  2B58 A;  3E0K A;  2Q04 A;  5ISV A;  5H84 A;  4E8O A;  3DSB A;  3RYO A;  4MI4 A;  4MY3 A;  3TTH A;  2F5I A;  2VEZ A;  1IID A;  1M4I A;  2QEC A;  1J4J A;  4NSQ A;  5JPH A;  2CY2 A;  4II9 A;  4ORF A;  3CXP A;  4AVC A;  2BSW A;  4FD5 A;  1KUV A;  3SXO A;  2J8N A;  3FXT A;  4MJ8 A;  2FL4 A;  4K30 A;  2PSW A;  3B8G A;  2Z11 A;  2Z0Z A;  3TO7 A;  2J8R A;  2C27 A;  1YGH A;  3QB8 A;  5IV0 A;  2G3T A;  2B5G A;  2JLM A;  4EVY A;  1MJ9 A;  3S6H A;  3TE4 A;  1Y9K A;  2IL4 A;  3GYA A;  4XNH B;  3S6G A;  3D2M A;  2WPX A;  4HNW B;  4XPL A;  4KLW A;  2PC1 A;  4R3K A;  3TCV A;  3S6F A;  4PV6 A;  2BL1 A;  2OU2 A;  3R9G A;  5FVJ A;  4DNC A;  2GE3 A;  3JVN A;  1RO5 A;  2P6E A;  4KVO E;  2ZXV A;  1QSO A;  2CNT A;  4F0Y A;  5F46 A;  2EUI A;  2Q7B A;  3V8I A;  1YVO A;  4LUA A;  5IX3 A;  4FD4 A;  4FD6 A;  3P2H A;  1IIC A;  2R8V A;  2B3V A;  4HNX B;  4PK3 A;  1B6B A;  3TOB A;  4CAX A;  4Y49 B;  3LD2 A;  1Q2D A;  2ZW5 A;  2FCK A;  4B5O A;  1XMT A;  3C26 A;  4KLV A;  2PR1 A;  1RXT A;  1XEB A;  3I9S A;  4NCZ A;  4AVB A;  3FBU A;  2AE6 A;  3KKW A;  2R1I A;  4M85 A;  4QBJ A;  4XPD C;  1QST A;  2HV2 A;  5J8F A;  3H4Q A;  1Y9W A;  4PSX A;  3CXQ A;  3VWE A;  2OZG A;  3OWC A;  3R9F A;  1S7K A;  2VQY A;  5KTA A;  4OAE A;  4KOX A;  4L8A A;  4CAW A;  3TO9 A;  4KZT A;  3BJ7 A;  1VKC A;  2OH1 A;  3SHP A;  1YK3 A;  5J8C A;  1R57 A;  1ON0 A;  1KZF A;  2EVN A;  1S7L A;  4KOV A;  1MJB A;  1I12 A;  2FT0 A;  2ZPA A;  3FNC A;  3TO6 A;  2OZH A;  4B5P B;  4QUS A;  1KUX A;  4CRY B;  2PRB A;  4R3L A;  3PGP A;  4UWI A;  3SXN A;  5F47 A;  3G8W A;  4QC6 A;  4X5K A;  4FD7 A;  3W91 A;  2B5G B;  3FYN A;  4B5P A;  4ONU A;  3FIX A;  1SQH A;  3W6S A;  1PU9 A;  1WK4 A;  1IB1 E;  4AB7 A;  1FY7 A;  2OB0 A;  4H89 A;  4MBU A;  5E96 A;  4F6A A;  1P4N A;  3EFA A;  2PDO A;  4KOW A;  1UFH A;  3D8P A;  4ZBG A;  3UY5 A;  3F8K A;  1I1D A;  2ZW4 A;  4XPK A;  2PR8 A;  2QIR A;  2R98 A;  4QVT A;  2FSR A;  2OZU A;  2P6F A;  5C82 A;  3TFY A;  5F49 A;  4U9Z A;  1Q2Y A;  2CNS A;  1L0C A;  1MJA A;  2X7B A;  3GY9 A;  4OAD A;  3CXS A;  3JUW A;  5GCN A;  1M4G A;  5KTC A;  2GIV A;  2VXK A;  2CNM A;  4E0A A;  1CJW A;  2P0W A;  4H6Z A;  2Q44 A;  4MY0 A;  2JEV A;  4NEX A;  2BUE A;  2J8M A;  1Y7R A;  4JWP A;  4YFJ A;  4UBR A;  2A4N A;  4QB9 A;  2VI7 A;  5I0C A;  1LRZ A;  4E2A A;  1Z4E A;  2R7H A;  4XPD B;  2VBQ A;  4LX9 A;  4XNH C;  1Q2C A;  3W6X A;  2Y0M A;  4KOT A;  5IB0 A;  2FIA A;  4HNY B;  3FRM A;  1S3Z A;  4KUA A;  1XF8 A;  4RS2 A;  4JLY A;  4R87 A;  1XE4 A;  1XIX A;  2HUZ A;  3WR7 A;  2K5T A;  3PZJ A;  2B4D A;  2ZW6 A;  3QAH A;  1NE9 A;  2ATR A;  1IYL A;  2REE A;  4GS4 A;  1TIQ A;  1GHE A;  3EC4 A;  3F0A A;  1YRE A;  2VZZ A;  3F5B A;  4Y49 C;  4YGO A;  4J3G A;  5JQ4 A;  4H6U A;  3DR8 A;  1CM0 A;  4CRZ B;  5EBV A;  1B87 A;  3DNS A;  1MK4 A;  1S5K A;  1YR0 A;  3DDD A;  3R9E A;  4UWJ A;  2QML A;  1YVK A;  1Z9U A;  2AJ6 A;  4JXQ A;  1S7F A;  2ZW7 A;  3D2P A;  4U5Y A;  5F48 A;  5C88 A;  3EO4 A;  1N71 A;  3ZJ0 A;  2NMT A;  3I3G A;  4KOY A;  4PK2 A;  1P0H A;  1V0C A;  2G0B A;  4YRH A;  5CNP A;  4RI1 A;  2P6G A;  2JDD A;  4KVM E;  1QSM A;  1S7N A;  1M4D A;  2RC4 A;  3FB3 A;  4I49 A;  5EC4 A;  4KUB A;  1PUA A;  2FS5 A;  1NMT A;  2VZY A;  5KTD A;  2FXF A;  1QSN A;  1K4J A;  4AG7 A;  3IGR A;  3K9U A;  1M44 A;  4L89 A;  2BEI A;  2KCW A;  3R96 A;  5DWN A;  1S60 A; 
#chains in the Genus database with same CATH topology
 3D3S A;  3NH5 A;  3R1K A;  3BJ8 A;  5JM6 A;  4A94 A;  2ANP A;  3T9Y A;  6CPA A;  3QAY A;  4JD6 A;  2V8G A;  4UCP A;  1CG2 A;  1YLE A;  4CPA A;  4JXR A;  3H5Z A;  1Y0Y A;  4NFR A;  2DXQ A;  5BWA B;  3B7I A;  4IF5 A;  1VHO A;  2JEW A;  4MHZ A;  4CYN A;  3SJE A;  2PJ8 A;  4B6Z A;  4U9Y A;  3VAT A;  1BAV A;  2EK8 A;  3TOA A;  3IU2 A;  2Z10 A;  4BMH A;  3LOD A;  2Z3N A;  2IMO A;  4OME A;  3LAC A;  5H86 A;  2I00 A;  2PQ8 A;  3ZZI A;  5LRK A;  3VWD A;  2PVV A;  3SJX A;  1FNO A;  1XJO A;  4GXH A;  2WZN A;  3CPA A;  3B3T A;  3HLP A;  1QQ9 A;  3NE7 A;  4G1P A;  1LAN A;  3G3S A;  2QVP A;  4UEF A;  1YX0 A;  4RN7 A;  3EY5 A;  1Z4R A;  4H2K A;  4UFW A;  3P2F A;  2YNC C;  5HVG A;  1U6M A;  1WWZ A;  3KGQ A;  3IFE A;  3V38 A;  4P4F A;  2B3U A;  2WPW A;  3DGV A;  4PSW A;  1VGY A;  1IU8 A;  4HKF A;  4R57 A;  2B4D B;  4KOU A;  2ZEE A;  4M3S A;  1ZLH A;  1OZP A;  2CIJ A;  2PE3 A;  4OLL A;  2D4P A;  2F8H A;  3PBB A;  3ISZ A;  4ZYQ A;  4HPS A;  3NH4 A;  1M1D A;  2GAN A;  2VL1 A;  3K9T A;  2REF A;  4DJL A;  1BO4 A;  2DPT A;  1LCP A;  1F2P A;  4AG9 