1M4VA

Crystal structure of set3, a superantigen-like protein from staphylococcus aureus
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
200
structure length
196
Chain Sequence
AKYENVTKDIFDLRDYYSGASKELKNVTGYRYSKGGKHYLIFDKHQKFTRIQIFGKDIERLKTRKNPGLDIFVVKEAETVFSYGGVTKKNQGAYYDYLNAPKFVIKKEVDAGVYTHVKRHYIYKEEVSLKELDFKLRQYLIQNFDLYKKFPKDSKIKVIMKDGGYYTFELNKKLQPHRMSDVIDGRNIEKMEANIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SET3, superantigen-like protein
publication title The three-dimensional structure of a superantigen-like protein, SET3, from a pathogenicity island of the Staphylococcus aureus genome
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Immune system
total genus 54
structure length 196
sequence length 200
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
A PF09199 SSL_OB Staphylococcal superantigen-like OB-fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1m4vA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1m4vA01
1M4VA 1D6EC 2SEBD 1YN4A 4ZYSA 1I4XA 1S5BD 1SXTA 1S5ED 3V05A 1D5MC 1XXGA 1BCPC 1I4GA 1MD2D 3OWEB 1EEFD 4L63B 4RGTA 3DWPA 1T5XD 1PTOF 1I4RA 1TS4A 2IPKD 1YN3A 1FNVA 3CHBD 1EU4A 1CQVA 2XNAC 1LTBD 1PRTF 2R61A 1SE3A 4RHSA 4O1NA 1PTOC 5FK9C 4RHRA 1LT4D 3BYYB 1XTCD 1BCPB 1LTRD 1S5FD 5ELCA 1PRTC 2XRSD 3EFXD 1B1ZA 1JWSD 3R2TA 1BCPF 5TSSA 3DWQA 1I4HA 1SE2A 2Z8LA 1PZKD 4TSSA 2CHBD 1LLRD 1CT1D 1PTOB 2QEJC 3BVZA 5I4DA 2QILA 1LTSD 1CHQD 1BCPD 5ELBA 2O2LD 1PRTB 1KLGD 1LT5D 3BYTB 3DWAA 1TY2A 3TSSA 3W2DA 1CHPD 1B44D 1EEID 1V1OA 2J4XA 1V1PB 1L0YB 3EA6A 1KTKA 1LT6D 3MFGA 4L6TB 2ICIA 4RH6A 1LO5D 1TY0A 1SJHD 1FNUA 1G8ZD 1PTOD 5D3IB 1S5CD 1ESFA 1D5XC 5ELEA 4C56C 2AQ1B 1L0XB 1CK1A 1HXYD 1PRTD 5D3DA 1FD7D 4RGOS 5FKAC 2XRQD 4RCOA 1AW7A 2IJ0A 1SJED 1EU3A 1JQYD 2RDHA 1STEA 4DXGA 1UUPA 1SEBD 3R8BA 4RGMA 1DYQA 1SBBB 1LTGD 1SE4A 1ENFA 2TSSA 1JCKB 1KLUD 2RDGA 1FNWA 5ELFA 4RFBA 1HA5A 1LTAD 2XN9C 4DXFA 2WV6D 4RGNA 1GOZA 1I4QA 1RD9D 1YN5A 1D5ZC 1HTLD 3BVMA 1PZID 1LTTD 3KLSX 1TS3A 4K6LA 1JR0D 1S5DD 1BXTA 3URYA 1EWCA 1FGBD 1V1PA 1F77A 3SEBA 1ET9A 1AN8A 3MC0B 2NTSA 1RDPD 1EFID 3BZDB 1TS5A 1UNSA 5ELDA 1I4PA 3GP7A 2AQ3B 2AQ2B 3BVGA 1HQRD 1LT3D 1LTID 4NZLB 2NTTA 1ET6A 1PZJD 4Z9CB 3R2IA 1TS2A 4OHJA 1PYWD 1JWMD 1DJRD 1JWUD 1QILA 2G9HD 3O13A 1RCVD 4UDUC 1RF2D 4BWGB 1PTOH
chains in the Genus database with same CATH superfamily
3H0GB 4AUQC 4Y7NB 2Q2UA 2PMVA 4JPSA 1YN4A 1DZ1A 1ZXTA 3UDIA 4CJ0B 1F2LA 1U5KA 4JI3L 1O7ZA 4QL5A 3IVFA 3B2FA 3U50C 5IYBG 4KX6B 5HFYA 1BKBA 1XXGA 4K2KA 1PVOA 3QJZA 1I4GA 3APCA 2YLMA 4N59A 2KOXA 3MVVA 3DWPA 1N32Q 4R4QA 2LVOA 3N1YC 1SFOH 1S3OA 3E9IA 2Z4IA 4OEMB 2HDEA 3VTUA 4TVAB 2K8BA 3WWVA 1GJXA 1NYQA 1WI5A 3CQZB 4AQYL 4HCPB 3PRZA 4EQPA 2JP1A 1AYFA 3BG3A 1E24A 1STBA 1WTVA 1FFVA 3ZUNA 1RJTA 2VXWA 2PEAA 4JYAQ 3P63A 3Q3MC 2H1EA 2Q8IB 4IWOA 4JCVE 1DCZA 5C5LA 1V2YA 2A1AA 2E3TA 4HWIB 1F2MA 1C79A 3DBRB 2Q2IA 3C46A 3AM9A 3L7ZC 3AFPA 1I94L 1YIJA 3S1NH 2ZW1A 3S15B 3OJ3A 1P8LA 1MG8A 3KK7A 4ULLA 4FXGC 3T1YL 2QDFA 2O2LD 3RNCC 2I2YA 1A3TA 2UUBQ 3Q2AC 4K81A 4HDOA 3BWUD 1TKEA 3DVNV 1V1PB 3HRZC 3PF4A 2IY0B 1XWEA 3K9OB 3Q8CA 1Q3LA 2PPBC 4A3FH 3P4QB 3R93A 4LF9Q 3S1RH 2BWES 2FCQA 1S5CD 5ELEA 5J2RA 2WGSA 1H9RA 2ZCCA 1HXYD 4LK0M 4FF2A 1XT9B 3X0WA 1X3GA 2I5LX 1YIWA 2KX3A 3K9PB 5M3FH 3GV6A 1V5TA 4KIKB 3UDGA 4OXPA 3CF6E 4IOIE 4ZHOA 1X56A 4XYQA 3F2DA 1EU3A 1JQYD 3CF5A 5C3JB 3K81C 5IT9L 4DXGA 4LF6Q 1QZEA 2WACA 2WDQB 2L11A 4GB9A 3RNEC 2XGTA 2WX1A 3LB8C 3SVMA 3SFEB 4W9CA 3UGBB 1B53A 3AEGB 1J7CA 4KN4C 4A3IG 3TBLD 2N9KA 3ZJVA 3VAWA 1TIID 3ZDMC 2WXRA 1HA5A 3MXUA 3P1HA 4JI8Q 2F0VA 3DXJC 2E2JH 3VFKA 3NZ3A 4JK1C 1ZDVA 4IUTA 2CWAA 5DCNA 1R4MI 4GKJL 2EJFC 4FULA 4RAUC 3DMUA 2I46A 2RD0A 1QOHA 4OWTB 1QOFA 3RNUA 3TZDA 1F77A 2KFKA 3WANA 3IKJA 5KNBA 2PMZB 2B3GA 1XPUA 2NTSA 4JQWC 2K5DA 1EFWA 4X64Q 4XDXA 3K7AB 4BKGA 3PO2G 3ZJTA 2B2UA 5AJ3Q 5J22A 4A3EH 4UY8C 3RZOB 4IC7B 3SK4A 3GP7A 1GUAB 3PGZA 2VUMH 1Y14B 3QC8B 2SNMA 2EYPA 2G5DA 4EUTA 4NKLA 3AU7A 2H5XA 1NCVA 4X3TA 4DAPA 3FAHA 1DJRD 1JWUD 1PLFA 1EQRA 1QILA 1VF7A 1PH5A 4P16A 5G5GA 4ZHPA 2KVMA 5LMNQ 4PG3A 2KVRA 2G9DA 4DAYA 4HJGE 1DOXA 2QCZA 3NSWA 2GN5A 3H15A 4JVZA 1KD1C 1I3QH 3SK8A 4ME3A 1EM7A 1SXTA 3TDQA 5FR6A 4TRDA 2CQOA 3KBXA 3GB1A 5JVH3 3NBHA 4RGTA 2WINB 1EL0A 3A5UA 3T1HQ 2L3ZA 2L1AA 4USAA 1VQ4A 1FD6A 2C9OA 2LJ5A 3CHBD 4NXML 2NN6H 2W82A 1PRTF 3DHHC 4L1BA 1Q46A 3V6CB 4OZCA 1NMGA 4IJHA 1ASZA 2BCOA 3L0WB 4PS8A 1BOSA 3T9LA 3BS1A 1Y56A 4DUZL 3TS2A 2W9NA 3I4NB 1K8GA 4DR2Q 4U673 2XRSD 1ICWA 3TUOA 3R2TA 4KN7C 2JN4A 1NEKB 3CMMB 1EUVB 2MA9B 3QK0A 4WQOB 5C1ZA 5ELNA 4JI6L 3B6YA 1PZKD 1HZ5A 3IT6B 2EJMA 4W9JA 3NWSA 4XDDA 2ZXRA 1MBYA 1VQOA 2OXPA 5E6JA 3J80i 2WP9B 4JBKA 2B2UC 3VYRA 1XX8A 2HQLA 3K80C 2X38A 3NVYA 1LM0A 1UE5A 3W2DA 4CQNA 1IPGA 3CCUA 5C3WA 4RA8A 3AEAB 3T8MA 4AJWA 3I4MH 1QLBB 2KFKB 3AFQA 2BTEA 4RH6A 4DV1Q 3BIID 1Q1EA 2ENBA 1N34Q 1I42A 4TKOB 4X57B 3J7AV 1ESFA 3OWFA 1PV4A 4EQOA 2ID0A 1NNXA 4C3IB 3ZJYC 1WZ3A 1FD7D 4PNYA 4E6IA 2PI2E 1QZGA 4P72A 1EQVA 3V6EB 1K3BC 1TIFA 4NXNL 1CKMA 2IJ0A 2PMZE 2PW7A 4S0RA 2EYLA 2ZCBA 4DAVA 5EE9A 5HY6A 3H1UA 4RGMA 4P74A 3B9JA 3X3NA 