1M4VA

Crystal structure of set3, a superantigen-like protein from staphylococcus aureus
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
200
structure length
196
Chain Sequence
AKYENVTKDIFDLRDYYSGASKELKNVTGYRYSKGGKHYLIFDKHQKFTRIQIFGKDIERLKTRKNPGLDIFVVKEAETVFSYGGVTKKNQGAYYDYLNAPKFVIKKEVDAGVYTHVKRHYIYKEEVSLKELDFKLRQYLIQNFDLYKKFPKDSKIKVIMKDGGYYTFELNKKLQPHRMSDVIDGRNIEKMEANIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The three-dimensional structure of a superantigen-like protein, SET3, from a pathogenicity island of the Staphylococcus aureus genome
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Immune system
molecule keywords SET3, superantigen-like protein
total genus 54
structure length 196
sequence length 200
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
A PF09199 SSL_OB Staphylococcal superantigen-like OB-fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1m4vA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1m4vA01
3R8BA 1I4QA 3BVMA 5ELDA 3GP7A 1BCPC 1LT6D 1TY2A 2G9HD 2WV6D 3DWQA 3V05A 3BZDB 4Z9CB 4RGTA 1I4HA 1V1PA 1D5MC 4UDUC 1HA5A 1L0YB 1I4GA 1FD7D 1I4XA 1HTLD 1PYWD 1S5DD 4RHRA 1SEBD 2AQ2B 1FNVA 1JCKB 2O2LD 4RCOA 1AN8A 5D3IB 1YN4A 1D5XC 1GOZA 1EU4A 1EU3A 1FNWA 1JQYD 1V1PB 1LTSD 1SXTA 1MD2D 1TS4A 2QILA 1G8ZD 2XRQD 1I4PA 3R2TA 1AW7A 1TS2A 1B44D 2TSSA 5ELBA 1LTID 1JWSD 1ESFA 1STEA 1SJED 1XXGA 2IJ0A 1PRTF 1JR0D 1BCPF 4RGOS 1RD9D 3URYA 1LTGD 2ICIA 1HQRD 1B1ZA 1PTOB 1LT4D 3W2DA 3CHBD 2IPKD 3EFXD 1PTOD 2QEJC 3DWAA 2XNAC 4NZLB 1S5CD 1UUPA 4L6TB 1KLGD 5TSSA 4DXGA 1TS3A 1TS5A 3BVGA 4RH6A 1LTAD 1S5ED 1JWMD 1CK1A 4BWGB 1CHPD 4RGNA 1BCPD 1TY0A 2AQ1B 2RDHA 2Z8LA 1I4RA 3EA6A 1SJHD 1T5XD 3DWPA 1YN5A 1LTRD 1EWCA 1ET6A 1PZID 1S5FD 1QILA 3TSSA 2XN9C 1EFID 2RDGA 1L0XB 1LT3D 1F77A 1PTOC 1LT5D 1BXTA 4O1NA 1PZJD 1SE3A 3O13A 1DJRD 1UNSA 1SBBB 3R2IA 1PRTD 1S5BD 1XTCD 2AQ3B 2NTTA 2R61A 3OWEB 4ZYSA 4RHSA 5ELFA 1BCPB 5I4DA 1LTBD 1YN3A 1LTTD 4TSSA 1KLUD 1PTOH 3BYYB 2NTSA 1D5ZC 1ENFA 1SE2A 1PRTB 3MFGA 2XRSD 4K6LA 5D3DA 3SEBA 1PZKD 3BVZA 1EEFD 4C56C 4L63B 1LO5D 1CHQD 1PTOF 1RF2D 1CT1D 5ELEA 1ET9A 3MC0B 1CQVA 2SEBD 5FK9C 1FNUA 5FKAC 1FGBD 1D6EC 4RFBA 3BYTB 3KLSX 1DYQA 1M4VA 2J4XA 5ELCA 1JWUD 1RDPD 1V1OA 1EEID 1PRTC 2CHBD 1RCVD 4OHJA 1LLRD 4DXFA 4RGMA 1HXYD 1SE4A 1KTKA
chains in the Genus database with same CATH superfamily
3KF6B 2KANA 1WGDA 4KGTA 2NVXB 4G0NB 4GB9A 3GTOB 1WXSA 2K5NA 2WV6D 3VR5A 4I6LB 4W9EA 4DUYL 4LCDE 2EY6A 1STHA 3HKZG 3VYSA 4YTNB 2WB1E 3TBIB 5M5XH 2G45B 2I5MX 3I2ZA 4C3JB 4NJ7A 4LF7L 3M95A 4CGYB 1VQCA 3CSTA 4AH6A 2PPBC 1K83H 1VQPA 1WGGA 4UHVA 4M8AA 3IL8A 1ASZA 3M4OB 2LMCA 1K9MC 3FKIG 4HN7A 2A6HD 2IGGA 3U8ZA 2Q8RE 4EZLA 2EQSA 3TREA 2DJGC 3DHGC 1SXTA 5C3WA 1HNZQ 2XRQD 5CHWA 2CS4A 3AE4B 2JJQA 4B6WA 4MIUA 1PH8A 4XGAB 5C3EH 1KFYB 1FXTB 3STBD 2RKSA 2JQOA 1EY8A 3S9WA 4JG2A 2NZHA 2L1BA 3URYA 2WDQB 1TR5A 1WD0A 1FD6A 1ASYA 3S15H 1E2ZA 1HQRD 2PMVA 2EYMA 2VQEL 2ZT9C 3UE1A 2PTLA 2M2LA 5A2QL 1OXSC 2Q8TA 5IYCG 1LTLA 2M19A 4NZLB 1XD3B 5HG2A 4DNIA 1IBML 4L5TA 4BBRB 2K5HA 1WF9A 4A3FG 5IGCA 1Q1BA 4RF0A 1I6HH 1ZKHA 3BVGA 4Q5VA 1V8CA 5EBCA 2K6QA 3HUIA 1BR9A 4TQ0A 2WKDA 3RNGC 4ACFA 1MJCA 1QF6A 4HCNB 1BCPD 4PMWA 3NS1A 5FLXE 1LV9A 4JYAL 1EYDA 4JPSA 5T1GA 4O0AA 4NMZA 5M3FH 4JI6L 1WY8A 2A73B 5E4XA 4KK7A 2WWZA 1YJIA 4KHPQ 1F9JA 4AYBB 1L0XB 1QVCA 4GNXA 4IM2A 2E74C 5C3EG 2ZTEA 3MTNB 4DF7A 5BMIA 1YI2A 3RZDH 2KCTA 3CC7A 4NXMQ 1VQGA 3MP9A 3NG0A 2GN5A 1YHQA 4MN3A 5JPMC 5COYA 3TEYA 3F1ZA 3AFPA 4W9HA 