1M4VA

Crystal structure of set3, a superantigen-like protein from staphylococcus aureus
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
200
structure length
196
Chain Sequence
AKYENVTKDIFDLRDYYSGASKELKNVTGYRYSKGGKHYLIFDKHQKFTRIQIFGKDIERLKTRKNPGLDIFVVKEAETVFSYGGVTKKNQGAYYDYLNAPKFVIKKEVDAGVYTHVKRHYIYKEEVSLKELDFKLRQYLIQNFDLYKKFPKDSKIKVIMKDGGYYTFELNKKLQPHRMSDVIDGRNIEKMEANIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The three-dimensional structure of a superantigen-like protein, SET3, from a pathogenicity island of the Staphylococcus aureus genome
pubmed doi rcsb
molecule keywords SET3, superantigen-like protein
source organism Staphylococcus aureus
molecule tags Immune system
total genus 54
structure length 196
sequence length 200
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
A PF09199 SSL_OB Staphylococcal superantigen-like OB-fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1m4vA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1m4vA01
1HXYD 1SJHD 1JWSD 5ELFA 3V05A 3BVZA 5ELDA 1M4VA 5ELEA 3BVMA 3BYTB 3EA6A 1RCVD 1QILA 3BVGA 1JWUD 1G8ZD 1V1PB 5ELCA 1ET9A 1UNSA 2XRQD 1L0YB 1PTOH 4K6LA 4C56C 1STEA 2AQ3B 1I4PA 2XN9C 1I4XA 1LTID 1EU3A 1RF2D 1V1OA 1ESFA 3MC0B 1B44D 5I4DA 1ET6A 1SE4A 5FKAC 1DYQA 1S5ED 1PRTD 2Z8LA 1I4RA 2RDHA 1L0XB 1S5DD 1LTBD 4RH6A 4RCOA 1PZKD 3R8BA 1XTCD 1CQVA 4ZYSA 1I4GA 2AQ2B 1SBBB 3BZDB 2SEBD 1TS4A 4OHJA 1PRTB 1LTSD 4NZLB 1EEID 4RGMA 1ENFA 2QEJC 4BWGB 2NTTA 2TSSA 2XRSD 1JQYD 1S5FD 1S5CD 2J4XA 1EFID 4DXGA 1V1PA 1TY2A 1MD2D 1S5BD 1PTOD 1SEBD 1HQRD 1BCPD 1BXTA 1LO5D 5ELBA 1YN3A 1EU4A 1FNUA 1HA5A 2QILA 3GP7A 4DXFA 1KLGD 3OWEB 1LTTD 3DWQA 3O13A 1JR0D 1F77A 1HTLD 1CHPD 4L6TB 4RHRA 1XXGA 1JWMD 1PZJD 2ICIA 4UDUC 1TS2A 1AW7A 1PTOB 1I4QA 1T5XD 2R61A 1BCPB 1I4HA 1LTAD 1GOZA 1PYWD 2CHBD 2IJ0A 1D5MC 2O2LD 3W2DA 1FGBD 1PTOF 4RFBA 3DWAA 1BCPF 1PRTF 1TY0A 1AN8A 1RD9D 1YN5A 1LTRD 1SXTA 2AQ1B 1FNWA 1FD7D 1PRTC 1LT4D 1D5ZC 1SJED 3BYYB 5D3IB 1YN4A 1SE2A 5TSSA 3URYA 1LT6D 3DWPA 1CHQD 1TS3A 3R2TA 1EWCA 2G9HD 4Z9CB 4RGNA 5D3DA 1D5XC 1FNVA 1KTKA 1SE3A 2NTSA 2WV6D 2XNAC 1DJRD 4RGTA 3TSSA 1EEFD 1JCKB 3EFXD 2IPKD 4TSSA 1RDPD 1B1ZA 1LT5D 4O1NA 1LTGD 4L63B 1D6EC 3R2IA 1KLUD 4RGOS 1LT3D 5FK9C 3CHBD 1CT1D 1LLRD 3KLSX 4RHSA 1TS5A 1UUPA 3SEBA 1PTOC 3MFGA 1PZID 1CK1A 2RDGA 1BCPC
chains in the Genus database with same CATH superfamily
1HUMA 4AYBB 4KZ0A 5J39A 4YT0B 3PRZA 4DV5Q 3BDLA 1BQQT 5BR8L 3SFDB 3EA6A 3B08A 1EF1A 2LRUA 4URKA 3LGJA 1KDAA 4BKSA 3P4PB 1RFAA 1BT0A 4RM9A 3SDZA 4DR1L 2D2QA 4DDGD 3NE5B 4OWWB 1EF5A 4UHVA 1X56A 4C3JH 3CXCA 1VJKA 1E2ZA 1R4QB 5I4DA 4LF6Q 2HD5B 3SDLC 2JWZA 2OJWA 1GUOA 2GVBA 2Z8LA 2JA6B 2PZTA 1PH5A 2LSSA 1Z5SB 2CW0C 3RNCC 3ZXVA 2PQAB 4NXNL 3GV6A 5E3FA 2VNUD 2UYZB 2K5DA 2MJ8A 5K5PA 3HRDD 2Y5PA 1IBKL 2M17A 3B2FA 3WDNA 3TEYA 2UXBQ 1GUNA 2V4DA 2KACA 2KXJA 4JLCA 4JI5Q 3M9BA 1IBLQ 2WXIA 1TWCH 1CJEA 2L1AA 3I4LA 4DQOC 3J80i 1BOSA 4GDLB 1B3AA 3DM3A 2JYOA 3I55A 1N32Q 3S9WA 4D2KA 1N9WA 4YIJA 2ENBA 3AFQA 3T3NA 4M8NA 3PSIA 3L10B 4E71A 1BXTA 3A1QA 5LMNQ 4WJ3M 2HTHA 2F0VA 4G3XB 4ZK9B 4LCDE 3I4NH 1SYGA 3DWQA 2BB5A 2J7QB 4NB3A 2QDBA 3EECA 2F0OA 1GC7A 3W5UB 1TS2A 1Q8IA 3UINB 1J19A 1E6EB 2A5HA 2M19A 3H6NA 4MTNA 3KUDB 1WGKA 2P5ZX 4DV6Q 2KN5A 4BY7H 3N20C 4NKLA 4X65Q 4YCWA 4I6LB 3NJTA 3TN2A 2HDMA 2KD0A 1OQQA 3PRMB 2HD3A 3U58A 1FCLA 3HOZB 2CKZB 2NR2A 1OGWA 5CGKA 1Y8OB 1YN5A 3TRZA 1K8RB 4QF4A 3LB8C 1WCMG 4KDLB 1G2SA 1SIJA 2YTVA 1Y69U 3DCGA 2F3VA 5IWAL 1FD7D 1PRTC 4X3KA 2YLMA 1D5ZC 3N1XC 4YY3L 1TR5A 2B2TA 3KF8B 2PI2E 2VB2X 2NN6I 4DU9A 3VR3A 3RNUA 2JA6H 4BBSG 3PZDA 1CHQD 3OLMD 2JZZA 4XYCA 3W1SC 1N33L 1KTKA 3HKZB 4LJZC 1UEBA 4P73A 4RGTA 2NB0A 2B63G 3L2PA 1V6EA 2A69C 2IPKD 3G7LA 3KOJA 2J52A 5BO4B 1FJGL 4B3SQ 3PIP3 3CPWA 2Q8IB 1WRIA 2LXKA 5IGGA 1LTGD 1S4ZA 2IO3B 3VYRA 3PREA 5IYCH 1KH0A 4DV1Q 2YYZA 3AXCA 1NMGA 4HDOA 4ICVA 4RHSA 3M3YB 1BR9A 3NS8A 1S1QB 1B2TA 2ACZB 5EE0A 1A2TA 4GSWA 1V97A 3CCMA 3BVMA 1G6JA 1VQIA 4JG2A 1AP0A 3J81E 3FILB 3M62B 2Q2UA 1IPGA 2A73B 3NQIA 2RMMA 1A62A 1EUJA 2F0LA 4BBNF 4KTAA 2WXKA 4K6LA 4XDCA 2AQ3B 4N9F4 1STHA 3D6WA 1Y1WG 1SR3A 3KBGA 3ULJA 2Z0DB 4MT5A 4HKQA 2BOSA 4ODGA 4ZUJA 4C4VA 2WP8J 2ZNVB 5IP9G 1IXRA 4KN4C 2LMCA 4JV5L 3HOZH 4XDDA 3RT3B 1VQ7A 4ZYSA 1TXYA 2JP1A 3PIOA 5M3FB 5C3WA 4AUQC 2E8GA 3U52E 1UE1A 4DAYB 1WOCA 4IKGA 4DHJD 5JOBA 2UU9Q 1YJIA 2INPE 1U4MA 1WYWB 4BWGB 1C76A 1NY4A 1L1OC 4GS3A 4GKKQ 2OTLA 5BYSA 3S1RH 5DM73 2DENB 3K5NA 1VQNA 3Q6BA 1U4PA 1HJPA 2L9HA 2KDFB 2INNE 4RA8A 1IYVA 3ULLA 1HQRD 1QE6A 4IQZA 1VQ6A 3AE8B 3UQBA 3JYUA 5H1SE 3I73A 2I1KA 5ELOA 1KLGD 3NG0A 5I6WA 4HMIA 2I38A 2H1EA 1SNPA 2V4LA 2X38A 1F77A 1UEAB 1X55A 1J9OA 2A5UA 3RR5A 4P72A 3M3YH 4YL8A 1XMOL 4KGTA 3TMPB 1AH9A 4IWPA 3HOUG 2IJ0A 3N32A 2RF4A 4M0WA 2JE6I 1CZPA 2GMIC 4C1NK 2UXCQ 2RCFA 3VRAB 3F2CA 3VUXA 1JC7A 3A0JA 1QWYA 3MWYW 1Q7YC 1DXMA 4LFCQ 4HIDA 4NQLB 1V8CA 2IHEA 4XWWA 1N34Q 1IW7D 2N4FA 5JEAG 3SFEB 2JT4B 2X69A 3W1SA 3DBLI 3PO0A 3HOYG 1C4PA 2GBKA 1HHVA 2WNMA 4FA6A 1D3ZA 4OONA 3EJIA 1R4PB 3VH3B 3MXGA 4W9FA 5FO9B 4AP4C 1QJOA 1EOVA 1GVPA 2KEEA 4QUFA 5G2NA 1X3GA 5IA7A 3D31A 5I6YA 