1O7LA 4DAYB 1STNA 2KHJA 5TR5A 2TSSA 1MSHA 1SNMA 1YITA 1JE4A 4WWOA 3NVZA 2L0CA 4FNFA 5LMUL 4C3IG 3ZXVA 5ELFA 2WXGA 1ZOYB 3QA8A 1UF0A 3CD6A 2DNFA 1ONLA 3NBHB 4Y7NH 2O2VA 1CFMA 1T0RC 1EZ8A 5CV9A 2X69A 3QAQA 4IW0A 3HVZA 2F1MA 2KQ4X 1S5DD 1NBWA 2L5TA 1JJ2A 1VQKA 1ZDXA 2VZKD 4FYDA 2F52A 1C4AA 2EMSA 4K0KL 3G48A 1WFYA 3RNBC 3VUXA 4WWMA 1WJ4A 3MC0B 3UDFA 1BR9A 2BYTA 4IUPA 1MKHA 2J52A 3CQZH 1KDBA 4B3RQ 2KHWB 4HSPA 1UAPA 2IT1A 1JWAD 3FRPB 2KACA 1HUMA 2AQ3B 4KHPL 3KUPA 2WXKA 3J81i 1ML0D 3KUCB 5C5MA 4KV6A 2UWQA 4Q0FA 1QF6A 3T3OA 2WXQA 2F0TA 1ZW7A 4GLSC 4BY1G 1WTPA 4M8NA 2FBWB 3O13A 2MFIA 4KD4A 1RHPA 4W9GA 4BBRB 1JMCA 2KT7A 3BY4B 3J80c 4K2LA 1SMYD 3BJUA 2BYVE 3WOEA 2IYDB 1B9NA 1U9RA 5J18A 4F8MA 3TEHB 1ASYA 1T5XD 2K25A 1II3A 2GI9A 3CWIA 3M9BA 1VMCA 2LUMA 5DNFA 1HE8A 4WAFA 1QQRA 3UINB 2Q2TA 4F1SA 4IWQA 3D0FA 4A3IH 3NY5A 1PTOC 4QQBX 3NZSA 1I35A 2QIEB 1SR3A 3VA5A 3RN5A 4KHVA 1VQ8A 4W9IA 2D2CC 1R4QB 2FAZA 1WGDA 3EFXD 1WD1A 3CC2A 1N62A 3E5SA 1B1ZA 2Z59B 1NBFC 4JI4L 4ZK9B 2QC8A 2WNMA 1IW7D 4TUUA 4BA1I 2LXKA 3NTHA 1J19A 4ZRPA 3BK2A 2JXXA 2KCMA 5AZFA 1Y8PB 1PTOB 2O2VB 1YBYA 3KYDD 1RL2A 2K6DB 4LFAQ 2EY1A 2WB1G 4LJPB 2KDMA 3PSEB 1NYRA 4J3OD 3S24A 4HCNB 3IFDA 1HR0W 1WTXA 1CA5A 4P1BC 1YJ9A 1T3QA 4FHKA 1HTOA 5GADC 2ZJRA 1YX5B 1SYCA 2JVCA 3NK9A 1JJCB 4QF4A 4WRDA 4X65Q 2JA7B 1E8YA 2PW5A 3B1LX 2ZTEA 5DLQE 4DV4L 3I91A 3HOVB 4AQ7A 3NE5B 4W9DA 2EXZA 4B6WA 3OW7A 2J7ZA 4CKEA 3FILA 2RSUA 4J15A 3K7AH 1IBLL 1VLBA 1OXXK 3NUHB 1U4RA 4ZYNA 1JE5A 1OQQA 1RWSA 1ZE3D 1BF4A 3VYUA 4JE3B 4NAMA 2LEKA 3J81c 3BDCA 4R8NA 2PPHA 3Q8BA 1C1YB 2V9HA 4TKNA 1HH2P 3OTOL 1WYWB 2M2LA 3O65B 1AEXA 2UXCL 1JQ4A 4XX5A 2PQEA 3MHBA 4I6PA 1GM5A 2ZXOA 1HFGA 4BXXG 4KGTA 5G3LF 2HHHQ 4KSKC 1ZP0B 1GOZA 2N9EB 1RFAA 1X65A 3IT4B 5C6AA 1NSNS 1K8MA 1B50A 1P0RA 5EPLA 2BB5A 3EJIA 4CDFC 4UP7A 1YD8U 2PVOD 4PT5A 2VH2A 4LLGM 5C23A 4R4TA 4DR5Q 1FM0D 1C78A 1MG4A 2XIWA 4KKSA 3RT3B 4HPMB 2MX2A 3RZFA 2L0FA 4EX5A 1NE3A 1DD2A 2VRRB 3I4NH 2KJXA 2RSNA 4EQ5A 1WR1A 1UWXA 2JE6I 4GN3B 2GBKA 1PH9A 3G6EA 1KIXA 3MFYA 3F1ZA 4RKBA 4X66Q 1VZ6A 4NPSA 2JUOA 4IM3A 2PW9A 3W5VB 2LXJA 3ZLZA 2LWPA 4LNFA 4ZYSA 3I73A 1IZ6A 2CU1A 3WAMA 1HA6A 5DM73 3AQQA 1N60A 4P2CB 1WM3A 2XEWA 3R3OA 3U4EG 4PQXA 4JI5L 1RLFA 1XJVA 4GKKL 3LYYA 2WX0A 3NTKA 1Q5WB 5KEEA 1WX7A 2WYQA 2CR5A 2N1WA 3RD4A 4FP5D 1M90C 2NB0A 3K59A 3FILB 5D7GA 4OX9L 1LTBD 1C3TA 2K8CA 4N9TA 5A2QL 2PZWA 2GA4B 4C3IH 4LUOA 5IGEA 3GS2A 1C4PA 4LDTB 3MWYW 2BS2B 5BMGA 5EQ0A 1TKWB 1KM7A 1DOYA 4JV5Q 2BS3B 3G4SA 3NP8A 4BZAA 3L2PA 4DV6L 5LLIA 1ESRA 1XTDA 1K8AC 3SU8X 2LRWA 4KI0A 1Y8OB 1MI0A 4JWSC 4B3SQ 2M8SA 4PYZA 4ZRIA 1N36L 1SNDA 4B3MQ 1YX6B 3LWUA 1IGDA 4CKBA 4K5VA 4C7YA 4ANVA 5FR3A 3GTMB 4H02A 3LXFA 4IWPA 4B0EA 2R93B 1X55A 2W54A 3MXGA 3UE0A 3AMZA 1Z6HA 4L8JA 4DU9A 3ZO5B 2BDOA 3CIRB 1GD7A 4MN3A 3F2CA 3QARA 3MFGA 1MHHE 1WGGA 3PUYA 2R92G 4CDEC 3M85A 4GZYC 2L76A 5D3IB 2KTFA 4OZBA 1WGKA 1MPEA 2MNAA 4IFDG 1X54A 2BE5C 5LL6S 4YT0B 1LM8B 4MM3A 2MCNB 2R93G 2I5MX 3I57A 1ZKHA 2PE9A 4K7WA 2OTLA 2INPE 4KGRA 3QB3A 2KWCA 1DOKA 3NS8A 4TV3A 1WTOA 1XD3B 4DBGA 1LQBA 3ONSA 1K53A 3LGJA 3IG3A 3L9AX 1UUPA 5EBDA 3S2AA 4EZJA 3JYUA 4QB4A 3ONAB 3RLNA 1R4NB 3FVQA 4NPNA 4OELB 4A3OA 5KNCA 1I6VC 3JC66 3A1QA 2PZTA 2I1KA 3GTJB 3SDZA 2BYEA 2JQOA 3T56B 3CW2C 5EKIA 1VQ5A 4BBRH 1QG7A 4HLEA 2KJ6A 2LGYA 2H88B 4DA2A 4I7ZC 1WX8A 2OCEA 3BVMA 3N52A 3HZXA 4LF4L 2Y5PA 1JJGA 3MTSA 1LTTD 5DAUA 3IBEA 1SDFA 4YCVA 1WH3A 1ZKOA 1DXMA 4UP9A 5CBEE 2AWOA 2RQXA 1VQPA 3RCZA 2LGIA 1AN8A 3VA7A 1QVGA 4R8IA 1JORA 1EF1A 2F0PA 2KAJA 3Q8DA 4LFCQ 1E10A 2K8HA 1IBML 1YI2A 4LF7Q 2UUCQ 1Y8RC 2GB1A 5DPSA 5GMVA 3RUIB 1WFQA 1WJ6A 1J8CA 3ULJA 2BGFA 3QQ8B 3QWNA 2DY8A 2IX0A 3K0YA 4KKUA 3RZDB 1FMAD 1VRAB 2RHSB 3A74A 5E4WC 1UH6A 1AE3A 3PUZA 1Q81C 2KJRA 1NDDA 3M3JA 3MHSD 1BQQT 3DHGC 4XQQA 2KMAA 4N8FA 2JZZA 1PTOH 3HOXB 3T16A 2MRPA 3CRKC 1R7SA 4ALPA 3MZ5A 4O2DA 5JXVA 1KXLA 1ZYRC 2GMIC 2LFIA 1IBKL 5KIXA 4YTPB 3CAMA 3U2SC 4LAAA 4K7SA 4A3CG 2NVQB 4OO1G 4L5TA 3A33B 1I4RA 1SB3C 3LJ3A 4N9PA 3NEMA 4MM3B 2K5VA 3Q14C 4GLAC 1N33L 4KZCA 4E3CA 4A20A 3HOXG 3HOVH 2JWZA 4RHRA 3E0EA 3KBGA 1EY9A 1LT4D 5M5YB 1I94Q 1EIYB 4BXXH 4IUNA 2E2HB 1QKZA 4JI7L 1SIJA 4DV0L 4CDCC 3HOUG 2EIFA 4EGVA 4MT5A 4ZCKA 1Y69U 3T1YQ 2QA4A 4DV3Q 2DUDA 2KXJA 3A1QB 3DVGX 2BBCA 4P75A 3OHXC 2D3CA 4QUFA 1SF0A 2KEDA 1G51A 4XT1B 2YVCA 3UI3A 4GS3A 4C3HB 2CFMA 1RAXA 5ELBA 4DPGA 1S40A 1Y1VB 3PVLA 1KLGD 3PUWA 3TL5A 4MACA 1YJWA 1EEID 3CC7A 2RR9A 1VJKA 4MELA 2M00A 3I5JC 1EY5A 4CO7A 1TY0A 1G8ZD 4HR7B 1PGAA 1G2SA 2M4NA 2BKRB 2B63B 1C0AA 1PFDA 4C3HG 3A55A 4KMUC 2K7VA 1Y1VG 5L37A 4L5RC 3A54A 4NW2A 5K5PA 4DR7L 3HG9A 4DR6L 5IN7A 2AEHA 1D4BA 4KKIA 5FKAC 3W1YA 4BOSC 4CKCA 5CR3A 4ZRZA 2XK5A 4RCNA 1HR0Q 2MJEA 3WIMA 3OIPA 1G6JA 3DVGY 1WRIA 4KZ0A 3TCAA 4X6AH 3AN1A 4GKJQ 2B63G 1GB4A 1MI2A 3KWVA 2JA8B 4KY5A 1FCCC 2WU5B 3BK1A 4W9FA 4QAYA 3WDNA 3D4WA 1P9DU 1LTAD 3DEPA 2F03A 3AEVA 2A4ZA 3MAQA 1BNZA 5C4HA 5I2YA 1JMLA 1XEEA 3NHHA 3W5UB 1X3PA 1VQHA 4PS7A 1VQNA 3URYA 1PH8A 1TGZB 3RULA 2IHFA 1R9TB 2LKVA 4B0MA 3H3VI 1C4CA 3W1GA 3VRBB 2JA8G 5MPOA 2GRIA 3OOCA 4EZLA 1T0QC 2KCTA 5IGCA 2V3PA 3VR6A 1XMOQ 2WXNA 1GPXA 