A;  2HQY A;  2Q0Y A;  4CS0 B;  4UA3 A;  4C68 A;  5HMN A;  2C6G A;  2EBJ A;  2O28 A;  3EXN A;  5LRG A;  4KOR A;  1LFW A;  3T90 A;  4AVA A;  4NF1 A;  4MCS A;  4R9M A;  4IUS A;  1VHS A;  3MN8 A;  4OC4 A;  4NGQ A;  4CAV A;  1IYK A;  5LYL A;  2FIW A;  2Z3K A;  1KUY A;  3NH8 A;  1IGB A;  1TKJ A;  2PJ3 A;  4MHD A;  4PXD A;  2G3A A;  4LQG A;  1NSL A;  4KVX A;  3VH9 A;  5HH1 A;  1IOF A;  1QSR A;  2YGW A;  3BLN A;  3IWG A;  2ARH A;  3TT2 A;  5DWM A;  4CGM A;  4EWT A;  2JBK A;  4KOS A;  4CGN A;  2AFO A;  1ARM A;  4MMO A;  4CYQ A;  2V8D A;  4OKO A;  3GKR A;  3WC7 A;  2PJC A;  2I79 A;  3FEC A;  4JJX A;  3FEE A;  1BOB A;  2D4O A;  1ZLI A;  5I4M A;  1Q7L A;  2Q4Y A;  4OC5 A;  4NXY A;  3N7Z A;  5G20 A;  2JDC A;  4X3R A;  3R95 A;  4B12 A;  3A9L A;  3MGD A;  3D7F A;  2QYV A;  1I21 A;  2FE7 A;  2Q4Z A;  3D4U A;  3D7D A;  3PP9 A;  4NGT A;  2H5M A;  4UCM A;  3S6K A;  3DR6 A;  2Q4V A;  2B4B A;  2B58 A;  3B2Y A;  3TX8 A;  5K8N A;  3E0K A;  2Q04 A;  3IJ3 A;  1IY7 A;  2AFW A;  3PB9 X;  5ISV A;  2C6C A;  5LYD A;  5H84 A;  4E8O A;  1Z5R A;  1DE4 C;  4C7H A;  3DSB A;  4FWU A;  3RYO A;  4IHM A;  4MI4 A;  5F09 A;  2Q7S A;  3NA6 A;  4MY3 A;  3TTH A;  1Y0R A;  4C7I A;  4NGR A;  2F5I A;  2DEA A;  2VEZ A;  1TKF A;  8CPA A;  1IID A;  4FBE A;  5HVF A;  4OC0 A;  4ZY1 A;  2BO9 A;  2BOA A;  3D67 A;  1M4I A;  2QEC A;  1J4J A;  4OIW A;  2XEG A;  3KZW A;  4NSQ A;  5JPH A;  2CY2 A;  4EFD A;  3ISX A;  4II9 A;  2PJ1 A;  4B14 A;  3LMS A;  2DPS A;  2ZEO A;  4ORF A;  4CYP A;  3CXP A;  1JWQ A;  4AVC A;  2BSW A;  4FD5 A;  1KUV A;  1Y7E A;  3SXO A;  2J8N A;  3FXT A;  4R7M A;  4UEE A;  1CPX A;  2CTB A;  1EE3 P;  3FED A;  3PB7 X;  4MJ8 A;  2FL4 A;  4K30 A;  4P4E A;  2PSW A;  1X12 A;  3B8G A;  2Z11 A;  3GIU A;  5G21 A;  3S9M A;  4ZX9 A;  2C1C A;  2Z0Z A;  2J8R A;  3TO7 A;  4DUK A;  2C27 A;  1YGH A;  1XFO A;  3QB8 A;  2V77 A;  2ZOG A;  5IV0 A;  2OOT A;  2G3T A;  2PJ9 A;  2B5G A;  3BI1 A;  5JGF A;  2JLM A;  4EVY A;  2EO8 A;  1MJ9 A;  2PJ6 A;  4NGS A;  3B3V A;  4OP4 A;  3S6H A;  3TE4 A;  2ZEN A;  1Y9K A;  2EWB A;  3FH4 A;  4PPZ A;  4A31 A;  2ZEP A;  4WJB A;  2IL4 A;  2O4H A;  2ZOF A;  3T8W A;  2YNE A;  3GYA A;  3S9N A;  4XNH B;  3S6G A;  1CX8 A;  5J1Q A;  2G9D A;  2GLJ A;  3GUX A;  