1UE6A 3FMCA 1MHXA 2IY1B 2KKCA 1NDDA 2LD9A 3UIOB 1P1AA 2K33A 2DWQA 1A3UA 5M3FH 3RN9C 3OJ3A 2A68D 1RDPD 2VZKD 3LJ3A 1A2UA 4F8MA 1CA5A 1PV4A 4GDKA 3AEVA 2IX0A 2FINB 5FO8B 1FXAA 4GKJQ 1Q81C 1QT9A 2KN4A 2UXDQ 1IL8A 2HHHL 3E0JA 4N59A 3AN1A 4MGZE 1HFNA 2K8BA 2F0DA 2HDLA 3NPPA 4A3CH 2F52A 1SLJA 1WGHA 3CC2A 1PZID 1FGUA 1TGZB 2JVCA 1BCPC 3AQQA 3MTNB 4LF9Q 4DR3L 2MBBB 2WDTB 1XCQL 2F4VL 1BVSA 1B4OA 1J7AA 2A6EC 1XNRQ 2RVLA 3C1FA 3G4SA 1EYGA 2L05A 1FO4A 3BYTB 3VR2A 2ZVNA 1VR9A 3UE1A 3BVGA 3Q22A 4A93G 3PV1A 5BN4A 4IURA 1JORA 2SNSA 4O0AA 2NUCA 4DAPA 1OFFA 2SAKA 4LNOA 4OZCA 4DXAB 5E6OA 4CO7A 5IYBH 1XNQQ 4DV4Q 4IC7B 2JA8B 4KHVA 2NYZD 3M7NA 3VQIA 1WR1A 4HIKA 1FXTB 1B44D 1F2YA 3NSWA 2V9HA 1FPYA 1UF0A 1WD1A 3ZTDA 4ANXA 2KYWA 3OOCA 1CZWA 2WS3B 3Q8FA 3MFYA 2BTEA 5GAEC 1RTNA 3OMCA 2LI5A 2DAJA 3RUIB 4JBWA 1QOGA 4M8MA 2YTXA 4K3CA 4R9WA 4YHHL 1L1OA 3R66C 4OIJA 3BZDB 5HI1A 4QY7A 4L1BA 1R4MB 2MJ3A 3KDFB 2PQEA 4WJNA 2UUBQ 2KMAA 2MWSB 2DGYA 4C3IG 4LK1C 2JA7B 4NZLB 4G50A 4YXDB 1WX9A 1WJ6A 4YTMB 4BXXG 1EFWA 2MBEA 2N9KA 1IZ6A 1NCVA 4REZA 3RZDH 4A3DG 5MPOA 3M4OB 2J4XA 5CHVC 5LL6S 4LF8L 2SNMA 1WM3A 4LDTD 1E10A 4ZKBB 1SEBD 2L11A 1OXTA 1EM7A 4GN5A 5ELNA 2O6VD 3DEPA 2KLCA 3KVFB 2V3PA 4A3PA 3U30A 4EVOA 1N36L 1SFOB 3AECB 3ERQA 5IKCM 1B9NA 2N88A 1SNQA 2PE9A 5LXIB 1TTNA 1SAPA 1PZJD 1RL2A 4I6PA 2BW2A 3QAQA 1JJCB 1PH2A 1ZXIA 1EIYB 1E24A 4HSPA 4LMQD 2D2CC 3S1QB 1BMLC 1WIAA 3PIPA 3S16H 1C79A 1L4DB 1VQAA 2BH2A 5IT9L 2HUGA 1PH7A 2R93B 1ENCA 1NYQA 3L7ZC 3NQTA 4H44C 2E5LQ 5FOBB 2ZW1A 2IW3A 3DHIC 5FLXL 2I5HA 4IPGA 2NBUA 5IP4D 4XQNA 4N9TA 2QMTA 2K1BA 3LNNA 5GAGC 2L0CA 4HPPA 4XGAB 3P75A 1KOTA 2Y5CA 2K22A 2ONQA 3AE1B 4G0NB 2BGFA 2N9LA 1I3QB 2N55A 4DN4M 4WJPA 4A3FB 3RMHA 4DV0L 1D1KA 2FIDA 1MI2A 2D5GA 1D5XC 2CVRA 4M01A 1OTCA 2M1MA 2N0SB 4MACA 3CCQA 5AEKB 1I35A 2L8JA 1B50A 3WANA 4FXDA 2M9VA 4LNQA 2V1CC 3NWTA 1LT5D 2LWPA 2NN6H 2YEPF 4JI3Q 4L63B 5E1FA 4P75A 3LYYA 4HEA1 4YCVA 4HVBA 4PYUA 4AH6A 4BBRG 2FCNA 4X62Q 4K8JA 4EZJA 5KRUA 3ZLZA 2PMZE 2AWTA 5LHY1 4KK7A 3M4OH 4LAAA 4BFRA 4ME5A 3S24A 2BYTA 1Q90A 5J2RA 1JWSD 3DVNU 1ZYRC 2F0QA 2C5LC 2JA5G 1EY0A 1QOHA 3I72A 1MBYA 4CDCC 1B7YB 5C2TB 5J22A 2E2DC 3TL5A 3OJ4B 1WTVA 4LUVA 1FXIA 2KECA 1HTPA 3KUPA 1UNSA 3GV3A 4NXML 1X6OA 4DR7L 3AV8A 2JEAI 3S1QH 2LKVA 2K8CA 3ABVB 3UDGA 5C4XB 4WWPA 2K14A 4DR2L 1SYCA 5BR8Q 1YBYA 2WB1G 1J7BA 1PYSB 1MKHA 1VQBA 3M85A 4IOIE 4PMCA 1L7YA 5JPNC 3HOVH 2IHFA 2L15A 2FUHB 1XTCD 4AJWA 2A8VA 3AU5A 4DR1Q 3DBLB 2WXOA 3L13A 1VQCA 5D6JB 2KMCA 1SMYC 2MPMA 1QLBB 2PPBC 3E0EA 2KO3A 2NPTB 4DV3L 1LFDA 1TWFH 4JCVE 4UPAA 2OF1A 2K5HA 1LTLA 3PO3B 1XF5L 2QEJC 3TP8A 4A3FH 3ZNHB 3MXUA 4DV7L 4NXNQ 1ZOYB 2VRRB 1O7LA 1F9SA 4WQOB 3D0FA 3QHTA 1CUKA 2F1MA 1J8IA 4P1CC 1VZ6A 3BZCA 1IBKQ 2E2HB 3TMEA 3A5UA 1YNNC 1P7FA 1SSOA 3H3VH 1GHKA 2AL6A 2LXCA 4J6IA 1KD1C 1RKNA 5IGEA 4GOPB 1F9JA 1N6ZA 1RFKA 3PO2B 3CIRB 3HFZB 4ILWA 4IPDA 2K7VA 2X8XX 1IBXA 4L6TB 4RHRA 5C3EG 5HURA 1FRDA 2ICIA 2ZJPA 3T51B 1I4QA 2O4XA 3DMUA 4C2MB 1T0RC 3DHGC 4FN2A 1N8RC 1I4HA 1LTAD 3NBIA 4L5TA 4IALA 4CBVA 1SNCA 3J7AV 2DLBA 1I94L 3AU4A 4FXCA 4WAFA 1E3PA 2V3SA 3RZWC 1F2RC 4NPNA 1EY6A 1E8WA 4PK1A 2IZVB 3DWAA 3OMGA 4IPHA 5L37A 4CKCA 4LNFA 1C78A 2WKCA 4PV1C 4GNXC 1G2TA 1KIXA 1FIQA 5LMUL 1V43A 1T3QA 1V5OA 2PW7A 3EHVA 1ZP0B 2EYOA 3HOXB 3OTOL 2NCNA 2R7DA 1YJNA 2K04A 4KD3A 1PGBA 3NTIA 2FMCA 3MHZA 4OVUA 2F0GA 3VH4B 2NBFA 2SDFA 4DK1A 3NBHB 2Z6KC 1C77A 3NHEB 4JWSC 1H4RA 1F9PA 4XIGS 2MQHA 3DLLA 3DVNV 3A8KE 3RLOA 4FJZA 4R3DA 2FXQA 1K8AC 4I65A 2IWHA 1KNAA 5IWAQ 4YY3Q 1PH3A 4IOAA 2Y3AA 1OQYA 2EYLA 2ON8A 1F9QA 4S3SA 3T56B 2K0PA 1U4RA 3QA8A 5DPTA 1OXXK 1QUQA 4QAYA 1W2BA 1N33Q 1B3QA 5LMNW 3HHMA 1PTOC 1NR2A 3CSFA 2E2HH 3CC4A 2OWOA 2CQAA 5K36H 2MLBA 4XWTA 5DPRA 3ZIMA 2L12A 1XLPA 1FJGQ 2V4IB 2VH2A 4W9HA 1HA6A 1ROEA 2IO0B 2W55A 4MM3B 4HTHA 2R2OA 2KENA 2KJRA 3PO2H 4A3IH 3BDOA 4A3JH 3RI7C 3FAHA 2D5DA 5GMVA 2EXZA 4KVGB 1JQ4A 3HOWB 3J7YW 3MHBA 3A4SC 1I6VC 4C2MH 3I4NG 1F2LA 4GLXA 5EBDA 4IDIA 1GUSA 1DONA 3MC0B 4DR5L 1SE4A 3CMMB 3CCUA 3TREA 5LL6X 4HJAA 1I4RA 1SDFA 4JC0A 3HRZC 1GJZA 1S5DD 4ZAIA 4A4IA 1OO9B 4AYBG 4CKBA 1FFUA 4XE0A 1YNTE 1Z7TA 4C3HB 2RD0A 4TQ1A 4BY7G 1IKMA 4EQNA 4TKOB 4W9EA 1ZDVA 2Q2HA 3Q8DA 2ZTEA 1K83B 1ZXHA 4BKGA 2C9OA 3P4RB 4KY6A 4NW2A 1WJUA 5LLIA 2ZXPA 3QX1A 2J0KA 1NI3A 3NWSA 3AE2B 3M63B 3X23A 4JV5Q 4RAUC 5JJZA 1K0SA 1FYCA 2WAQG 1PA6A 3Q6SA 4KKUA 1UZXB 2JA6G 1VCBA 2PMZB 2MH7A 4QQBX 1I6HB 1XQQA 4EE2A 5ELBA 1LO5D 5KHOA 1J8CA 5EE1A 2G5DA 2QSDA 1CFMA 1FNUA 3VR4A 2ES2A 1B53A 3VA5A 2JWUA 3O13A 2HCIA 4X57B 2CWPA 4MN3A 2G4DB 2L1BA 2M2LA 2K5NA 4X64L 2KQ7A 3GE3C 1HZ9A 3X3MA 4ZKCB 5CV7A 2LVQA 1LGRA 2K5PA 4UP7A 1C4QA 2CFMA 2WXMA 3JAMi 4MH0E 3W9CB 5GXGB 5EPJA 4A90A 1Y8RC 4QUCA 3ML8A 1E1OA 3QC8B 4TQ0A 3TP7A 1XMOQ 3HOWH 2Z6KA 3ITPA 3K5LA 1SB3C 3AMUA 2KNBA 4P7IA 4W9DA 4ACFA 1HR0L 4EEWA 1V5TA 5C4JB 4BVUC 1ONLA 3APFA 2JXXA 3QG1A 5CHWA 2VQEL 2G1EA 3RD4A 1K3RA 3F2UA 3MVVA 3MXNA 3R2TA 1SE3A 3MEHA 2NTSA 2BS3B 2KCCA 3J7ZC 1YX5B 2LGIA 2GB1A 5C44H 4JIOU 4LJPB 1K73C 3VAWA 1CKNB 3K7UC 5EGTA 4O1NA 3HOZG 5G5HA 1YJ9A 1PUTA 4ARCA 2EY2A 2DNCA 4A3BH 1D2BA 4FULA 4ZOHC 4IN3A 3GD7A 2W3SA 1UD7A 