5BYQA 1GB4A 1KRSA 2PQAA 4NPNA 4XYQA 3I4MH 4OO1I 2IHEA 3FKIH 1VQ8A 2MP2A 2M4NA 1I42A 1JJCB 1LTTD 2MO1A 3CCUA 4GKKL 4BBSG 2ZPYA 4LTUA 5HURA 3RD2A 4DPGA 2K5DA 1HFNA 5I9PA 4ZHOA 4MGYE 5EPJA 3HOZH 4A90A 1PRTB 3J80c 1B50A 2AWOA 2F0KA 4MM3A 1UE7A 1LO5D 2RMMA 2FIDA 3RLOA 2MJ3A 3WIMA 3G4SA 2R93G 1CZPA 4FBJB 4N9TA 3S17H 2ZXPA 3KDFB 2MP1A 1DOLA 3VA7A 5IOCA 3UQAA 3ULPA 2ALYB 2K14A 1IKMA 2L83A 3FKYA 4IWPA 1PHJA 2WXRA 2E8GA 2GBNA 3SK6A 3Q3JA 3RR5A 2WX1A 2EJMA 1L1OC 3W1SA 2QIEB 3DVGY 4HIKA 4B0EA 4IPCA 2NMQA 1WM3A 1Z6HA 1L0WA 2JQRB 4JCVE 2E3TA 2NBWB 3O65B 2UUBL 4A3DG 1LT6D 3PO2G 3ZGZA 2HD3A 2MJ8A 2DY8A 1YJ9A 4KGRA 1KNEA 1SGHA 5BYSA 2BA1A 4K5WA 2BYEA 2V1YA 2WXGA 4ZDVA 1WJUA 1GHJA 1UD7A 2KMCA 4DV2Q 5JVH3 2K8HA 4RM9A 1WOCA 3A9KA 2KQSA 5E3FA 4WH4A 1LABA 4DDID 4LK0M 2D10A 2DY7A 3FVQA 4FO2A 3HVDA 3Q3NC 4WJOA 3CWIA 2XWBB 5E6OA 4R4OA 2JK8A 1M90C 5G3LD 2A5UA 1EQVA 2HIXA 1MBYA 4GLSC 1DCZA 3H6MA 4HJ9A 3NZ3A 2F0IA 2L1AA 3OW7A 2R93B 2J0TD 1NYQA 2D3BA 1J6QA 3NK9A 2D0OA 3DLLA 1EF5A 4ANXA 4RWSC 1JWSD 2O5IC 2HIVA 1X1MA 4KHVA 3RZOB 2RDBC 3MHZA 4AIMA 3NUHB 2CCZA 4DUZQ 2FNJB 1LTGD 5G55A 1KH0A 5CV9A 2PE6B 3HEJA 3RZOH 2I07B 2X69A 4A3BG 2UUCL 1MKHA 2CFMA 1BOSA 2D2QA 2DYMA 3AQQA 2XNAC 5C4XG 1F52A 1HPCA 3WAMA 1LFDA 1XMOQ 1S3OA 4N59A 4W9GA 3TCAA 3HM6X 3NTHA 1GJXA 4AJYB 3MAQA 2GBMA 4IUPA 4JI2Q 2ZM6Q 4B3SQ 4KIKA 1WTVA 4D2KA 1G2SA 2Z4HA 5KNDA 1CHPD 3ML9A 4YSYB 1F2MA 2XIWA 3ULLA 1HEZE 4TMAB 1SSOA 2L76A 3DDCB 4HJGE 2RDFA 5M3MG 3AE5B 1PDQA 4BY7B 1PFNA 3MXNA 3BS1A 1VF7A 5K36H 5IGFA 1QUQA 1N61A 4BY7H 1BXTA 2INDC 3GB1A 3T8MA 2KYWA 3L7ZC 1V9PA 4JI3L 2VL6A 1R9TH 2WLBA 2KD0A 3TL5A 1WYGA 3P42A 3ZNZB 4AP4C 2J7ZA 4MM3B 2PO4A 4DHJB 4A3FB 1S5BD 3TEHB 2ZXRA 4ZYSA 3U2SC 4JI6Q 2WDRB 2KHWB 4K3CA 2HE7A 4QF4A 4E71A 4YTMB 1QNKA 2R7FA 1IPGA 4HSVA 4M01A 4HPLB 5T8IA 3U7ZA 4JI7Q 2B2YC 1VMPA 1BNZA 2RSUA 3Q8AA 3AU7A 1LYLA 3K6OA 5JXVA 2F0HA 2V4IB 3R7RA 3RNCC 4JI8L 2JEBI 2KWVB 4QL5A 4DNRB 1ET9A 1I5FA 1CQVA 5J1ZA 3I56A 3LGJA 1K53A 4AS1A 1KABA 3H94A 3PCOB 3AE3B 2BT6A 3ETRA 2LWPA 4LFAQ 5ELCA 1E8ZA 1Z5SB 4UY8C 3KLRA 5M5YB 1UWXA 1PFBA 5HGQA 1XQQA 4YWGG 1LLRD 2D5DA 4G7HC 4PT5A 4PK1A 1JMCA 1UWMA 1HTPA 4EZJA 1X32A 4I7ZC 5LL6S 5CC4A 5FLXc 1GC7A 3DBLI 2I5HA 4B9WA 1MFWA 4OXPA 1W6KA 4XQQA 3B0AA 5D2MB 1M94A 1IW7D 5DNFA 4B3RQ 2MX2A 2MPMA 2BH8A 2LXKA 3VDYA 2K4KA 3X3MA 3M85A 4DV6L 4RAUC 1V49A 2ASQA 3OJ3A 3Q69A 2UXBQ 1YIWA 5AZFA 2BWES 3ICEA 3Q3OC 1GM5A 2WFWA 3SK4A 2BW2A 3APDA 3H7PB 1TKGA 1XLPA 2EY1A 2KUMA 4JL9A 1TKEA 5GXGB 2YTXA 2K75A 1TWGH 1V1PB 4KHPL 5EGTA 3ENEA 1A15A 2F1MA 1I4PA 1HTOA 1XMOL 1QVFA 3HK0A 2BB5A 3Q8BA 1J9OA 3AECB 2GBJA 4ARCA 1RL2A 2A69C 2F3IA 1I94L 1WR1A 1XXGA 4C7ZA 1GNUA 1WMHB 2EKIA 1U9RA 2Y5PA 3GTOH 2KT7A 3CAMA 1NNXA 1Q3LA 5JEAH 3GTMB 3EHVA 2IPKD 2ASBA 4ARIA 1QVGA 1AZPA 5IGBA 4IFDH 3HOVH 1W2BA 2W9NA 4KKIA 5LMNL 1UUPA 2L52A 4NXNL 4XWTA 5JVG3 1SE9A 4OX9L 4WIPA 1IBKQ 5IAAC 1GKHA 2DHZA 2F0FA 5EE1A 4DV5L 1JOOA 5I2YA 5CORA 4B3TQ 1WYDA 4KMUC 1GVPA 5HY6A 4OX9Q 1JOQA 2MW5A 3VFKA 3ZKJC 3OHXC 2V3SA 3DEPA 2B63H 4XC2A 3OSOA 2A4ZA 4JI1L 2KEEA 2OTJA 1SYBA 1PH1A 2ZCBA 4P75A 3QHTA 1AE3A 1PDXA 4V190 1SMXA 1PXUA 1NMGA 1F77A 4A3MH 2GBRA 4LDTD 1VQ4A 4JK1C 3A1QA 1RJTA 1C4AA 2VH2A 4JPBW 3T51B 5GAEC 1EYCA 1X3GA 2FUHB 4IURA 5AEKB 4YWLA 3A5UA 2YU9B 2JZ3B 3I72A 3AB5A 1JRPA 2A68C 1HZAA 1AEXA 1ZYRD 3L4PA 1PTOH 4XT3B 4GLXA 4KTAA 1F9QA 1QE6A 2OHFA 3B08A 4DR1Q 3E3XA 4YY3Q 4RMAA 3NQTA 2EJGC 1ACCA 1AFPA 1FYCA 2F0DA 3NZUA 1HZCA 2Z6KA 1IW7C 2KCCA 1I7HA 3MHSD 5HI1A 5J18A 1CT1D 4U68A 1EFWA 3NZSA 4NXNQ 