1M4GA

Aminoglycoside 2'-n-acetyltransferase from mycobacterium tuberculosis-complex with coenzyme a and ribostamycin
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
181
structure length
181
Chain Sequence
MHTQVHTARLVHTADLDSETRQDIRQMVTGAFAGDFTETDWEHTLGGMHALIWHHGAIIAHAAVIQRRLIYRGNALRCGYVEGVAVRADWRGQRLVSALLDAVEQVMRGAYQLGALSSSARARRLYASRGWLPWHGPTSVLAPTGPVRTPDDDGTVFVLPIDISLDTSAELMCDWRAGDVW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aminoglycoside 2'-N-acetyltransferase
publication title Aminoglycoside 2'-N-acetyltransferase from Mycobacterium tuberculosis in complex with coenzyme A and aminoglycoside substrates.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 54
structure length 181
sequence length 181
chains with identical sequence B
ec nomenclature ec 2.3.1.-:
pdb deposition date 2002-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13527 Acetyltransf_9 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1m4gA00
3F5BA 4IUSA 5DWMA 1IYKA 3TO7A 5KTAA 2B5GA 3BLNA 2G3TA 3IWGA 4E0AA 1N71A 1OZPA 1M4GA 4F0YA 1M44A 4OADA 3G3SA 5E96A 1YVKA 3OWCA 3TE4A 4XPDC 2ZW4A 2IL4A 2GIVA 1S7FA 4KOUA 1IICA 3F0AA 4KVXA 4NCZA 1Y9WA 1S7LA 3LD2A 4QUSA 4QBJA 4M85A 2Q4VA 4R57A 2G0BA 3C26A 1PU9A 5KTDA 3LODA 3FB3A 2BUEA 2AE6A 4K30A 4JD6A 4CS0B 1S5KA 2VEZA 4AVBA 1NMTA 2Z11A 1MJ9A 4PSXA 3W6SA 1QSMA 3D8PA 3TOBA 1S60A 3R96A 2A4NA 1Q2CA 5HH1A 4U5YA 5IX3A 3CXPA 3F8KA 3FNCA 4KZTA 4KOYA 2OZUA 3R9GA 4YFJA 3TOAA 2FT0A 4QC6A 4XNHB 3QB8A 1YR0A 1P0HA 2PR1A 3TO9A 3JUWA 1V0CA 1I21A 2Q7BA 4UWIA 2BSWA 4AG9A 1MK4A 1Z9UA 4KLVA 5FVJA 4KOTA 1MJAA 2P6GA 2Q4YA 1IIDA 1KUVA 4JLYA 4MI4A 3S6HA 2Q44A 4GS4A 2PRBA 3FIXA 4MJ8A 2ZW6A 4M3SA 5CNPA 2B3UA 1S7NA 1CJWA 2Z0ZA 2B4BA 4OLLA 1ON0A 3D3SA 2BL1A 3SHPA 4F6AA 1B87A 3VWEA 2B58A 4NF1A 1Y7RA 3TCVA 2PDOA 2FIAA 3E0KA 4U9YA 1VKCA 4B5PA 4JWPA 4RI1A 1GHEA 1XMTA 2B4DB 3GKRA 3R1KA 1CM0A 1Z4EA 1FY7A 2FXFA 4LX9A 4R3LA 2QMLA 2ZPAA 5F46A 3I9SA 4YGOA 3SXOA 4FD5A 3MGDA 4LUAA 2J8RA 1XF8A 2CNTA 2D4PA 4CAVA 1M4IA 4KOWA 2AJ6A 2EUIA 4KLWA 4BMHA 2G3AA 1QSNA 4EVYA 4R87A 5J8CA 3D2MA 1K4JA 1NE9A 5JQ4A 1Y9KA 2J8NA 3H4QA 4J3GA 3ZZIA 2R8VA 1BO4A 4HKFA 4MY0A 2PR8A 3IGRA 3DR6A 3CXQA 3TFYA 4Y49C 1YREA 2KCWA 4R3KA 1QSTA 4UWJA 4XPDB 4II9A 1M4DA 3FXTA 3GYAA 2Y0MA 2B5GB 1UFHA 2JLMA 3BJ8A 2OH1A 2ARHA 4CRZB 1SQHA 4AVAA 3B8GA 2WPWA 4YRHA 1XE4A 1QSOA 4PK2A 2FL4A 3R9EA 4DNCA 1VHSA 1WK4A 3DR8A 2Z10A 2ZW5A 4B5OA 1YLEA 5HMNA 5ISVA 5F47A 3UY5A 4FD7A 3T9YA 4KOVA 1S7KA 5KTCA 4H6UA 4KORA 4KVOE 4HNYB 1M1DA 3N7ZA 3ZJ0A 4PV6A 3FYNA 1YGHA 5F48A 3GY9A 1Q2YA 4IF5A 2VI7A 4R9MA 5DWNA 2VQYA 4XPLA 4ORFA 3SXNA 3S6GA 4L89A 2HV2A 2RC4A 3TTHA 4CAXA 3S6FA 2VBQA 2O28A 4HNXB 3PZJA 2FIWA 2BEIA 3NE7A 4AB7A 2C27A 4NEXA 3PGPA 4AG7A 3BJ7A 3RYOA 3S6KA 4E2AA 2OU2A 3FRMA 4I49A 3EO4A 1KZFA 1MJBA 4UBRA 2CY2A 3V8IA 5J8FA 4KVME 5F49A 3P2FA 3DSBA 5GCNA 1KUYA 1TIQA 3DNSA 4OAEA 2Q04A 4UA3A 4JXQA 1IB1E 1PUAA 4CAWA 1QSRA 1XIXA 1YVOA 3EY5A 3R9FA 1YK3A 1I1DA 3TO6A 2REEA 1L0CA 4PSWA 4KUBA 2FE7A 2EVNA 2NMTA 5I0CA 2I00A 2B3VA 1BOBA 3CXSA 2CNSA 2PSWA 4RS2A 2R98A 1R57A 1XEBA 4QB9A 2GE3A 3EXNA 3VWDA 2VZYA 4H6ZA 2JEVA 1U6MA 3EC4A 4MHDA 1J4JA 4B5PB 3R95A 4NXYA 5H84A 1NSLA 4PK3A 1YX0A 1I12A 3QAHA 2ZXVA 3DDDA 2P6FA 3EFAA 5C88A 4XNHC 3K9UA 1LRZA 2FSRA 4L8AA 3KKWA 3P2HA 4MY3A 2OZHA 1KUXA 2H5MA 5EBVA 2QECA 2R1IA 2PQ8A 2REFA 3D2PA 5H86A 5IV0A 4MBUA 4Y49B 2FCKA 2ZW7A 4ZBGA 4E8OA 4AVCA 3W6XA 3JVNA 2F5IA 4KUAA 2OB0A 2ATRA 2HUZA 4NSQA 3WR7A 2B4DA 2GANA 2PC1A 4XPKA 1S3ZA 1P4NA 2P6EA 2HQYA 2VXKA 4CRYB 2X7BA 4KOXA 3TT2A 2CNMA 1Z4RA 3I3GA 3T90A 3G8WA 5EC4A 4JJXA 5C82A 1B6BA 1Q2DA 1WWZA 2OZGA 2R7HA 4X5KA 4FD4A 5IB0A 2P0WA 4JXRA 1IYLA 4ONUA 5JPHA 4HNWB 2K5TA 2DXQA 2D4OA 2JDDA 2I79A 4H89A 4U9ZA 2QIRA 3W91A 3PP9A 2J8MA 1RXTA 2FS5A 2Q0YA 3FBUA 4KOSA 4FD6A 2WPXA 2VZZA 2JDCA 1RO5A 4QVTA
chains in the Genus database with same CATH superfamily