3HM3A 5JXVA 1EYCA 3K0YA 1VQ4A 1Q82C 3QR8A 3A74A 4EQOA 2MGSA 3H3VC 1FM0D 2WXPA 4KKJA 1PH6A 3BVZA 5ELDA 5J17A 2B8GA 3HKZG 1SIFA 5KHQA 1BBUA 3NENA 3KF6A 4QB4A 1T0SC 1TT2A 1L0VB 4ZRKA 5EE9A 2HHHQ 4R8NA 1JOQA 1OXSC 1JMLA 4GLVB 3KUZA 1JE5A 4DK6C 2QDLA 4HJ9A 4C56C 2YU9B 4KHPL 2XN9C 3H15A 4DR3Q 1FMAD 4PS7A 4BKTA 2F4VQ 2R6GA 1Q46A 1YJWA 3QOJA 1CKMA 1UWMA 3PPAA 1A3VA 1WXQA 3QWNA 3UIPB 4MGYE 1M1KC 2LUEA 2AWNA 4L2YA 1WE6A 1V8QA 2KX3A 4OZBA 3W1YA 1KDBA 5CV6A 4LF7L 1ZDXA 2J0TD 1G91A 4EZLA 3KW5B 4CHTB 5I2YA 3ZUNA 2K25A 2CH4W 1B9RA 2O5IC 1WTXA 5HFYA 1WJJA 1SYBA 5EKKA 2HDEA 5FJ8H 1P8LA 1T6BX 3BY4B 4RF1A 3ZJTA 1X3PA 1ENFA 1STAA 3CMEA 1E0ZA 2E74C 4RKBA 3W3AA 4JI1L 1IBML 3HGBA 4YHHQ 2WDRB 2M0AA 1V1PA 4RG1A 1MD2D 4GN1A 2B2WA 2EDGA 1F0ZA 1EQRA 2FUG1 4A3LH 3Q3JA 2SOBA 3PMFA 4C7ZA 1X32A 4TUUA 3M4PA 3JAML 1K53A 4W9LA 5M3FG 3X0WA 2NVYB 2LXJA 3BK2A 1E1TA 3CC7A 2DNEA 5E6NA 1P0RA 4PNYA 4YCUA 3ZJUA 3I3TB 4LF8Q 5BMGA 4BY1B 1YHQA 4F87A 3GTJB 2IGGA 2VXWA 4V190 1PYWD 1Q1OA 1SYDA 1XCTL 2PJHA 3KWLA 2JYEA 1HNWL 3K5MA 1LYLA 1MHHE 3AH7A 4IM3A 1EO6A 2PVGC 4A3CG 5C0XH 1EYAA 1N36Q 1R9TH 3L9AX 3I90A 3G6EA 1UBQA 1QCBD 2EXDA 5IYDH 2KHSA 3PT2B 4HN7A 1EQVA 3K8AA 2JA9A 2YU9H 1P3QU 2DYOA 1BUIC 3A9JA 1ISNA 3RNGC 2C7MB 1Q1BA 2GA4B 3P4QB 3U4VA 3HVDA 4KD4A 4OO1I 3URYA 1WJNA 4K5WA 2K5WA 5IYBG 3FRPB 4DF7A 1JB7A 1KRTA 2KVZA 3ZKJC 4FBJB 2PZWA 1FNVA 1R4NB 1WGRA 3BU2A 3D4WA 3MA2B 3L3OC 3TSSA 4HPMB 4RF0A 2ZEQA 4DDID 3RFZB 3ICEA 1VF5C 3EFXD 4B0MA 4HWIB 2EJMA 2ZJDA 4N8X1 4ANUA 4OZAA 1EUVB 3UE0A 2DUDA 4Y7NB 3VUWA 1S40A 1VQFA 1LUZA 4A3EB 1Q5WB 1XLNA 2RR9A 2MHVA 3TEWA 2EQSA 2B29A 3FEWX 1KLUD 1UE7A 3OG5A 4DV0Q 1O7ZA 4KIKB 3VTWA 2IDYA 3KLSX 3UI3A 4X3UA 3T3OA 1GG3A 4MH8A 3LWUA 3V61A 3WAMA 4HCSA 5G5GA 3VR5A 3HK0A 1DOLA 1VZ7A 2G9DA 1QG7A 3E6ZX 4OELB 5CTRC 5T8IA 4HEDA 5JHBA 4JBJA 3GS2A 2MX2A 1STNA 5ELEA 1K8GA 1RTOA 2N9XA 2K05A 5H8YE 4K6DA 3MJWA 3AMZA 1H9SA 1T0QC 2KANA 3PHWB 1WXSA 1V86A 1JWAD 2Z1CA 4H13C 2BKRB 4BY1H 4Q2JA 1GJXA 1I4XA 2MUYA 1RYJA 2GN5A 1VQ9A 1ET6A 4IUTA 5FO7B 3Q2AC 4DV2L 1IW7C 1MG4A 3EBEA 4FF1A 2I1JA 3Q14C 5AZFA 4KX6B 4A3OA 2AQ2B 2CU1A 1E7PB 2SEBD 2BWES 4NXMQ 4DR7Q 1PMRA 2RSUA 3U9SA 3ZXRA 2B2VC 5CV5A 2LGXA 3IHPC 2FFKB 1GAQB 1WVLA 4DR2Q 1EEID 5AZHA 3FPPA 2BWFA 2R92B 2ZPNA 4DNRB 2YTYA 2A68C 3V2TA 4L5RC 2BA0A 3WWVA 4A3KB 1UGMA 2VW9A 2F0TA 3LDZE 2F0JA 4J15A 4OIKA 3PF5A 1A63A 3A7LA 4Y7NH 1HNZL 3PHXB 4DV3Q 1O80A 4A3EH 2KHIA 4WJWA 3W1GA 1HE8A 3EFCA 4WWOA 2FCSA 4MSQB 5IOIA 5C1ZA 1SGHA 4DV7Q 3RZOB 3J80L 1CHPD 1BO0A 4YWKA 4KKTA 3R93A 2JX5A 2E2IB 3QIJA 2JU6X 3U8ZA 4ASWC 1QVCA 4DR6L 2H89B 1X54A 1JOKA 1FL0A 2LFNA 1LV9A 2IL8A 3BZKA 3RNEC 2VH1A 4I7ZC 2XK5A 1JALA 2EYFA 3OHXC 1WD0A 2Z9HA 2IY0B 4FDBA 3OAWA 4GXBA 4KI0A 1U5KA 1YIWA 3JAME 2EY6A 5LNK1 2MNAA 1U4LA 1T9HA 5DPSA 1GPXA 2DY7A 5IAAC 4OWXB 4K3BA 1K8MA 4YWGG 4ZCKA 1DGSA 1PFBA 1Y8PB 2YV5A 2GOWA 5CR3A 1I94Q 1C1YB 4GIVA 2ZCBA 3HUIA 2JY6A 5FLMH 1Q12A 3P1HA 2N1WA 3IVFA 1U0LA 3RCZA 1A8VA 1G6PA 1Q10A 3C46A 5LMUQ 2MP2A 2KFKA 4XT3B 3DM1A 2KTFA 2KZRA 3OTOQ 3CCLA 1TKWB 2QEXA 2DZJA 1K28A 1TZ1A 3HOVG 2RSOA 4M02A 4WWMA 4IFDH 1NEKB 3R2IA 1X9NA 3M4QA 4FXKC 3K58A 3ND8A 3AYHB 2R92H 4MJSA 5I9PA 3Q0AA 4EX5A 1LACA 3C19A 4ULLA 2F0IA 3MFGA 4A3KH 3WAOA 3SK6A 3BDCA 1WTWA 2MCNB 4CJ2C 4BA2I 3A4RA 4DKAC 2Q2IA 4A3FG 4JI7L 2M8SA 2AX5A 2CWAA 4EQ5A 3T13A 2EE1A 2RHSB 3J7A5 1STYA 3HS0C 4YSXB 3D32A 3DXJC 2DAFA 4DUYL 4LNIA 3RZOH 3FKIB 4WURA 3T1HL 1RLFA 5IIFA 2E2IH 2MBHA 3RLFA 3R7RA 5KNCA 2K50A 4F7ZA 1STEA 1L5PA 5H92C 1LTID 1V1OA 3C3LA 3UGBB 3TEZA 3N9YC 2LEKA 3HM6X 1WX8A 1VQ8A 4NMZA 5C0XJ 2B2VA 2Z59B 4PMWA 1N62A 2MJEA 1NR4A 3JC66 1JRPA 1TWGB 3QK0A 2AMCB 4FJYA 5JZEB 3OSOA 3W5OA 1SBBB 2GRIA 4FHKA 3UF8A 3I4MB 1YI2A 3CCJA 4BBSB 3TQYA 4DR5Q 3SGIA 1KNEA 1SROA 1KQSA 1XEEA 3DDCB 2G4SA 5BYQA 3TBLD 2E3TA 2RCNA 4W9JA 1WMHB 2HIXA 3RMKC 2UUCL 4KSKC 1EFID 2L0FA 1XJVA 4JWUC 3VR9B 3PLVA 4CDFC 1G51A 2DN8A 4JX1C 3K9OB 3RNAC 2VZAA 2MSED 1EU4A 1EY4A 2MFIA 1IYJB 1VRAB 4ANVA 2ZCCA 3GTOB 1K50A 3PSEB 1HTLD 4F8CB 4JI6L 2GLSA 1T5XD 4NAWB 3DQVA 2JSOA 4CQNA 1GNUA 4NJ6A 3N6RA 3SK4A 2KDEB 3A5ZB 2KMMA 1D5MC 4IUUA 3F2BA 2ZXOA 1HZAA 1IKLA 1PXUA 1WJ4A 3H7PB 4I6NB 1I42A 4KSLC 2XTIA 3KJPA 3NUCA 1NSNS 4HSVA 5IOCA 4LJOB 5K36G 3FKIH 3EN2A 4X64Q 4P16A 1KL9A 1AN8A 3ERSX 4B9WA 3ZJVA 1L2FA 2KTRB 3AEAB 2F0SA 2AQ1B 3J80E 2Q8RE 5EPLA 2X6GA 4LF4L 2OEOA 5I2XA 4A3IG 4A3JG 3TZUA 3GO5A 3U9OA 3PO2G 3P20A 1VQ5A 1E90A 2NBVB 1H9JA 1V49A 2ZM6Q 2QHOA 2WX1A 2JRHA 1FEHA 1BKBA 2W9NA 5C23A 2PZUA 5HG2A 3DWPA 4CKEA 4Y52H 4XC2A 2LVPA 2WV6D 3TS2A 1WGDA 4PS8A 1UE5A 2B3GA 1TWGH 1DJRD 4G57A 2Z4HA 1DD2A 4E3CA 3UQAA 1HZCA 4QIWE 3ONAB 3I4MH 2N1VA 1HR0Q 1N5WA 2LJ5A 1KJTA 3B2GA 2O6VA 4OO1H 3MC8A 2DZKA 1O7IA 2VQEQ 4JE3B 1SF0A 1MGSA 3MTSA 1GUAB 2I07B 3CHBD 2O2VA 1E7VA 3CD6A 1UWXA 3TS0A 2DY8A 2M00A 3X3NA 2JA8H 2NBWB 3N3KB 2A1AA 2XEWA 1TKYA 4YSZB 4ZHPA 1ZUD2 4JGHB 5JJKA 3UDFA 2WGSA 3GZNI 4XX5A 5IE8A 3Q3OC 5CHFA 3RNFC 1TIID 1CA6A 2F0HA 4OVVA 2QW7A 3GTOH 1VDZA 1BUVT 1FFVA 2K5QA 5EE3A 3HKSA 2B8FA 4W9KA 2ZXRA 1WXVA 2XRQD 3I70A 3I8ZA 3J81c 2NS5A 1VQKA 4DAVA 1K8OA 2RPQA 3C0RB 4BOZB 1GB1A 1B70B 3A1QB 1WRDB 1H9RA 1RF2D 