3OPOA 3Q3FA 3L10B 3ZRFA 2JA5G 1MGSA 1FCLA 1SIFA 4R4CA 1A62A 4HK2A 4CBVA 1X3FA 1L4ZB 2FIFA 3QIJA 2KVZA 3DQVA 1SNPA 4I6LB 2R92H 1F9JA 3Q23A 1VCIA 3SK6A 2UXBL 4OVVA 1D6EC 2EKIA 1J5EL 3AV8A 3GTMH 2DZKA 4WORA 2EPBA 2P5ZX 1WTRA 2R93H 2KDIA 4NXMQ 2ON8A 3OIQA 2IX3A 2IY1B 2KMMA 1E2ZA 1NTGA 4S17A 4NQKE 2HJ8A 1UGMA 4MJSA 2VS1A 3E9HA 4DK1A 4TQ1A 1WTWA 2FINB 3VH4B 3GTLB 3AB5A 3T3NA 3EHVA 3M4PA 2WDTB 1TQOA 2ASQA 4HIDA 3HHMA 4WFN3 1IKLA 3AMUA 2NR2A 5FK9C 3ML9A 2GLSA 4HROA 2MGSA 4ARIA 4A9AA 2XK5B 1ILQA 2EYOA 4IQZA 2Z1CA 2G3QB 1ISNA 3PF5A 2BA0A 3K6OA 4HJKA 2N1VA 1BCPF 3H91A 3DWQA 5M9OA 3SE0A 2N7JA 2HTHA 3A9JA 2F0SA 3ABVB 1SSOA 1RTNA 1A3VA 3KJPA 1B9MA 1C48A 3R3MA 1LTSD 3GTJH 5IYCG 3GTOB 1TTNA 3T51B 3TMEA 1KAAA 4YWKA 1JB7A 2KO3A 3VDZA 1GNUA 2H89B 4AOFA 5F2DA 2E5LL 1PH6A 3U7ZA 3VXWA 1SYDA 3Q6BA 4P71A 2Z6BA 2NZOA 3OJ4B 3FC4A 5FLXE 1EZ6A 2MO0A 1W6KA 2WAQG 2D07B 1L0VB 1Y8NB 4GU2A 3NVVA 3BZCA 1KHIA 2F0HA 1OQYA 1CM9A 4E71A 5JH5C 4IOCA 1OTRB 1EQTA 3D6CA 4LFBQ 4FLHA 1X3QA 2EQSA 5J1ZA 1ILPA 2MBEA 5G55A 1XMQQ 3AU5A 3U9OA 1YNJC 4FJZA 3PS6A 4HDQA 3Q24A 3RZDH 1UBIA 3ITPA 3SHQA 4A3CH 2KQ7A 4K5WA 3JAMc 4OO1H 4HCEA 1E7VA 3H7PA 4DUYQ 1F9QA 2INDC 2L7RA 4MGKE 2K5QA 1FNWA 2QDBA 4D2KA 4DV5L 1AZPA 3HOXH 4GIVA 1D5ZC 4MJSB 2AWNA 4QMGA 4JI1Q 2L05A 4NJCA 4A3IB 5C3EG 2EYHA 3KLSX 2PNRC 2GOWA 1BXTA 4A3GG 4YCUA 1KLVA 2AL3A 2GBJA 2NVQH 4OWWB 3AU4A 2ATWA 4C00A 2CHZA 3Q8AA 3SEBA 4GOPA 4FXCA 4NMZA 4JGHB 4K6DA 2C5LC 4XWTA 1UGJA 5I6WA 2KWVB 3VR8B 1SLJA 3HVDA 4G11A 1CKOA 1GUTA 4FA6A 1A15A 1CZGA 2E2DC 2NWGA 4OL7A 5FO7B 3WOFA 3VHTC 4BBNC 3A9JB 1HNWL 5M5YH 1N5WA 1F2RC 4I65A 2E2HH 3X3MA 3KQ4A 2VQFQ 4NZLB 2EYJA 1K0RA 2FXQA 5G5HA 4GLVB 2NTTA 3NQIA 4OW0A 1PDQA 4CHKA 1F52A 2WXIA 3PREA 3PO2B 1RODA 4FHJA 1BUVT 2FIDA 4MIUA 4UDUC 5EKKA 1ZXIA 3KVFB 4OIJA 3UDXA 2CKZB 4C3HH 1TWGB 2Y0SB 1J9OA 1SAPA 4HSVA 3Q0AA 2I38A 4KV2A 1Y1VH 4ZUIA 4EFOA 1V5OA 4PYUA 1FFUA 2YU9B 2D10A 2F4IA 1RRBA 2J0KA 2LD9A 4RF0A 2CHXA 1MFWA 5K36H 1EYCA 2A8VA 5J17A 1TS4A 1T9HA 2L1BA 1YN3A 2XNAC 3VR2A 4JI4Q 2FJ2A 2B63H 1VD2A 1EY4A 2RCFA 2Y0SG 3ZJUA 2ZVOA 5KRUA 1PGBA 2RGFA 3MC8A 3LX0A 4WJQA 2A6EC 2GBRA 3AI5A 2K52A 2QF7A 4JI0L 4LF8Q 5IWAQ 2K5PA 2NMQA 3H7PB 5COYA 2AUKA 1I4HA 4JC0A 4GOPC 4NJ7A 2CW0C 4YHHL 1YJJA 4ARCA 4NDXA 5EAYA 2JA8H 2C5CA 1LFDA 1SSNA 2M17A 4HN7A 3IFWB 3DBRI 3RNAC 2NBFA 3M63B 5JHAA 4ZUJA 3RR5A 5HGQA 2EYMA 1XNRL 3ZIMA 3KLRA 3V2TA 1YQBA 1E90A 1B3AA 4GOPB 1STAA 1LT6D 2JA5H 2I0QA 4A3DB 2QMTA 1FIQA 3SDLC 2WXPA 4DDGD 3SHLA 2NZHA 1PTOD 3PQIA 4ZLTF 2DHZA 3FMCA 1R9TH 4QY7A 5AZHA 2I5HA 2JXMB 4K8JA 4KJNA 1C4QA 4I7AA 4YCWA 2VQEL 3KUZA 4OWXB 3PTFC 5CV5A 1QZHA 4B9KA 3JAME 3CRLC 4DXAB 2IGDA 2NBWB 1NAPA 1XNQL 1A70A 1VS0A 2KLCA 3OTOQ 1P98A 3PO0A 2OQKA 2OT2A 1AW7A 1WE6A 2IGGA 2ASBA 2DAFA 4F87A 4OVZA 4A3DG 4FJYA 3EBEA 4TMAB 4A3BB 3P75A 3U9SA 1HTPA 1YHQA 5E6PA 2K28A 3TQYA 5BMHA 5EBCA 3U30A 1L5PA 2JU6X 3RFZB 4POGA 1CZPA 2RDGA 5CHWA 2FUHB 3U52E 4DXFA 2KYWA 2KTRA 3FKYA 1ZGUB 5BMIA 3QWZB 3STBC 2YEPF 1PYSB 5GQOA 3J80L 2JYEA 1T5EA 4EEWA 1VQFA 1E8ZA 1WD0A 1CI3M 1NMFA 1TWHB 1CA6A 2VB3X 4A3BG 2IO0B 2MSED 1QWYA 2BVCA 1UE6A 2FFKB 1Z47A 2RCNA 3TMPB 5JJIA 1XLOA 4DKAC 3GTLH 2Q5WD 1WXSA 2K14A 3ETRA 4R1JA 1WF9A 2H4OA 5IYBH 1WI0A 4CDDC 4B3TL 2KDFB 2IW3A 2LSSA 2LHDA 5L95C 3NELA 4X3UA 5IYCH 4TQUS 1PFMA 1DGJA 4LMQD 2MJ3A 3I72A 2BWFA 3HOYG 4KDIC 5LNK1 1N32L 2MBOA 3RMKC 4LF5Q 1KDCA 1QNKA 1LABA 2CKHB 1SNCA 4DV7Q 4WAAA 1V43A 4XQJA 1GHKA 1K8RB 1EO6A 1W2BA 3QX1A 4RM8A 4LNQA 1F9SA 4MGYE 3IAM1 3P4RB 2ZPYA 1K8OA 3WALA 4ZDVA 1KNAA 1MHXA 2JXTA 3RPFC 1VQCA 3GTOH 4OX9Q 4CGYB 5E3FA 1BDOA 1OQRA 5BYQA 1UEAB 5C0XI 2KZRA 1WCMB 4BY1B 2LJIA 1TWAB 3MHZA 1CTMA 2JZPA 4WJNA 1V86A 1O78A 1EUJA 1FNVA 1PH1A 1P7FA 2CQAA 3A7LA 1WTQA 2MUYA 1EY6A 2IHEA 1E22A 3S1QB 2JA6G 2DWQA 3C1EA 5CMDA 1WWTA 2KOLA 3NVWA 1XTCD 1N36Q 2UUBL 3K8AA 4YY3L 1TT5B 3NWTA 1KRSA 1WCMG 5FO8B 1L4DB 1Q0WB 4AIMA 4DNTB 2O6VA 3AECB 3C8YA 5AFWA 4X62L 3K5OA 1TBEA 4WURA 4LF9L 3EECA 2KC1A 4PV1C 2WXMA 4BS9A 4RWSC 3J81L 1B8AA 5J39A 2LVQA 4A3GH 5T8IA 3VUYA 4DK3C 3NOBA 1KRHA 2N3SA 2KTRB 4PS3A 2OOBB 1J7AA 4LDTD 4XQNA 2BDNA 5M3MB 3KF6B 3WA0A 4BA2I 3DWGC 3D4RA 1CUKA 3NJTA 3D4DA 1C9OA 4NP5A 4QUCA 4DHJB 2GBMA 3ZYYX 2B2WA 4IUUA 4LF6L 2F0QA 4XIGS 2UYZB 1E0ZA 1OFFA 3EROA 2WB1B 3OAWA 1MJEA 1KQSA 1XPOA 4JI2L 2HDLA 1W3SA 1EQQA 5E6NA 3L16A 5M3MG 2AHOB 4DDID 5IT9E 4M8MA 3BDLA 1Z2MA 3ZRCA 1FXTB 1P16A 1KRTA 4RNAA 2AYOB 2M56B 1TWFB 2CU3A 2E74C 2K03A 3J81j 1VQJA 1IKMA 3D32A 4G4KA 2L9HA 5FO9B 1BMLC 1E7UA 1L7YA 4A3JB 1GC6A 3Q69A 4C7ZA 2N8NA 4N9F4 1ENFA 2FMCA 3L08A 4LF4Q 2MBHA 3KF8A 4B9WA 5FJ8G 4R4IA 3PO2H 1SE8A 3SXHA 1WVLA 1WZ0A 4X64L 4IM2A 4DNRB 1WYDA 4ID6A 5H1SE 4L5SA 1NJIC 4JX1C 4ZAIA 3M62B 2ZZPB 1JC7A 3M7GA 1L6UA 1TWGH 4KLKA 5C0XJ 2ES2A 3ML8A 4JLCA 2V4IB 4WJPA 3DEOA 4N58A 4A3JG 5IKCM 3CCQA 1TS3A 2YU9H 1GUWA 2A19A 1NR4A 2BE5D 1VQMA 3I56A 1VQ6A 2KN4A 1W6JA 3S9WA 2K0PA 2FE8A 4LUVA 1RIPA 5LMNL 3S2DB 3QR8A 1RDPD 1WTHA 5BR8Q 2YYZA 1E8WA 3WAOA 3FHWA 1HZ9A 1UNSA 3CP0A 2O6VB 4RMAA 3WAPA 3VTWA 3R7RA 3PO3G 2OJWA 3NQTA 2ZM6Q 2MWSB 1ZUD2 3T1HL 4ODGA 2K6AA 3QOLA 4GDKA 1JROA 4ZRQA 1A0IA 4OHJA 4PZ6A 2WXOA 