5DCNA 2QDBA 4NDXA 3T1YL 1JRUA 1L4DB 1XCTL 4LNFA 2A74C 4KN7C 3KFUA 2DYBA 1SYFA 3BYTB 3K7UC 1H9MA 4B3MQ 1QNUA 2HD5B 2ENBA 1OEYJ 1XNRL 1XO3A 4CDDC 5K5PA 4NW2A 5E7NA 4H13C 3TP8A 1NCVA 2EVBA 3G6EA 3PF5A 5K36G 1SMYD 4FHJA 4LDTB 1RCVD 2PW9A 2MCNB 3L3OC 5JOBA 3EQLC 3OOCA 3EC8A 5DPTA 2MJDA 4DUYQ 2D2CC 2DENB 3GP7A 4N8X1 3DWQA 3STBC 5DM63 4RMFA 3SR6A 2A69D 4DFAA 4ASWC 3M4QA 4RGTA 2K25A 3GQBA 4I6PA 2Q5WD 3U4VA 1UEBA 1HR0L 4OZBA 3WA0A 3VYRA 1V5OA 5CTRC 1JT8A 2YV5A 4GXBA 2DGYA 1V43A 5DEHA 3DCGA 3J9CA 3I3CA 2KMAA 1Y1WB 2B29A 2VUMG 2F3VA 3RNBC 3NHHA 2Y0SE 5LXIB 4LJZC 4P71A 1EWYC 2PW5A 3RZDB 1SMYC 1EU3A 2CWPA 3M63B 4DV7L 3PS6A 1K52A 1GO3E 1G8ZD 4JOIA 2G5DA 3J80E 1WCMG 1PV4A 1IBMQ 2E2IB 1EOTA 4OIKA 3JC66 3KYDD 4WWOA 1J8CA 4K81A 2LFIA 2BKRB 2GA4B 5ELBA 3TQYA 1ESFA 1C4QA 4DA2A 2PPHA 2KFKB 3HOYH 4QB4A 4K7SA 3KF8B 5C0XG 5EE3A 5JH5C 1C4PA 5HKHA 4IPDA 1VQAA 4I6NB 3K7AB 3KQ4A 1BMLC 1XYIA 3D8GA 2PI2E 2X6GA 3N6RA 3MWYW 1RAXA 3HOZB 2KACA 4GKJL 5KIXA 1QQRA 3WAOA 1K0SA 1WXQA 4R4TA 5ISRA 1ENCA 1KLGD 5TSSA 2JPHA 3F2DA 1XPUA 1IBLL 3DOWA 5LMUQ 1FRDA 2FBWB 3U30A 3VUXA 2O6VD 1PYSB 1OFFA 1WTHA 1ZXTA 4R4IA 4L8JA 5M5WB 2J42A 2L9HA 4ZKBB 3VR8B 1UAPA 3H6NA 5GMVA 2R92B 2Y5CA 3EBEA 3VDZA 3NTIA 3R3OA 2LI5A 2LXJA 2M17A 1EY6A 3S1NB 2RPVA 2Y0SB 1JJ2A 1HUMA 2ID0A 2LMCB 2F03A 2RDGA 2N9KA 1DOMA 1B9RA 2QCZA 2Y3AA 3PO3G 3U9SA 2Y0SG 2OXPA 4L5SA 1OQRA 4EKUA 4B08A 1AYFA 5KEEA 1STBA 3A7AB 1PH9A 1MSGA 5L37A 1C9OA 1E7ZA 5KNCA 1XTCD 1M1KC 2WXIA 3NS8A 4RHSA 1WZ0A 3N3KB 1L7YA 2MBBB 1ISNA 2N4FA 3DM1A 4CO7A 2KA7A 4II2B 2D07B 2QC8A 4HJ8A 2NB0A 1DD2A 4KJNA 4C3JH 3L08A 4DK1A 3T3OA 3KOJA 4LK1C 4JI4Q 3V2TA 3KBGA 3KJOA 2E5LQ 2F0WA 4MJSA 3IFDA 5DLQE 3EFCA 4NQKE 1IBLQ 3ZJYC 4L2YA 3W9CB 3A9KB 3CU7A 2RA4A 4RFBA 1VQ7A 3ECIA 1AP0A 4R4CA 4F8MA 1UGJA 1TKWB 2XK5A 3ZNID 2J4XA 3DQVA 2B2VA 3P7JA 1Q0WB 2JX5A 3DBHB 5DPSA 2DAFA 3H0GG 3ZVVA 4KI0A 3MVVA 2JY6A 1KF6B 1UE5A 1BQQT 5J22A 3LB8C 4A3FH 1WE6A 1P1AA 1XT9B 2ZJRA 4FLHA 1ESRA 4H7BA 2F0SA 1MI2A 5C6AA 3AEDB 3V05A 5LXHA 2JYOA 4IJHA 1YJNA 4A75A 4K2LA 1CTMA 4LMQD 1EZ8A 4NPSA 3X3NA 2D3CA 3M4YA 3C1FA 5IYBG 2KJ6A 1GG3A 3T56B 2Q2TA 1MIUA 2WXOA 3UDFA 2D9UA 3RUZA 2A6ED 2WXHA 3I8ZA 1NR2A 2WQYB 2INPE 2MLBA 1K73C 1FNVA 3ERQA 1E1TA 2DNEA 3Q3MC 2WACA 1YN4A 2BPSA 2UWQA 2ONQA 1EU4A 3RULA 1A2UA 1WI0A 2BYFA 2UUAL 4MELA 4WWMA 3AU5A 1ZUD2 2FUG1 4L23A 3ABVB 3K5NA 1OXUA 4FP5D 2KWUB 3NQIA 1HJPA 3L17A 1EY4A 1II3A 2LUEA 4CHKA 1CFMA 3JSVB 2BS4B 5AUIA 1STEA 3QOJA 1C76A 5CBAE 3MC9A 1ONLA 4C1NI 5FR3A 1LGRA 5EKLA 1L6UA 1YHBA 4PG3A 3I91A 1SSNA 1E8XA 2PJHA 5A2QE 4FNFA 1I94Q 3EFXD 3S2DH 3TP6A 2EELA 1I35A 3K81C 1EUVB 1RIPA 3GE3C 4KSLC 1X3EA 2V4LA 2M1MA 3DEOA 1FEHA 2V9HA 4N58A 5FOBB 2Y5BB 2LY7A 2IX0A 3BJUA 1XLOA 1YNXA 1A3UA 4OWWB 1GXDC 1CKNB 4PQXA 4UP8A 3S1QB 2JA7B 4CJ0B 4X3TA 3CCSA 4FA6A 5C44G 3MXUA 4Q0FA 3H3VH 3MTSA 2E6XA 5E4WC 1QT9A 5H8YE 1N60A 1HTQA 1NYRA 2VB2X 3QB3A 1WX7A 4MGZE 2KVZA 3PIO3 4J8QA 3SK5A 2XTIA 3ML8A 4G57A 3UI3A 3BU2A 3OW2A 2KTRA 2REXA 1IL8A 4FJVB 4YWMA 1E90A 2M9VA 1UGMA 1YNJD 4GNXB 3DHQA 2K8BA 3TMEA 1AE2A 3NVZA 4CYEA 3RCZA 4GN1A 1FXAA 1VQOA 5EE0A 4KY6A 1OO9B 3JSVA 1F9SA 4HIOA 3SVMA 3KDFA 1FVIA 3HOZG 1TTNA 2DZJA 2PEAA 2LASA 4DBGA 3ZQ4A 4HJ7A 1PQSA 2IY1B 1EQQA 3HHMA 4J3OD 5IO9A 2IO2B 3W5VB 3RZWC 1A62A 3SDZA 3UE0A 5KNBA 2QCPX 3BVZA 4C1NK 3QG1A 4W9LA 5C0XH 4KKSA 5FJ8H 3OIPA 3UI2A 2JN4A 3L13A 1U4AA 4M02A 1WCMB 1Y1VB 3FC4A 3K5OA 3DPDA 2PLPA 2L0TA 2G1EA 3SHQA 1VQBA 2B2UC 4A3LG 2F0MA 1VJKA 4B3TL 5EAYA 4IKGA 4EFOA 1BUIC 2FCNA 5JPNC 2IX3A 1G6JA 3NJTA 