1IGBA 5THWA 3F5BA 3K9TA 2XEJA 4IUSA 4A37A 2ZEPA 5DWMA 1IYKA 3WABA 4RN7A 3TO7A 6CPAA 5KTAA 1VGYA 2B5GA 4A31A 3BLNA 2G3TA 3IWGA 2ZEGA 4E0AA 4HPSA 1XBUA 1N71A 3ISXA 2V8DA 1OZPA 3IC1A 1M4GA 5A27A 4P6YA 4H2KA 2C6PA 4TWEA 4F0YA 1M44A 4OADA 1AUGA 3G3SA 3KL9A 5E96A 1YVKA 3OWCA 1Z8TA 2WZNA 4UFXA 4XPDC 3TE4A 1ARLA 4A33A 5IB9A 1ZG7A 2ZW4A 4IK2A 2IL4A 3FX6A 3IJ3A 2GIVA 3SI0A 1S7FA 4KOUA 3H8EA 1AYEA 1IICA 3F0AA 4CAEA 4KVXA 4NCZA 3WC5A 1Y9WA 4B11A 1S7LA 1VHOA 3LD2A 4MRIA 2J9AA 1ELMP 4QUSA 2ZOFA 1IY7A 4A38A 2Z3KA 1JQGA 4C2YA 4QBJA 1M4LA 3PRTA 4M85A 2Q4VA 2ZOGA 4R57A 1UWYA 2DEAA 2G0BA 5K8PA 1F2OA 3C26A 1ARMA 1PYTB 2PE3A 2V8HA 1PU9A 2JBKA 4P45A 5KTDA 4X3RA 3LODA 3FB3A 2C6CA 4CAFA 1ZG8A 2EK8A 1VIXA 2BUEA 2AE6A 3KASA 4K30A 4JD6A 3V7ZA 3GIUA 4MFPA 4PXEA 4CS0B 1S5KA 2VEZA 3NH5A 3PBBA 4R8FA 1F2PA 3FMCA 1NMTA 2Z11A 4AVBA 4CPAA 4TNUA 1MJ9A 2HC9A 4PSXA 1QSMA 3W6SA 4EWTA 3D68A 1A2ZA 1ZO0A 1QQ9A 3D8PA 3CPAA 3FEEA 3TOBA 4IAVA 4P4BA 1S60A 2IMOA 2A4NA 3PB8X 3R96A 1Q2CA 5HH1A 2OR4A 4U5YA 5IX3A 3CXPA 3F8KA 3BXMA 3FNCA 4KZTA 4CYNA 1XJOA 4ZX9A 1LCPA 4KOYA 2JEWA 2OZUA 3R9GA 2QVPA 4YFJA 2ZEDA 5JGFA 5JM6A 3TOAA 5K8MA 2FT0A 3NH8A 5LRGA 4QC6A 3CPXA 4XNHB 1LFWA 3L2NA 2GFQA 3QB8A 1YR0A 4MCPA 2ZEEA 1P0HA 2PR1A 3TO9A 2O53A 3JUWA 3LWUA 1V0CA 2EO8A 3JRUA 1I21A 3RZAA 3CZXA 3IEHA 5EMIA 2Q7BA 3KQXA 4UWIA 1ELLP 2BSWA 2PJ4A 2PVVA 4R6TA 1MK4A 4AG9A 2NSMA 3D66A 1Z9UA 3KI9A 4KLVA 5FVJA 4F8ZA 4KOTA 1MJAA 2P6GA 5AG7A 3D7DA 2Q4YA 2ZELA 1IIDA 4NFRA 1KUVA 4JLYA 4MI4A 3S6HA 2Q44A 4GS4A 2PRBA 1BLLE 3FIXA 2PCUA 3FVLA 3ISZA 2ZW6A 4M3SA 4MJ8A 5CNPA 3S9NA 4OC4A 3PFOA 2B3UA 1S7NA 4UEEA 4F9UA 1CJWA 4BD9A 3RNZA 5A28A 2Z0ZA 2B4BA 4OIDA 3I1UA 4OLLA 5G22A 1ON0A 2PJ3A 3D3SA 1R43A 4YWYA 2BL1A 3SHPA 3MRUA 3SJEA 4F6AA 1B87A 3VWEA 2ZEHA 4JZ0A 3MN8A 2B58A 4B12A 2PJ5A 4NF1A 4B14A 2FVGA 4DUKA 1Y7RA 3TCVA 3KR4A 5AG4A 2PDOA 3BHXA 2FIAA 3E0KA 2G9DA 4U9YA 2PIZA 3QNVA 3PEIA 1CPXA 1VKCA 4NGTA 5JH9A 1Y7EA 4B5PA 1Z8WA 4JWPA 4MHYA 4RI1A 1GHEA 4A94A 3FH4A 2XEIA 1IU8A 1XRYA 1XMTA 2B4DB 3GKRA 4R76A 3WT4A 2BOAA 4CGMA 1YQEA 3R1KA 1CG2A 1CM0A 1FY7A 1Z4EA 2FXFA 4LX9A 4R3LA 2F7VA 5LYDA 2QMLA 4R7MA 2CXAA 2NYQA 2ZPAA 3CDXA 3B35A 5AG5A 5F46A 3I9SA 4YGOA 2OOTA 4Q36A 4UEFA 2IQ6A 4UEZA 5HXDA 3NE8A 3SXOA 2EWBA 3A9LA 4FD5A 2QYVA 3MGDA 4LUAA 4UIAA 2J8RA 4MFQA 2DF5A 4ZX8A 1TKHA 1XF8A 2CNTA 3QAYA 4NGRA 4OC2A 4OMEA 2D4PA 4CAVA 1M4IA 2Q51A 2AJ6A 4KOWA 4P10A 3V38A 1Y0YA 2BO9A 2EUIA 7CPAA 4KLWA 3VH9A 4BMHA 3LACA 2G3AA 1QSNA 1CBXA 4R87A 5D29A 4EVYA 5J8CA 2JBJA 3D2MA 2WSAA 1K4JA 4NJRA 3H5ZA 1NE9A 1TKFA 5JQ4A 4ZGYB 1Y9KA 2J8NA 2VL1A 3H4QA 3T8WA 1HDQA 1VHEA 4J3GA 4JYWA 3ZZIA 2R8VA 1BO4A 4HKFA 4MY0A 4A32A 2PR8A 2V8GA 3IGRA 4KSIA 4YU9A 4GM5A 5DS0A 3DR6A 4CGNA 4P44A 3CXQA 3TFYA 3VARA 2CTCA 1FNOA 4Y49C 1YREA 2KCWA 4R3KA 1QSTA 3KZWA 4UWJA 4B13A 2ZENA 4XPDB 4FWUA 1M4DA 2V77A 3FXTA 5BWAB 4II9A 3KGQA 2AFXA 3RAMA 4ZY0A 3GYAA 2Y0MA 2PJ1A 3GB0A 2B5GB 1UFHA 2JLMA 4IHMA 1X10A 4C2ZA 3BJ8A 4CYOA 2OH1A 1KWMA 2ARHA 4MFZA 4CRZB 1SQHA 4AVAA 1BPMA 3B8GA 2PJ9A 2WPWA 4DYOA 3S9LA 4KSFA 4YRHA 1XE4A 3IIBA 2Q7SA 1QSOA 4PK2A 2DPTA 2CIJA 2O4HA 2PJAA 4CGPA 2FL4A 3R9EA 4DNCA 2C1CA 1VHSA 2RFHA 1WK4A 3DR8A 2YNEA 3HUVA 1RO5A 2GREA 3PB6X 2Z10A 2ZW5A 4MHNA 1EE3P 4MCRA 4B5OA 3D67A 1YLEA 3IWWA 3PB4X 5HMNA 1ZG9A 5ISVA 2PIYA 4A30A 4P4DA 5F47A 3UY5A 4FD7A 2C6GA 3T9YA 4KOVA 4M6HA 1S7KA 4OP4A 2BCOA 5KTCA 1CP6A 2ZEMA 4LQ6A 1X12A 4H6UA 1Z2LA 4KORA 4KVOE 5ELYA 3HLPA 3WC7A 4HNYB 1M1DA 4CGLA 4UFWA 3N7ZA 3ZJ0A 4EMEA 4PV6A 4K3NA 3PFEA 1Z8XA 2YNCA 4CYPA 5LYFA 3FYNA 1YGHA 5F48A 4EFDA 4RUHA 3GY9A 1DTDA 2DPSA 3TX8A 1Q2YA 2PJ7A 4IF5A 4OC1A 2VI7A 4R9MA 5DWNA 2VQYA 4XPLA 4W9YA 4ORFA 1TF9A 3SXNA 1NSAA 3FEDA 1CPSA 3S6GA 3NA6A 1Z8LA 4L89A 5G21A 2HV2A 5G1ZA 4A2ZA 2RC4A 3TTHA 4MFKA 4CAXA 3S6FA 2GU2A 2POKA 2VBQA 2O28A 4NGNA 4HNXB 2YNCC 4C7HA 4NGPA 3B3CA 3PZJA 2FIWA 2BEIA 3NE7A 4AB7A 4PQAA 4B6ZA 2C27A 4NEXA 4X2TA 3PGPA 4AG7A 4UIBA 3BJ7A 1TXRA 3RYOA 3S6KA 4E2AA 4FUUA 1CX8A 2OU2A 3FRMA 4MFLA 5LYIA 4I49A 4KSAA 3EO4A 4OC3A 2PJ0A 1KZFA 4MFJA 2PVWA 1MJBA 1YLOA 3FF3A 2CY2A 2QJ8A 1YSJA 4UBRA 3V8IA 2V8VA 5J8FA 4KVME 5HVFA 1LAMA 3WC6A 2GLFA 5F49A 2ODFA 3D7GA 3FJUA 3IU1A 3P2FA 3D7HA 3DGVA 3DSBA 4MCQA 5GCNA 4KS9A 4M6IA 5HVGA 4AXVA 4M6GA 2RB7A 1KUYA 4P4IA 2CF4A 1BPNA 4OC0A 1TIQA 3DNSA 4OAEA 4OIWA 2Q04A 4MHPA 