4LQ6 A;  3D2M A;  2WPX A;  4HNW B;  4MHP A;  4XPL A;  1YW4 A;  2EK9 A;  3PBE A;  2PC1 A;  3PB6 X;  2YND A;  4KLW A;  4R3K A;  3TCV A;  2IJZ A;  4ONW A;  1YW6 A;  4PV6 A;  3S6F A;  1TF9 A;  2BL1 A;  5CPA A;  2OU2 A;  4C2Y A;  2J9A A;  3R9G A;  3RO0 A;  3PFO A;  4KSI A;  5FVJ A;  2YNC A;  4A95 A;  1LOK A;  4DNC A;  2GE3 A;  2PIZ A;  3JVN A;  1RO5 A;  4MHY A;  2P6E A;  4TWE A;  2ZEF A;  1CP7 A;  4KVO E;  2ZXV A;  1QSO A;  2CNT A;  4ZY2 A;  4A2Z A;  4F0Y A;  2C6P A;  2EUI A;  3H8E A;  1BLL E;  3RAM A;  5F46 A;  3NE8 A;  2Q7B A;  5D29 A;  3V8I A;  1YVO A;  4P4I A;  4WWV A;  2RB7 A;  4P44 A;  3SJG A;  5HXD A;  4LUA A;  3N5F A;  5IX3 A;  1CBX A;  1TKH A;  4FD4 A;  4FD6 A;  3IU1 A;  5A27 A;  4A37 A;  3P2H A;  1TXR A;  4R76 A;  2I3C A;  3HUV A;  2QJ8 A;  1IIC A;  1Z8X A;  2R8V A;  3IWW A;  1YLO A;  5D8N A;  2RFH A;  2B3V A;  2PRQ A;  4HNX B;  4PK3 A;  1B6B A;  3CT9 A;  2OR4 A;  3TOB A;  4BIN A;  4CAX A;  2O53 A;  3PEI A;  4MHN A;  3LD2 A;  4Y49 B;  3VAR A;  1Q2D A;  2ZW5 A;  4F9U A;  5K8P A;  2FCK A;  3FF3 A;  2PJA A;  3B3W A;  3D66 A;  4B5O A;  2Q43 A;  4EME A;  1XMT A;  4MCQ A;  3C26 A;  2GFQ A;  3KR4 A;  4KLV A;  1AMP A;  3KHX A;  2PR1 A;  3KR5 A;  1RXT A;  1XEB A;  3I9S A;  4MCP A;  4NCZ A;  4AVB A;  2XEI A;  5DS0 A;  5JH9 A;  3FBU A;  5K8O A;  2Z3L A;  3BI0 A;  3LWU A;  4OC2 A;  1R3N A;  5LYI A;  2AE6 A;  3KKW A;  1R43 A;  2R1I A;  4M85 A;  4CYO A;  4NJQ A;  4YU9 A;  4QBJ A;  4XPD C;  1QST A;  1JQG A;  4X2T A;  3K2K A;  2HV2 A;  2JBJ A;  5J8F A;  3H4Q A;  5AG7 A;  2PJB A;  1Y9W A;  4PSX A;  3WAB A;  3WT4 A;  3CXQ A;  3VWE A;  2OZG A;  3OWC A;  4MFK A;  3R9F A;  1S7K A;  2VQY A;  4P45 A;  1GYT A;  5KTA A;  2POK A;  4OAE A;  2PJ4 A;  2PVW A;  4KOX A;  4L8A A;  4CAW A;  3TO9 A;  4RUH A;  4KZT A;  4K3N A;  3PRT A;  4UIA A;  3BJ7 A;  3WC5 A;  1Z8T A;  1VKC A;  2PIY A;  4B13 A;  2OH1 A;  3SHP A;  1HDU A;  1YK3 A;  4UFV A;  5J8C A;  1R57 A;  1ON0 A;  4Q7A A;  1KZF A;  2EVN A;  4P6Y A;  3RBU A;  1S7L A;  4KOV A;  1MJB A;  1I12 A;  1ZG7 A;  2FT0 A;  3CDX A;  4P4D A;  2ZPA A;  3FNC A;  4A30 A;  3TO6 A;  2OZH A;  4B5P B;  4QUS A;  5LYF A;  3IIB A;  1KUX A;  4CRY B;  5LRJ A;  4C2Z A;  4GM5 A;  5A28 A;  2PRB A;  4R3L A;  3RNZ A;  5IB9 A;  1TF8 