3ZKJC 4NAWA 4ASWC 4B08A 1IBKQ 2KCCA 4A3LG 1OGWA 2EY2A 2SEBD 3P7JA 2L32A 2KQSA 3AE9B 2IZVB 4LJOB 3TEZA 4DR1L 3HP3A 2DAJA 3V05A 1OTCA 1FRRA 1N33Q 3N30A 3V62A 1BCPC 4FADA 2SDFA 4L63B 1P3QU 4XDCA 5EE0A 4IOAA 4BY7B 1FO4A 4FJVB 2WDVB 4A3DH 4HTHA 4DQOC 4LK1C 1D7QA 1Q82C 2KANA 4JI7Q 1HHVA 4YTNB 3L0OA 4DV0Q 2R61A 4WWPA 2D3GA 2A5UA 2B2TA 4DF7A 5CHVC 3APFA 3DM3A 5D14A 1E7PB 2N4FA 5KHQA 2UXDL 4O42A 5D6JB 1BCPB 2RA4A 1EY8A 2WB1E 5ELCA 1TKYA 1BBXC 4BY7G 2LUEA 2EY5A 1C7YA 3SK5A 3KF8B 5CBAE 1N34L 5ISRA 1TKGA 4A3BH 4TSSA 1DONA 1HFNA 2IO1B 4GXBA 1OXVA 3ERSX 3PCOB 3K7UC 1A63A 3AEDB 3QCAA 4I6NB 4YSYB 5KHOA 3SR1A 5GAGC 3AYHB 1S72A 3DBLI 4M00A 3X23A 2UU9Q 1ZYRD 4W9LA 1GC7A 2KK8A 3ND8A 2HD3A 1TR5A 3NXWA 3I90A 3G6JB 3GZNB 2B76B 5G2NA 2F0NA 1UELA 1SN8A 2HE7A 1V1OA 1CSPA 4KD3A 4PMWA 1FJGQ 3U7DA 2B3AA 1WRDB 4REZA 1TWHH 1LV9A 3HKZB 5D65A 2F4VL 4DR7Q 1UE7A 4OVUA 5CX3A 1U4LA 4P7IA 3KLSA 5JPNC 2DZMA 5E1FA 4C3JG 1NY4A 3S2HB 4A6QA 2JRIB 5AUKA 5HGTA 5JJKA 3KDFA 5D3DA 5EPKA 3NHEB 1RM6C 2EY6A 4KY7A 3GOEA 1SMXA 1KAWA 2BA1A 3BINA 1QUQA 2XSCA 2Z4HA 5IIFA 2EZVA 2R92B 2FCSA 3EUB2 4GDKB 3MXPA 5JEAJ 2K39A 5IYDG 3OLMD 4XXEA 1TZOA 1N61A 5IOIA 1SEBD 2KENA 3HKZG 1VDVA 3ER0A 3J7AF 2WDRB 1DYQA 3I9V1 4NAWB 2XVSA 3SGIA 1EWYC 2PJHA 3E3XA 1JCKB 3RYTA 2B2TC 2FUG1 2MPMA 1K52A 4B3RL 2LMCA 1RD9D 2JA6H 2NPTA 4HXDA 4HJAA 1QE6A 2VL6A 5IODA 1FXAA 2K1FA 1GAQB 1A8VA 3APDA 3DDCB 1VQLA 4K14A 1WCMH 2IL8A 4BY1H 1FRDA 1VMPA 1TWAH 3MJ5A 1TXYA 1KNEA 3J7A5 2DENB 2Z0SA 2G1EA 2F3VA 3UIPB 4C80A 2AKWB 2DJGC 4HKZE 1BBUA 3DBHI 2V3SA 2D0PA 5LL6X 2MP2A 2D9UA 3S1QH 4KTAA 2OTJA 4NY0A 2PTLA 2K50A 3S16B 2AX5A 4KDLB 1LT3D 1UE1A 4EE2A 2EYFA 2DLBA 1J5EQ 1ET6A 3IL8A 3K5NA 2ZW0A 4XC2A 4DK6C 1TS2A 2IGHA 5IAAC 1JWMD 1G6PA 3AULA 2K05A 1V8CA 4G0NB 1E5WA 2LXCA 1L2NA 3LWEA 3VDYA 4KSLC 3D8GA 3CSTA 5IP7G 5M3MH 1ZPSA 3PLUA 1TJEA 4BKSA 3NG0A 3D6WA 5H92C 1VQAA 4YWLA 2L8JA 3HOZG 1EEFD 3V96A 2FCMA 4MGIE 2B29A 2CH4A 1HNZL 3MC9A 2PCFB 3KDFB 3IXSA 1PYBA 2L55A 1LYLA 3PV1A 4ICVA 1EU4A 1KABA 2A69C 2RMMA 1QUQB 4W9HA 3V3XA 3PIO3 2WHIA 5FJ8H 2JWUA 3CCRA 1Q12A 3B08A 4XWWA 1RYJA 1XO3A 4JI3Q 2LY7A 2DGYA 1NUCA 1PRTC 2KBNA 1TWFH 2RBMA 2M9VA 2JQRB 1SYGA 1AWDA 3AE6B 4KKJA 3PSIA 2XBBC 4A3JH 5C2TB 4H0LC 4X3KA 1Z5SB 2JJQA 3CMEA 2JK8A 1Q90A 1IBXA 3H3VC 2DYOA 5CTRC 5A35A 4AQYQ 2LMCB 2NPTB 3F2UA 5JHBA 1FPYA 1VDZA 4NQLB 3HOUB 2Q8TA 2ZJPA 1PRTB 1LT5D 2J0TD 2D62A 4V0BA 2ZXPA 1S4ZA 2KA7A 3OW2A 3S14B 5HG2A 2WKDA 3NPPA 4WIPA 5T1IA 3A4SC 1LO5D 3B2GA 2HUGA 1FNUA 2B2YA 4DR3L 2MP2B 4IUMB 1AE2A 2EDGA 1CK1A 5LHY1 3S2DH 3ALBA 2HHHL 1X1MA 4DHZB 2WKCA 2K75A 3ERQA 2QCPX 3HEJA 4DV5Q 3AEFB 5CHFA 4ME5A 1SROA 4A4IA 1PA6A 2YTXA 1SE4A 5LXHA 3L17A 1QOBA 3DHIC 1DOMA 3RN9C 2Y3AA 2F0LA 2WXFA 2DZJA 1N63A 1VQBA 1N8RC 2KUMA 3KYHC 1R4NI 3EIVA 1B3QA 2K22A 3ZQ4A 1I4QA 3E6ZX 4A8XC 3ZVVA 1E0BA 3U4VA 1WGYA 4YSXB 2KFJA 2Q2HA 3FPUB 2F0MA 4BY7H 4EKUA 3KOJA 3IFTA 5G3LD 1E3PA 1IL8A 3CU7A 4JPBW 1HNWQ 1WSPA 4ITKA 4JBJA 2E6XA 1ROEA 2CVRA 5FLXc 2MLBA 2PNHA 1NI2A 5IA7A 2RDFA 3U4ZA 1N5XA 1YNJD 5ELDA 5C4XB 3L3OC 5IGBA 1JT8A 2Z9HA 4AYBB 4PZ8A 1VCBA 4HPLB 3BVGA 5DPWA 4AS1A 3QOJA 4IUQA 2VW9A 4MNOA 3J9CA 1KFYB 2INCC 2WWZA 1BUIC 4OZAA 2B2YC 4R4OA 1IBXB 4MH0E 1SNQA 4CHTB 3ZTCA 3TJPA 1HCZA 3DHQA 1HRJA 4OGQC 2G9HD 2QEXA 1Y1WB 1DOLA 3PIP3 4K3BA 4BAXA 2JA5B 4C3JH 1AP0A 1G2TA 3TS0A 2Z6KA 4YWMA 5C4XG 3LDZE 4M0WA 4AYBG 2ACZB 1B7YB 5JPMC 1SE9A 2KN5A 1AH9A 4HPPA 1KJTA 1ICFB 1OXSC 2A5HA 2DYMA 1ZXHA 3I55A 5A2QE 3OMGA 1PTOF 5IYDH 2KCNA 2JF5A 2K32A 2NBVB 4ANXA 3A0JA 5LXIB 1Y1WG 4B3SL 5JOBA 2A74C 4IN3A 1EYAA 4JI0Q 1LTLA 1V9PA 3S2HH 2YTVA 4H44C 4IPGA 3F2BA 2C7NB 3JAMi 5KNDA 1FGUA 5H8YE 3SD5A 3W3AA 3N9YC 2CHWA 2C7HA 3VYSA 2PQAA 2X6LA 1O7IA 5TSSA 2IY5B 1XNRQ 4IFDH 2M0XA 4UAIA 1X9NA 1EF5A 2L0TA 1LXDA 3UQBA 1CT1D 2V0GA 5BYSA 2OEOA 1FVIA 2VH1A 5I4DA 2QILA 2RVLA 1QCBD 3AE4B 3VYTA 1WGRA 3OMCA 1PFBA 3M7NA 2J0MA 3WCQA 1V9JA 4DUZQ 2REXA 5D94A 2QDLA 3C0RB 2EVBA 3TP6A 2Y5CA 2PIAA 2X8XX 2MHVA 3EN2A 5GROA 2ICIA 3FEWX 4WJ3M 4HVBA 4JI6Q 1I5FA 4FXKC 3L13A 1C77A 3DUZA 5BN3A 3NBIA 1UBQA 5M5XB 3DM1A 4WJOA 4C56C 3RLFA 2F0JA 4DV2L 1SYEA 2A6ED 2CH4W 4G7HC 3A4RA 1A3UA 2N78A 1FEHA 1L1OA 2JYOA 2DJFC 4GN4B 1Z9FA 4K8IA 3S16H 5IP7H 2WAQB 2KDBA 1A2UA 1STGA 3P42A 1D1IA 5EGTA 2CW0D 4II3B 4K1RB 4LNOA 3HOZH 3I4MG 4WJ4A 1P7EA 1IL2A 1XLNA 1BVSA 3W5OA 1HZ6A 4JBWA 2K04A 4M0WB 1R4MB 3CSFA 3JSVA 4A3PA 1STHA 2UUAL 4MHEA 5CGKA 1XF5L 1BT0A 3G71A 4LF7L 3CMAA 1KC8C 1UEBA 3OSOA 2HTME 4NXNQ 2F3IA 4URKA 2NBUA 2GVBA 4LJZC 1TZ1A 5EE3A 2AL6A 1BBWA 4IPHA 1C76A 1F2YA 5I9OA 4HJ9A 2CWPA 1S3SG 4B3TQ 2D2QA 1SYBA 3K5LA 2Y5BB 1HQMC 2K5NA 2NN6I 3S17B 2LGXA 4H2AA 5E6OA 3GTGB 4WJWA 5LMUQ 3TZUA 2DYBA 3EC8A 5EJWA 1N6ZA 3Q8FA 2IO3B 3H94A 5C3EB 2PQAB 1HNXL 2PI2A 4QIWB 4A3GB 2JT4B 1O80A 3H0GG 5GAHC 4MGZE 4GMVA 1YJIA 2V4DA 2AMCB 1WXMA 3KH0A 4Q2JA 4FDBA 3PZDA 4IG7B 2DBYA 4A3KB 3PMFA 2HCIA 1K73C 4K0KQ 3UF8A 2VZAA 3STBD 3KLWA 1PH4A 4BWGB 1L1OC 2F0OA 1YOVB 4F7XA 2MW5A 2J53A 5IE8A 2KNBA 4RF1A 2F0IA 2LGSA 1J8IA 4J8QA 3HOUH 4KHPQ 2B8FA 2KEEA 2JA9A 3U58A 1M1KC 3S14H 4A3KG 3A9KA 4DV3L 2WP8J 3MTNB 2R6GA 4GN1A 4BVUC 3PLVA 4HEDA 3AB9A 1MJCA 2INNE 