4UA3A 2Q43A 4JXQA 4MHZA 1IB1E 1PUAA 1FT7A 4CAWA 2Z3PA 4F9VA 1QSRA 1XIXA 1OBRA 1YVOA 3EY5A 4P4EA 1BAVA 3KR5A 3R9FA 1RTQA 4Z65A 1H8LA 1YK3A 4MMOA 1I1DA 3TO6A 1Y0RA 2REEA 1L0CA 1PCAA 3PB7X 4KUBA 1Q7LA 4PSWA 3B3TA 4PXCA 2FE7A 5CBMA 2EBJA 2EVNA 4DJLA 2NMTA 5I0CA 2I00A 4P4FA 2B3VA 1BOBA 2XEFA 1GYTA 3CXSA 2CNSA 4MXUA 2PSWA 4RS2A 2R98A 5AGEA 4NGMA 1R57A 1XEBA 3KHZA 3D4UA 2GE3A 4QB9A 3IU2A 3GLJA 2CTBA 3EXNA 3CT9A 4WWVA 3VWDA 2VZYA 4H6ZA 2PRQA 2PJCA 1LANA 3B2YA 1XMBA 2Z3NA 2JEVA 3SJFA 1U6MA 4C7IA 3EC4A 4MHDA 1J4JA 4B5PB 3R95A 4ZI6A 3H8FA 3D7FA 1LOKA 4NXYA 2PJ2A 4UCMA 2PJ6A 3NFZA 5H84A 3B3WA 3KHXA 4FBEA 4UCNA 5HVHA 1NSLA 4PK3A 3S9MA 1YX0A 1IOFA 1I12A 1Z5RA 3LMSA 1XOVA 3QAHA 2ZXVA 5LYLA 1QMUA 3DDDA 2P6FA 3FECA 3EFAA 5C88A 4X8IA 2PJBA 1YW4A 4XNHC 4Q38A 3BI1A 3K9UA 4NGQA 3SJXA 1LRZA 2FSRA 4L8AA 4C2XA 3KKWA 2ZEOA 3P2HA 1YMEA 3IFEA 4MY3A 2OZHA 1KUXA 2H5MA 5EBVA 4MCSA 3N5FA 2QECA 3GUXA 2R1IA 2PQ8A 2REFA 3D2PA 3H8GA 5H86A 4A39A 5IV0A 4UCPA 4FAIA 4MBUA 3PB9X 4Y49B 1XFOA 2GLJA 5F09A 5I4MA 4OKOA 2Z3LA 2FCKA 2ZW7A 4Q7AA 4ZBGA 4O23A 3RO0A 4E8OA 2ABZA 4AVCA 1TF8A 2YNDA 2AFWA 3JVNA 3W6XA 2WYRA 4ZY1A 3SI2A 3IO1A 2F5IA 4G1PA 3B3VA 4KUAA 3JTKA 4ONWA 1DE4C 2OB0A 2ATRA 2HUZA 5J1QA 1AMPA 4PXDA 4NSQA 1HDUA 2B4DA 3WR7A 4F0XA 1IOIA 2GANA 2PC1A 4C68A 4XPKA 2ANPA 2PJ8A 3B3SA 3IWEA 1S3ZA 1P4NA 2AFSA 2P6EA 2HQYA 2VXKA 3SJGA 4CRYB 2X7BA 1CP7A 4KOXA 3TT2A 1JWQA 2CNMA 4CGOA 4CYQA 1Z4RA 3I3GA 3T90A 3G8WA 4LQGA 5EC4A 2I3CA 4JJXA 3SI1A 4ZY2A 2AFMA 1B6BA 1Q2DA 4P4JA 3TC8A 3VATA 5C82A 1WWZA 8CPAA 2OZGA 4PPZA 2R7HA 3NH4A 4X5KA 4BINA 4FD4A 5K8NA 5AG6A 2AFUA 2XEGA 4WJBA 3RBUA 2P0WA 1ZLIA 1TKJA 4JXRA 5IB0A 3PBEA 2AFOA 2EK9A 1IYLA 3B7IA 1HEEA 2Z3MA 2F8HA 4NGSA 4ONUA 1R3NA 5LRJA 5JPHA 5G20A 1F57A 2HB6A 4HNWB 3BI0A 2K5TA 3DLJA 5K8OA 2DXQA 4ZYQA 2D4OA 4NJQA 4BBHA 5CPAA 4PXBA 2JDDA 4A95A 4UFVA 2I79A 4H89A 4U9ZA 2AFZA 2QIRA 2YGWA 2ZEFA 5D8NA 3PP9A 3W91A 2J8MA 4B10A 1RXTA 1ZLHA 2FS5A 4GXHA 2Q0YA 1LAPA 3FBUA 4KOSA 5LRKA 4UF4A 3K2KA 4FD6A 2WPXA 2Q4ZA 4OC5A 2VZZA 2Z3OA 2JDCA 2WUUA 2IJZA 1YW6A 4QVTA 3KQZA
chains in the Genus database with same CATH topology
3F5BA 4IUSA 5DWMA 1IYKA 3TO7A 5KTAA 2B5GA 4A31A 3BLNA 2G3TA 3IWGA 4E0AA 1N71A 1OZPA 1M4GA 5A27A 4F0YA 1M44A 4OADA 3G3SA 5E96A 1YVKA 3OWCA 4UFXA 3TE4A 4XPDC 4A33A 2ZW4A 2IL4A 2GIVA 1S7FA 4KOUA 1IICA 3F0AA 4CAEA 4KVXA 4NCZA 1Y9WA 4B11A 1S7LA 3LD2A 4QUSA 2Z3KA 4C2YA 4QBJA 4M85A 2Q4VA 4R57A 2G0BA 3C26A 1PU9A 5KTDA 3LODA 3FB3A 4CAFA 2BUEA 2AE6A 4K30A 4JD6A 4MFPA 4CS0B 1S5KA 2VEZA 4AVBA 1NMTA 2Z11A 1MJ9A 4PSXA 3W6SA 1QSMA 1ZO0A 3D8PA 3TOBA 1S60A 3R96A 2A4NA 1Q2CA 5HH1A 4U5YA 5IX3A 3CXPA 3F8KA 3FNCA 4KZTA 4CYNA 4KOYA 2OZUA 3R9GA 4YFJA 3TOAA 2FT0A 4QC6A 4XNHB 3QB8A 1YR0A 1P0HA 2PR1A 3TO9A 3JUWA 1V0CA 1I21A 2Q7BA 4UWIA 2BSWA 4AG9A 1MK4A 1Z9UA 4KLVA 5FVJA 4KOTA 1MJAA 2P6GA 5AG7A 2Q4YA 1IIDA 1KUVA 4JLYA 4MI4A 3S6HA 2Q44A 4GS4A 2PRBA 3FIXA 4MJ8A 2ZW6A 4M3SA 5CNPA 2B3UA 1S7NA 1CJWA 5A28A 2Z0ZA 2B4BA 4OLLA 5G22A 1ON0A 3D3SA 2BL1A 3SHPA 4F6AA 1B87A 3VWEA 2B58A 4B12A 4NF1A 4B14A 1Y7RA 3TCVA 5AG4A 2PDOA 2FIAA 3E0KA 4U9YA 1VKCA 4B5PA 4JWPA 4RI1A 1GHEA 1XMTA 2B4DB 3GKRA 4CGMA 3R1KA 1CM0A 1Z4EA 1FY7A 2FXFA 4LX9A 4R3LA 2QMLA 2CXAA 2ZPAA 5AG5A 5F46A 3I9SA 4YGOA 4Q36A 3SXOA 3A9LA 4FD5A 3MGDA 4LUAA 2J8RA 4MFQA 1XF8A 2CNTA 2D4PA 4CAVA 1M4IA 4KOWA 2AJ6A 2EUIA 4KLWA 4BMHA 2G3AA 1QSNA 4EVYA 4R87A 5J8CA 3D2MA 2WSAA 1K4JA 3H5ZA 1NE9A 5JQ4A 4ZGYB 1Y9KA 2J8NA 3H4QA 4J3GA 3ZZIA 4A32A 2R8VA 1BO4A 4HKFA 4MY0A 2PR8A 3IGRA 4CGNA 3DR6A 3CXQA 3TFYA 4Y49C 1YREA 2KCWA 4R3KA 1QSTA 5BWAB 4UWJA 4B13A 4XPDB 4II9A 1M4DA 3FXTA 3GYAA 2Y0MA 2B5GB 1UFHA 2JLMA 4C2ZA 4CYOA 3BJ8A 2OH1A 2ARHA 4MFZA 4CRZB 1SQHA 4AVAA 3B8GA 2WPWA 4KSFA 4YRHA 1XE4A 1QSOA 4PK2A 2DPTA 4CGPA 2FL4A 3R9EA 4DNCA 1VHSA 1WK4A 3DR8A 2YNEA 2Z10A 2ZW5A 4B5OA 1YLEA 5HMNA 5ISVA 4A30A 5F47A 3UY5A 4FD7A 3T9YA 4KOVA 1S7KA 5KTCA 4H6UA 4CGLA 4KORA 4KVOE 4HNYB 1M1DA 4UFWA 3N7ZA 3ZJ0A 4PV6A 2YNCA 4CYPA 3FYNA 1YGHA 5F48A 3GY9A 2DPSA 1Q2YA 4IF5A 2VI7A 4R9MA 5DWNA 2VQYA 4XPLA 4ORFA 3SXNA 3S6GA 4L89A 5G21A 2HV2A 5G1ZA 4A2ZA 2RC4A 3TTHA 