A;  3PGP A;  4R6T A;  4UWI A;  3SXN A;  4ZGY B;  1CP6 A;  5F47 A;  4A32 A;  1PYT B;  2WUU A;  3G8W A;  4MFJ A;  4FD7 A;  3JTK A;  4QC6 A;  2CXA A;  4X5K A;  3W91 A;  3L2N A;  2B5G B;  3FYN A;  4B5P A;  3CZX A;  4ONU A;  3GB0 A;  3FVL A;  2ZEM A;  3FIX A;  1DTD A;  1SQH A;  3W6S A;  1PU9 A;  1WK4 A;  4MFP A;  1IB1 E;  4AB7 A;  1FY7 A;  1XMB A;  2Z3M A;  2OB0 A;  3IO1 A;  4H89 A;  4MBU A;  4P10 A;  5E96 A;  2AFX A;  5AGE A;  4F6A A;  1P4N A;  4OC3 A;  3EFA A;  2PDO A;  4KOW A;  1UFH A;  1BPM A;  3D8P A;  4ZBG A;  3UY5 A;  3F8K A;  4MCR A;  1AUG A;  3DLJ A;  1YSJ A;  4KSA A;  1I1D A;  1A2Z A;  2AFU A;  2ZW4 A;  4XPK A;  3IWE A;  2ZEL A;  2PR8 A;  2QIR A;  2R98 A;  4QVT A;  2FSR A;  2OZU A;  1RTQ A;  2P6F A;  5C82 A;  2NYQ A;  3TFY A;  5F49 A;  2HB6 A;  4U9Z A;  1Q2Y A;  2CF4 A;  3IC1 A;  2ZED A;  2CNS A;  4R8F A;  1ZG8 A;  3D7H A;  1L0C A;  3JRU A;  1MJA A;  2X7B A;  4F9V A;  1YME A;  1Z2L A;  3GY9 A;  4OAD A;  3CXS A;  3JUW A;  5GCN A;  1M4G A;  1XBU A;  2ABZ A;  3H8G A;  4ZX8 A;  4B10 A;  4A33 A;  5AG6 A;  5KTC A;  2GIV A;  2VXK A;  2XEJ A;  2CNM A;  4NGN A;  5ELY A;  4E0A A;  4YWY A;  1CJW A;  1QMU A;  1VIX A;  2P0W A;  2Q44 A;  4H6Z A;  1HEE A;  2PCU A;  4MY0 A;  2JEV A;  4NEX A;  4MXU A;  4W9Y A;  2BUE A;  2J8M A;  1IOI A;  1Y7R A;  4C2X A;  4OC1 A;  4JWP A;  4AXV A;  4MFL A;  3GLJ A;  2AFS A;  4NJR A;  1PCA A;  4YFJ A;  1OBR A;  3B3C A;  2PJ5 A;  4UBR A;  3S9L A;  4P4J A;  2A4N A;  4QB9 A;  2VI7 A;  5I0C A;  3CPX A;  1LRZ A;  1Z8L A;  3SJF A;  4KSF A;  4E2A A;  1KWM A;  1Z4E A;  3PB4 X;  4NGP A;  2R7H A;  4PXB A;  4XPD B;  2VBQ A;  4LX9 A;  4XNH C;  4PQA A;  1F2O A;  4NGM A;  1Q2C A;  4M6I A;  5AG5 A;  3W6X A;  4CGO A;  3WC6 A;  4PXE A;  3QNV A;  2Y0M A;  1LAM A;  4KOT A;  4TNU A;  2FIA A;  4HNY B;  5IB0 A;  3FRM A;  1S3Z A;  4KUA A;  1XF8 A;  2FVG A;  3KQX A;  4RS2 A;  4JLY A;  1XOV A;  4R87 A;  1XE4 A;  4M6G A;  1M4L A;  1XIX A;  3D68 A;  4A39 A;  4O23 A;  4CGP A;  4JYW A;  3BHX A;  1X10 A;  2XEF A;  5HVH A;  2HUZ A;  3KHZ A;  4FAI A;  3WR7 A;  2K5T A;  3PZJ A;  2IQ6 A;  1VHE A;  3KL9 A;  4OID A;  3BXM A;  4Q38 A;  1ZG9 A;  2B4D A;  2ZW6 A;  3QAH A;  4IAV A;  4A38 A;  1HDQ A;  4KS9 A;  1NE9 A;  2ATR A;  3B35 A;  4F8Z A;  1IYL