1EU3A 2N8NA 2JA7H 2B3AA 4K7UA 4MZ9A 2PTLA 4FP5D 5FKAC 2CR5A 4G7HC 4K1RB 1PFNA 5IGCA 2BDNA 4JBKA 4GU2A 2D3CA 2K32A 3NRZA 5EDSA 3HOYB 4FNFA 2WB1E 2BS4B 4GB9A 1CQVA 1I4GA 3UDXA 5KEEA 4QCLA 2WIIB 2NWGA 1YITA 4LK0M 1A6XA 4OHJA 4KHPQ 2H88B 2LHEA 3O65B 5D65A 1ZKHA 5D94A 3N52A 2KDBA 3VHTC 1LQBA 4LW1A 1GC6A 1SFOH 4ZLTF 1L6VA 3NP8A 3HOWG 1WXAA 1PVOA 1TWAB 2L4NA 4H02A 5DEHA 1SE8A 4HJ8A 4B3TL 3P7JA 2XRSD 4LF7Q 4DR4L 2J0MA 4KDIC 4N6EB 5AUIA 4FVMA 2HJ1A 4PT5A 2RDFA 1CMXB 5KYLA 4TMAB 2PYKA 3PVLA 3V6EB 4BBNC 1JJGA 1VCIA 4HJ7A 2KDIA 2OXPA 3RLNA 4IFDJ 1VQHA 2Y0SG 3NEMA 4FXGC 1EZ6A 2R93H 3MC9A 3VTVA 5C44G 3AEBB 3MZ5A 2C7NB 4JI1Q 2PQAA 2RA4A 4XYQA 3IAYA 1XXGA 1IBMQ 3PLUA 2Z0SA 1AW7A 2R61A 2FJ2A 4KGRA 3D6CA 2PMVA 3WAPA 4A3BG 2O2LD 1KM7A 4A93B 1I3QH 4NDXA 2ZNVC 4YTPB 5A35A 2F3IA 1E7ZA 2OTJA 1KFYB 2QGQA 2L32A 1C4AA 4ALPA 4GLSC 1YHBA 1RD9D 4NP5A 2O5JC 2ZW0A 3DBSA 4GDLA 3KWVA 2KHWB 5IGBA 2MW5A 3I91A 4M8AA 2KK8A 2VS1A 1LT4D 3PF4A 2ATWA 3IFWB 3MHSD 1HNWQ 1SE2A 1YJ1A 5CV4A 2JZPA 2L00B 2ID0A 2A6HD 2M0XA 3GTGB 1BNZA 2N9PC 1TWHB 4O42A 3AFPA 4RKLA 1EQTA 2KDMA 1O78A 4J1MA 4C3IB 4CGYB 3GB1A 2WDQB 1EZ8A 2IO2B 2NVQB 4RM8A 1A15A 3QOLA 4A3GB 2V0GA 3V62A 2RKSA 4R1JA 3I3CA 2ASQA 4XZ4A 1PYBA 3K6OA 2LMCB 1FCCC 1VS0A 4XQQA 1LT3D 4PQXA 1TWAH 5I9OA 3EUB2 4WH4A 2N9EB 4WQMA 3NZSA 3QQ8B 1WTQA 5C3XA 5C4ZA 4HJGE 2OHFA 4LNKA 5FJ8G 2XWJB 3CCVA 4KIKA 4YSYB 4AOFA 2E75C 3DEOA 1HXYD 5C4XH 5M5YB 3SR1A 2LVOA 1QKZA 3AEGB 2K03A 2F4IA 4AQ7A 2GBNA 1ZE3D 1HUNA 5KIXA 2R2QA 2DBYA 3RYTA 1RCVD 3KF8A 1QILA 4C3JG 1O7YA 5IT9E 3WCQA 4HCEA 1I5FA 2WU5B 2HIVA 4X66L 1PGAA 4DK5A 1IGDA 4A3LG 3RULA 5FLXE 1V1QA 3M4YA 4L5SA 4NJ7A 4IUQA 3LX0A 3PO3H 1GO3E 4CJ1B 2PNRC 1EIGA 2KQ3A 3ER0A 1VQDA 1HTOA 4KN7C 3WALA 1P16A 3IKJA 2EVBA 2LUMA 3C2PA 3L54A 4AYBE 5CBEE 4M0WB 1TS4A 3G48A 4KY5A 4PG3A 5GQOA 5C0XG 4P2CB 1RM6C 5BMIA 1YEZA 3DUZA 4CYEA 1PRTB 4QIWB 5M3MB 1I7HA 3K0XA 4RGMA 5IYDG 2F3WA 1XMQL 4ZRZA 4DV2Q 5J3BA 2WQYB 4IO9A 3PRPB 4IZ8A 2K75A 2NTTA 3GTGH 1TWHH 3FILA 2ZTDA 1Q3LA 3AU7A 3PQIA 3PZ8A 4J3OD 2PVOD 4H2AA 1S5CD 2EJFC 2KA7A 3UI2A 1NYRA 4KMUC 2NVQH 1TY2A 4A3GH 2PLPA 2QJLA 1XYIA 4BBRB 4DNIA 2RHQB 2WX0A 2RQXA 2WAQE 3PS6A 4PZ7A 1SNDA 3RZFA 1HA5A 1KHIA 2KAJA 1CI3M 3NY5A 1H9MA 3VYSA 5L95C 3S2DB 2BYFA 2H4OA 3CRKC 4UDUC 4PMBA 3HOXH 4DA2A 3AE4B 2EJGC 4JI2L 1ZGUB 4JQWC 4GDKB 2K3UA 4JVZA 3GZNB 1Y56A 1ZXTA 1KABA 1HNZQ 2A74C 4DAYA 2VL6A 3EFUA 2MEKA 1NNXA 1HCZA 4KKIA 1GXDC 4GMVA 4K14A 4O2DA 4CDDC 3EROA 2QIEB 3GQBA 2F0PA 3GDEA 4DK3C 2VUMB 4DR6Q 3ZGZA 2FAZA 4HRSA 3E9SA 4ANWA 3BYYB 2F0WA 2NZ1D 1TIFA 3AE7B 4A3MB 1SYFA 3KUCB 1DGJA 2XIWA 3R3OA 4BOSC 2MBQA 2AKWB 2EYJA 2B2WC 4G11A 4M00A 3HP3A 1H8CA 4US8A 5BN3A 2BPSA 3AI5A 4AS1A 1HH2P 1EEFD 1CSQA 3BJUA 1JCKB 4ZUIA 5IYCG 1BBXC 3H0GB 4H7BA 3NVWA 4XQJA 3IAS1 5C5MA 3Q8AA 4ZRPA 2PW9A 3NTHA 4MHEA 4USAA 3KLSA 2C5CA 2KUMA 2PCFB 5M3MH 1SYEA 2BVCA 4JI4L 4AIMA 3SVMA 2JQOA 5BYRA 3BWUD 4RGOS 5FK9C 3FP9A 1QOBA 2WXNA 3EQLC 1L1OB 2W54A 3ZDTA 1EY9A 3SEBA 2D07B 4OVZA 3SU8X 5DAUA 4RCNA 1E2WA 1T5EA 2RDGA 2F0FA 3ND9A 5DLQE 5KYIA 4FADA 4TRDA 3G6JB 1YQ4B 1WY8A 3OYYA 4LTUA 5M5XB 2J0JA 1KAWA 5JVH3 1WE7A 4IJHA 1SMXA 3SHLA 4C3HH 2K39A 3Q24A 3A33B 1JWUD 4HR7B 2FBWB 2WWZA 3CF5A 4DUZL 3S2DH 2JN4A 3P63A 2KOXA 4A3EG 5EBCA 1K83H 4J6HA 1VD2A 2MP1A 4HMJA 3NTKA 2BH8A 3J7AF 2FNJB 4P71A 4JI7Q 1VZ8A 2JSVX 2QDFA 3NZUA 4S0RA 3AEEB 4TQUS 1ASYA 5CX3A 5C3JB 2IGDA 2I2YA 2KQSA 2RDHA 4XT1B 1HEZE 1CZGA 5IP7H 2PKOA 4DUYQ 1LTBD 2CJNA 1MI0A 2FE8A 3T1HQ 1PZKD 4J8QA 4KHZA 1EIFA 1I50B 4YTNB 4IM2A 2VUMH 1PFMA 4DFAA 1S72A 1I6HH 2EOTA 5GAHC 3GTQB 3T1YL 4A3MH 4UAIA 4NAMA 4EUTA 1X1MA 1KC8C 3VDZA 1DOYA 3ZNZB 4OXPA 1QZHA 2AYOB 2G45B 2INCC 5L83A 1EQQA 1E8ZA 1PHJA 3IAM1 1JQYD 3DOWA 1UH6A 3LWEA 4L8JA 3H0GH 2J7ZA 2X6LA 2REXA 2WXQA 2Z6BA 5FLMG 4WJOA 4WWNA 2OQKA 4R8IA 2Y5BB 3A8JE 3S1MB 4MTKA 3IRBA 2MBOA 5KNBA 3U7DA 3H09A 1K51A 1YQ3B 4DXFA 3AB9A 4C80A 3CAMA 4OW0A 5IGDA 3ZO5B 1TWCB 3QWZB 4JL9A 4K81A 3VFKA 3BINA 1FD6A 2UUCQ 1A70A 2EMTA 3GTPB 2PI2A 1N5XA 1QVGA 1D8LA 1CM9A 2VQFL 4IFDG 1WR6E 2C60A 1G6ZA 1HPCA 1RIPA 5C4JH 1BCPB 2IYDB 3DVGX 4BZAA 1EY5A 4PYZA 2R92G 4MIUA 1E9MA 5J18A 1WI0A 3KDFA 4NAWA 1Q86C 1FGBD 3GTKB 4A3KG 3PGEA 1LXDA 1BCPF 1F2RI 2B2UC 1LM8B 4BKSD 5JH5C 2MQJA 4MEMA 1EY8A 2LGSA 2F0NA 4ICUA 4HJKA 3ZRCA 4JI6Q 4HCPB 1FNWA 1NAPA 4HIOA 2F0EA 1DOIA 1X3EA 3WOEA 1SJED 1IYFA 5D3IB 4LWCA 2OQ0A 2PE6B 4GZYC 3ALBA 5D14A 1NUCA 2B2YC 1P98A 4BY7B 1A3TA 1JWBD 4G7ZC 3P1MA 3A56A 3OW7A 1F1HA 3IT6B 1L2NA 1K52A 3ECIA 4Q0FA 4AJYB 2XNAC 1YNJD 1I50H 4ABNA 4NNJB 2DZMA 4PZ8A 1Y1VB 4KZCA 1WTRA 4LF4Q 3GTQH 5DNFA 4K7WA 4K0KL 5IT9c 3NVYA 3I2ZA 4CJ0B 5IY0A 5KGUA 3I56A 4GOPC 4R4OA 1AFPA 2OCEA 3IG3A 4LNNA 2WAQB 4WAAA 1HZBA 5FLXc 1STBA 1V9PA 1VQJA 1F2ZA 2EZVA 1H95A 3U4EG 3NXWA 4I7AA 4ME3A 2L3ZA 2KFJA 1SJHD 4E6IA 2CHZA 3AEDB 1X3QA 3S1MH 1EOTA 1OXUA 1YNXA 3STBD 3AM9A 1Q0WB 5A2QL 4K2KA 3PUXA 1QVFA 3TZDA 1AZQA 3K57A 3GTPH 3QJYA 3E5SA 5JHAA 4IWQA 3OW2A 2BYVE 4MGIE 1D1IA 1WTHA 1VQEA 4IUMB 1J0GA 4GGQA 1YQBA 1EWYC 1ICFB 1S5ED 4BA1I 3GTKH 4R4CA 3L08A 4QL5A 1L0XB 1ESRA 3KLWA 3TEHB 1PH1A 1IBXB 4PZ6A 4KLKA 4C1NI 3E3XA 2JXTA 3BK1A 2BE5D 4KJNA 