4MFKA 4CAXA 3S6FA 2VBQA 2O28A 4HNXB 2YNCC 4C7HA 3PZJA 2FIWA 2BEIA 3NE7A 4AB7A 2C27A 4NEXA 3PGPA 4AG7A 3BJ7A 3RYOA 3S6KA 4E2AA 2OU2A 3FRMA 4MFLA 4I49A 4KSAA 3EO4A 1KZFA 4MFJA 1MJBA 4UBRA 2CY2A 3V8IA 5J8FA 4KVME 5F49A 3IU1A 3P2FA 3DSBA 5GCNA 4KS9A 1KUYA 1TIQA 3DNSA 4OAEA 2Q04A 4UA3A 4JXQA 1IB1E 1PUAA 4CAWA 2Z3PA 1QSRA 1XIXA 1YVOA 3EY5A 3R9FA 1YK3A 1I1DA 3TO6A 2REEA 1L0CA 4PSWA 4KUBA 2FE7A 2EVNA 2NMTA 5I0CA 2I00A 2B3VA 1BOBA 3CXSA 2CNSA 2PSWA 4RS2A 2R98A 5AGEA 1R57A 1XEBA 4QB9A 2GE3A 3IU2A 3EXNA 3VWDA 2VZYA 4H6ZA 2Z3NA 2JEVA 1U6MA 4C7IA 3EC4A 4MHDA 1J4JA 4B5PB 3R95A 4NXYA 4UCMA 5H84A 4UCNA 1NSLA 4PK3A 1YX0A 1I12A 3QAHA 2ZXVA 3DDDA 2P6FA 3EFAA 5C88A 4XNHC 4Q38A 3K9UA 1LRZA 2FSRA 4L8AA 4C2XA 3KKWA 3P2HA 4MY3A 2OZHA 1KUXA 2H5MA 5EBVA 2QECA 2R1IA 2PQ8A 2REFA 3D2PA 5H86A 5IV0A 4UCPA 4MBUA 4Y49B 2Z3LA 2FCKA 2ZW7A 4ZBGA 4E8OA 4AVCA 2YNDA 3W6XA 3JVNA 2F5IA 4KUAA 3JTKA 2OB0A 2ATRA 2HUZA 4NSQA 3WR7A 2B4DA 4F0XA 2GANA 2PC1A 4C68A 4XPKA 3IWEA 1S3ZA 1P4NA 2P6EA 2HQYA 2VXKA 4CRYB 2X7BA 4KOXA 3TT2A 2CNMA 4CGOA 4CYQA 1Z4RA 3I3GA 3T90A 3G8WA 5EC4A 4JJXA 5C82A 1B6BA 1Q2DA 1WWZA 2OZGA 2R7HA 4X5KA 4FD4A 5AG6A 5IB0A 2P0WA 4JXRA 1IYLA 4ONUA 2Z3MA 5JPHA 5G20A 4HNWB 2K5TA 2DXQA 2D4OA 4BBHA 2JDDA 4A95A 4UFVA 2I79A 4H89A 4U9ZA 2QIRA 2YGWA 3W91A 3PP9A 2J8MA 4B10A 1RXTA 2FS5A 2Q0YA 3FBUA 4KOSA 4FD6A 2WPXA 2VZZA 2Z3OA 2JDCA 2WUUA 1RO5A 4QVTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F5B A;  4IUS A;  5DWM A;  1IYK A;  3TO7 A;  5KTA A;  2B5G A;  3BLN A;  2G3T A;  3IWG A;  4E0A A;  1N71 A;  1OZP A;  1M4G A;  4F0Y A;  1M44 A;  4OAD A;  3G3S A;  5E96 A;  1YVK A;  3OWC A;  3TE4 A;  4XPD C;  2ZW4 A;  2IL4 A;  2GIV A;  1S7F A;  4KOU A;  1IIC A;  3F0A A;  4KVX A;  4NCZ A;  1Y9W A;  1S7L A;  3LD2 A;  4QUS A;  4QBJ A;  4M85 A;  2Q4V A;  4R57 A;  2G0B A;  3C26 A;  1PU9 A;  5KTD A;  3LOD A;  3FB3 A;  2BUE A;  2AE6 A;  4K30 A;  4JD6 A;  4CS0 B;  1S5K A;  2VEZ A;  4AVB A;  1NMT A;  2Z11 A;  1MJ9 A;  4PSX A;  3W6S A;  1QSM A;  3D8P A;  3TOB A;  1S60 A;  3R96 A;  2A4N A;  1Q2C A;  5HH1 A;  4U5Y A;  5IX3 A;  3CXP A;  3F8K A;  3FNC A;  4KZT A;  4KOY A;  2OZU A;  3R9G A;  4YFJ A;  3TOA A;  2FT0 A;  4QC6 A;  4XNH B;  3QB8 A;  1YR0 A;  1P0H A;  2PR1 A;  3TO9 A;  3JUW A;  1V0C A;  1I21 A;  2Q7B A;  4UWI A;  2BSW A;  4AG9 A;  1MK4 A;  1Z9U A;  4KLV A;  5FVJ A;  4KOT A;  1MJA A;  2P6G A;  2Q4Y A;  1IID A;  1KUV A;  4JLY A;  4MI4 A;  3S6H A;  2Q44 A;  4GS4 A;  2PRB A;  3FIX A;  4MJ8 A;  2ZW6 A;  4M3S A;  5CNP A;  2B3U A;  1S7N A;  1CJW A;  2Z0Z A;  2B4B A;  4OLL A;  1ON0 A;  3D3S A;  2BL1 A;  3SHP A;  4F6A A;  1B87 A;  3VWE A;  2B58 A;  4NF1 A;  1Y7R A;  3TCV A;  2PDO A;  2FIA A;  3E0K A;  4U9Y A;  1VKC A;  4B5P A;  4JWP A;  4RI1 A;  1GHE A;  1XMT A;  2B4D B;  3GKR A;  3R1K A;  1CM0 A;  1Z4E A;  1FY7 A;  2FXF A;  4LX9 A;  4R3L A;  2QML A;  2ZPA A;  5F46 A;  3I9S A;  4YGO A;  3SXO A;  4FD5 A;  3MGD A;  4LUA A;  2J8R A;  1XF8 A;  2CNT A;  2D4P A;  4CAV A;  1M4I A;  4KOW A;  2AJ6 A;  2EUI A;  4KLW A;  4BMH A;  2G3A A;  1QSN A;  4EVY A;  4R87 A;  5J8C A;  3D2M A;  1K4J A;  1NE9 A;  5JQ4 A;  1Y9K A;  2J8N A;  3H4Q A;  4J3G A;  3ZZI A;  2R8V A;  1BO4 A;  4HKF A;  4MY0 A;  2PR8 A;  3IGR A;  3DR6 A;  3CXQ A;  3TFY A;  4Y49 C;  1YRE A;  2KCW A;  4R3K A;  1QST A;  4UWJ A;  4XPD B;  4II9 A;  1M4D A;  3FXT A;  3GYA A;  2Y0M A;  2B5G B;  1UFH A;  2JLM A;  3BJ8 A;  2OH1 A;  2ARH A;  4CRZ B;  1SQH A;  4AVA A;  3B8G A;  2WPW A;  4YRH A;  1XE4 A;  1QSO A;  4PK2 A;  2FL4 A;  3R9E A;  4DNC A;  1VHS A;  1WK4 A;  3DR8 A;  2Z10 A;  2ZW5 A;  4B5O A;  1YLE A;  5HMN A;  5ISV A;  5F47 A;  3UY5 A;  4FD7 A;  3T9Y A;  4KOV A;  1S7K A;  5KTC A;  4H6U A;  4KOR A;  4KVO E;  4HNY B;  1M1D A;  3N7Z A;  3ZJ0 A;  4PV6 A;  3FYN A;  1YGH A;  5F48 A;  3GY9 A;  1Q2Y A;  4IF5 A;  2VI7 A;  4R9M A;  5DWN A;  2VQY A;  4XPL A;  4ORF A;  3SXN A;  3S6G A;  4L89 A;  2HV2 A;  2RC4 A;  3TTH A;  4CAX A;  3S6F A;  2VBQ A;  2O28 A;  4HNX B;  3PZJ A;  2FIW A;  2BEI A;  3NE7 A;  4AB7 A;  2C27 A;  4NEX A;  3PGP A;  4AG7 A;  3BJ7 A;  3RYO