4YY3Q 2DY7A 1M94A 4LTUA 1XPRA 1L1OB 3D3RA 3H3VH 3AE3B 1EWIA 2FNJB 5FOBB 4X62Q 1MIUA 2F0GA 1RKNA 3CKIB 1XYIA 2N0SB 2I1JA 2W3RA 2YV5A 1WIAA 1E1TA 3KUDB 3KW5B 1VQGA 2JRHA 1Q86C 2WQYB 3JVZX 2NVYB 2A68C 4UPAA 1I7HA 2BW2A 2R2OA 2NCNA 4L2YA 4LNKA 3JSVB 1B9RA 3ZW3A 3VQIA 2A73B 2R7FA 1LLRD 2WAQE 1CHQD 1EYGA 4W9KA 4WQMA 3PPAA 4JOIA 4DGZA 1L6VA 5HKHA 2LZ6A 2CS4A 2KWUB 1K51A 3RNFC 4JI2Q 2MQHA 3M95A 3VTVA 1HZBA 4M02A 1L0YB 4IALA 3EA6A 1HZCA 1HR0L 2PKOA 5DEHA 4L6TB 5ELOA 4FF4A 2HJ1A 4BKTA 3ZGZA 1B70B 2K5WA 1SJHD 2L12A 2F0DA 1HUNA 2XTIA 1A6XA 1V80A 5EDSA 3VR4A 1E1OA 2NVTB 5CC4A 3K0XA 3PV0A 4YWGG 3AEBB 1E2WA 3MEFA 1DGSA 4G7ZC 4DHJD 5C4ZA 2LFNA 1G291 1T6BX 2NUCA 2KLGA 5C4XH 4RCOA 1U4PA 3H7SA 4QCLA 3HK0A 2RDHA 4RG1A 1STEA 3OG5A 4K5XA 4II2B 1WYGA 2RPVA 1DM0B 2F0KA 4YXDB 1Q8KA 1CZWA 2XWJB 3MA2B 4QIWE 4HJ8A 4DV4Q 2MP1A 2QHOA 3VH3B 1Y1WH 2N9XA 4RFBA 2QSDA 4WWNA 1XMOL 2XN9C 4ZKBB 4N8X1 3C1FA 1IBLQ 3A9KB 3NZUA 1YNTE 2R3ZA 3HKSA 4OIKA 2J0JA 3L54A 4F88A 4ZOHC 1JR0D 1FL0A 4KGSA 5KYIA 5FLMG 1FGBD 2LVPA 2RPQA 4HIKA 3UIOB 1JOKA 4P6VF 2D5GA 4PK1A 3P20A 4A93B 3DVNU 1Q7YC 2UXCQ 1YEZA 1EFID 4JOIC 1JWBD 1GG3A 1VR9A 4FN2A 5HURA 3Q3OC 5IY0A 3KYCD 1V49A 5CYUA 4V190 5M5WH 4DR4L 3PRMB 1OEYJ 4A75A 4C1NI 5IT9c 5C0XG 1K0SA 4KKTA 2CJOA 4IDIA 4TQ0A 4DK0A 1KOTA 1QT9A 3W1BA 2BQQA 2SNSA 1MJDA 4RM9A 2NZ1D 4Z9CB 4DR1Q 2HT1A 4DFAA 1MSGA 4A93G 2QJLA 1VQ9A 4MEMA 3KF6A 2O6VD 2DNEA 1K83B 4IURA 2IBIB 1GUOA 3RD2A 3DBSA 3HOYB 1UZXB 3MXNA 1G6ZA 3IHPC 2Y0SE 3W9CB 1PHJA 4JG2A 4ZRKA 3ZXRA 1U4AA 1GB1A 1HZAA 1IP9A 3GO5A 4YL8A 2LS01 3I4NG 2UXDQ 1F2RI 2LASA 4G7OC 2CCZA 3OYYA 1SYFA 1CQVA 1PFNA 3TN2A 5M5XH 1QOGA 5DPRA 5DM63 1AFPA 2QGQA 3DCGA 3HOWB 1YJNA 1M8AA 1X6OA 2LI5A 4LCDE 4R3DA 3ZNID 1S5FD 3VVWB 1B4OA 2LRUA 4U68A 4LWCA 2HDMA 1JWSD 3LNNA 4JI5Q 4F7ZA 2TMPA 3CCLA 4GKKQ 2LXAA 3AE8B 1L2FA 2RF4A 3V60A 1XQQA 2JA6B 3ICEA 3M4OH 4KVGB 5AUIA 2E8GA 2EE1A 2CHBD 1PH2A 4HMIA 4LNIA 4JYAL 3HOWG 2EMTA 1VZ8A 2A6HD 2F4VQ 1BCPD 3QIAA 3RUZA 3NS1A 4MH8A 3TREA 4LFBL 2D3AA 3DWAA 3BYTB 4ICUA 5D2MB 4J1MA 4M1UB 5EPJA 3PHXB 1XMQL 5NUCA 1D2BA 3HFZB 2V4LA 4C4VA 1TWCB 3A7AB 1GUGA 3BZKA 3H0GH 3EQLC 4DV6Q 3Q3JA 5BYRA 2IO2B 5GXGB 1JOOA 1YMHE 4A55A 3TEYA 3KJOA 2K5HA 5GAEC 2V1YA 2D0OA 1MVKA 3S17H 2AQ1B 5L83A 4DUYL 3GTGH 1L0XB 1PDXA 1E6EB 1WX9A 2N9PC 1X32A 2C35B 1G91A 2FMMA 3N32A 3C19A 5C3EH 1XLQA 1H9MA 2JEBI 3BU2A 4RGOS 3R66C 4JI1L 3SR6A 2ZPNA 2KD0A 1GVPA 1AARA 2SAKA 3FDTA 3A8IE 1P1AA 3I70A 1GUNA 1PGXA 3Q8EA 1WGHA 4A3KH 3K57A 3HS0C 1KLUD 4B95A 4P1CC 3MXNB 4PZ7A 4MSMB 3I2ZA 1L0WA 3AXCA 4US8A 1MHWC 4JL9A 2MBQA 3PRPB 1T0YA 4C1NK 1V81A 1HTLD 1QJOA 4EZKA 3CCJA 1I50B 2BOSA 5IP9G 4L23A 1KL9A 2VQFL 1VQIA 5JEAG 1OXTA 2MJ8A 4K6LA 4FF1A 3S15H 3VUWA 1RTOA 4JI8L 3RN2A 1Q10A 4UHVA 3RI7C 4YSZB 1HTQA 4AH6A 2R7DA 1F0ZA 4ZRJA 2G45B 4GN5A 2W55A 1PH7A 3UE1A 2Z0EB 1H9JA 3DPDA 3HGBA 2AQ2B 1HQRD 3C2PA 1LTID 4H13C 3GTKB 4BBRG 4FO2A 2HD5B 2ZEQA 1J0GA 3CCSA 2NVYH 1PZJD 1VQ7A 2R7ZB 1CQFA 4S3SA 1QVFA 1C9FA 5AJ3L 3CCEA 3ENEA 1IYUA 2N7EA 2F0FA 4A3MB 3DBLB 5I6YA 1CMXB 1RF2D 2Z0DB 2XWBB 3CCVA 3PO3B 1Z7TA 1EY7A 4PMCA 1UD7A 1IBMQ 1HNZQ 4C4VB 3ZDTA 3T4AC 1S5BD 1YHBA 3QHTA 1V8QA 3NENA 1A2TA 2PVGC 2M0AA 4JBMA 3PGEA 1MD2D 4IJLA 1GJZA 4LF8L 2D5DA 1IXRA 5IWAL 2R7ZG 2OWOA 2UU7A 1Q8IA 3H8HA 3ZNGC 2YTYA 5C4JB 3Q22A 2WXLA 4US9A 2IPKD 2N49A 2N88A 4A3MG 2B2WC 2QW7A 2EOTA 5BN5A 2RDBC 1CSQA 2KQ3A 1HPCA 2NVTH 2BB6A 4O1NA 2JZ3B 1TYGB 2E2IB 1VF5C 1K3RA 3FP9A 3I4OA 4HMJA 1UWVA 2O5JC 1JRUA 4MDKE 1D1KA 2PO4A 1JALA 1H95A 4BBSB 4EQNA 5KYLA 4FVMA 5EKLA 1OO9B 4XYOA 4ANUA 3TP5A 2JSOA 3F8TA 4HIOA 1IYVA 1WJNA 2MH7A 2C9WB 4MSQB 2WXJA 1XLPA 3RZOH 5FLMH 2ZT9C 3N20C 2QEJC 1GUSA 2A6HC 5IGGA 1NR2A 5JVG3 4DR2L 2X6GA 3RLOA 1WXVA 2JA7G 1LUZA 1F9PA 4DR3Q 1YZ6A 1F1HA 3KWLA 3HOVG 1TY2A 3TSSA 1K9MC 4BBSG 1YNND 1TU2B 3EGRA 4YTMB 4XGAB 4K3CA 5E4XA 2BF8B 3J7ZC 1JW9D 1KTKA 2A69D 5C0XH 3S1MB 4OONA 1OXUA 4FXDA 2L52A 5IGFA 4NB3A 1VZ7A 1YHAA 1QVCA 2EKEC 1D5XC 3PUVA 3GTQB 4GDLA 4JWUC 4EVOA 5C3XA 2Q8RE 4HJ5A 4IM0A 4A93H 4AP4C 1ENCA 1PRTD 2MEKA 2MQJA 3DBHB 5AEKB 4CJ1B 2J7QB 4DV1L 4CYEA 3M3YB 2HCCA 4UP8A 4HKQA 2XRQD 2O5IC 5JJZA 4HJ7A 1CJEA 1Q1OA 2IX1A 2DN8A 4C3JB 4GSWA 4ZKCB 1IUEA 4F8CB 2OJRA 2K6QA 2RSOA 2OF1A 1WM2A 2NS5A 2VZKB 1HJPA 2HIXA 3J80E 1LGRA 5JAVA 3VR5A 1U4MA 1H4RA 1K83H 5HHDG 4DR6Q 3GD7A 1YN5A 4GNXA 4FF3A 3HOYH 2AWTA 3E56A 3PT2B 3RZWC 3T13A 1FXIA 3TEXA 2BYFA 3EVQA 3QG1A 3TRZA 2BKFA 1WMHA 4NNJB 2ZNVC 3GE3C 1D8LA 4LF5L 4LUZA 1SMYC 3U8ZA 3KFUA 1JB3A 3GTPB 2LGDA 2KX0A 2KHIA 5CV7A 4DV7L 3H09A 4BKSD 4BBNF 1O7YA 3TP7A 2F0EA 2JEAI 2NVXB 4XE0A 2WLBA 4XYCA 1I6HB 3P4PB 4JW0A 3HOWH 4GOCA 2KECA 1I4PA 2ALYB 4QJFA 3I8ZA 5C44B 1SGHA 2DNCA 1FR3A 4ILWA 2PYKA 5BN4A 4Y52H 2V3NA 1R4PB 5CV4A 2ZNVB 3DLLA 2KMCA 1AZQA 3HM6X 1IYJB 1EIGA 3SFDB 3K58A 2N55A 3N6RA 3NRZA 1IHZA 4K7UA 2HQEA 1E8XA 5E7NA 1IW7C 1E2VA 4HRSA 1QB5D 3A8JE 3J7YW 1K50A 3FKIB 5C44G 1D5MC 5CV8A 2K3UA 4MTNA 4C2MB 5IGDA 2DX5B 3OWEB 3AE1B 2BH2A 1WXAA 3HIZA 1TWCH 2GVAA 4GDLB 3ZTDA 2E75C 2NYZD 1PUTA 1TVXA 3GV3A 2N7DA 2WS3B 4RHSA 4YIJA 4HIMA 5DPTA 3TBIB 1RFKA 3IAYA 2UXBQ 3CPFA 5IP4D 3HOZB 4GNXC 3BYYB 3FKIG 4G57A 3H9DA 