3R8BA 1MG8A 2L52A 1VQPA 2QCZA 3TJPA 2B76B 2JPHA 1ENAA 1YVCA 4DGZA 2D3BA 1D4BA 2WACA 4C00A 3FKIG 1EWHA 5T1GA 4UP9A 1RHPA 3AE9B 1BBWA 2NVYH 3CU7A 1HR0W 4JYAL 2K28A 3H9DA 4WJ4A 2HQLA 5F2DA 2R7ZB 2NVUI 3OIPA 1ILQA 2JXMB 1OQRA 1UBIA 2KWDA 1R7SA 2KJXA 5HGQA 3GTJH 1BDOA 1Y1VH 4L5QA 2LASA 2E76C 2C9WB 3CPFA 3ZQ4A 2PEAA 4ZYNA 1TKEA 1LABA 4JI8L 5AJ3L 1R4MI 2EY5A 3UDIA 3Q8CA 2C7HA 4X6AH 1MHWC 3DHQA 3I4MG 3DHHC 1ZEQX 4II3B 4F7XA 4AQYL 4B3TQ 2WFWA 3S1RB 2LXAA 4OO1G 5JJIA 4DR4Q 2K01A 3OIQA 1DOXA 2B2UA 1EIHA 3EIVA 3DVGY 1U9RA 2AEHA 2PO4A 4W9GA 1ML0D 1E2VA 1SNOA 5IN7A 2LHDA 4H0LC 2N49A 2L7RA 3DBRB 2DJFC 2NPTA 4KV6A 2JA8G 1QUQB 3NUHB 1AWDA 2B2YA 5KNDA 2CW0D 3K5OA 3A9KB 2DHZA 1L6UA 3Q3FA 1SXTA 1Z2MA 2K9XA 1AEXA 3NK9A 2MA9B 5IO9A 3F2DA 4G7OC 1HZ6A 1KXLA 2W3RA 5HKHA 3ENEA 1TU2B 1PH8A 5JJLA 1F52A 1GHJA 1WTOA 1LT6D 4HCNB 4M1UB 1K0RA 4JPBW 4GOPA 1C8CA 1XLQA 4HKZE 4ZRIA 4A20A 1XTDA 2NN6G 2JA7G 3DBHI 1CSPA 3TEXA 3VYUA 2QA4A 3T9LA 3I7FA 5EKLA 1ILPA 4B3RL 2OEDA 4LFAL 3L16A 3PUVA 2DJGC 5CYUA 2JUOA 1UAPA 4JBMA 4CHKA 2ZT9C 1TQOA 4HK2A 1M90C 1SE9A 1AE3A 2INDC 1AYFA 2EY1A 3E56A 1CT1D 3FHWA 2R7ZH 4GN3B 2NVXB 4FHJA 1TS5A 4GN4B 2IO1B 1Z6HA 4A55A 1PGXA 1CK1A 4RGNA 2GBMA 2WXRA 4P1BC 5GADC 3H8HA 4EKUA 5FR3A 3QIAA 3HZXA 2JQRB 4N58A 3CRLC 2WLBA 2ZTCA 2NMQA 3H3VI 3L0OA 4YWLA 3FC4A 2R7FA 2KX0A 2L0TA 1G8ZD 4KKSA 3FPUB 3GTMB 2VB3X 3NBHA 3IFDA 1GB4A 4W9CA 1GUWA 2LFIA 5HHDG 2QF7A 1IGCA 1EY7A 1UWVA 2R93G 3A7AB 3SE0A 1XO3A 2LJIA 4GLAC 4OGQC 3WA0A 2D62A 1L0WA 1Y14B 2KCTA 1DYQA 4US9A 4N9PA 3ETRA 1PRTD 1IL2A 2D3GA 3Q69A 2UUAL 2CQOA 3OPOA 4RH6A 4P74A 1PDXA 2A4ZA 5A2QE 3HVZA 3PTFC 1HNXL 3CCRA 4LFBL 1SSNA 1QNUA 3S2HB 1NE3A 4X66Q 4GNXB 2EELA 4K5VA 4AWJA 3V6CB 2LY7A 1E0BA 4OX9L 3V3XA 4B3ML 3VYTA 5C5LA 3CW2C 2A69D 4ZRQA 4APVA 3IXSA 4MM3A 1PH9A 1M8AA 5TR5A 3U4ZA 4K2LA 2IX3A 1GUTA 2HCCA 1WGYA 1IHZA 5LXHA 3GTLB 3EC8A 1NJIC 1S5FD 1WM2A 2TMPA 3EGRA 2CJOA 2JZ3B 4DHZE 1MJCA 3WIMA 3H91A 3V96A 1YN3A 3V60A 1WCMB 1RWSA 3QARA 2RSNA 3MXNB 1HFGA 1XMQQ 3M3JA 3PCOB 4QMGA 2ZPYA 4B95A 4EGVA 2NVXH 3D8GA 2KOLA 3SXHA 3ZDMC 2RGFA 1NBFC 4JI0L 3U7ZA 2KWCA 1IP9A 1PTOB 3CWIA 5EAYA 3RZDB 1JJ2A 3APCA 1B8AA 3TP6A 1P7EA 4A9AA 3PUYA 1JMCA 2CHBD 1X65A 2B63B 1PFDA 1HZ5A 1PTOF 1ZW7A 2BF8B 1GUGA 1YIJA 5C4XG 3ZJYC 1P9DU 1KDCA 3IFTA 3GTMH 2D10A 3KQ4A 4LF5L 1MVKA 2CKHB 4RMAA 3ZNID 1LTRD 2R3ZA 2NZHA 1J5EL 1V81A 4JOIC 2RPVA 1JE4A 1RJTA 1HRJA 2J42A 3VXWA 4JI2Q 1ASZA 1QOFA 2MRPA 3VVWB 4DWFA 1N60A 1NI2A 4KJOA 4B08A 3KF6B 1T0YA 2ZJRA 2XVSA 3F8TA 5DPWA 2OOBB 3U2SC 3S16B 1W6JA 3Q8EA 3CP0A 1WH3A 1OTRB 4DK0A 3K9PB 3JSVB 1F9RA 3I57A 4BAXA 5CC4A 2J53A 3SHQA 3S2HH 3TUOA 1K3BC 1Z9FA 3PO3G 3AE6B 4FF3A 4WIPA 1M94A 4NQKE 3A55A 4DV5L 1B1ZA 4GOCA 3T53B 2K52A 2L55A 3APDA 3GE8C 2N7EA 2I0QA 5E7NA 1Y1WB 4W9IA 3GTLH 1YOVB 2PPHA 3F1ZA 1ZKOA 4WJQA 4DNTB 5G55A 3VTUA 1UUPA 3DWMA 5GROA 1TZOA 3SD5A 1YZ6A 2EYPA 2OJRA 1TVXA 2DNFA 3N1YC 3CQZB 1VF7A 3V05A 1V2YA 4WRDA 2XBBC 4LF6L 5G3LD 1WCMH 3J81j 4RMFA 3PUWA 2FCQA 3PGZA 2KLGA 3ZTCA 1IUEA 1C9OA 5ISRA 4JI4Q 2M4NA 3AEFB 1TJEA 4A3GG 4C7YA 2LS01 4ID6A 2W82A 1V1PB 5HGTA 1WF9A 2WXGA 4V0BA 1PTOH 4BBSH 1ICWA 2UXBL 2EIFA 2I46A 1E5WA 1TKGA 2UU7A 4G4KA 1RAXA 4JI5L 4R4IA 4X3SA 1Z47A 1IBLL 2B63H 4L23A 2HJ8A 1CKNA 3ONSA 1FVIA 1WYDA 3HOXG 5IGFA 2PIAA 3C8YA 2DX5B 2ZZPB 4XYOA 5AUKA 4ZHOA 4RCOA 4DUZQ 3JVZX 1V9JA 4IUPA 1N32L 2NZOA 4BS9A 2A19A 2OT2A 2MHJA 4FLHA 1QF6A 3MJ5A 4F1SA 1Q8KA 1YHAA 3I5JC 3NZ3A 5LMNL 1LTSD 3TBIB 2GBRA 2A6HC 1ZPSA 2ASBA 3K59A 3ULPA 4R4TA 5E4XA 2CCZA 3HOUB 2D3AA 2WP9B 3DBHB 1MSGA 4PS3A 5AZGA 4HIMA 3H94A 3A9JB 2Z0EB 3HOVB 3AB5A 4EFOA 3KH0A 1AZPA 2ALYB 1S5BD 4EOYA 1Q1EA 2KWVB 3T1YQ 1QZGA 1TT5B 2G3QB 1DOKA 1BCPD 4DV6L 2FIFA 4Q5VA 4P6VF 2KWUB 4X65L 4LUOA 3K80C 1N61A 2L76A 3OWEB 3SK8A 2A6ED 1TWFB 4OWTB 2K8HA 1Y1WH 3K81C 1JT8A 1ACCA 2Y0SE 2V1YA 2EKIA 2WHIA 2MJDA 5IP9H 5M3MG 2YEPB 2N7DA 5E6PA 2BQQA 3CQZH 1GKHA 2AL3A 1GOZA 1YX6B 5EPKA 3W2DA 5M9OA 4JOIA 3L0WB 2AHOB 3RPFC 4EZKA 4EQPA 3P42A 2IBIB 1E8XA 2KCNA 4NPSA 3L4PA 1XPUA 3M95A 2NVTB 2CS4A 1WXMA 4DPGA 3G71A 3Q3MC 1VQOA 2VQFQ 1Y8NB 3Q23A 3DPDA 2WU2B 4R4QA 4HXDA 4B3SL 1DCZA 1F2MA 2I5MX 4XTCS 4C3HG 3JAMc 2QC8A 3RNBC 1YN4A 2WXJA 3N30A 4JPSA 1II3A 3KK7A 2AUJD 1H9SB 3CCSA 4DV1L 2RDBC 3ZYYX 1EWCA 2G9HD 4Z9CB 3L17A 1KAAA 3E9HA 2K4KA 2D11A 2LGYA 2EYMA 1AARA 3VDYA 1C7YA 4ARIA 5CBAE 2EKEC 2LGDA 2C35B 4TSSA 4FYDA 3NVVA 5IP7G 3SK5A 4JK1C 1NBWA 3NS1A 4DHZB 4HLEA 1VLBA 4MNOA 4ZQ3A 2AWOA 2BDOA 1J6QA 2VUMG 3HOUH 3BS1A 1MPEA 1KRSA 4WFN3 1WX7A 2ICEC 2KBNA 4A6QA 4A3MG 3Q3NC 1S3OA 2HQEA 1YJJA 4A8XC 3NVZA 3A8IE 5ELFA 5CV9A 3B6YA 1PH4A 2CU3A 4K0KQ 2V3NA 2KJ6A 1M4VA 4WORA 1MIUA 5JEAH 1WI5A 3ZW3A 3NELA 1K9MC 5M5WB 2HE7A 1XX8A 3BG3A 5COYA 2GBJA 3HOYH 1J7CA 1WFYA 3H0GG 2L5TA 4IWOA 4K7SA 4POGA 2VY3A 3FDTA 2XGTA 3RN2A 1L4ZB 4QJFA 3W5VB 1FR3A 1L0YB 1WZ0A 4MELA 4C4VB 1I4PA 1VQGA 3MP9A 1UGJA 2HT1A 3S1NB 2UU9L 4A3DB 3S15B 3D4DA 4CDEC 3S17B 1NMFA 3R3MA 2Q5WD 4GKKL 4A75A 4LLGM 1C48A 3ZNGC 1JW9D 4A3IB 4A3JB 1JB3A 4U673 4HJ5A 1MSHA 2NVTH 2FHTA 3B0AA 3CKIB 5C0XI 4S17A 3FKYA 2H5XA 2MO0A 2KHJA 1VDVA 2KCMA 4KGSA 3HG9A 2XK5B 3KYHC 5EQ0A 2D0OA 2F0MA 4B0EA 