A;  2REE A;  4GS4 A;  1TIQ A;  3FMC A;  1BPN A;  1XRY A;  3PFE A;  4Z65 A;  3D7G A;  1GHE A;  3EC4 A;  3F0A A;  3V7Z A;  5K8M A;  1YRE A;  2ODF A;  2VZZ A;  4X8I A;  3F5B A;  4Y49 C;  2GLF A;  2GRE A;  2PJ0 A;  4J3G A;  4YGO A;  5JQ4 A;  4H6U A;  3DR8 A;  1ARL A;  1CM0 A;  3MRU A;  5EMI A;  5EBV A;  3KAS A;  4CRZ B;  1B87 A;  3DNS A;  2CTC A;  1MK4 A;  1S5K A;  1YR0 A;  3DDD A;  2F7V A;  4PXC A;  1F57 A;  4JZ0 A;  3R9E A;  2WSA A;  2GU2 A;  2WYR A;  2ZEH A;  2QML A;  4UWJ A;  2Z3O A;  2BCO A;  1YVK A;  1Z9U A;  2AJ6 A;  4JXQ A;  3B3S A;  4MRI A;  3SI2 A;  4ZI6 A;  1S7F A;  2ZW7 A;  3D2P A;  3KI9 A;  4U5Y A;  4UF4 A;  5F48 A;  5C88 A;  3EO4 A;  1N71 A;  2HC9 A;  3ZJ0 A;  1YQE A;  2DF5 A;  2AFZ A;  5THW A;  2NMT A;  3PB8 X;  3I3G A;  1H8L A;  1Z8W A;  4KOY A;  4BBH A;  4M6H A;  3SI0 A;  5AG4 A;  4PK2 A;  4B11 A;  4F0X A;  1P0H A;  1V0C A;  2G0B A;  4YRH A;  5CNP A;  4RI1 A;  2P6G A;  3I1U A;  2JDD A;  4KVM E;  1QSM A;  2Q51 A;  2Z3P A;  1ZO0 A;  1S7N A;  4DYO A;  4CGL A;  4CAE A;  1M4D A;  2RC4 A;  3FB3 A;  4I49 A;  5G1Z A;  3KQZ A;  2PJ7 A;  3IEH A;  4FUU A;  7CPA A;  5EC4 A;  4MFZ A;  4KUB A;  5G22 A;  4MFQ A;  4UCN A;  3SI1 A;  3TC8 A;  1PUA A;  2FS5 A;  1NMT A;  3FJU A;  1UWY A;  3RZA A;  2VZY A;  2V8V A;  4P4B A;  1ELM P;  4CAF A;  4IK2 A;  2ZEG A;  4Q36 A;  1NSA A;  5KTD A;  2FXF A;  1FT7 A;  1QSN A;  3H8F A;  1K4J A;  2NSM A;  3IGR A;  4AG7 A;  1CPS A;  3NFZ A;  2AFM A;  4UFX A;  4UIB A;  1ELL P;  5CBM A;  1LAP A;  3K9U A;  4UEZ A;  1M44 A;  2PJ2 A;  4ZY0 A;  4L89 A;  2BEI A;  4BD9 A;  2KCW A;  3R96 A;  5DWN A;  1S60 A;  2V8H A;  1AYE A;  3FX6 A; 
#chains in the Genus database with same CATH homology
 3D3S A;  3R1K A;  3BJ8 A;  3T9Y A;  4JD6 A;  4UCP A;  1YLE A;  4JXR A;  3H5Z A;  2DXQ A;  5BWA B;  4IF5 A;  4CYN A;  4U9Y A;  3TOA A;  3IU2 A;  2Z10 A;  4BMH A;  3LOD A;  2Z3N A;  5H86 A;  2I00 A;  2PQ8 A;  3ZZI A;  3VWD A;  3NE7 A;  3G3S A;  1YX0 A;  3EY5 A;  1Z4R A;  4UFW A;  3P2F A;  2YNC C;  1U6M A;  1WWZ A;  2B3U A;  2WPW A;  4PSW A;  4HKF A;  4R57 A;  2B4D B;  4KOU A;  4M3S A;  1OZP A;  4OLL A;  2D4P A;  1M1D A;  2GAN A;  2REF A;  1BO4 A;  2DPT A;  4AG9 A;  2HQY A;  2Q0Y A;  4CS0 B;  4UA3 A;  4C68 A;  5HMN A;  2O28 