4TVAB 4KD3A 1C7YA 3E56A 2RSOA 2SOBA 4A3EB 4HWIB 3GDEA 5FLMG 1Q1OA 4DXFA 2MEKA 4FXDA 1SFOH 4M00A 4A3EH 2G9HD 2MBOA 2UYZB 3PUZA 3PRPB 3F2UA 5M5XB 3K9OB 3X23A 4XDDA 4P74A 2W82A 1KL9A 4WQOB 2EMSA 5HHDG 3P4RB 3HP3A 2WP9B 2LRWA 4ZYNA 4PS8A 3GTLH 1FGUA 2QF7A 3TEXA 2CH4A 2F0TA 3QR8A 4F1SA 4ZLTF 3HOXG 4K0KL 4MSMB 2AQ2B 3DWGC 2H4OA 1E2WA 4RCOA 1GC6A 2JA5B 4JI2L 2L5TA 1VZ8A 1QUQB 5CV4A 3HOYG 4W9FA 2KOXA 3P1HA 4HLEA 1LTSD 2RD0A 3IT4B 1VQEA 3E9HA 3PF4A 4MGKE 3EUB2 1WM2A 3H0GB 3PIPA 3WALA 1PGBA 4B0MA 2SAKA 2R7DA 1SJED 2XBBC 1XLQA 4S0RA 4DXAB 1WTPA 1YHAA 2IL8A 2BBCA 3K8AA 4NY0A 4PV1C 3FMCA 5CV6A 4DR2L 4JE3B 3K57A 5H92C 1N34Q 2A6EC 4QAYA 3QARA 3DWAA 1GUGA 2IGDA 1UEAB 2F0GA 4XXEA 1MG4A 1H9SB 3DHIC 4IPHA 4BAXA 2A6HC 3TS2A 4MDKE 4DR5L 1VDVA 1N63A 4EX5A 1P0RA 2LVPA 1ZYRC 5IT9E 2YU9H 2KCNA 4LFAL 3GTQB 4XYCA 1EZ6A 1UF0A 2JA7H 4HPMB 1PLFA 2GMIC 3DBSA 3PO3H 4IZ8A 3M7NA 1STNA 1EM7A 1TGZB 1VZ7A 1PZID 1ZGUB 4JI5Q 1O78A 2Z6BA 4F7XA 3A4SC 2GI9A 4IQZA 1QG7A 1U4MA 2VXWA 1QILA 3TSSA 2E2IH 1CQFA 2M0XA 4GIVA 4ICUA 1IYFA 3UIPB 2RVLA 1SNQA 2C35B 2F0EA 1X6OA 3RLNA 4ID6A 4DDGD 1YQ4B 4MH8A 4IM0A 3H3VC 2Z0DB 1B9NA 4A3OA 2CR5A 1U4RA 2K5WA 4GN5A 4MHEA 1UNSA 1E3PA 3I4MB 3VR9B 2R92G 1P98A 1SR3A 2ACZB 3AYHB 1TWHB 3KK7A 3ER0A 2JYEA 4OELB 3BY4B 2LGYA 1QOAA 3A7LA 2VB3X 3V96A 1MHHE 2CJNA 3I70A 4GKJQ 5IGDA 1YN3A 2Z0EB 3PTFC 3RZFA 3WAPA 2UXDL 1KLUD 1HNXQ 2HDLA 3W3AA 2L55A 1IGCA 3IXSA 2XVSA 4HJ5A 3K5LA 2FE8A 4R8NA 4GOPA 1KJTA 4A3IH 1C8CA 2JXTA 3AEEB 1YD8U 4KHZA 4JWUC 4YT0B 1E7PB 1RHPA 5CR3A 4US8A 1FNUA 3A33B 2HUGA 3H15A 1YNJC 4URKA 3W1GA 3K58A 4IALA 4GLAC 3HOUH 3B2FA 1YQ3B 3MC8A 1O80A 4XT1B 1G2TA 2N1WA 2JA9A 1ZW7A 4A3IG 2M0AA 2D3GA 3RN9C 3FPUB 3S2AA 1E7VA 3AE2B 2CKHB 2WU2B 1LXDA 3VQIA 3DM3A 4HKZE 2WB1G 2K1FA 1Q90A 3A0JA 1XEEA 1TY2A 2N9LA 4RKBA 2QMTA 4JQWC 2CU1A 5C3JB 1Y1WG 4ZUJA 2KHJA 4B9XA 1DXMA 1I4HA 4LFBQ 2PW7A 2HDEA 3NBIA 1JJGA 4BKSD 1V1PA 4OVVA 1SN8A 1E6EB 2I5LX 2WB1B 1KM7A 4BXXH 2H89B 2HTHA 1L0YB 4LUVA 2OTLA 1CJEA 2ZJDA 1H9KA 5JJKA 3ZIMA 1I3QB 3VVWB 3FRPB 4FF3A 1ILPA 1FO4A 1ZXIA 1QOFA 4A3DB 2K05A 1HCZA 1M8AA 2OJRA 1Q82C 1BBWA 1UZXB 4P1BC 4DR3Q 4DR2Q 2OF1A 3QIAA 3PRMB 4LJPB 3U4ZA 4WWNA 2D62A 1C48A 4FXGC 2DZIA 4US9A 1TS2A 5D65A 2AL6A 1B44D 2JZZA 2R2OA 4POGA 4WQMA 1LTID 2HT1A 1YNND 1JICA 3D0FA 5LL6X 3AMZA 3APCA 1XWEA 2PZWA 3PO0A 3S1MH 4ZRPA 4WFN3 1LT4D 1OXVA 3HVZA 4IOIE 4X3SA 1H8CA 1UH6A 3NELA 2J0JA 1XPRA 1ENAA 4K6DA 1WD1A 2UXBL 3ZYYX 3EJIA 3CF5A 2UXCQ 3AMUA 2I2YA 3QAQA 2F4VL 2WXMA 4X66L 4EUTA 2E2DC 1SNMA 4QJFA 1JWMD 1BF4A 3TUOA 2EE1A 3P75A 4DN4M 3VAWA 2FIFA 2X6LA 3KH0A 2JA6B 1RLFA 1JE4A 2MHVA 1WTXA 3DWPA 1CMXB 1J0GA 3VTWA 4FDBA 1C3TA 3AB9A 4OONA 5BYRA 3C19A 2G4DB 3AE6B 3AE9B 1NR4A 4ZRJA 1DONA 2M8SA 4ZUIA 2QSDA 2CWAA 4ZRKA 4EQ5A 1KAWA 3MXGA 3D4DA 3CXCA 4KKUA 5IIFA 3IG3A 3AXCA 1SBBB 1SF0A 3GO5A 1IBKL 2BWFA 4WAFA 5IN7A 1X3PA 4DR4Q 3U9OA 4GN4B 1E0ZA 3JAMi 1ZDVA 1TWHH 2JF5A 1EY0A 2C7HA 4OVZA 3ULJA 4GZYC 1C1YB 2KMMA 4UPAA 1P9DU 2ICEC 2PE9A 3PV0A 1SNCA 4IUQA 3L2PA 4DR7L 3V61A 2B2TC 2PZTA 4C56C 2KWCA 3GS2A 4J15A 4ANWA 1PUTA 3QQ8B 3PIOA 4DV1Q 4ZRIA 1V9JA 3I3TB 5I6YA 4DKAC 4JYAQ 1D6EC 3G71A 4EQNA 4GDKB 1NSNS 4X66Q 3D31A 2JA5G 2FFKB 1H9SA 5BMGA 2FMMA 1WJJA 1GUTA 4ME3A 2KFJA 2JT4B 4QIWB 3HOXB 4NAMA 4DV0Q 1KTKA 5L83A 4DAMA 3GTJB 3AEGB 1E5WA 1WJNA 2LRUA 3QOLA 4Z9CB 1R4NI 1MGSA 2H1EA 2WAQG 1IYUA 3J81E 2WAQB 1QZEA 4ZRZA 1AZQA 2IX1A 2KX0A 2NPTB 2F0NA 4HMJA 1B7YB 1L4ZB 1UE6A 2KJHB 3CC4A 2OQ0A 1D5MC 1DM0B 1HA5A 4GOPB 4JBMA 3EROA 3S1NH 5AUKA 1EY9A 4A3EG 