2C60A 2EXDA 3J81E 4N6EB 2PZUA 1U0LA 2L15A 4PMBA 3FPPA 1DOIA 4O0AA 3ZNZB 2WFWA 5IP9H 3PIOA 1HEZE 5JEAH 4FBJB 1SE2A 1KDAA 4AJYB 4J6IA 1H8CA 2I07B 3I3TB 3P4SB 3M4QA 5I9PA 3V61A 1K28A 1Q1BA 4GNXB 1FYCA 2F0WA 3MJWA 2KWDA 3CC4A 1IGCA 4BOZB 3HUIA 4E74A 1YNNC 4DV2Q 3N1XC 1WMHB 2G4SA 1CHPD 2SOBA 3C3LA 2J4XA 1F9RA 1EYDA 2KDEB 4X3SA 1I50H 1SFOB 2VB2X 3GZNI 3IAS1 4LFAL 3DWMA 3HKZE 1EOTA 2EELA 3H6MA 2BT6A 3Q3NC 1WOCA 1WY8A 5FLXL 4BFRA 1F2ZA 1TT2A 4X65L 2AUJD 3ND9A 4DWFA 4QGUA 2E5LQ 2UUAQ 3R8BA 3GQBA 4NJ6A 4ANWA 3GTKH 3N3KB 2LHEA 1SBBB 1PXUA 5I2XA 4L5QA 2R7ZH 5BO4B 3S1NB 4IKGA 1JICA 1VQEA 2F3WA 3P2BA 4Q5VA 4HAEA 5BR8L 4IFDI 2N9LA 4JIOU 4A3MH 4WH4A 1SRUA 2F0UA 3PO3H 1NENB 2OQ0A 3PHWB 2WV6D 2EJGC 4XTCS 1D3ZA 4KHZA 4IO9A 1NI3A 3I7FA 1NVID 1PH3A 5T1GA 2ZM6L 3CXCA 2KKCA 4A3FB 2ZJQA 1V6EA 4APVA 3S1RB 3MP9A 2IWHA 1EWCA 5LMNW 1HNXQ 4A3LH 1BO0A 4KY6A 5C4JH 3VR3A 3AE2B 5IOCA 3PUXA 1ACCA 3BZDB 1H9KA 1TS5A 2JPHA 2WU2B 5AZGA 3ECIA 5M3FB 4GGQA 1QOAA 2E2IH 2JA7H 2KHSA 4M8AA 1H9SA 2WIIB 2KC2A 4M01A 4A3FG 1SNOA 3E0JA 4BBSH 4DR5L 1A5RA 2YEPB 1PFSA 3TIXA 1PYWD 2ONQA 2K33A 4IUVA 3IRBA 1J7BA 2M1MA 1RCVD 3PZ8A 3N1ZC 2L4NA 1YQ3B 2MBBB 1E7ZA 5M3FG 2E2JB 1M4VA 3GDEA 3T53B 1CKNA 3K5MA 2B8GA 4W9EA 1I4XA 4MZ9A 1S5ED 3PZ7A 1STYA 3UI2A 3D31A 4HCSA 4X66L 3PIPA 2O4XA 3R7QA 2K1BA 1JRPA 3I4LA 3S1MH 2KJHB 2PLPA 3CPWA 1SE3A 1N9WA 4IZ8A 2UU9L 2OHFA 3GTQH 1KH0A 3EFUA 3AH7A 1PMRA 5EE1A 4A3EB 2JY6A 3P1MA 2HIVA 1WXQA 4ACFA 4DK5A 1EWHA 1LTRD 4J6HA 2VUMB 3M3YH 4POFA 5JJLA 1FJGL 1EOVA 2ZJDA 3AE7B 3RNGC 2G4DB 3NUCA 4ABNA 2D3BA 2IDYA 4OO1I 5IO9A 3VR9B 1WJJA 2Z8LA 1OEYA 4ZQ3A 5K36G 2ZTDA 4IFDJ 2ICEC 3ULLA 2RHQB 3BVZA 3MEHA 4P73A 3RMHA 4JV5L 4A3EG 1I3QB 4GLXA 2NVUI 4XZ4A 3TP8A 4EOYA 1VQDA 3A8KE 2E76C 2VUMG 1IYFA 4KJOA 1B44D 1GKHA 2K9XA 1XCQL 4B3ML 4RKLA 5KGUA 2DZIA 3AE5B 4DAMA 2WXHA 2D11A 4H7BA 5HI1A 2B2VA 1V97A 1EY0A 5M5WB 2J42A 4YHHQ 3NTIA 3GTPH 2OEDA 4RMFA 5CV6A 2BH8A 3JW0X 1H9SB 4CJ2C 3H6NA 3B0AA 3AEEB 4G50A 3W1SA 5CORA 2A68D 4R9WA 2NVXH 4KK7A 1T0SC 1YJ1A 3HRDD 2K4KA 1XCTL 1I6HH 4HEA1 1GHJA 1B2TA 1GO3E 1ENAA 3QO2A 3VRAB 1GXDC 3UQAA 2M19A 1SJED 4DHZE 5C44H 3JAML 1ZEQX 4DNIA 3I63C 3TEWA 3CCMA 2BPSA 3A56A 3BDOA 1WJUA 4A90A 1LTGD 4IPCA 2V1CC 2MO1A 2NN6G 1QNUA 1EIFA 2L00B 2RKSA 3E9SA 2VNUD 3L4PA 1CKNB 1UWMA 3GE8C 2VQEQ 2C7MB 1V1QA 2VY3A 1LACA 3QJYA 4AWJA 2JSVX 2MJDA 2QKIC 5JZEB 1C8CA 2MHJA 3EFCA 1X3EA 2JX5A 1XNQQ 3ZNHB 4RGNA 3HM3A 2R2QA 2ZTCA 2K01A 1KF6B 4MTKA 3I4MB 2ZVNA 1J6QA 3FKIH 2FCNA 1PZID 2L83A 2BS4B 4G3XB 4C2MH 3DOWA 2Z6KC 2W3SA 1WR6E 4DR4Q 1V1PA 1YVCA 1E9MA 3A5ZB 1ET9A 4XT3B 3Q6SA 4LW1A 5J3BA 2FHTA 1YQ4B 2JYTA 1JOQA 3M4OB 4A76A 2GBNA 4AYBE 2B39A 1PQSA 4KIKA 2B2VC 2CJNA 1EIHA 4LFCL 3ULPA 1YNXA 4IPDA 3R2IA 3M4YA 2UUCL 2PE6B 3I3CA 1S1QB 4LNNA 4B9XA 3W1SC 3G7LA 1WE7A 4DN4M
chains in the Genus database with same CATH topology
3H0GB 4Y7NB 4JPSA 2PMVA 1YN4A 1DZ1A 1ZXTA 4CJ0B 1F2LA 1O7ZA 3B2FA 4KX6B 5HFYA 1XXGA 4K2KA 1I4GA 4N59A 3MVVA 3DWPA 2HDEA 2Z4IA 1GJXA 1NYQA 3CQZB 4EQPA 2JP1A 1AYFA 3BG3A 1STBA 1WTVA 1FFVA 1RJTA 2VXWA 3P63A 2H1EA 2Q8IB 1DCZA 5C5LA 2E3TA 1F2MA 1C79A 3C46A 3AM9A 3L7ZC 2ZW1A 3S15B 3KK7A 4ULLA 4FXGC 2O2LD 2I2YA 1A3TA 3BWUD 1TKEA 1V1PB 3HRZC 1XWEA 3Q8CA 1Q3LA 2PPBC 3P4QB 3R93A 1S5CD 5ELEA 1H9RA 4LK0M 1HXYD 4FF2A 3GV6A 4ZHOA 4IOIE 4XYQA 1EU3A 1JQYD 5C3JB 5IT9L 4DXGA 2WDQB 2WACA 3SFEB 2L11A 3LB8C 3SVMA 1B53A 3AEGB 1J7CA 4KN4C 2N9KA 3ZJVA 1TIID 2WXRA 1HA5A 3MXUA 3P1HA 2F0VA 3DXJC 3NZ3A 4JK1C 1ZDVA 4IUTA 2EJFC 4RAUC 3DMUA 2I46A 1QOHA 1QOFA 3TZDA 1F77A 3IKJA 5KNBA 2PMZB 2NTSA 2K5DA 4XDXA 3K7AB 3ZJTA 2B2UA 5J22A 3RZOB 3SK4A 3GP7A 2SNMA 2EYPA 4NKLA 3AU7A 1NCVA 4X3TA 4DAPA 3FAHA 1DJRD 1JWUD 1PLFA 1QILA 1VF7A 5G5GA 4ZHPA 4P16A 2KVMA 4HJGE 2G9DA 4DAYA 1DOXA 3NSWA 1EM7A 3SK8A 1SXTA 3TDQA 4TRDA 3KBXA 3GB1A 5JVH3 3NBHA 4RGTA 2WINB 1EL0A 2L1AA 4USAA 1FD6A 2C9OA 3CHBD 2NN6H 2W82A 1PRTF 4L1BA 4OZCA 2BCOA 1BOSA 3BS1A 1Y56A 3I4NB 4U673 2XRSD 1ICWA 3TUOA 3R2TA 4KN7C 1NEKB 1PZKD 1HZ5A 3IT6B 2EJMA 3NWSA 4XDDA 2ZXRA 1MBYA 2OXPA 5E6JA 2WP9B 2B2UC 3VYRA 1XX8A 2X38A 3NVYA 4CQNA 3W2DA 3AEAB 5C3WA 4RA8A 1QLBB 2BTEA 4RH6A 3BIID 1Q1EA 2ENBA 4TKOB 3J7AV 1ESFA 3OWFA 4EQOA 2ID0A 4C3IB 1FD7D 4PNYA 4E6IA 1EQVA 2IJ0A 2PW7A 2EYLA 5EE9A 4DAVA 4RGMA 3B9JA 3X3NA 1O7LA 1STNA 2TSSA 1MSHA 1SNMA 1JE4A 3NVZA 2L0CA 4FNFA 4C3IG 5ELFA 2WXGA 1ZOYB 1ONLA 1CFMA 1EZ8A 5CV9A 2X69A 3HVZA 2F1MA 2KQ4X 1S5DD 2L5TA 1ZDXA 2VZKD 4FYDA 1C4AA 4WWMA 3MC0B 2BYTA 1BR9A 4IUPA 2J52A 1KDBA 4HSPA 1UAPA 2IT1A 1JWAD 3FRPB 2KACA 1HUMA 2AQ3B 3KUPA 2WXKA 1ML0D 5C5MA 4KV6A 1QF6A 4Q0FA 3T3OA 2WXQA 2F0TA 4GLSC 1WTPA 2FBWB 3O13A 4KD4A 1RHPA 4BBRB 4K2LA 1SMYD 3WOEA 1B9NA 1U9RA 4F8MA 1T5XD 1II3A 2GI9A 3CWIA 1VMCA 2LUMA 5DNFA 4WAFA 1QQRA 1PTOC 2QIEB 3VA5A 4KHVA 2D2CC 1R4QB 3EFXD 1WD1A 1N62A 3E5SA 1B1ZA 4ZK9B 2WNMA 1IW7D 4BA1I 4ZRPA 3NTHA 3BK2A 1Y8PB 1PTOB 2EY1A 2KDMA 1NYRA 4J3OD 3IFDA 1WTXA 1CA5A 1T3QA 1SYCA 3NK9A 4QF4A 4WRDA 2JA7B 2PW5A 3I91A 3HOVB 4AQ7A 3NE5B 2EXZA 3OW7A 2J7ZA 4CKEA 3FILA 1VLBA 1OXXK 3NUHB 1U4RA 1OQQA 1RWSA 1ZE3D 1BF4A 3VYUA 4JE3B 4NAMA 2LEKA 3BDCA 4R8NA 3Q8BA 2M2LA 1AEXA 1JQ4A 2PQEA 