A;  3EXN A;  4KOR A;  3T90 A;  4AVA A;  4NF1 A;  4R9M A;  4IUS A;  1VHS A;  4CAV A;  1IYK A;  2FIW A;  2Z3K A;  1KUY A;  4MHD A;  2G3A A;  1NSL A;  4KVX A;  5HH1 A;  1QSR A;  2YGW A;  3BLN A;  3IWG A;  2ARH A;  5DWM A;  4CGM A;  4KOS A;  4CGN A;  4CYQ A;  3GKR A;  2I79 A;  4JJX A;  1BOB A;  2D4O A;  2Q4Y A;  4NXY A;  3N7Z A;  5G20 A;  2JDC A;  3R95 A;  4B12 A;  3MGD A;  3A9L A;  3TT2 A;  1I21 A;  2FE7 A;  3S6K A;  3PP9 A;  4UCM A;  2H5M A;  3DR6 A;  2Q4V A;  2B4B A;  2B58 A;  3E0K A;  2Q04 A;  5ISV A;  5H84 A;  4E8O A;  4C7H A;  3DSB A;  3RYO A;  4MI4 A;  4MY3 A;  3TTH A;  4C7I A;  2F5I A;  2VEZ A;  1IID A;  1M4I A;  2QEC A;  1J4J A;  4NSQ A;  5JPH A;  2CY2 A;  4II9 A;  4B14 A;  2DPS A;  4ORF A;  4CYP A;  3CXP A;  4AVC A;  2BSW A;  4FD5 A;  1KUV A;  3SXO A;  2J8N A;  3FXT A;  4MJ8 A;  2FL4 A;  4K30 A;  2PSW A;  3B8G A;  2Z11 A;  5G21 A;  2Z0Z A;  3TO7 A;  2J8R A;  2C27 A;  1YGH A;  3QB8 A;  5IV0 A;  2G3T A;  2B5G A;  2JLM A;  4EVY A;  1MJ9 A;  3S6H A;  3TE4 A;  1Y9K A;  4A31 A;  2IL4 A;  2YNE A;  3GYA A;  4XNH B;  3S6G A;  3D2M A;  2WPX A;  4HNW B;  4XPL A;  4KLW A;  2PC1 A;  4R3K A;  2YND A;  3TCV A;  3S6F A;  4PV6 A;  2BL1 A;  2OU2 A;  4C2Y A;  3R9G A;  5FVJ A;  2YNC A;  4A95 A;  4DNC A;  2GE3 A;  3JVN A;  1RO5 A;  2P6E A;  4KVO E;  2ZXV A;  1QSO A;  2CNT A;  4A2Z A;  4F0Y A;  5F46 A;  2EUI A;  2Q7B A;  3V8I A;  1YVO A;  4LUA A;  5IX3 A;  4FD4 A;  4FD6 A;  5A27 A;  3IU1 A;  3P2H A;  1IIC A;  2R8V A;  2B3V A;  4HNX B;  4PK3 A;  1B6B A;  3TOB A;  4CAX A;  4Y49 B;  3LD2 A;  1Q2D A;  2ZW5 A;  2FCK A;  4B5O A;  1XMT A;  3C26 A;  4KLV A;  2PR1 A;  1RXT A;  1XEB A;  3I9S A;  4NCZ A;  4AVB A;  3FBU A;  2Z3L A;  2AE6 A;  3KKW A;  2R1I A;  4M85 A;  4CYO A;  4QBJ A;  4XPD C;  1QST A;  2HV2 A;  5J8F A;  3H4Q A;  5AG7 A;  1Y9W A;  4PSX A;  3CXQ A;  3VWE A;  2OZG A;  3OWC A;  4MFK A;  3R9F A;  1S7K A;  2VQY A;  5KTA A;  4OAE A;  4KOX A;  4L8A A;  4CAW A;  3TO9 A;  4KZT A;  3BJ7 A;  1VKC A;  4B13 A;  2OH1 A;  3SHP A;  1YK3 A;  4UFV A;  5J8C A;  1R57 A;  1ON0 A;  1KZF A;  2EVN A;  1S7L A;  4KOV A;  1MJB A;  1I12 A;  2FT0 A;  2ZPA A;  3FNC A;  4A30 A;  3TO6 A;  2OZH A;  4B5P B;  4QUS A;  1KUX A;  4CRY B;  4C2Z A;  5A28 A;  2PRB A;  4R3L A;  