1PYWD 5ELNA 5MPOA 4RHRA 1B3AA 2UU9Q 3MA2B 1DGJA 2EKEC 5M5WH 2BVCA 1HZBA 4HROA 4OVUA 3IRBA 2LEKA 2WXFA 3BK1A 4IWOA 1YJWA 4IWQA 4XWWA 1VQMA 3ONSA 1TT2A 4GS3A 3RN5A 4HIDA 4BA2I 4TV3A 2KNBA 4NB3A 3C8YA 2J7QB 2K5VA 2LKVA 2KZRA 1KRHA 2KCMA 2QEXA 3OLMD 2BQQA 4X65L 1XJVA 4JI8Q 3QO2A 3S17B 1UBQA 2RQXA 3OAWA 1BBUA 1VR9A 4A6QA 3ZJUA 1JR0D 2BYTA 2PMZE 4RGOS 4LLGM 1HQMC 1Q7YC 1A70A 2JWUA 4II3B 1V80A 2ICIA 2AX5A 1B1ZA 1IHZA 1K3BC 2NVTB 4BBSB 2ZEQA 4YTPB 4X65Q 4EQOA 3AEFB 3TP5A 2EPBA 4H2AA 2N8NA 3N32A 1PH3A 3LXFA 4YWKA 2EY5A 1O7LA 3GD7A 2BA0A 2V3PA 4B95A 1VQHA 1JROA 4LNNA 3H09A 2UXCL 4IN3A 4Q2JA 1N32L 4I65A 3J7AF 3RNAC 4FN2A 4JWSC 4FYDA 2R3ZA 5E1FA 4AYBG 2B8GA 3Q22A 3ERSX 4HMIA 2UU7A 1DZ1A 2IWHA 4LWCA 2K5PA 5CYUA 5C1ZA 2EYLA 2N55A 3VXWA 3Q2AC 3KYCD 1N5XA 1N36L 2KOLA 1WFYA 2JA6G 3KWLA 4QIWE 1G291 4LW1A 1JWAD 1LT5D 5C44B 1MSHA 2C9OA 2K5QA 1C78A 1TKYA 3FILB 1CUKA 2JA7G 3E0JA 3O13A 1DOYA 1N6ZA 1F0ZA 2WXKA 3SE0A 4FXCA 3T4AC 1EL0A 1HA6A 1B8AA 4HSPA 3CIRB 1IZ6A 2K6AA 2LHEA 4USAA 1S40A 2HCIA 1BCPB 3D6CA 4FF1A 1SRUA 3AM9A 3PUVA 3VYUA 1ZEQX 1VZ6A 3H8HA 5C4XH 1GPXA 3ZNHB 3IAYA 3NWTA 2BH2A 1YJ1A 1D5ZC 1Y14B 1MJDA 2J52A 4K1RB 1PH6A 4W9KA 4EEWA 2KFKA 1TVXA 3CPWA 1FJGQ 3ZXRA 2VW9A 3UGBB 3TMPB 3VTVA 1PTOF 1L2NA 3H0GH 4R9WA 1CKNA 4DHZB 3FEWX 4OW0A 1R7SA 5J2RA 1ZKOA 3DWMA 4DAVA 1M4VA 1WFQA 4J1MA 5IWAQ 1T9HA 3PSEB 5CV7A 3SGIA 2OT2A 1W6JA 4DK3C 4ZKCB 1B53A 1MJEA 2LUMA 1SNPA 2CU3A 2B8FA 3MEFA 2FJ2A 3GTPB 3IVFA 3S2HH 2P5ZX 1HXYD 1WGRA 1Y56A 5J3BA 4JI7L 4KX6B 1JB3A 1I4QA 4MACA 2CH4W 4C3JG 3HOXH 3LWUA 2L3ZA 1BCPC 2PNRC 2PKOA 3I7FA 1WGYA 3F2BA 3S1RB 3CMMB 4XTCS 3NSWA 4PMCA 2V4DA 5C2TB 3HKZB 4DNTB 4X6AH 2DYOA 3H7SA 4KIKB 3VRAB 1E2VA 4XDXA 2EZVA 2HTME 1NBFC 3WOEA 2LVOA 1K8AC 4K7UA 1STGA 3A8IE 1NDDA 2F4IA 4A3IB 2K04A 2I1JA 5IYCH 2KC2A 2WNMA 2HDMA 1MG8A 2WXLA 4MT5A 4ITKA 2NVYH 2L8JA 3PUXA 4JIOU 2AUJD 1Q8KA 4WJ4A 1Y69U 4KLKA 4HDOA 4PYUA 3UDIA 3HOUB 2WDVB 3Q8EA 3HKSA 5AZHA 4M8NA 3ZTCA 2B39A 1Z2MA 2INCC 1QJOA 4A3LH 4P6VF 2HCCA 2FAZA 3WWVA 2MFIA 4ODGA 4S3SA 1HFGA 2ZW1A 2EMTA 3K7AH 1PVOA 1A6XA 2KN5A 1VCIA 4A9AA 2NBVB 1WGHA 2O4XA 2N9PC 1IBXB 1ZE3D 2CHWA 5FLXL 4OL7A 1C4CA 3LX0A 3H3VI 5J17A 1G51A 2EIFA 1WXVA 4HCPB 1TWAH 4FF2A 1EOVA 2KQ3A 1VD2A 4O42A 1I50H 3CCQA 4DR3L 4N6EB 5JJZA 3PUYA 3D4RA 3LDZE 5KHOA 4NJ6A 1YEZA 5EKIA 3D32A 1JORA 3GOEA 1BKBA 1NMFA 2X38A 2MBEA 5CHFA 1TZ1A 4JOIC 4OEMB 4RGNA 2B2YA 4FJZA 2N3SA 4A3DH 2Z8LA 4IUNA 2KDEB 3CW2C 1SJHD 1BO0A 1T5XD 1WCMH 2K03A 3SR1A 1JE5A 5BR8L 1JALA 1XF5L 2VZAA 2FHTA 4A20A 3P4PB 1MVKA 1S5FD 3DMUA 4J6HA 1K51A 2BGFA 4EE2A 2L12A 5C3EB 1Q81C 4YHHQ 2KJRA 5C23A 5C4HA 4BZAA 3P4QB 3T13A 1NI2A 2VY3A 3S1MB 1T5EA 3JYUA 2ZTCA 1DJRD 1HZ9A 2KDMA 5KGUA 3N9YC 3WDNA 2NCNA 3AU4A 3DVNV 1PYBA 4P7IA 3OPOA 4I7AA 2K8CA 1R4NB 2F0LA 5ELOA 3PZDA 4M0WA 3G7LA 1FXIA 4MEMA 5C4ZA 2PCFB 3L0WB 4BBRG 1HNWL 3CF6E 2ZXOA 3MFGA 3CMAA 5EPLA 2QKIC 4K6LA 4ZQ3A 1KIXA 4X57B 4LF6Q 4A4IA 4R3DA 3RUIB 1MI0A 3DVGX 1VQFA 3ZRFA 1WZ3A 1K8OA 5LLIA 5FKAC 5D6JB 3N1YC 1HHVA 5BN4A 4JW0A 2KLCA 2HJ1A 2DNFA 3VR2A 5I9OA 3QWNA 2UXDQ 1JWBD 4LF9L 2RCFA 2WDTB 4DAYA 1V1OA 1WXAA 2ZM6L 4B3RL 1BBXC 4G4KA 1VQ5A 3NOBA 1XMQL 3B6YA 2C7NB 2K22A 1F1HA 4DV7Q 5E6JA 5HFYA 1NUCA 3M4OH 4RGMA 1Q46A 1XCQL 2CW0D 3V60A 3NEMA 1T0SC 4K5XA 3M3YB 1NTGA 4JV5L 1L5PA 5BO4B 2OWOA 3RNUA 3S14B 1MHXA 4HKQA 1T3QA 4M1UB 2N7JA 1TYGB 1GUSA 5IYBH 3J81L 3T3NA 1SNDA 2KHIA 4CKEA 3F2CA 2B3AA 3D3RA 5EDSA 5GAHC 1CA6A 4LFBL 4NAWB 5G3LF 1I4XA 3PGZA 2D5GA 2W3RA 1CZGA 1EY7A 1U4LA 3QJYA 1SEBD 2K52A 4IPGA 3GTQH 