3MHBA 2ZXOA 1HFGA 4KGTA 5G3LF 1ZP0B 1GOZA 3IT4B 5C6AA 1NSNS 1K8MA 1B50A 5EPLA 2BB5A 3EJIA 2PVOD 4PT5A 4LLGM 1FM0D 1C78A 2XIWA 4KKSA 1DD2A 2KJXA 2RSNA 1UWXA 2JE6I 3MFYA 4RKBA 1VZ6A 2PW9A 3W5VB 4ZYSA 3I73A 1HA6A 5DM73 1N60A 4P2CB 3R3OA 3U4EG 4PQXA 3LYYA 3NTKA 5KEEA 3RD4A 4FP5D 2NB0A 3K59A 3FILB 5D7GA 1LTBD 4N9TA 5A2QL 2PZWA 2GA4B 5IGEA 3GS2A 1C4PA 3MWYW 2BS2B 5BMGA 5EQ0A 1TKWB 2BS3B 3NP8A 1ESRA 4KI0A 1Y8OB 1MI0A 4JWSC 1SNDA 3LWUA 1IGDA 4CKBA 4K5VA 4C7YA 5FR3A 3GTMB 3LXFA 4B0EA 2R93B 2W54A 3MXGA 3AMZA 1Z6HA 4L8JA 4DU9A 2BDOA 3CIRB 4MN3A 3MFGA 1MHHE 3PUYA 3M85A 4GZYC 5D3IB 4OZBA 1WGKA 1MPEA 4IFDG 2BE5C 5LL6S 4YT0B 3I57A 4KGRA 2INPE 3QB3A 1DOKA 1WTOA 1K53A 3L9AX 1UUPA 5EBDA 4QB4A 3ONAB 3FVQA 5KNCA 1I6VC 2PZTA 3GTJB 3SDZA 3T56B 5EKIA 1QG7A 2H88B 4DA2A 4I7ZC 3BVMA 3N52A 2Y5PA 3HZXA 3MTSA 1LTTD 5DAUA 1SDFA 1ZKOA 1DXMA 5CBEE 2AWOA 2RQXA 2LGIA 1AN8A 3VA7A 4R8IA 1JORA 2F0PA 2KAJA 1E10A 2GB1A 3QWNA 2DY8A 2IX0A 3K0YA 4KKUA 3RZDB 1FMAD 1VRAB 5E4WC 3PUZA 1BQQT 4XQQA 1PTOH 3HOXB 3T16A 3CRKC 1R7SA 3MZ5A 5JXVA 1ZYRC 2LFIA 5KIXA 4YTPB 3U2SC 4LAAA 2NVQB 4OO1G 1I4RA 1SB3C 4N9PA 4MM3B 4RHRA 3KBGA 1EY9A 1LT4D 5M5YB 2E2HB 1QKZA 4IUNA 1SIJA 4EGVA 4MT5A 1Y69U 2BBCA 3OHXC 4QUFA 1SF0A 2KEDA 4XT1B 3UI3A 4C3HB 5ELBA 1Y1VB 1KLGD 3PUWA 4MACA 1EEID 1VJKA 2M00A 1EY5A 1TY0A 1G8ZD 4HR7B 1PGAA 1G2SA 2B63B 1PFDA 4C3HG 3A55A 4KMUC 2K7VA 3A54A 4NW2A 5K5PA 3HG9A 1D4BA 4KKIA 5FKAC 4CKCA 5CR3A 4ZRZA 4RCNA 2MJEA 3OIPA 1WRIA 3AN1A 1GB4A 1MI2A 3KWVA 2JA8B 4KY5A 1FCCC 2WU5B 3BK1A 3WDNA 3D4WA 1LTAD 3DEPA 2F03A 3MAQA 1BNZA 5C4HA 5I2YA 1JMLA 1XEEA 3NHHA 3W5UB 1X3PA 3URYA 1R9TB 2LKVA 4B0MA 1C4CA 3VRBB 5MPOA 2GRIA 3OOCA 5IGCA 2V3PA 3VR6A 2WXNA 1GPXA 3OPOA 1MGSA 1FCLA 4CBVA 1L4ZB 1SNPA 3Q23A 1VCIA 3SK6A 1D6EC 2EKIA 3AV8A 2ON8A 4WORA 2EPBA 1WTRA 3OIQA 2IX3A 2KMMA 1E2ZA 4DK1A 4TQ1A 1WTWA 2FINB 3GTLB 3AB5A 3T3NA 1TQOA 4WFN3 1IKLA 3AMUA 5FK9C 4HROA 2MGSA 4ARIA 4A9AA 1ILQA 2EYOA 4IQZA 2Z1CA 2BA0A 3K6OA 1BCPF 3H91A 3DWQA 5M9OA 3SE0A 2N7JA 2F0SA 3ABVB 1SSOA 1RTNA 1A3VA 1B9MA 1C48A 1LTSD 3GTOB 3T51B 3TMEA 1KAAA 2H89B 5F2DA 1SYDA 3FC4A 5FLXE 1EZ6A 1W6KA 1L0VB 1Y8NB 3NVVA 2F0HA 1CM9A 1EQTA 3D6CA 1X3QA 5J1ZA 1ILPA 3U9OA 1YNJC 3Q24A 3ITPA 4K5WA 4OO1H 4HCEA 1F9QA 2K5QA 1FNWA 2QDBA 4D2KA 1AZPA 1D5ZC 2AWNA 4QMGA 4NJCA 4A3IB 2EYHA 3KLSX 2PNRC 1BXTA 3Q8AA 3SEBA 4FXCA 4NMZA 4K6DA 4XWTA 1UGJA 5I6WA 3VR8B 3HVDA 1GUTA 1A15A 5FO7B 1CZGA 2E2DC 2NWGA 3WOFA 4OL7A 1N5WA 1F2RC 4I65A 3KQ4A 3X3MA 4NZLB 5G5HA 2EYJA 2NTTA 3NQIA 4OW0A 1PDQA 2WXIA 3PO2B 1RODA 1BUVT 4MIUA 4UDUC 5EKKA 1ZXIA 4OIJA 3Q0AA 1TWGB 2Y0SB 1J9OA 1SAPA 4HSVA 2I38A 4ZUIA 1FFUA 2YU9B 2F4IA 4RF0A 5K36H 1EYCA 1TS4A 2L1BA 1YN3A 2XNAC 3VR2A 2FJ2A 1EY4A 3ZJUA 5KRUA 1PGBA 3LX0A 2A6EC 2QF7A 2K5PA 2NMQA 5COYA 2AUKA 1I4HA 2CW0C 1YJJA 4ARCA 4NDXA 2C5CA 1SSNA 4HN7A 2NBFA 4ZUJA 2EYMA 3KLRA 3V2TA 1B3AA 1STAA 1LT6D 4A3DB 2QMTA 1FIQA 2WXPA 3SHLA 4ZLTF 1PTOD 3FMCA 2JXMB 4K8JA 4KJNA 1C4QA 5CV5A 3JAME 3CRLC 2IGDA 1NAPA 1A70A 3PO0A 2OT2A 1AW7A 2IGGA 4OVZA 4F87A 4TMAB 4A3BB 3P75A 3U9SA 1HTPA 5BMHA 2K28A 5EBCA 1L5PA 2JU6X 3RFZB 1CZPA 2RDGA 3U52E 4DXFA 5BMIA 2YEPF 3J80L 2JYEA 1T5EA 4AS1A 3U7ZA 1WD0A 1CI3M 1TWHB 1CA6A 2VB3X 1QWYA 2FFKB 1Z47A 1XLOA 2Q5WD 3ETRA 2H4OA 2IW3A 2LHDA 4X3UA 4TQUS 1PFMA 1DGJA 4LMQD 2MJ3A 3I72A 5LNK1 1KDCA 1QNKA 1LABA 1SNCA 1V43A 4XQJA 1GHKA 1F9SA 3IAM1 3P4RB 1K8OA 1KNAA 1MHXA 2JXTA 3RPFC 4CGYB 5E3FA 1BDOA 1OQRA 5BYQA 1UEAB 5C0XI 1WCMB 4BY1B 2LJIA 1TWAB 3MHZA 1CTMA 2JZPA 1O78A 1FNVA 1P7FA 2CQAA 3A7LA 1WTQA 2MUYA 1EY6A 3S1QB 2DWQA 3C1EA 5CMDA 1WWTA 2KOLA 3NVWA 1XTCD 3NWTA 5FO8B 1L4DB 4DNTB 3AECB 3C8YA 5AFWA 3K5OA 4WURA 4PV1C 2WXMA 4BS9A 4RWSC 3J81L 5J39A 5T8IA 1KRHA 1J7AA 4XQNA 2BDNA 5M3MB 4BA2I 3DWGC 3D4RA 3D4DA 4NP5A 4QUCA 3ZYYX 2B2WA 4IUUA 2F0QA 4XIGS 1E0ZA 1OFFA 3EROA 2WB1B 2HDLA 5IT9E 3BDLA 4RNAA 2M56B 1TWFB 2CU3A 2E74C 2K03A 1IKMA 4G4KA 2L9HA 5FO9B 1BMLC 4A3JB 3Q69A 4C7ZA 1ENFA 2FMCA 3KF8A 4B9WA 3SXHA 1WVLA 4DNRB 4ID6A 4JX1C 4ZAIA 1JC7A 3M7GA 1L6UA 5C0XJ 2V4IB 3DEOA 4N58A 1TS3A 1GUWA 1NR4A 2BE5D 2KN4A 1W6JA 3S9WA 2K0PA 2FE8A 3S2DB 1RDPD 2YYZA 1UNSA 3NQTA 1ZUD2 4ODGA 2K6AA 3QOLA 1JROA 4ZRQA 4OHJA 2WXOA 4B08A 2KCCA 2EY2A 2SEBD 3P7JA 2L32A 3AE9B 3TEZA 3HP3A 3V05A 1FRRA 1BCPC 2SDFA 4L63B 5EE0A 4XDCA 4BY7B 1FO4A 2WDVB 4HTHA 4DQOC 4LK1C 1HHVA 4YTNB 2R61A 2B2TA 4DF7A 5D14A 1E7PB 4O42A 1BCPB 2RA4A 1EY8A 5ELCA 1TKYA 1BBXC 2EY5A 3SK5A 5CBAE 5ISRA 1TKGA 4TSSA 1DONA 1HFNA 1OXVA 3AEDB 4YSYB 3SR1A 1ZYRD 3ND8A 1TR5A 3NXWA 3I90A 3G6JB 2B76B 2F0NA 1V1OA 4KD3A 4PMWA 4REZA 1LV9A 3HKZB 5D65A 1U4LA 3KLSA 5JPNC 5E1FA 4C3JG 3S2HB 4A6QA 5AUKA 5HGTA 5D3DA 5EPKA 1RM6C 2EY6A 4KY7A 2BA1A 2XSCA 2Z4HA 5IIFA 2EZVA 2R92B 3EUB2 4GDKB 3MXPA 5JEAJ 4XXEA 1TZOA 1N61A 1SEBD 3I9V1 1VDVA 4NAWB 2WDRB 3J7AF 1DYQA 2XVSA 1EWYC 1JCKB 2B2TC 2FUG1 2MPMA 1K52A 2LMCA 1RD9D 1QE6A 5IODA 1FXAA 1GAQB 4K14A 1FRDA 2IL8A 1VMPA 3MJ5A 1KNEA 2G1EA 2F3VA 4C80A 4HKZE 5LL6X 2D9UA 4KTAA 2PTLA 3S16B 2AX5A 4EE2A 1LT3D 2EYFA 2DLBA 1ET6A 3IL8A 3K5NA 2ZW0A 2IGHA 1TS2A 1JWMD 2K05A 1V8CA 3LWEA 3D8GA 1ZPSA 1TJEA 3D6WA 5H92C 1EEFD 3V96A 2PCFB 3IXSA 2L55A 1EU4A 