A;  3S6K A;  4E2A A;  2OU2 A;  3FRM A;  4I49 A;  3EO4 A;  1KZF A;  1MJB A;  4UBR A;  2CY2 A;  3V8I A;  5J8F A;  4KVM E;  5F49 A;  3P2F A;  3DSB A;  5GCN A;  1KUY A;  1TIQ A;  3DNS A;  4OAE A;  2Q04 A;  4UA3 A;  4JXQ A;  1IB1 E;  1PUA A;  4CAW A;  1QSR A;  1XIX A;  1YVO A;  3EY5 A;  3R9F A;  1YK3 A;  1I1D A;  3TO6 A;  2REE A;  1L0C A;  4PSW A;  4KUB A;  2FE7 A;  2EVN A;  2NMT A;  5I0C A;  2I00 A;  2B3V A;  1BOB A;  3CXS A;  2CNS A;  2PSW A;  4RS2 A;  2R98 A;  1R57 A;  1XEB A;  4QB9 A;  2GE3 A;  3EXN A;  3VWD A;  2VZY A;  4H6Z A;  2JEV A;  1U6M A;  3EC4 A;  4MHD A;  1J4J A;  4B5P B;  3R95 A;  4NXY A;  5H84 A;  1NSL A;  4PK3 A;  1YX0 A;  1I12 A;  3QAH A;  2ZXV A;  3DDD A;  2P6F A;  3EFA A;  5C88 A;  4XNH C;  3K9U A;  1LRZ A;  2FSR A;  4L8A A;  3KKW A;  3P2H A;  4MY3 A;  2OZH A;  1KUX A;  2H5M A;  5EBV A;  2QEC A;  2R1I A;  2PQ8 A;  2REF A;  3D2P A;  5H86 A;  5IV0 A;  4MBU A;  4Y49 B;  2FCK A;  2ZW7 A;  4ZBG A;  4E8O A;  4AVC A;  3W6X A;  3JVN A;  2F5I A;  4KUA A;  2OB0 A;  2ATR A;  2HUZ A;  4NSQ A;  3WR7 A;  2B4D A;  2GAN A;  2PC1 A;  4XPK A;  1S3Z A;  1P4N A;  2P6E A;  2HQY A;  2VXK A;  4CRY B;  2X7B A;  4KOX A;  3TT2 A;  2CNM A;  1Z4R A;  3I3G A;  3T90 A;  3G8W A;  5EC4 A;  4JJX A;  5C82 A;  1B6B A;  1Q2D A;  1WWZ A;  2OZG A;  2R7H A;  4X5K A;  4FD4 A;  5IB0 A;  2P0W A;  4JXR A;  1IYL A;  4ONU A;  5JPH A;  4HNW B;  2K5T A;  2DXQ A;  2D4O A;  2JDD A;  2I79 A;  4H89 A;  4U9Z A;  2QIR A;  3W91 A;  3PP9 A;  2J8M A;  1RXT A;  2FS5 A;  2Q0Y A;  3FBU A;  4KOS A;  4FD6 A;  2WPX A;  2VZZ A;  2JDC A;  1RO5 A;  4QVT A; 
#chains in the Genus database with same CATH topology
 1IGB A;  5THW A;  3F5B A;  3K9T A;  2XEJ A;  4IUS A;  4A37 A;  2ZEP A;  5DWM A;  1IYK A;  3WAB A;  4RN7 A;  3TO7 A;  6CPA A;  5KTA A;  1VGY A;  2B5G A;  4A31 A;  3BLN A;  2G3T A;  3IWG A;  2ZEG A;  4E0A A;  4HPS A;  1XBU A;  1N71 A;  3ISX A;  2V8D A;  1OZP A;  3IC1 A;  1M4G A;  5A27 A;  4P6Y A;  4H2K A;  2C6P A;  4TWE A;  4F0Y A;  1M44 A;  4OAD A;  1AUG A;  3G3S A;  3KL9 A;  5E96 A;  1YVK A;  3OWC A;  1Z8T A;  2WZN A;  4UFX A;  4XPD C;  3TE4 A;  1ARL A;  4A33 A;  5IB9 A;  1ZG7 A;  2ZW4 A;  4IK2 A;  2IL4 A;  3FX6 A;  3IJ3 A;  2GIV A;  3SI0 A;  1S7F A;  4KOU A;  3H8E A;  1AYE A;  1IIC A;  3F0A A;  4CAE A;  4KVX A;  4NCZ A;  3WC5 A;  1Y9W A;  4B11 A;  1S7L A;  1VHO A;  3LD2 A;  4MRI A;  2J9A A;  1ELM P;  4QUS A;  2ZOF A;  1IY7 A;  4A38 A;  2Z3K A;  1JQG A;  4C2Y A;  4QBJ A;  1M4L A;  3PRT A;  4M85 A;  2Q4V A;  2ZOG A;  4R57 A;  1UWY A;  2DEA A;  2G0B A;  5K8P A;  1F2O A;  3C26 A;  1ARM A;  1PYT B;  2PE3 A;  2V8H A;  1PU9 A;  2JBK A;  4P45 A;  5KTD A;  4X3R A;  3LOD A;  3FB3 A;  2C6C A;  4CAF A;  1ZG8 A;  2EK8 A;  1VIX A;  2BUE A;  2AE6 A;  3KAS A;  4K30 A;  4JD6 A;  3V7Z A;  3GIU A;  4MFP A;  4PXE A;  4CS0 B;  1S5K A;  2VEZ A;  3NH5 A;  3PBB A;  4R8F A;  1F2P A;  3FMC A;  1NMT A;  2Z11 A;  4AVB A;  4CPA A;  4TNU A;  1MJ9 A;  2HC9 A;  4PSX A;  1QSM A;  3W6S A;  4EWT A;  3D68 A;  1A2Z A;  1ZO0 A;  1QQ9 A;  3D8P A;  3CPA A;  3FEE A;  3TOB A;  4IAV A;  4P4B A;  1S60 A;  2IMO A;  2A4N A;  3PB8 X;  3R96 A;  1Q2C A;  5HH1 A;  2OR4 A;  4U5Y A;  5IX3 A;  3CXP A;  3F8K A;  3BXM A;  3FNC A;  4KZT A;  4CYN A;  1XJO A;  4ZX9 A;  1LCP A;  4KOY A;  2JEW A;  2OZU A;  3R9G A;  2QVP A;  4YFJ A;  2ZED A;  5JGF A;  5JM6 A;  3TOA A;  5K8M A;  2FT0 A;  3NH8 A;  5LRG A;  4QC6 A;  3CPX A;  4XNH B;  1LFW A;  3L2N A;  2GFQ A;  3QB8 A;  1YR0 A;  4MCP A;  2ZEE A;  1P0H A;  2PR1 A;  3TO9 A;  2O53 A;  3JUW A;  3LWU A;  1V0C A;  2EO8 A;  3JRU A;  1I21 A;  3RZA A;  3CZX A;  3IEH A;  5EMI A;  2Q7B A;  3KQX A;  4UWI A;  1ELL P;  2BSW A;  2PJ4 A;  2PVV A;  4R6T A;  1MK4 A;  4AG9 A;  2NSM A;  3D66 A;  1Z9U A;  3KI9 A;  4KLV A;  5FVJ A;  4F8Z A;  4KOT A;  1MJA A;  2P6G A;  5AG7 A;  3D7D A;  2Q4Y A;  2ZEL A;  1IID A;  4NFR A;  1KUV A;  4JLY A;  4MI4 A;  3S6H A;  2Q44 A;  4GS4 A;  2PRB A;  1BLL E;  3FIX A;  2PCU A;  3FVL A;  3ISZ A;  2ZW6 A;  4M3S A;  4MJ8 A;  5CNP A;  3S9N A;  4OC4 A;  3PFO A;  2B3U A;  1S7N A;  