3Q8BA 1QQRA 2F0KA 1G291 2DYBA 3KYCD 2K6AA 5AFWA 1C4CA 2JF5A 3JW0X 4TVAB 2TSSA 1C3TA 1JICA 3ZRFA 1QOAA 4X3TA 2RBMA 2Q2TA 4MSMB 3CSTA 4A93H 4DHJB 1B9MA 1YD8U 2JJQA 3H6MA 5JPMC 2QILA 4IUNA 2PNHA 3D4RA 1TYGB 1ZYRD 2UXCL 3J9CA 2KEDA 1LTTD 4FJVB 5E6JA 4LFCL 5DCNA 4JYAQ 1E8YA 2MP2B 3IL8A 2XSCA 2KFKB 1JWMD 1N34L 4IJLA 2KT7A 1GM5A 1A0IA 2EPBA 3QCAA 2JRIB 4NY0A 4ZRJA 2BT6A 4JI8Q 1RODA 5M5WH 1SNMA 5AJ3Q 3AE5B 4MJSB 3MAQA 4HROA 1PRTF 4MGKE 5FR6A 4NJCA 3MEFA 4C3IH 1TY0A 4A76A 1E22A 4AQYQ 1VQMA 1WTPA 5HY6A 1UELA 4YWMA 2K6QA 3KBXA 3DWGC 4DBGA 4FF4A 2JEBI 5CORA 4UP8A 4JW0A 2Q8TA 3CMAA 4BXXH 3OWFA 2K5VA 2EYHA 3A9KA 3GOEA 4TKNA 3A54A 3S1NH 4A3DH 3C1EA 3S15H 1SMYD 3J80c 2F03A 1MJDA 1V80A 5TSSA 3S17H 4GKJL 2CHXA 2WYQA 3P4SB 1CTMA 2UXDL 4IOCA 4KV2A 2MO1A 1VMCA 3T8MA 5D3DA 1VQLA 2JA5B 3VA7A 3EVQA 5M5YH 1QZEA 3TP5A 4LF9L 1PQSA 2KQ4X 4B9KA 2IY5B 1JRUA 3I4OA 2CH4A 1XNRL 1W3SA 1YNND 4HDQA 2XWBB 4QGUA 1E7UA 1D6EC 3QO2A 4XXEA 2KC1A 3TCAA 2IX1A 1OEYJ 1LLRD 4MDKE 5CV8A 1KRHA 2WB1B 3BIID 1STGA 2KJHB 2Y0SB 1W6KA 5IODA 3J81i 4DV4L 1XNQL 4B3RQ 4LFAQ 1R4NI 5C44B 5DM63 2VZKB 3ZVVA 2Z4IA 2WKDA 2N78A 3HEJA 1WWTA 1EYDA 3RD2A 4KY7A 4RWSC 3S14B 3W1BA 4BY1G 1MFWA 3I9V1 4ITKA 3AE3B 5BMHA 2E2JB 1PLFA 1Y1VG 4IPCA 1SN8A 3T16A 3NOBA 1PFSA 4A3BB 3KYDD 3VRBB 4K5XA 5ELCA 2BB6A 1ET9A 3N1ZC 1EWIA 1NTGA 3WOFA 2KC2A 2ZVOA 2DZIA 2PW5A 2IT1A 3NHHA 2UUBL 2GVAA 1ESFA 4B6WA 3K7AB 4HAEA 3DBRI 2BCOA 2N3SA 4XDXA 5BN5A 2D0PA 5JVG3 1WYGA 2CHWA 1A5RA 1KF6B 5J1ZA 2WINB 2WXLA 3H7SA 1NVID 5T1IA 3FVQA 3M7GA 3VR6A 1RRBA 4BBRH 1WGGA 4OL7A 1JROA 3D3RA 4K8IA 1CKOA 4IUVA 1TBEA 4TV3A 2M56B 2QKIC 4GNXA 5C3EB 1EL0A 1JOOA 3R7QA 4IG7B 2K6DB 3AULA 4POFA 3HKZE 2ZM6L 3IBEA 3QJZA 2UUAQ 1YNJC 1N63A 3PV0A 2BBCA 1YMHE 1OXVA 2L83A 2GI9A 5E4WC 1DM0B 2BS2B 2JA5H 1HNXQ 4LFBQ 3KJOA 2FMMA 5EKIA 4DXGA 2EMSA 1CQFA 3CCEA 4OX9Q 1PTOD 4B3MQ 2FCMA 3CF6E 4FF2A 3E9IA 1C9FA 1FRRA 3B9JA 3GP7A 1XPRA 5NUCA 3KFUA 5G3LF 1JR0D 3SR6A 1WZ3A 5C6AA 4IFDI 1HQMC 2E5LL 1MJEA 3VUYA 3H1UA 4LDTB 3PIO3 1IYUA 4RNAA 3STBC 1XLOA 2O6VB 3RUZA 3T4AC 1C0AA 2AUKA 1BF4A 2BYEA 2UWQA 4C3JB 2KVRA 3S2AA 1GD7A 2DYMA 2R7ZG 3P2BA 5JEAJ 4F88A 3S14H 4IW0A 4E74A 2O2VB 2ZJQA 5EJWA 4ZDVA 4RFBA 4DAMA 1X3FA 2E2JH 3PUZA 3RN5A 2F0UA 2I5LX 1NENB 1U4AA 4IM0A 2E6XA 3KLRA 3B1LX 2WDVB 2N7JA 1SRUA 2JK8A 1WMHA 4JI0Q 1AE2A 5D2MB 4LUZA 2D9UA 4N8FA 1S3SG 5C4HA 1DZ1A 3HIZA 1H9KA 3PZ7A 4JI3L 2YVCA 1QNKA 5JAVA 3K7AH 5CMDA 3IT4B 3TIXA 1VMPA 3QB3A 2WXHA 2BE5C 2LZ6A 3I63C 4FO2A 1TS3A 4X62L 2LRWA 1LM0A 3U50C 1R9TB 4B9XA 4LF5Q 2HTME 3TDQA 1DOMA 1J5EQ 2IGHA 1XWEA 3JSVA 2B2TC 1OEYA 1KLVA 5M5XH 2QCPX 4U68A 3J81L 5C3EH 1HTQA 4HPLB 4II2B 1WFQA 2KVMA 4UY8C 3ML9A 3H7PA 3I4NB 2JYTA 3LXFA 1XT9B 4OEMB 1QB5D 1D7QA 2K1FA 2WXFA 1XPOA 1XD3B 2BA1A 5D7GA 2B39A 1PDQA 3MXPA 1WSPA 3VR8B 2BKFA 2KTRA
chains in the Genus database with same CATH topology
1HUMA 4AYBB 5J39A 4YT0B 3BDLA 1BQQT 3SFDB 3EA6A 1KDAA 3P4PB 3SDZA 3NE5B 1VJKA 1E2ZA 1R4QB 5I4DA 1GUOA 2Z8LA 2JA6B 2PZTA 2CW0C 3GV6A 5E3FA 2VNUD 2K5DA 2MJ8A 5K5PA 3HRDD 2Y5PA 3B2FA 3WDNA 1GUNA 2V4DA 2KACA 2WXIA 1CJEA 2L1AA 3I4LA 4DQOC 1BOSA 4GDLB 1B3AA 2JYOA 3S9WA 4D2KA 4YIJA 2ENBA 3T3NA 1BXTA 2F0VA 4ZK9B 1SYGA 3DWQA 2BB5A 2QDBA 2F0OA 3W5UB 1TS2A 1Q8IA 1E6EB 2A5HA 2M19A 1WGKA 4NKLA 3TN2A 2HDMA 1OQQA 1FCLA 3HOZB 5CGKA 1Y8OB 1YN5A 3LB8C 4QF4A 1G2SA 1SIJA 1Y69U 2F3VA 1FD7D 1PRTC 4X3KA 1D5ZC 1TR5A 2B2TA 2VB2X 2NN6I 4DU9A 3VR3A 1CHQD 1KTKA 3HKZB 4LJZC 4RGTA 2NB0A 2A69C 2IPKD 3G7LA 2J52A 3PIP3 2Q8IB 1WRIA 5IGGA 1LTGD 1S4ZA 3VYRA 1KH0A 2YYZA 4RHSA 3M3YB 1BR9A 1B2TA 2ACZB 5EE0A 1A2TA 1V97A 3BVMA 1AP0A 3J81E 3FILB 2A73B 3NQIA 2RMMA 2F0LA 4KTAA 2WXKA 4K6LA 4XDCA 2AQ3B 1STHA 3D6WA 4HKQA 3KBGA 4MT5A 2BOSA 4ODGA 4ZUJA 2WP8J 4KN4C 2LMCA 4XDDA 4ZYSA 2JP1A 5M3FB 5C3WA 3U52E 4IKGA 5JOBA 1YJIA 2INPE 1U4MA 4BWGB 1C76A 5BYSA 5DM73 3K5NA 1U4PA 2L9HA 2INNE 4RA8A 1IYVA 1HQRD 1QE6A 4IQZA 3AE8B 3I73A 1KLGD 5I6WA 4HMIA 2I38A 2H1EA 1SNPA 2X38A 1F77A 1UEAB 1J9OA 4KGTA 2IJ0A 4M0WA 2JE6I 1CZPA 4C1NK 3VRAB 1JC7A 1QWYA 3MWYW 1DXMA 1V8CA 4XWWA 1IW7D 5JEAG 3SFEB 2X69A 3W1SA 3PO0A 1C4PA 1HHVA 2WNMA 3EJIA 1R4PB 3MXGA 5FO9B 1QJOA 2KEEA 4QUFA 3D31A 5I6YA 1MHXA 3FMCA 2K33A 2DWQA 1A3UA 2A68D 1RDPD 2VZKD 1A2UA 4F8MA 1CA5A 2IX0A 2FINB 5FO8B 1FXAA 1QT9A 2KN4A 1IL8A 3E0JA 4N59A 3AN1A 1HFNA 2F0DA 2HDLA 3NPPA 1PZID 1BCPC 1XCQL 1B4OA 1J7AA 2A6EC 2RVLA 3C1FA 1FO4A 3BYTB 3VR2A 1VR9A 3BVGA 3Q22A 5BN4A 4IURA 1JORA 2SNSA 4OZCA 2NUCA 4DAPA 1OFFA 2SAKA 2JA8B 4KHVA 2NYZD 3M7NA 3VQIA 1B44D 1F2YA 3NSWA 1WD1A 3OOCA 1CZWA 2WS3B 3Q8FA 3MFYA 2BTEA 1RTNA 3OMCA 4JBWA 1QOGA 4R9WA 4OIJA 3BZDB 5HI1A 4L1BA 2MJ3A 2PQEA 4C3IG 4LK1C 2JA7B 4NZLB 4YXDB 4YTMB 2N9KA 1NCVA 4REZA 5MPOA 3M4OB 2J4XA 5LL6S 2SNMA 1E10A 4ZKBB 1SEBD 2L11A 1OXTA 1EM7A 3DEPA 2V3PA 4EVOA 1SFOB 3AECB 3ERQA 1B9NA 2N88A 1SNQA 1SAPA 1PZJD 2BW2A 1ZXIA 4HSPA 4LMQD 1BMLC 2D2CC 3S1QB 1C79A 1L4DB 5IT9L 2HUGA 2R93B 1ENCA 1NYQA 3L7ZC 3NQTA 4H44C 5FOBB 2ZW1A 2IW3A 5FLXL 4XQNA 4N9TA 2QMTA 2K1BA 3LNNA 2L0CA 3P75A 2Y5CA 2K22A 2ONQA 3AE1B 2N9LA 1I3QB 2N55A 4DN4M 4A3FB 3RMHA 1D1KA 1MI2A 2D5GA 1D5XC 2CVRA 2N0SB 4MACA 1B50A 4FXDA 