1KABA 2A69C 2RMMA 3V3XA 3PIO3 2JWUA 1Q12A 4XWWA 1RYJA 1XO3A 2LY7A 1NUCA 1PRTC 2RBMA 2M9VA 2JQRB 1SYGA 1AWDA 3AE6B 4KKJA 5C2TB 4H0LC 4X3KA 1Q90A 1IBXA 3H3VC 2DYOA 5A35A 2LMCB 3F2UA 1VDZA 3HOUB 2Q8TA 1PRTB 1LT5D 2J0TD 2D62A 4V0BA 2ZXPA 1S4ZA 2KA7A 3S14B 5HG2A 2WKDA 3NPPA 4WIPA 5T1IA 1LO5D 3B2GA 2HUGA 1FNUA 2B2YA 2EDGA 1CK1A 5LHY1 2WKCA 3ERQA 2QCPX 3HEJA 3AEFB 4ME5A 1SE4A 1QOBA 1DOMA 2Y3AA 2F0LA 2WXFA 1N63A 2KUMA 2K22A 3ZQ4A 1I4QA 3E6ZX 4A8XC 1E0BA 4YSXB 3FPUB 2F0MA 3IFTA 5G3LD 1IL8A 3CU7A 1WSPA 4ITKA 2E6XA 1ROEA 2CVRA 2RDFA 1N5XA 1YNJD 5ELDA 5C4XB 3L3OC 5IGBA 4AYBB 3BVGA 3QOJA 4IUQA 3J9CA 1KFYB 1BUIC 4OZAA 2B2YC 1IBXB 1SNQA 4CHTB 1HCZA 3DHQA 1HRJA 4OGQC 2G9HD 1Y1WB 1DOLA 3PIP3 2JA5B 1AP0A 1G2TA 4M0WA 2ACZB 5JPMC 1OXSC 2A5HA 2DYMA 1ZXHA 5A2QE 3OMGA 1PTOF 2KCNA 2K32A 5JOBA 2A74C 4IN3A 1EYAA 4H44C 5KNDA 5H8YE 3W3AA 3N9YC 3VYSA 2X6LA 5TSSA 4IFDH 4UAIA 1CT1D 2V0GA 5BYSA 2OEOA 5I4DA 2QILA 2RVLA 1QCBD 3AE4B 3VYTA 3OMCA 1PFBA 3M7NA 3WCQA 2EVBA 3TP6A 2Y5CA 2PIAA 2MHVA 2ICIA 3FEWX 4FXKC 1C77A 3DUZA 5BN3A 3NBIA 5M5XB 3DM1A 4C56C 3RLFA 2F0JA 1SYEA 2A6ED 4G7HC 1A3UA 1FEHA 2JYOA 4K8IA 2WAQB 1A2UA 1STGA 3P42A 1D1IA 5EGTA 2CW0D 1P7EA 1XLNA 1HZ6A 4JBWA 2K04A 1STHA 4MHEA 5CGKA 1XF5L 3OSOA 2HTME 4LJZC 5EE3A 1C76A 1F2YA 5I9OA 1SYBA 3K5LA 1DOYA 1HQMC 2NN6I 4H2AA 3S17B 3GTGB 4WJWA 3TZUA 5EJWA 3Q8FA 3H94A 5C3EB 4QIWB 4A3GB 1O80A 1YJIA 2V4DA 4Q2JA 2DBYA 4A3KB 3PMFA 2HCIA 4BWGB 2F0OA 4F7XA 2J53A 4RF1A 2F0IA 1J8IA 4J8QA 2B8FA 2KEEA 2WP8J 2R6GA 4HEDA 3AB9A 2INNE 2DY7A 4LTUA 3D3RA 3AE3B 5FOBB 2F0GA 1RKNA 3CKIB 1XYIA 2N0SB 2W3RA 2WQYB 2NVYB 2A68C 1I7HA 2BW2A 4L2YA 1B9RA 3VQIA 2A73B 1LLRD 1CHQD 4WQMA 4DGZA 1L6VA 1K51A 1L0YB 4IALA 3EA6A 2PKOA 5DEHA 4L6TB 4FF4A 3ZGZA 2K5WA 1SJHD 2L12A 2F0DA 1HUNA 1A6XA 3VR4A 2NVTB 5CC4A 3PV0A 4YWGG 3AEBB 1E2WA 4G7ZC 5C4ZA 2LFNA 1G291 1T6BX 2NUCA 4RCOA 1U4PA 4QCLA 2RDHA 1STEA 4K5XA 1WYGA 2RPVA 1DM0B 2F0KA 4YXDB 1CZWA 2XWJB 3MA2B 2MP1A 4RFBA 2QSDA 2XN9C 4ZKBB 3C1FA 1YNTE 2R3ZA 4OIKA 4F88A 4ZOHC 1JR0D 4KGSA 5KYIA 1FGBD 1JOKA 4P6VF 2D5GA 3P20A 4A93B 1EFID 1JWBD 1VR9A 5HURA 5CYUA 4V190 4C1NI 4IDIA 5C0XG 4TQ0A 4KKTA 2CJOA 4DK0A 1QT9A 2SNSA 2NZ1D 4Z9CB 4DFAA 1MSGA 2QJLA 4IURA 2DNEA 1K83B 1GUOA 3HOYB 3MXNA 1G6ZA 3W9CB 1GB1A 3GO5A 2LS01 1F2RI 4G7OC 1SYFA 1CQVA 1PFNA 3TN2A 1QOGA 5DM63 1AFPA 3HOWB 1M8AA 4R3DA 1S5FD 1B4OA 4U68A 2HDMA 1JWSD 3LNNA 2TMPA 3AE8B 2JA6B 5AUIA 2EE1A 2CHBD 4HMIA 1VZ8A 2A6HD 1BCPD 3QIAA 3RUZA 3NS1A 4MH8A 3DWAA 3BYTB 4J1MA 4M1UB 5EPJA 5NUCA 1D2BA 1TWCB 3A7AB 1GUGA 3EQLC 5BYRA 5GXGB 4A55A 1JOOA 1YMHE 3TEYA 1MVKA 2AQ1B 1L0XB 1PDXA 1E6EB 1X32A 1G91A 2FMMA 1XLQA 1H9MA 2JEBI 4RGOS 3SR6A 2SAKA 3FDTA 3A8IE 3I70A 1GUNA 1PGXA 3Q8EA 3K57A 3HS0C 1KLUD 4US8A 4C1NK 1HTLD 1QJOA 1I50B 2BOSA 4L23A 5JEAG 1OXTA 2MJ8A 4K6LA 4FF1A 1RTOA 1Q10A 4YSZB 1F0ZA 2W55A 1H9JA 3HGBA 2AQ2B 1HQRD 3C2PA 1LTID 4H13C 3GTKB 4FO2A 1PZJD 2R7ZB 1CQFA 4S3SA 1C9FA 1IYUA 2F0FA 4A3MB 5I6YA 1RF2D 2XWBB 3PO3B 1Z7TA 1EY7A 4PMCA 3T4AC 1S5BD 1V8QA 1A2TA 2PVGC 2M0AA 1MD2D 2D5DA 1Q8IA 3H8HA 5C4JB 3Q22A 2WXLA 4US9A 2IPKD 2N88A 2B2WC 2EOTA 5BN5A 2KQ3A 1HPCA 2BB6A 4O1NA 1TYGB 2E2IB 1VF5C 4HMJA 2O5JC 1D1KA 2PO4A 1JALA 4BBSB 4EQNA 5KYLA 4FVMA 5EKLA 1OO9B 4XYOA 3TP5A 2JSOA 1IYVA 2MH7A 2WXJA 1XLPA 2ZT9C 2QEJC 1GUSA 2A6HC 5IGGA 1NR2A 5JVG3 2X6GA 1F9PA 3KWLA 1TY2A 3TSSA 1YNND 1TU2B 3EGRA 4YTMB 5E4XA 1JW9D 2L52A 1KTKA 2A69D 5C0XH 3S1MB 4FXDA 1OXUA 5IGFA 1VZ7A 1D5XC 3PUVA 3GTQB 4JWUC 4EVOA 5C3XA 2Q8RE 1ENCA 1PRTD 2MEKA 4CJ1B 3M3YB 2HCCA 4HKQA 2XRQD 2O5IC 5JJZA 1CJEA 2IX1A 2DN8A 4C3JB 4ZKCB 1IUEA 2RSOA 2OF1A 2VZKB 3J80E 5JAVA 3VR5A 1U4MA 5HHDG 3GD7A 1YN5A 4FF3A 3E56A 3T13A 1FXIA 3TEXA 3EVQA 3QG1A 1SMYC 1JB3A 3GTPB 5CV7A 3H09A 1O7YA 3TP7A 2F0EA 2JEAI 2NVXB 4XE0A 2WLBA 1I6HB 3P4PB 2KECA 1I4PA 3I8ZA 5C44B 2DNCA 1FR3A 4ILWA 2PYKA 5BN4A 2V3NA 1R4PB 5CV4A 1AZQA 1EIGA 3SFDB 3K58A 2N55A 3N6RA 3NRZA 1IHZA 2HQEA 1IW7C 1E2VA 4HRSA 1QB5D 3A8JE 3J7YW 1K50A 3FKIB 1D5MC 5CV8A 2K3UA 4C2MB 5IGDA 3OWEB 3AE1B 4GDLB 2E75C 2NYZD 1PUTA 1TVXA 3GV3A 2WS3B 4RHSA 4YIJA 3TBIB 1RFKA 3IAYA 3HOZB 3BYYB 4G57A 3J81E 4N6EB 2PZUA 4PMBA 3FPPA 1DOIA 1HEZE 5JEAH 1SE2A 1KDAA 2I07B 3P4SB 5I9PA 1Q1BA 1FYCA 2F0WA 2KWDA 1IGCA 3HUIA 1YNNC 1CHPD 2SOBA 3C3LA 2J4XA 1F9RA 1EYDA 4X3SA 1SFOB 2VB2X 3IAS1 3DWMA 1EOTA 2EELA 3H6MA 2BT6A 5FLXL 1F2ZA 1TT2A 2AUJD 3ND9A 3R8BA 3GQBA 2LHEA 1SBBB 1PXUA 5I2XA 3S1NB 4IKGA 1JICA 2F3WA 4Q5VA 4HAEA 4IFDI 2N9LA 4WH4A 2F0UA 1NENB 2WV6D 2EJGC 4XTCS 4KHZA 1NI3A 1NVID 5T1GA 4A3FB 3S1RB 3MP9A 2IWHA 1EWCA 1BO0A 4KY6A 3VR3A 3AE2B 5IOCA 3PUXA 1ACCA 3BZDB 1H9KA 1TS5A 2WU2B 5M3FB 1QOAA 2KHSA 4M8AA 1H9SA 2WIIB 1SNOA 3E0JA 2YEPB 1PYWD 2ONQA 2K33A 4IUVA 1J7BA 1RCVD 3PZ8A 2L4NA 1YQ3B 2E2JB 1M4VA 3T53B 3K5MA 2B8GA 1I4XA 1S5ED 3PZ7A 3UI2A 1STYA 3D31A 4HCSA 2O4XA 2K1BA 1JRPA 3I4LA 2PLPA 1SE3A 4IZ8A 2OHFA 1KH0A 5EE1A 3AH7A 1PMRA 4A3EB 3P1MA 1WXQA 1EWHA 1LTRD 4J6HA 2VUMB 3AE7B 3NUCA 4ABNA 2IDYA 4OO1I 3VR9B 2Z8LA 4ZQ3A 5K36G 4IFDJ 2ICEC 3BVZA 3MEHA 3RMHA 1I3QB 3TP8A 3A8KE 2E76C 4KJOA 1B44D 2K9XA 1XCQL 4RKLA 5KGUA 3AE5B 2WXHA 4H7BA 5HI1A 2B2VA 1V97A 1EY0A 5M5WB 2J42A