4UEE A;  4F9U A;  1CJW A;  4BD9 A;  3RNZ A;  5A28 A;  2Z0Z A;  2B4B A;  4OID A;  3I1U A;  4OLL A;  5G22 A;  1ON0 A;  2PJ3 A;  3D3S A;  1R43 A;  4YWY A;  2BL1 A;  3SHP A;  3MRU A;  3SJE A;  4F6A A;  1B87 A;  3VWE A;  2ZEH A;  4JZ0 A;  3MN8 A;  2B58 A;  4B12 A;  2PJ5 A;  4NF1 A;  4B14 A;  2FVG A;  4DUK A;  1Y7R A;  3TCV A;  3KR4 A;  5AG4 A;  2PDO A;  3BHX A;  2FIA A;  3E0K A;  2G9D A;  4U9Y A;  2PIZ A;  3QNV A;  3PEI A;  1CPX A;  1VKC A;  4NGT A;  5JH9 A;  1Y7E A;  4B5P A;  1Z8W A;  4JWP A;  4MHY A;  4RI1 A;  1GHE A;  4A94 A;  3FH4 A;  2XEI A;  1IU8 A;  1XRY A;  1XMT A;  2B4D B;  3GKR A;  4R76 A;  3WT4 A;  2BOA A;  4CGM A;  1YQE A;  3R1K A;  1CG2 A;  1CM0 A;  1FY7 A;  1Z4E A;  2FXF A;  4LX9 A;  4R3L A;  2F7V A;  5LYD A;  2QML A;  4R7M A;  2CXA A;  2NYQ A;  2ZPA A;  3CDX A;  3B35 A;  5AG5 A;  5F46 A;  3I9S A;  4YGO A;  2OOT A;  4Q36 A;  4UEF A;  2IQ6 A;  4UEZ A;  5HXD A;  3NE8 A;  3SXO A;  2EWB A;  3A9L A;  4FD5 A;  2QYV A;  3MGD A;  4LUA A;  4UIA A;  2J8R A;  4MFQ A;  2DF5 A;  4ZX8 A;  1TKH A;  1XF8 A;  2CNT A;  3QAY A;  4NGR A;  4OC2 A;  4OME A;  2D4P A;  4CAV A;  1M4I A;  2Q51 A;  2AJ6 A;  4KOW A;  4P10 A;  3V38 A;  1Y0Y A;  2BO9 A;  2EUI A;  7CPA A;  4KLW A;  3VH9 A;  4BMH A;  3LAC A;  2G3A A;  1QSN A;  1CBX A;  4R87 A;  5D29 A;  4EVY A;  5J8C A;  2JBJ A;  3D2M A;  2WSA A;  1K4J A;  4NJR A;  3H5Z A;  1NE9 A;  1TKF A;  5JQ4 A;  4ZGY B;  1Y9K A;  2J8N A;  2VL1 A;  3H4Q A;  3T8W A;  1HDQ A;  1VHE A;  4J3G A;  4JYW A;  3ZZI A;  2R8V A;  1BO4 A;  4HKF A;  4MY0 A;  4A32 A;  2PR8 A;  2V8G A;  3IGR A;  4KSI A;  4YU9 A;  4GM5 A;  5DS0 A;  3DR6 A;  4CGN A;  4P44 A;  3CXQ A;  3TFY A;  3VAR A;  2CTC A;  1FNO A;  4Y49 C;  1YRE A;  2KCW A;  4R3K A;  1QST A;  3KZW A;  4UWJ A;  4B13 A;  2ZEN A;  4XPD B;  4FWU A;  1M4D A;  2V77 A;  3FXT A;  5BWA B;  4II9 A;  3KGQ A;  2AFX A;  3RAM A;  4ZY0 A;  3GYA A;  2Y0M A;  2PJ1 A;  3GB0 A;  2B5G B;  1UFH A;  2JLM A;  4IHM A;  1X10 A;  4C2Z A;  3BJ8 A;  4CYO A;  2OH1 A;  1KWM A;  2ARH A;  4MFZ A;  4CRZ B;  1SQH A;  4AVA A;  1BPM A;  3B8G A;  2PJ9 A;  2WPW A;  4DYO A;  3S9L A;  4KSF A;  4YRH A;  1XE4 A;  3IIB A;  2Q7S A;  1QSO A;  4PK2 A;  2DPT A;  2CIJ A;  2O4H A;  2PJA A;  4CGP A;  2FL4 A;  3R9E A;  4DNC A;  2C1C A;  1VHS A;  2RFH A;  1WK4 A;  3DR8 A;  2YNE A;  3HUV A;  1RO5 A;  2GRE A;  3PB6 X;  2Z10 A;  2ZW5 A;  4MHN A;  1EE3 P;  4MCR A;  4B5O A;  3D67 A;  1YLE A;  3IWW A;  3PB4 X;  5HMN A;  1ZG9 A;  5ISV A;  2PIY A;  4A30 A;  4P4D A;  5F47 A;  3UY5 A;  4FD7 A;  2C6G A;  3T9Y A;  4KOV A;  4M6H A;  1S7K A;  4OP4 A;  2BCO A;  5KTC A;  1CP6 A;  2ZEM A;  4LQ6 A;  1X12 A;  4H6U A;  1Z2L A;  4KOR A;  4KVO E;  5ELY A;  3HLP A;  3WC7 A;  4HNY B;  1M1D A;  4CGL A;  4UFW A;  3N7Z A;  3ZJ0 A;  4EME A;  4PV6 A;  4K3N A;  3PFE A;  1Z8X A;  2YNC A;  4CYP A;  5LYF A;  3FYN A;  1YGH A;  5F48 A;  4EFD A;  4RUH A;  3GY9 A;  1DTD A;  2DPS A;  3TX8 A;  1Q2Y A;  2PJ7 A;  4IF5 A;  4OC1 A;  2VI7 A;  4R9M A;  5DWN A;  2VQY A;  4XPL A;  4W9Y A;  4ORF A;  1TF9 A;  3SXN A;  1NSA A;  3FED A;  1CPS A;  3S6G A;  3NA6 A;  1Z8L A;  4L89 A;  5G21 A;  2HV2 A;  5G1Z A;  4A2Z A;  2RC4 A;  3TTH A;  4MFK A;  4CAX A;  3S6F A;  2GU2 A;  2POK A;  2VBQ A;  2O28 A;  4NGN A;  4HNX B;  2YNC C;  4C7H A;  4NGP A;  3B3C A;  3PZJ A;  2FIW A;  2BEI A;  3NE7 A;  4AB7 A;  4PQA A;  4B6Z A;  2C27 A;  4NEX A;  4X2T A;  3PGP A;  4AG7 A;  4UIB A;  3BJ7 A;  1TXR A;  3RYO A;  3S6K A;  4E2A A;  4FUU A;  1CX8 A;  2OU2 A;  3FRM A;  4MFL A;  5LYI A;  4I49 A;  4KSA A;  3EO4 A;  4OC3 A;  2PJ0 A;  1KZF A;  4MFJ A;  2PVW A;  1MJB A;  1YLO A;  3FF3 A;  2CY2 A;  2QJ8 A;  1YSJ A;  4UBR A;  3V8I A;  2V8V A;  5J8F A;  4KVM E;  5HVF A;  1LAM A;  3WC6 A;  2GLF A;  5F49 A;  2ODF A;  3D7G A;  3FJU A;  3IU1 A;  3P2F A;  3D7H A;  3DGV A;  3DSB A;  4MCQ A;  5GCN A;  4KS9 A;  4M6I A;  5HVG A;  4AXV A;  4M6G A;  2RB7 A;  1KUY A;  4P4I A;  2CF4 A;  1BPN A;  4OC0 A;  1TIQ A;  3DNS A;  4OAE A;  4OIW A;  2Q04 A;  4MHP A;  4UA3 A;  2Q43 A;  4JXQ A;  4MHZ A;  1IB1 E;  1PUA A;  1FT7 A;  4CAW A;  