2M9VA 3NWTA 1LT5D 2YEPF 2NN6H 3LYYA 4AQ7A 4L63B 5E1FA 4HEA1 4K8JA 5KRUA 5LHY1 4KK7A 4LAAA 2BYTA 4ME5A 1Q90A 1JWSD 1ZYRC 2F0QA 1EY0A 1QOHA 3I72A 1MBYA 5C2TB 5J22A 2E2DC 1WTVA 1FXIA 2KECA 1HTPA 3KUPA 1UNSA 3GV3A 3AV8A 2JEAI 3ABVB 2LKVA 5C4XB 1SYCA 1J7BA 3M85A 4IOIE 4PMCA 5JPNC 1XTCD 2WXOA 1SMYC 2MPMA 1QLBB 2PPBC 2OF1A 3PO3B 1XF5L 2QEJC 3TP8A 3MXUA 1ZOYB 1O7LA 1F9SA 2F1MA 1J8IA 1VZ6A 2E2HB 3TMEA 1YNNC 1P7FA 1SSOA 1GHKA 1RKNA 5IGEA 1RFKA 3PO2B 3CIRB 4ILWA 1IBXA 2K7VA 4L6TB 4RHRA 1FRDA 5HURA 2ICIA 3T51B 1I4QA 2O4XA 3DMUA 4C2MB 4CBVA 1I4HA 1LTAD 3NBIA 4IALA 3J7AV 1SNCA 2DLBA 2JQRB 4FXCA 4ITKA 4WAFA 1F2RC 1EY6A 3DWAA 3OMGA 4CKCA 1C78A 2WKCA 4PV1C 1G2TA 1FIQA 1V43A 1T3QA 2PW7A 1ZP0B 2EYOA 3HOXB 2K04A 4KD3A 1PGBA 3NTIA 2FMCA 3MHZA 2F0GA 2NBFA 2SDFA 4DK1A 1C77A 4JWSC 1F9PA 4XIGS 3A8KE 4R3DA 4I65A 2IWHA 1KNAA 2Y3AA 2EYLA 2ON8A 1F9QA 4S3SA 3T56B 2K0PA 1U4RA 1OXXK 1PTOC 1NR2A 4XWTA 2CQAA 5K36H 2L12A 1XLPA 2V4IB 1HA6A 1ROEA 2W55A 4MM3B 4HTHA 3BDOA 3FAHA 2D5DA 2EXZA 1JQ4A 3HOWB 3J7YW 3MHBA 1I6VC 1F2LA 4IDIA 5EBDA 1GUSA 1DONA 3MC0B 1SE4A 5LL6X 1I4RA 1SDFA 3HRZC 1S5DD 4ZAIA 1OO9B 4CKBA 4XE0A 1FFUA 1YNTE 1Z7TA 4C3HB 4TQ1A 1IKMA 4EQNA 4TKOB 1ZDVA 1K83B 1ZXHA 2C9OA 3P4RB 4KY6A 4NW2A 2ZXPA 1NI3A 3NWSA 3AE2B 4RAUC 5JJZA 1FYCA 3Q6SA 4KKUA 2PMZB 2MH7A 1I6HB 4EE2A 5ELBA 1LO5D 5EE1A 2QSDA 1CFMA 1FNUA 3VR4A 1B53A 3VA5A 2JWUA 3O13A 2HCIA 4MN3A 2L1BA 2M2LA 3X3MA 4ZKCB 5CV7A 2K5PA 1C4QA 2WXMA 3W9CB 5GXGB 5EPJA 4A90A 4QUCA 3TP7A 3ITPA 3K5LA 1SB3C 3AMUA 5C4JB 1ONLA 3QG1A 2G1EA 3RD4A 3F2UA 3MVVA 3MXNA 3R2TA 1SE3A 2NTSA 3MEHA 2BS3B 2KCCA 2LGIA 2GB1A 5EGTA 4O1NA 5G5HA 1PUTA 4ARCA 2EY2A 2DNCA 1D2BA 4ZOHC 4IN3A 3GD7A 2W3SA 5JXVA 1EYCA 3K0YA 4EQOA 2MGSA 3H3VC 1FM0D 2WXPA 4KKJA 3BVZA 5ELDA 2B8GA 4QB4A 1TT2A 1L0VB 5EE9A 4R8NA 1JOQA 1OXSC 1JMLA 4C56C 2YU9B 2XN9C 1FMAD 2R6GA 3QOJA 1UWMA 1A3VA 1WXQA 3QWNA 2AWNA 4L2YA 1V8QA 4OZBA 1KDBA 5CV6A 1ZDXA 2J0TD 1G91A 4CHTB 5I2YA 1B9RA 2O5IC 1WTXA 5HFYA 1SYBA 5EKKA 2HDEA 3ZJTA 1T6BX 4RF1A 1X3PA 1ENFA 1STAA 1E0ZA 2E74C 4RKBA 3W3AA 3HGBA 2WDRB 2M0AA 1V1PA 1MD2D 2B2WA 2EDGA 1F0ZA 2FUG1 4C7ZA 2SOBA 3PMFA 1X32A 3JAML 1K53A 2NVYB 3BK2A 2DNEA 4PNYA 3ZJUA 5BMGA 4BY1B 4F87A 3GTJB 2IGGA 2VXWA 4V190 1PYWD 1SYDA 1XCTL 3KWLA 2JYEA 1MHHE 3K5MA 3AH7A 2PVGC 5C0XH 1EYAA 3L9AX 3I90A 1QCBD 2KHSA 4HN7A 1EQVA 2DYOA 1BUIC 1Q1BA 2GA4B 3P4QB 3HVDA 4KD4A 4OO1I 3URYA 4K5WA 2K5WA 3FRPB 4DF7A 2PZWA 1FNVA 3D4WA 3MA2B 3L3OC 3TSSA 3RFZB 4RF0A 1VF5C 3EFXD 4B0MA 2EJMA 4OZAA 4Y7NB 4A3EB 1XLNA 2MHVA 3TEWA 3FEWX 1KLUD 1O7ZA 2IDYA 3KLSX 3UI3A 4X3UA 3T3OA 4MH8A 3LWUA 4HCSA 5G5GA 3VR5A 1DOLA 1VZ7A 2G9DA 1QG7A 3E6ZX 5T8IA 4HEDA 3GS2A 1STNA 5ELEA 1RTOA 2K05A 5H8YE 4K6DA 3AMZA 1H9SA 1JWAD 2Z1CA 4H13C 4Q2JA 1GJXA 1I4XA 2MUYA 1RYJA 1ET6A 4IUTA 5FO7B 1IW7C 4FF1A 4KX6B 2AQ2B 1E7PB 2SEBD 1PMRA 3U9SA 2B2VC 5CV5A 2FFKB 1GAQB 1WVLA 1EEID 3FPPA 2R92B 4DNRB 2A68C 3V2TA 2BA0A 4A3KB 2F0TA 2F0JA 4OIKA 4HJGE 3A7LA 1O80A 4WJWA 3RZOB 3J80L 1CHPD 1BO0A 4KKTA 3R93A 2JX5A 2E2IB 2JU6X 2H89B 1JOKA 2LFNA 1LV9A 2IL8A 4I7ZC 1JALA 2EYFA 3OHXC 1WD0A 4KI0A 3JAME 2EY6A 5LNK1 1U4LA 1GPXA 2DY7A 1K8MA 4YWGG 1PFBA 1Y8PB 5CR3A 3HUIA 1Q12A 3P1HA 1Q10A 3C46A 4XT3B 3DM1A 1TKWB 2RSOA 4WWMA 4IFDH 1NEKB 3R2IA 4FXKC 3K58A 3ND8A 5I9PA 3Q0AA 1LACA 4ULLA 2F0IA 3MFGA 3SK6A 3BDCA 1WTWA 4CJ2C 4BA2I 2AX5A 4YSXB 3T13A 2EE1A 1STYA 3HS0C 3DXJC 3FKIB 4WURA 5IIFA 3RLFA 5KNCA 1STEA 1L5PA 5H92C 1LTID 1V1OA 3C3LA 3N9YC 2LEKA 4NMZA 5C0XJ 2B2VA 4PMWA 1N62A 2MJEA 1NR4A 1JRPA 1TWGB 3OSOA 1SBBB 2GRIA 3I4MB 4BBSB 1KNEA 1XEEA 5BYQA 2E3TA 1EFID 4JWUC 3VR9B 2DN8A 4JX1C 1EU4A 1EY4A 1VRAB 3GTOB 1K50A 1HTLD 1T5XD 4NAWB 2JSOA 4CQNA 3SK4A 3N6RA 2KMMA 1D5MC 4IUUA 2ZXOA 1PXUA 1IKLA 3NUCA 1NSNS 4HSVA 5IOCA 5K36G 4P16A 4B9WA 1AN8A 3ZJVA 3AEAB 2F0SA 2AQ1B 3J80E 2Q8RE 5EPLA 2X6GA 1EL0A 2OEOA 5I2XA 3TZUA 3GO5A 3U9OA 3P20A 1H9JA 1FEHA 2PZUA 5HG2A 3DWPA 4CKEA 2WV6D 4G57A 1DJRD 2Z4HA 1DD2A 3ONAB 1N5WA 3B2GA 4OO1H 4JE3B 1SF0A 1MGSA 3MTSA 2I07B 3CHBD 1UWXA 2DY8A 2M00A 3X3NA 1TKYA 4YSZB 4ZHPA 1ZUD2 1TIID 1CA6A 2F0HA 1FFVA 1VDZA 1BUVT 2K5QA 5EE3A 2B8FA 2ZXRA 2XRQD 3I70A 3I8ZA 1GB1A 4DAVA 1K8OA 1H9RA 1RF2D 1EU3A 2PTLA 4FP5D 5FKAC 4G7HC 1PFNA 5IGCA 2BDNA 2K32A 3NRZA 3HOYB 4FNFA 2BS4B 1CQVA 1I4GA 5KEEA 4QCLA 2WIIB 2NWGA 4LK0M 1A6XA 4OHJA 2H88B 2LHEA 5D65A 3N52A 4ZLTF 1L6VA 3NP8A 1TWAB 2L4NA 5DEHA 3P7JA 2XRSD 4N6EB 5AUIA 4FVMA 4PT5A 2RDFA 5KYLA 4TMAB 2PYKA 1VCIA 2OXPA 4IFDJ 4FXGC 1EZ6A 3AEBB 3MZ5A 2RA4A 4XYQA 3IAYA 1XXGA 1AW7A 2R61A 2FJ2A 4KGRA 3D6CA 2PMVA 2O2LD 4A93B 4NDXA 4YTPB 5A35A 1KFYB 2L32A 1C4AA 4GLSC 1RD9D 4NP5A 2O5JC 2ZW0A 3KWVA 5IGBA 3I91A 4M8AA 1LT4D 1SE2A 5CV4A 2JZPA 2ID0A 2A6HD 3GTGB 1BNZA 1TWHB 4O42A 4RKLA 1EQTA 2KDMA 1O78A 4J1MA 4C3IB 4CGYB 3GB1A 2WDQB 1EZ8A 2NVQB 1A15A 3QOLA 4A3GB 2V0GA 2RKSA 3I3CA 3K6OA 2LMCB 1FCCC 4XQQA 1LT3D 4PQXA 3EUB2 5I9OA 4WH4A 4WQMA 1WTQA 5C3XA 5C4ZA 2OHFA 2XWJB 4YSYB 2E75C 3DEOA 1HXYD 5M5YB 3SR1A 1QKZA 3AEGB 2K03A 2F4IA 1ZE3D 1HUNA 5KIXA 2DBYA 1RCVD 3KF8A 1QILA 4C3JG 1O7YA 5IT9E 3WCQA 4HCEA 2WU5B 1PGAA 1IGDA 5FLXE 3M4YA 4IUQA 3LX0A 4CJ1B 2PNRC 1EIGA 2KQ3A 4KN7C 3IKJA 2EVBA 