3TJPA 2OEOA 2K7VA 1KD1C 3PLVA 1JCKB 2L7RA 5D3IB 1VQLA 4C80A 2RGFA 4DR5Q 2B2WC 4OO1H 1EUJA 1D3ZA 1S1QB 1YX5B 1FNWA 2K9XA 4QMGA 4BOZB 1Q5WB 3H7PA 1H95A 3R66C 1SYEA 3J81j 1X3FA 1PH2A 1XNQQ 2B63G 4JV5Q 1PGAA 1Q10A 1V86A 1WE7A 2W55A 2UUBQ 3KWVA 3PHWB 3PLUA 3A8JE 3PPAA 2SNSA 5EQ0A 1TQOA 3EFUA 1TZOA 2JA6H 3D6WA 1GAQB 3NY5A 1WX9A 3IFWB 2C5CA 4EOYA 1E0BA 3KYHC 2QEJC 4YL8A 2XWJB 2JRIB 2VQEQ 4IFDG 4LF4L 4AQYL 2KKCA 2J0MA 4OZAA 2DWQA 2KEDA 4POFA 1TWGB 5M9OA 4IJLA 1F9PA 1FL0A 4EGVA 1AARA 3F8TA 3U58A 2BE5C 2XEWA 3QCAA 2ZPNA 2NVQH 3I4NB 3CC2A 2IY5B 4LAAA 1S5ED 1CK1A 2JXMB 2QDLA 1KC8C 1HH2P 3I4LA 1QLBB 2N88A 5E6NA 3Q24A 3EGRA 1HR0W 3LJ3A 3VUYA 3WANA 2KVRA 2MJEA 3ZTDA 5IOIA 1YN5A 2E5LL 4FHKA 4RNAA 4IOAA 2W54A 3VRBB 3CSFA 2NN6G 2JA8G 3WOFA 5KYLA 4C2MH 1PH4A 3VR3A 3DBHI 4FF4A 3NVVA 1YNTE 3BIID 3VTUA 3T16A 1WRIA 1PZJD 4AQYQ 1TJEA 3E9SA 1FCCC 1SFOB 4XIGS 4AQ7A 1X54A 4LF6L 2BB6A 2KENA 3AEVA 4X62Q 3RYTA 2I46A 2SDFA 2UUAQ 1KQSA 2KAJA 1FMAD 4KKJA 4HXDA 1E8YA 2N9EB 3E5SA 3I4NG 1WXMA 4GMVA 3C46A 3ZUNA 2BDNA 2LS01 2IO0B 1YVCA 2NTSA 4XQJA 2Q2UA 4LF5L 3BDCA 4MJSB 4ANUA 4C7YA 4X64L 3SDLC 1L2FA 4ALPA 1BT0A 2XRSD 3G6JB 2BYVE 3QA8A 2Q8IB 2RPQA 1WTRA 1J8IA 4ILWA 1X55A 3MC0B 2L00B 5FK9C 4GNXC 1FM0D 2MQJA 4DV4L 4HEDA 1ML0D 2OEDA 4JGHB 3P1MA 3I57A 3FPPA 3HOUG 1SYDA 3OMGA 3U50C 3TS0A 4JI3Q 5LNK1 2B63B 3A8KE 2VRRB 2MBHA 4OHJA 2CQOA 4P1CC 4G7ZC 1T6BX 2QW7A 1VF5C 2ZVNA 2NS5A 3BZKA 3NENA 1VQ9A 4W9JA 2VUMB 1W3SA 1C77A 4C3HH 1JW9D 1L6VA 4Y7NH 1RFAA 3PRZA 1N33Q 2EYHA 2QGQA 3E9IA 2K33A 3K80C 3W1BA 1J5EL 1YX6B 3N1ZC 4TKNA 4GGQA 2AUKA 1L0VB 4KGSA 4WURA 4A55A 1FD7D 2B2UA 5D7GA 1QOHA 4IDIA 4KVGB 1S5DD 4A3MG 3ZXVA 1F2ZA 2O5JC 2KHSA 4JI1Q 1VQJA 2F3WA 2YTYA 1AWDA 2UUCQ 3CPFA 4APVA 3JAME 1K8RB 2AWTA 2C5LC 4E74A 1YITA 4IC7B 3L0OA 3I9V1 1Q1EA 1AH9A 5LHY1 1TT5B 2NR2A 3IT6B 2WINB 1NI3A 4HVBA 3I5JC 2G3QB 5DAUA 1V2YA 2AHOB 3S16H 2E2JB 2KBNA 1RWSA 3S2DB 4YXDB 1DOKA 1A2TA 4YSZB 1P8LA 4WWPA 4IUVA 1G91A 2QHOA 2YTVA 4JC0A 2MUYA 3AEAB 4ME5A 4UP7A 3TZDA 5FO9B 3L16A 5AJ3L 2QDFA 3Q8DA 4ICVA 4NKLA 4HJAA 2DZMA 1UELA 4XQNA 1VS0A 1A3VA 2FCSA 2VH1A 3CCJA 5FO7B 2GVAA 4NP5A 1HRJA 4AUQC 1OTCA 2LXCA 4QUCA 2MNAA 2ATWA 4PNYA 4R1JA 3T1YQ 2NVYB 4ZRQA 2RDHA 1N62A 3JAML 2R7ZB 2FCQA 4BY7G 1IP9A 3HOWG 1LTRD 2RCNA 3KF8A 1YBYA 3HRZC 5M3MB 2CHXA 2EYFA 4MSQB 3ZO5B 4BFRA 2DNCA 3ZDMC 5IP9G 4LF8Q 5M3MH 3CRLC 5NUCA 1HNXL 3CD6A 4DR6L 1WMHA 2KXJA 3S1RH 3AE8B 1O7ZA 1KRTA 2B2VC 3JAMc 4BY1H 1U0LA 1H4RA 4L1BA 2TMPA 2LJIA 2DJFC 1Q12A 3RMHA 3AI5A 2NZ1D 1QOGA 2D11A 3CMEA 3C0RB 4M8MA 3SD5A 5BMHA 1WX8A 1K3RA 4Y52H 3N52A 1G6PA 1I50B 3TN2A 1UWVA 1WIAA 3BYYB 3N1XC 3TZUA 1HNZL 4A3JB 4ANVA 3VYTA 5JEAG 1SDFA 1Y1VH 4A76A 4DXGA 5D3DA 4A3BH 2LGSA 4GKKQ 4XE0A 3DVNU 1LUZA 2ON8A 3UINB 1PMRA 4LFCQ 4GDLA 4C3HG 4IM3A 2R6GA 1SYGA 4DR6Q 2L05A 3KUCB 3L9AX 3AFQA 4DV5Q 3IFTA 1TU2B 4HTHA 3R93A 5C3XA 4KY7A 2JUOA 1JC7A 3KUDB 2NN6H 2JA8H 1D8LA 5IGGA 3B9JA 2WX0A 3V3XA 2EXZA 1O7IA 2C7MB 4DV3L 4HR7B 3KLWA 1EQTA 1XNRQ 3BVMA 1HE8A 4XDCA 3LWEA 2I1KA 4HRSA 4IOCA 5FR6A 2A19A 3BZDB 2VQFQ 4TRDA 4V0BA 4BBSH 2L15A 1GHKA 4TQUS 3GTLB 1F9RA 4CBVA 2DLBA 4GOPC 2IO3B 2LGDA 4UP9A 3OTOQ 5IT9L 4Y7NB 1J7BA 1IBXA 4H02A 2RHQB 1IXRA 5GAGC 4EZKA 2RF4A 3HRDD 3GTGH 1I4GA 4DR1L 1UBIA 1SIJA 1GUWA 3NVWA 2D3AA 3H1UA 2JP1A 1BUVT 3PZ7A 5IP7H 1CKMA 2O2VB 1D4BA 3P63A 1WSPA 5LMNW 3U4EG 4K0KQ 1R9TB 1VQDA 1N36Q 4RF1A 4NAWA 4OWXB 1DOIA 2IDYA 4LNKA 2G4SA 2XSCA 3ZJVA 2MQHA 4A3KB 5C44H 3A74A 3EN2A 2AYOB 2YEPF 4A93H 1WI5A 2Q2HA 1PTOB 3W5UB 3IKJA 2E2HH 3W2DA 3SFEB 