2Z3P A;  4F9V A;  1QSR A;  1XIX A;  1OBR A;  1YVO A;  3EY5 A;  4P4E A;  1BAV A;  3KR5 A;  3R9F A;  1RTQ A;  4Z65 A;  1H8L A;  1YK3 A;  4MMO A;  1I1D A;  3TO6 A;  1Y0R A;  2REE A;  1L0C A;  1PCA A;  3PB7 X;  4KUB A;  1Q7L A;  4PSW A;  3B3T A;  4PXC A;  2FE7 A;  5CBM A;  2EBJ A;  2EVN A;  4DJL A;  2NMT A;  5I0C A;  2I00 A;  4P4F A;  2B3V A;  1BOB A;  2XEF A;  1GYT A;  3CXS A;  2CNS A;  4MXU A;  2PSW A;  4RS2 A;  2R98 A;  5AGE A;  4NGM A;  1R57 A;  1XEB A;  3KHZ A;  3D4U A;  2GE3 A;  4QB9 A;  3IU2 A;  3GLJ A;  2CTB A;  3EXN A;  3CT9 A;  4WWV A;  3VWD A;  2VZY A;  4H6Z A;  2PRQ A;  2PJC A;  1LAN A;  3B2Y A;  1XMB A;  2Z3N A;  2JEV A;  3SJF A;  1U6M A;  4C7I A;  3EC4 A;  4MHD A;  1J4J A;  4B5P B;  3R95 A;  4ZI6 A;  3H8F A;  3D7F A;  1LOK A;  4NXY A;  2PJ2 A;  4UCM A;  2PJ6 A;  3NFZ A;  5H84 A;  3B3W A;  3KHX A;  4FBE A;  4UCN A;  5HVH A;  1NSL A;  4PK3 A;  3S9M A;  1YX0 A;  1IOF A;  1I12 A;  1Z5R A;  3LMS A;  1XOV A;  3QAH A;  2ZXV A;  5LYL A;  1QMU A;  3DDD A;  2P6F A;  3FEC A;  3EFA A;  5C88 A;  4X8I A;  2PJB A;  1YW4 A;  4XNH C;  4Q38 A;  3BI1 A;  3K9U A;  4NGQ A;  3SJX A;  1LRZ A;  2FSR A;  4L8A A;  4C2X A;  3KKW A;  2ZEO A;  3P2H A;  1YME A;  3IFE A;  4MY3 A;  2OZH A;  1KUX A;  2H5M A;  5EBV A;  4MCS A;  3N5F A;  2QEC A;  3GUX A;  2R1I A;  2PQ8 A;  2REF A;  3D2P A;  3H8G A;  5H86 A;  4A39 A;  5IV0 A;  4UCP A;  4FAI A;  4MBU A;  3PB9 X;  4Y49 B;  1XFO A;  2GLJ A;  5F09 A;  5I4M A;  4OKO A;  2Z3L A;  2FCK A;  2ZW7 A;  4Q7A A;  4ZBG A;  4O23 A;  3RO0 A;  4E8O A;  2ABZ A;  4AVC A;  1TF8 A;  2YND A;  2AFW A;  3JVN A;  3W6X A;  2WYR A;  4ZY1 A;  3SI2 A;  3IO1 A;  2F5I A;  4G1P A;  3B3V A;  4KUA A;  3JTK A;  4ONW A;  1DE4 C;  2OB0 A;  2ATR A;  2HUZ A;  5J1Q A;  1AMP A;  4PXD A;  4NSQ A;  1HDU A;  2B4D A;  3WR7 A;  4F0X A;  1IOI A;  2GAN A;  2PC1 A;  4C68 A;  4XPK A;  2ANP A;  2PJ8 A;  3B3S A;  3IWE A;  1S3Z A;  1P4N A;  2AFS A;  2P6E A;  2HQY A;  2VXK A;  3SJG A;  4CRY B;  2X7B A;  1CP7 A;  4KOX A;  3TT2 A;  1JWQ A;  2CNM A;  4CGO A;  4CYQ A;  1Z4R A;  3I3G A;  3T90 A;  3G8W A;  4LQG A;  5EC4 A;  2I3C A;  4JJX A;  3SI1 A;  4ZY2 A;  2AFM A;  1B6B A;  1Q2D A;  4P4J A;  3TC8 A;  3VAT A;  5C82 A;  1WWZ A;  8CPA A;  2OZG A;  4PPZ A;  2R7H A;  3NH4 A;  4X5K A;  4BIN A;  4FD4 A;  5K8N A;  5AG6 A;  2AFU A;  2XEG A;  4WJB A;  3RBU A;  2P0W A;  1ZLI A;  1TKJ A;  4JXR A;  5IB0 A;  3PBE A;  2AFO A;  2EK9 A;  1IYL A;  3B7I A;  1HEE A;  2Z3M A;  2F8H A;  4NGS A;  4ONU A;  1R3N A;  5LRJ A;  5JPH A;  5G20 A;  1F57 A;  2HB6 A;  4HNW B;  3BI0 A;  2K5T A;  3DLJ A;  5K8O A;  2DXQ A;  4ZYQ A;  2D4O A;  4NJQ A;  4BBH A;  5CPA A;  4PXB A;  2JDD A;  4A95 A;  4UFV A;  2I79 A;  4H89 A;  4U9Z A;  2AFZ A;  2QIR A;  2YGW A;  2ZEF A;  5D8N A;  3PP9 A;  3W91 A;  2J8M A;  4B10 A;  1RXT A;  1ZLH A;  2FS5 A;  4GXH A;  2Q0Y A;  1LAP A;  3FBU A;  4KOS A;  5LRK A;  4UF4 A;  3K2K A;  4FD6 A;  2WPX A;  2Q4Z A;  4OC5 A;  2VZZ A;  2Z3O A;  2JDC A;  2WUU A;  2IJZ A;  1YW6 A;  4QVT A;  3KQZ A; 
#chains in the Genus database with same CATH homology
 3F5B A;  4IUS A;  5DWM A;  1IYK A;  3TO7 A;  5KTA A;  2B5G A;  4A31 A;  3BLN A;  2G3T A;  3IWG A;  4E0A A;  1N71 A;  1OZP A;  1M4G A;  5A27 A;  4F0Y A;  1M44 A;  4OAD A;  3G3S A;  5E96 A;  1YVK A;  3OWC A;  4UFX A;  3TE4 A;  4XPD C;  4A33 A;  2ZW4 A;  2IL4 A;  2GIV A;  1S7F A;  4KOU A;  1IIC A;  3F0A A;  4CAE A;  4KVX A;  4NCZ A;  1Y9W A;  4B11 A;  1S7L A;  3LD2 A;  4QUS A;  2Z3K A;  4C2Y A;  4QBJ A;  4M85 A;  2Q4V A;  4R57 A;  2G0B A;  3C26 A;  1PU9 A;  5KTD A;  3LOD A;  3FB3 A;  4CAF A;  2BUE A;  2AE6 A;  4K30 A;  4JD6 A;  4MFP A;  4CS0 B;  1S5K A;  2VEZ A;  4AVB A;  1NMT A;  2Z11 A;  1MJ9 A;  4PSX A;  3W6S A;  1QSM A;  1ZO0 A;  3D8P A;  3TOB A;  1S60 A;  3R96 A;  2A4N A;  1Q2C A;  5HH1 A;  4U5Y A;  5IX3 A;  3CXP A;  3F8K A;  3FNC A;  4KZT A;  4CYN A;  4KOY A;  2OZU A;  3R9G A;  4YFJ A;  3TOA A;  2FT0 A;  4QC6 A;  4XNH B;  3QB8 A;  1YR0 A;  1P0H A;  2PR1 A;  3TO9 A;  3JUW A;  1V0C A;  1I21 A;  2Q7B A;  4UWI A;  2BSW A;  4AG9 A;  1MK4 A;  