2LUMA 3C2PA 5CBEE 1TS4A 4KY5A 1RM6C 5BMIA 5C0XG 4P2CB 3DUZA 1PRTB 4QIWB 5M3MB 1I7HA 4RGMA 2F3WA 4ZRZA 2WQYB 4IZ8A 2NTTA 3FILA 1Q3LA 3AU7A 3PZ8A 4J3OD 2PVOD 4H2AA 1S5CD 2EJFC 2KA7A 3UI2A 1NYRA 4KMUC 1TY2A 2PLPA 2QJLA 1XYIA 4BBRB 2RQXA 1SNDA 1HA5A 2KAJA 1CI3M 1H9MA 3VYSA 3S2DB 2H4OA 3CRKC 4UDUC 4PMBA 4DA2A 3AE4B 2EJGC 4GDKB 2K3UA 1Y56A 1ZXTA 1KABA 2A74C 4DAYA 2MEKA 1HCZA 4KKIA 1GXDC 4K14A 3EROA 2QIEB 3GQBA 2F0PA 2VUMB 3ZGZA 4HRSA 3E9SA 3BYYB 2F0WA 2NZ1D 3AE7B 4A3MB 1SYFA 1DGJA 2XIWA 3R3OA 2EYJA 2B2WC 3HP3A 4US8A 5BN3A 4AS1A 1EEFD 4ZUIA 1BBXC 1JCKB 3NVWA 3H0GB 4H7BA 4XQJA 3IAS1 5C5MA 3Q8AA 4ZRPA 2PW9A 3NTHA 4MHEA 4USAA 3KLSA 2C5CA 2KUMA 2PCFB 1SYEA 3SVMA 5BYRA 3BWUD 4RGOS 5FK9C 1QOBA 2WXNA 3EQLC 2W54A 1EY9A 3SEBA 4OVZA 5DAUA 4RCNA 1T5EA 1E2WA 2RDGA 2F0FA 3ND9A 5KYIA 4TRDA 3G6JB 1YQ4B 4LTUA 5M5XB 5JVH3 3SHLA 3Q24A 1JWUD 4HR7B 2FBWB 3P63A 5EBCA 4J6HA 2MP1A 4HMJA 3NTKA 3J7AF 2JSVX 1VZ8A 5C3JB 2I2YA 3AEEB 4TQUS 2IGDA 2RDHA 4XT1B 1HEZE 1CZGA 2PKOA 1LTBD 2CJNA 1MI0A 2FE8A 1PZKD 4J8QA 4KHZA 1I50B 4YTNB 1PFMA 4DFAA 2EOTA 3GTQB 4NAMA 4UAIA 1DOYA 3IAM1 1JQYD 3LWEA 4L8JA 2J7ZA 2X6LA 2WXQA 4R8IA 3A8JE 3S1MB 5KNBA 3H09A 1K51A 1YQ3B 4DXFA 3AB9A 4C80A 4OW0A 5IGDA 1TWCB 1FD6A 1A70A 3GTPB 1N5XA 1CM9A 4IFDG 1G6ZA 1HPCA 1BCPB 1EY5A 4MIUA 1E9MA 1FGBD 3GTKB 1BCPF 1F2RI 2B2UC 1EY8A 2F0NA 1FNWA 1NAPA 1DOIA 2F0EA 3WOEA 1SJED 5D3IB 4GZYC 5D14A 1NUCA 2B2YC 4BY7B 1A3TA 1JWBD 4G7ZC 3P1MA 3A56A 3OW7A 3IT6B 1K52A 4Q0FA 2XNAC 1YNJD 4ABNA 1Y1VB 1WTRA 5DNFA 3NVYA 1AFPA 4CJ0B 5KGUA 2WAQB 1STBA 1F2ZA 2EZVA 3U4EG 3NXWA 1SJHD 4E6IA 3AEDB 1X3QA 1EOTA 1OXUA 3AM9A 5A2QL 4K2KA 3PUXA 3TZDA 1AZQA 3K57A 3QJYA 3E5SA 1D1IA 1EWYC 1S5ED 4BA1I 1L0XB 1ESRA 1IBXB 4C1NI 3BK1A 2JXTA 2BE5D 4KJNA 3R8BA 2L52A 2B76B 1ENAA 4DGZA 1D4BA 2WACA 1EWHA 5T1GA 1RHPA 3AE9B 3CU7A 2K28A 5F2DA 2R7ZB 3OIPA 1ILQA 2JXMB 1OQRA 2KWDA 1R7SA 2KJXA 1BDOA 2E76C 3ZQ4A 1TKEA 1LABA 2EY5A 3Q8CA 3DHQA 1ZEQX 4F7XA 3S1RB 4OO1G 1DOXA 2K01A 3OIQA 2B2UA 1EIHA 1U9RA 2PO4A 1ML0D 1E2VA 1SNOA 2LHDA 4H0LC 4KV6A 3NUHB 1AWDA 2B2YA 5KNDA 2CW0D 3K5OA 1L6UA 1SXTA 2K9XA 1AEXA 3NK9A 4G7OC 1HZ6A 2W3RA 1TU2B 1GHJA 1WTOA 1LT6D 4M1UB 1C8CA 1XLQA 4HKZE 2NN6G 3TEXA 3VYUA 5EKLA 1ILPA 2OEDA 3PUVA 5CYUA 1UAPA 2ZT9C 1TQOA 1AYFA 2EY1A 3E56A 1CT1D 2NVXB 1TS5A 4A55A 1Z6HA 1PGXA 4RGNA 1CK1A 2WXRA 3H8HA 5FR3A 3QIAA 3HZXA 4N58A 3CRLC 2WLBA 2NMQA 3FC4A 1G8ZD 4KKSA 3FPUB 3GTMB 2VB3X 3NBHA 3IFDA 1GB4A 1GUWA 2LFIA 5HHDG 2QF7A 1IGCA 1EY7A 3A7AB 3SE0A 1XO3A 2LJIA 4OGQC 2D62A 1DYQA 4US9A 4N9PA 3ETRA 1PRTD 3Q69A 3OPOA 4RH6A 1PDXA 5A2QE 3HVZA 1SSNA 1QNUA 3S2HB 2EELA 4K5VA 2LY7A 1E0BA 3V3XA 3VYTA 5C5LA 2A69D 4ZRQA 3IXSA 1M8AA 2IX3A 4K2LA 1GUTA 2HCCA 1IHZA 3GTLB 1S5FD 2TMPA 3EGRA 2CJOA 3H91A 3V96A 1YN3A 1WCMB 1RWSA 2RSNA 1HFGA 4QMGA 4EGVA 3D8GA 2KOLA 3SXHA 3U7ZA 1PTOB 3CWIA 3RZDB 3TP6A 1P7EA 4A9AA 3PUYA 2CHBD 2B63B 1PFDA 1HZ5A 1PTOF 1GUGA 1KDCA 3IFTA 3KQ4A 3TEYA 1MVKA 1LTRD 2R3ZA 2RPVA 1JE4A 1RJTA 1HRJA 2J42A 1QOFA 1N60A 4KJOA 4B08A 2XVSA 3U2SC 3S16B 1W6JA 3Q8EA 4DK0A 1F9RA 3I57A 5CC4A 2J53A 3TUOA 3AE6B 4FF3A 4WIPA 3A55A 1B1ZA 3T53B 2L55A 1Y1WB 3TEZA 1ZKOA 4DNTB 1UUPA 3DWMA 1TZOA 2EYPA 1TVXA 3CQZB 1VF7A 3V05A 4WRDA 5G3LD 3PUWA 1IUEA 5ISRA 3AEFB 1TJEA 4C7YA 2LS01 4ID6A 2W82A 1V1PB 5HGTA 2WXGA 4V0BA 1PTOH 1ICWA 4TQ0A 2I46A 1TKGA 4G4KA 4X3SA 4L23A 1Z47A 5IGFA 2PIAA 3C8YA 4XYOA 5AUKA 4ZHOA 4RCOA 4IUPA 4BS9A 2OT2A 1QF6A 3MJ5A 3NZ3A 1LTSD 3TBIB 2A6HC 1ZPSA 3K59A 5E4XA 3HOUB 2WP9B 1MSGA 3H94A 3HOVB 3AB5A 1AZPA 1S5BD 1Q1EA 1DOKA 1BCPD 4Q5VA 4P6VF 1N61A 3OWEB 3SK8A 2A6ED 1TWFB 1ACCA 2EKIA 2MJDA 2YEPB 1GOZA 5EPKA 3W2DA 5M9OA 3RPFC 4EQPA 3P42A 2KCNA 3L4PA 2NVTB 1Y8NB 3Q23A 2WU2B 1DCZA 1F2MA 4XTCS 4C3HG 1YN4A 2WXJA 4JPSA 1II3A 3KK7A 2AUJD 1H9SB 3ZYYX 1EWCA 2G9HD 4Z9CB 1KAAA 2EYMA 4ARIA 5CBAE 4TSSA 4FYDA 3NVVA 3SK5A 4JK1C 3NS1A 1VLBA 4ZQ3A 2AWOA 2BDOA 1MPEA 3BS1A 4WFN3 2ICEC 4A6QA 2HQEA 1YJJA 4A8XC 3NVZA 3A8IE 5ELFA 5CV9A 2V3NA 2CU3A 1M4VA 4WORA 5JEAH 5M5WB 1XX8A 3BG3A 5COYA 1J7CA 2L5TA 3FDTA 1L4ZB 3W5VB 1FR3A 1L0YB 1I4PA 3MP9A 1UGJA 3S1NB 4A3DB 3S15B 3D4DA 3S17B 2Q5WD 4LLGM 1C48A 1JW9D 4A3IB 4A3JB 1JB3A 4U673 1MSHA 2FHTA 3CKIB 5C0XI 1VDVA 4KGSA 3HG9A 5EQ0A 2F0MA 4B0EA 3Q8BA 1QQRA 2F0KA 1G291 2K6AA 5AFWA 1C4CA 2TSSA 1JICA 1QOAA 4X3TA 2RBMA 1B9MA 3H6MA 5JPMC 2QILA 4IUNA 1TYGB 3D4RA 3J9CA 1ZYRD 2KEDA 1LTTD 5E6JA 3IL8A 2XSCA 1JWMD 2EPBA 2BT6A 1RODA 1SNMA 3AE5B 3MAQA 4HROA 1PRTF 4NJCA 1TY0A 1WTPA 3DWGC 3KBXA 4FF4A 2JEBI 5CORA 2Q8TA 3OWFA 2EYHA 3A54A 3C1EA 1SMYD 2F03A 5TSSA 3P4SB 1CTMA 1VMCA 5D3DA 2JA5B 3VA7A 3EVQA 3TP5A 2KQ4X 1YNND 2XWBB 1D6EC 3QO2A 4XXEA 2IX1A 1LLRD 5CV8A 1KRHA 2WB1B 1STGA 2Y0SB 1W6KA 5IODA 2VZKB 5C44B 5DM63 2Z4IA 2WKDA 3HEJA 1WWTA 1EYDA 4KY7A 4RWSC 3S14B 3I9V1 3AE3B 5BMHA 2E2JB 1PLFA 3T16A 4A3BB 3VRBB 4K5XA 5ELCA 2BB6A 1ET9A 3WOFA 2PW5A 2IT1A 3NHHA 1ESFA 3K7AB 4HAEA 2BCOA 5JVG3 4XDXA 5BN5A 1WYGA 1KF6B 5J1ZA 2WINB 2WXLA 1NVID 5T1IA 3FVQA 3M7GA 3VR6A 4OL7A 1JROA 3D3RA 4K8IA 4IUVA 2M56B 2QKIC 5C3EB 1JOOA 1N63A 1YNJC 2BBCA 3PV0A 1YMHE 1OXVA 2L83A 2GI9A 5E4WC 1DM0B 2BS2B 2FMMA 5EKIA 4DXGA 1CQFA 1PTOD 4FF2A 1C9FA