2WKCA 1NE3A 2PYKA 2BOSA 4P72A 5GADC 1Z47A 4JBKA 3J7A5 1ICFB 4K3BA 1OXXK 3E6ZX 4PS7A 2V3NA 4KV2A 1K83B 2KDFB 2LHDA 2L11A 3H91A 2EJFC 5M5YH 2IY0B 1QZGA 4DV0L 3IHPC 3QJZA 3BDOA 3SU8X 4BS9A 4TKOB 3PV1A 4KZ0A 4LJOB 3RI7C 1EWCA 5C0XI 5C0XJ 1ET6A 1TWCH 1ILQA 3I4OA 3EECA 3NE5B 1EIHA 3ZW3A 2ZNVC 3DBRI 2INNE 2ES2A 1VQNA 1ZPSA 4PZ8A 5M3FB 2WHIA 5M3FG 1K28A 1H9JA 1E7UA 4DV4Q 2O2VA 2QJLA 2RBMA 3HGBA 5H1SE 1NVID 3RNFC 2Z4IA 3R2IA 3A4RA 3GTJH 3HFZB 1XNQL 1F2RC 5BN3A 2YVCA 2ZZPB 3GE8C 4OO1G 1L1OA 4KY5A 4PMBA 4RM8A 3W1SC 5I4DA 1EF1A 1K50A 1IYVA 3RMKC 4O2DA 4BBRH 4B3ML 3UDGA 1ICWA 4HK2A 3HM3A 3DXJC 4K14A 1N5WA 4FVMA 3I55A 5CV8A 3J81i 3A5ZB 4JVZA 4ULLA 2WXQA 1BDOA 2YEPB 2FINB 1Y8NB 1PFMA 4WJNA 4F7ZA 4K5VA 2K50A 1QCBD 3J7AV 3S14H 4A3BB 1WTOA 2R7ZH 1FGBD 1E10A 3VR4A 5A35A 5JJIA 3C1EA 3BK2A 3FP9A 3KLSA 3KLSX 3G48A 1YIJA 4WJ3M 4B3SL 2JVCA 3GZNB 4DHZE 2LD9A 4A3KG 2KO3A 5KRUA 3BINA 4TQ1A 4CKCA 4PS3A 4WORA 2WU5B 4J6IA 2A1AA 4HJKA 2CJOA 3PVLA 4BKGA 3BZCA 2PZUA 1HZ6A 2O6VA 3PT2B 4DK6C 3ZJTA 1BCPF 1FRRA 1XMQQ 4FXKC 5C5LA 3K5MA 2MA9B 5JZEB 1WTWA 1CZWA 4JI0Q 2B2TA 1IYJB 2F0PA 3T9LA 2Z6KC 4LF8L 3HZXA 3NBHA 3M4PA 3C2PA 2AWNA 4DGZA 1K8GA 1C9FA 4UDUC 1HR0Q 3FILA 3Q6BA 3Q3FA 2KTFA 2L32A 4H0LC 4LNIA 4BA1I 3SXHA 5AZGA 3NUCA 1GUAB 2KLGA 4EQPA 4M0WB 4WJPA 2EYPA 2JWZA 4DQOC 1F2YA 4MTNA 1C0AA 4JI4L 1WGKA 2WYQA 1TS4A 2CVRA 3FHWA 4P2CB 5I2XA 2MP2B 2NBUA 2MWSB 3CCEA 1G6ZA 2KECA 2TSSA 4P73A 1B3QA 1IKLA 4MH0E 2DUDA 1WTQA 1PRTF 2NVTH 3ALBA 1P7FA 3B2GA 2J0KA 2PNHA 1YZ6A 4X64Q 3NVYA 4K7WA 4TUUA 2L0CA 1DOXA 4C3HB 4DAYB 1CSPA 1VQKA 4DR4L 1JQ4A 1PH7A 1PTOD 4HCEA 3KF6A 3QC8B 1Y8RC 1JOKA 1S5CD 1IUEA 5I6WA 4A3JG 2KN4A 3LNNA 2NVXH 2FCMA 3I4MG 4MTKA 4AJWA 4ZAIA 4L5RC 4CJ1B 1STYA 2DZKA 2BS3B 2N7DA 2MO0A 1FPYA 3RNEC 4HIMA 4CDFC 2J53A 1I4RA 4HPPA 4P16A 3IAM1 2MBQA 2F52A 2GBKA 4WJQA 2DN8A 4QUFA 4CHTB 4IO9A 3R3MA 3T1HL 1E9MA 2XN9C 1EFID 5GROA 2EDGA 5LMUL 1LT3D 2VZKB 1WR6E 2E2JH 3KUPA 4GLVB 2VUMH 1BVSA 4ZCKA 4EVOA 4A3KH 4A3CG 5CX3A 4R8IA 3AEBB 5EE9A 3HOWB 2JYTA 3GZNI 3KUZA 4LNOA 4YHHL 2R7ZG 2IHFA 2AQ3B 2M56B 3VUWA 5IYDG 2NTTA 3PSIA 5FO8B 1PGXA 4MNOA 2NUCA 4JI5L 2IYDB 5C4XB 5F2DA 3B1LX 3PHXB 3TIXA 4JLCA 3NHEB 1OXTA 1V1QA 1JB7A 1K0RA 4BBNF 1QOBA 1VDZA 1K8MA 4HCSA 2I38A 2H5XA 4C3IB 1KAAA 4MZ9A 4ZK9B 3NPPA 1I6VC 3S24A 2KK8A 3RPFC 1F2RI 4DV2L 2JXXA 5IYDH 1RF2D 2EYOA 4G11A 3AH7A 5D94A 1YQBA 5CGKA 3UQBA 2L4NA 2R2QA 1NJIC 2LGIA 3HOYB 4C00A 3HG9A 4JBWA 4A3CH 3AE1B 3ZRCA 3MXNB 2Z59B 2KDBA 4GSWA 2WXNA 3GTPH 2YLMA 3M9BA 1V97A 3L54A 2F0QA 1RODA 3MHBA 4F87A 2K1BA 4FJYA 1CSQA 2KX3A 1CM9A 2NYZD 3ND9A 3MJWA 4KDLB 1ZDXA 1ZXHA 1CA5A 5IA7A 2IBIB 2O6VB 1LACA 1WYWB 1V5TA 3A55A 1TWAB 2N78A 4W9DA 3PO2B 3I90A 3AE7B 4YSXB 4A3JH 3HIZA 3N30A 1RKNA 1YOVB 3V62A 2JZPA 2GOWA 1V81A 4G3XB 1DGSA 4XYOA 2NVQB 3SFDB 2ZTDA 3J7YW 2FMCA 4LUOA 3TDQA 2DBYA 2IO1B 4PYZA 2LGXA 4GDLB 4KSKC 1GOZA 4IUMB 1N33L 2QA4A 3QX1A 2JRHA 1JQYD 2QILA 5T1IA 3DUZA 1SB3C 2A68D 3V6CB 4BY1B 2JE6I 1AW7A 5C4JH 1J19A 3M62B 4CDCC 3HKZE 3Q0AA 2PVOD 1C79A 3T53B 4HEA1 4R4QA 3ZLZA 5JHAA 2L0FA 2IJ0A 3K0YA 1LM8B 1ZP0B 1KDAA 1RD9D 3J80L 4NJCA 1A3TA 3QIJA 4W9IA 5IWAL 2GVBA 5JJLA 3A56A 2ZNVB 3NTKA 1NAPA 3HOVG 1XPOA 4A3GH 4QCLA 4L6TB 1QKZA 4RA8A 4DU9A 2BS2B 3Q8FA 1GB1A 1SE8A 1TS3A 1N34L 1J7CA 4RH6A 1FJGL 3MEHA 2PI2A 4MGIE 2RSNA 2Z9HA 2GRIA 3E0EA 1WJ4A 2N0SB 3PGEA 2NWGA 4LF5Q 3PMFA 1NENB 1T0YA 2K0PA 1IL2A 3TRZA 3K9PB 1GD7A 3W5OA 5AJ3Q 1XLNA 3CKIB 1FFUA 3P2BA 2BF8B 2IT1A 5BR8Q 1H9RA 5JAVA 3CQZB 2IZVB 1STAA 3K59A 1EWIA 2CQAA 2E75C 