3PGP A;  4UWI A;  3SXN A;  4ZGY B;  5F47 A;  4A32 A;  2WUU A;  3G8W A;  4MFJ A;  4FD7 A;  3JTK A;  4QC6 A;  2CXA A;  4X5K A;  3W91 A;  2B5G B;  3FYN A;  4B5P A;  4ONU A;  3FIX A;  1SQH A;  3W6S A;  1PU9 A;  1WK4 A;  4MFP A;  1IB1 E;  4AB7 A;  1FY7 A;  2Z3M A;  2OB0 A;  4H89 A;  4MBU A;  5E96 A;  5AGE A;  4F6A A;  1P4N A;  3EFA A;  2PDO A;  4KOW A;  1UFH A;  3D8P A;  4ZBG A;  3UY5 A;  3F8K A;  4KSA A;  1I1D A;  2ZW4 A;  4XPK A;  3IWE A;  2PR8 A;  2QIR A;  2R98 A;  4QVT A;  2FSR A;  2OZU A;  2P6F A;  5C82 A;  3TFY A;  5F49 A;  4U9Z A;  1Q2Y A;  2CNS A;  1L0C A;  1MJA A;  2X7B A;  3GY9 A;  4OAD A;  3CXS A;  3JUW A;  5GCN A;  1M4G A;  4B10 A;  4A33 A;  5AG6 A;  5KTC A;  2GIV A;  2VXK A;  2CNM A;  4E0A A;  1CJW A;  2P0W A;  4H6Z A;  2Q44 A;  4MY0 A;  2JEV A;  4NEX A;  2BUE A;  2J8M A;  1Y7R A;  4C2X A;  4JWP A;  4MFL A;  4YFJ A;  4UBR A;  2A4N A;  4QB9 A;  2VI7 A;  5I0C A;  1LRZ A;  4KSF A;  4E2A A;  1Z4E A;  2R7H A;  4XPD B;  2VBQ A;  4LX9 A;  4XNH C;  1Q2C A;  5AG5 A;  3W6X A;  4CGO A;  2Y0M A;  4KOT A;  5IB0 A;  2FIA A;  4HNY B;  3FRM A;  1S3Z A;  4KUA A;  1XF8 A;  4RS2 A;  4JLY A;  4R87 A;  1XE4 A;  1XIX A;  4CGP A;  2HUZ A;  3WR7 A;  2K5T A;  3PZJ A;  4Q38 A;  2B4D A;  2ZW6 A;  3QAH A;  4KS9 A;  1NE9 A;  2ATR A;  1IYL A;  2REE A;  4GS4 A;  1TIQ A;  1GHE A;  3EC4 A;  3F0A A;  1YRE A;  2VZZ A;  3F5B A;  4Y49 C;  4YGO A;  4J3G A;  5JQ4 A;  4H6U A;  3DR8 A;  1CM0 A;  4CRZ B;  5EBV A;  1B87 A;  3DNS A;  1MK4 A;  1S5K A;  1YR0 A;  3DDD A;  3R9E A;  2WSA A;  4UWJ A;  2QML A;  2Z3O A;  1YVK A;  1Z9U A;  2AJ6 A;  4JXQ A;  1S7F A;  2ZW7 A;  3D2P A;  4U5Y A;  5F48 A;  5C88 A;  3EO4 A;  1N71 A;  3ZJ0 A;  2NMT A;  3I3G A;  4KOY A;  4BBH A;  5AG4 A;  4PK2 A;  4B11 A;  4F0X A;  1P0H A;  1V0C A;  2G0B A;  4YRH A;  5CNP A;  4RI1 A;  2P6G A;  2JDD A;  4KVM E;  1QSM A;  2Z3P A;  1ZO0 A;  1S7N A;  4CGL A;  4CAE A;  1M4D A;  2RC4 A;  3FB3 A;  4I49 A;  5G1Z A;  5EC4 A;  4MFZ A;  4KUB A;  5G22 A;  4MFQ A;  4UCN A;  1PUA A;  2FS5 A;  1NMT A;  2VZY A;  4CAF A;  4Q36 A;  5KTD A;  2FXF A;  1QSN A;  1K4J A;  4AG7 A;  3IGR A;  4UFX A;  3K9U A;  1M44 A;  4L89 A;  2BEI A;  2KCW A;  3R96 A;  5DWN A;  1S60 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...