1Z9U A;  4KLV A;  5FVJ A;  4KOT A;  1MJA A;  2P6G A;  5AG7 A;  2Q4Y A;  1IID A;  1KUV A;  4JLY A;  4MI4 A;  3S6H A;  2Q44 A;  4GS4 A;  2PRB A;  3FIX A;  4MJ8 A;  2ZW6 A;  4M3S A;  5CNP A;  2B3U A;  1S7N A;  1CJW A;  5A28 A;  2Z0Z A;  2B4B A;  4OLL A;  5G22 A;  1ON0 A;  3D3S A;  2BL1 A;  3SHP A;  4F6A A;  1B87 A;  3VWE A;  2B58 A;  4B12 A;  4NF1 A;  4B14 A;  1Y7R A;  3TCV A;  5AG4 A;  2PDO A;  2FIA A;  3E0K A;  4U9Y A;  1VKC A;  4B5P A;  4JWP A;  4RI1 A;  1GHE A;  1XMT A;  2B4D B;  3GKR A;  4CGM A;  3R1K A;  1CM0 A;  1Z4E A;  1FY7 A;  2FXF A;  4LX9 A;  4R3L A;  2QML A;  2CXA A;  2ZPA A;  5AG5 A;  5F46 A;  3I9S A;  4YGO A;  4Q36 A;  3SXO A;  3A9L A;  4FD5 A;  3MGD A;  4LUA A;  2J8R A;  4MFQ A;  1XF8 A;  2CNT A;  2D4P A;  4CAV A;  1M4I A;  4KOW A;  2AJ6 A;  2EUI A;  4KLW A;  4BMH A;  2G3A A;  1QSN A;  4EVY A;  4R87 A;  5J8C A;  3D2M A;  2WSA A;  1K4J A;  3H5Z A;  1NE9 A;  5JQ4 A;  4ZGY B;  1Y9K A;  2J8N A;  3H4Q A;  4J3G A;  3ZZI A;  4A32 A;  2R8V A;  1BO4 A;  4HKF A;  4MY0 A;  2PR8 A;  3IGR A;  4CGN A;  3DR6 A;  3CXQ A;  3TFY A;  4Y49 C;  1YRE A;  2KCW A;  4R3K A;  1QST A;  5BWA B;  4UWJ A;  4B13 A;  4XPD B;  4II9 A;  1M4D A;  3FXT A;  3GYA A;  2Y0M A;  2B5G B;  1UFH A;  2JLM A;  4C2Z A;  4CYO A;  3BJ8 A;  2OH1 A;  2ARH A;  4MFZ A;  4CRZ B;  1SQH A;  4AVA A;  3B8G A;  2WPW A;  4KSF A;  4YRH A;  1XE4 A;  1QSO A;  4PK2 A;  2DPT A;  4CGP A;  2FL4 A;  3R9E A;  4DNC A;  1VHS A;  1WK4 A;  3DR8 A;  2YNE A;  2Z10 A;  2ZW5 A;  4B5O A;  1YLE A;  5HMN A;  5ISV A;  4A30 A;  5F47 A;  3UY5 A;  4FD7 A;  3T9Y A;  4KOV A;  1S7K A;  5KTC A;  4H6U A;  4CGL A;  4KOR A;  4KVO E;  4HNY B;  1M1D A;  4UFW A;  3N7Z A;  3ZJ0 A;  4PV6 A;  2YNC A;  4CYP A;  3FYN A;  1YGH A;  5F48 A;  3GY9 A;  2DPS A;  1Q2Y A;  4IF5 A;  2VI7 A;  4R9M A;  5DWN A;  2VQY A;  4XPL A;  4ORF A;  3SXN A;  3S6G A;  4L89 A;  5G21 A;  2HV2 A;  5G1Z A;  4A2Z A;  2RC4 A;  3TTH A;  4MFK A;  4CAX A;  3S6F A;  2VBQ A;  2O28 A;  4HNX B;  2YNC C;  4C7H A;  3PZJ A;  2FIW A;  2BEI A;  3NE7 A;  4AB7 A;  2C27 A;  4NEX A;  3PGP A;  4AG7 A;  3BJ7 A;  3RYO A;  3S6K A;  4E2A A;  2OU2 A;  3FRM A;  4MFL A;  4I49 A;  4KSA A;  3EO4 A;  1KZF A;  4MFJ A;  1MJB A;  4UBR A;  2CY2 A;  3V8I A;  5J8F A;  4KVM E;  5F49 A;  3IU1 A;  3P2F A;  3DSB A;  5GCN A;  4KS9 A;  1KUY A;  1TIQ A;  3DNS A;  4OAE A;  2Q04 A;  4UA3 A;  4JXQ A;  1IB1 E;  1PUA A;  4CAW A;  2Z3P A;  1QSR A;  1XIX A;  1YVO A;  3EY5 A;  3R9F A;  1YK3 A;  1I1D A;  3TO6 A;  2REE A;  1L0C A;  4PSW A;  4KUB A;  2FE7 A;  2EVN A;  2NMT A;  5I0C A;  2I00 A;  2B3V A;  1BOB A;  3CXS A;  2CNS A;  2PSW A;  4RS2 A;  2R98 A;  5AGE A;  1R57 A;  1XEB A;  4QB9 A;  2GE3 A;  3IU2 A;  3EXN A;  3VWD A;  2VZY A;  4H6Z A;  2Z3N A;  2JEV A;  1U6M A;  4C7I A;  3EC4 A;  4MHD A;  1J4J A;  4B5P B;  3R95 A;  4NXY A;  4UCM A;  5H84 A;  4UCN A;  1NSL A;  4PK3 A;  1YX0 A;  1I12 A;  3QAH A;  2ZXV A;  3DDD A;  2P6F A;  3EFA A;  5C88 A;  4XNH C;  4Q38 A;  3K9U A;  1LRZ A;  2FSR A;  4L8A A;  4C2X A;  3KKW A;  3P2H A;  4MY3 A;  2OZH A;  1KUX A;  2H5M A;  5EBV A;  2QEC A;  2R1I A;  2PQ8 A;  2REF A;  3D2P A;  5H86 A;  5IV0 A;  4UCP A;  4MBU A;  4Y49 B;  2Z3L A;  2FCK A;  2ZW7 A;  4ZBG A;  4E8O A;  4AVC A;  2YND A;  3W6X A;  3JVN A;  2F5I A;  4KUA A;  3JTK A;  2OB0 A;  2ATR A;  2HUZ A;  4NSQ A;  3WR7 A;  2B4D A;  4F0X A;  2GAN A;  2PC1 A;  4C68 A;  4XPK A;  3IWE A;  1S3Z A;  1P4N A;  2P6E A;  2HQY A;  2VXK A;  4CRY B;  2X7B A;  4KOX A;  3TT2 A;  2CNM A;  4CGO A;  4CYQ A;  1Z4R A;  3I3G A;  3T90 A;  3G8W A;  5EC4 A;  4JJX A;  5C82 A;  1B6B A;  1Q2D A;  1WWZ A;  2OZG A;  2R7H A;  4X5K A;  4FD4 A;  5AG6 A;  5IB0 A;  2P0W A;  4JXR A;  1IYL A;  4ONU A;  2Z3M A;  5JPH A;  5G20 A;  4HNW B;  2K5T A;  2DXQ A;  2D4O A;  4BBH A;  2JDD A;  4A95 A;  4UFV A;  2I79 A;  4H89 A;  4U9Z A;  2QIR A;  2YGW A;  3W91 A;  3PP9 A;  2J8M A;  4B10 A;  1RXT A;  2FS5 A;  2Q0Y A;  3FBU A;  4KOS A;  4FD6 A;  2WPX A;  2VZZ A;  2Z3O A;  2JDC A;  2WUU A;  1RO5 A;  4QVT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...