4X62L 4XX5A 1PTOC 2K28A 1LM0A 2K01A 2M00A 2MSED 4O1NA 1SAPA 2OJWA 5DPRA 3NXWA 2X8XX 5D14A 1NBWA 5EKKA 2BE5D 4DHJD 3M3YH 2JU6X 1RRBA 3EIVA 2HQLA 3U7DA 4JI0L 4ZOHC 1MPEA 3DHHC 3NP8A 4LFCL 3GTGB 4QQBX 2MH7A 3UIOB 5CBEE 4CKBA 2MHJA 4K8JA 4F88A 4QY7A 1P7EA 4KN4C 2LVQA 3WCQA 1X3QA 1N8RC 2I0QA 1B9MA 3M7GA 1ENFA 1TWFB 3IAS1 1SE2A 1X56A 2C60A 3AV8A 2ZW0A 2Q2IA 3SEBA 1EEFD 2N1VA 1SROA 4L63B 4C3IH 3IBEA 1L1OB 1OQQA 2AMCB 3S16B 1IGDA 3PREA 5E6PA 4G7OC 1DYQA 4DV6Q 1B70B 3CP0A 2LXAA 1RDPD 3FKIB 4KD4A 4B9KA 1ROEA 2E76C 2IGHA 1S3SG 5JHBA 5IP7G 1X65A 3RD4A 3CCVA 3R8BA 3HOWH 4X3KA 4LNQA 2JA5H 4W9CA 5BN5A 3Q23A 5IKCM 1E8WA 4PZ6A 1NY4A 4A8XC 2ZVOA 3MJ5A 3S15B 4CDEC 4BKSA 1GUNA 4KDIC 3J7ZC 3GTKH 1E22A 2K39A 3VH3B 5JEAJ 3PUWA 2HQEA 3A9JB 4ZHPA 3U52E 3PQIA 3P20A 3GTKB 5G5HA 2BCOA 4DV3Q 3EVQA 1T0QC 2EYJA 3L10B 4FADA 1KOTA 2N9XA 1I6HB 1Q8IA 1U5KA 4A93G 1NEKB 1J7AA 2KTRB 3RLFA 2B3GA 1MD2D 4JBJA 1EWHA 4N8FA 1O7YA 3R2TA 2WAQE 2A8VA 3Q14C 1SNOA 4GU2A 4DWFA 1T0RC 1YNNC 1V6EA 3PIP3 2MGSA 1TXYA 2ZJPA 1ZOYB 1PFSA 3T1HQ 2AEHA 1Y1VG 3FAHA 2NVUI 3JW0X 4GDKA 2PIAA 4QGUA 2OCEA 4A3GG 1A63A 4DK0A 3MXPA 3CCLA 5IGEA 3S2HB 4WJWA 2A5HA 1RYJA 4OZCA 4BXXG 4HAEA 5IE8A 2V1CC 4YCWA 3NRZA 1TS5A 1X9NA 2KJXA 2B2WA 4N9PA 4E3CA 2IW3A 1KLVA 1EY5A 4H44C 1LTAD 4LF9Q 2WGSA 1MHWC 1Y1WH 3OG5A 1A8VA 5IY0A 5CHVC 1TY0A 3S1QH 1SLJA 2OOBB 1VRAB 1KXLA 2JA8B 4S17A 3EA6A 1OEYA 2RHSB 4LF7Q 1JMLA 1SIFA 1CI3M 4LF4Q 5IP9H 4AYBE 1OGWA 4C2MB 1P16A 4NXML 2V0GA 5IT9c 3KVFB 4K2KA 4DAPA 2SNMA 2Z0SA 4RCNA 1KDCA 4KJOA 3FDTA 2DAJA 4K8IA 4IG7B 4L5QA 1Y8OB 4JX1C 4BOSC 2VS1A 2JSVX 1VCBA 3VH4B 5G2NA 3KJPA 1D7QA 2NZOA 3OYYA 1A0IA 1SYCA 4X3UA 1PRTD 4GOCA 4XZ4A 1Z7TA 3RFZB 3VHTC 2CW0C 3HOVB 2JEAI 2NBFA 1TIID 2D0PA 3MZ5A 1PFDA 1GUOA 1EYAA 2N7EA 1Y8PB 1EO6A 3P4SB 3V6EB 5J39A 2BTEA 5HGTA 2EOTA 4NNJB 5DPWA 4CJ2C 1FIQA 3AULA 2ZJQA 2GLSA 1D2BA 3DBRB 4YCVA 2F4VQ 1YJJA 1PZKD 3DBLB 1CHQD 3KBXA 1VLBA 2W3SA 2LSSA 1EIGA 3C3LA 4IUTA 2SEBD 2PMZB 4BY1G 5CMDA 1VMCA 4YY3L 2R92H 1R4MB 3CCRA 1EQRA 4YIJA 1YMHE 4KKTA 2CHZA 3ZNGC 2BKFA 3Q6SA 1WVLA 3APFA 1U4PA 2C9WB 1JWUD 2Z1CA 1EEID 3D4WA 1PRTC 2R93H 3OWFA 1WWTA 3QK0A 2K32A 1WJ6A 1I3QH 1XTDA 1P3QU 2LFNA 4LUZA 4OWTB 2RR9A 3ZDTA 3Q8CA 4CQNA 1FR3A 1SE4A 2CKZB 5TR5A 5KYIA 1KHIA 3SK8A 5ELDA 4A93B 4OGQC 3X0WA 1QWYA 2KWDA 2E2HB 4A3MB 4GN3B 2KQ4X 4RKLA 4DUZL 3K0XA 3VR6A 2ZCCA 4DK5A 1TWFH 5IODA 3JVZX 3J81c 5IP4D 2LZ6A 3J80i 1VQ6A 1TWCB 2DX5B 1HTLD 1V8QA 1HNWQ 4YCUA 3A9JA 3TEWA 1R4PB 3RN2A 3TBLD 2LJ5A 2WP8J 2F0JA 4WRDA 2O2LD 1UE1A 1AN8A 3OIQA 2XK5B 2KDIA 1D5XC 1TBEA 1WH3A 3W1YA 3GV6A 2VNUD 1OTRB 4ABNA 3A1QB 2WIIB 4FULA 1PA6A 1LQBA 4DV1L 5G5GA 2BDOA 4G50A 1F2LA 2NN6I 2K3UA 4WAAA 4C4VB 3QWZB 2KQ7A 1VQIA 1QZHA 2FXQA 1B4OA 4C3IG 2HHHL 4DR7Q 1N9WA 4E6IA 4U673 1HZ5A 3UDXA 2N49A 2F0OA 2KC1A 3LYYA 4BVUC 3CHBD 3BWUD 2WS3B 3PO2H 2F0UA 3AN1A 2NPTA 3I4NH 2AL3A 3M3JA 3H9DA 2JSOA 2PVGC 3TEZA 1B2TA 3ITPA 2KVMA 2WXPA 1RTNA 1PH5A 2WXJA 1EIFA 3A54A 1TIFA 1FCLA 1R4QB 5C5MA 4BWGB 4IFDI 4IFDJ 2VZKD 3UF8A 4AOFA 4A3PA 2UU9L 2AQ1B 3RT3B 4OIJA 4C4VA 4REZA 1RFKA 4IW0A 5EBDA 2EXDA 3CRKC 5FJ8G 5FLMH 5KHQA 3CCMA 1XX8A 1EIYB 2OQKA 5C4JB 2PQEA 3PO3B 2H88B 5L95C 4KZCA 3ND8A 5EPKA 3HS0C 4KV6A 4RG1A 3MFYA 4N9F4 1R4MI 2XGTA 1SE3A 3R7QA 1J5EQ 1RTOA 2PQAB 3ONAB 1Z9FA 1S72A 3GV3A 2EY2A 3NBHB 3I63C 4UAIA 4AWJA 2R61A 3OWEB 4F8CB 1CKOA 5ELFA 4A3GB 3PZ8A 3BG3A 1LTBD 3KW5B 2F0VA 3NWSA 5AFWA 1EYGA 4TSSA 3VA5A 2K6DB 3GTMH 3BDLA 1HUNA 1QB5D 5DM73 4NQLB 5EJWA 3OJ4B 1A5RA 2GB1A 4BKTA 4HDQA 1E24A 1GJZA 1KNAA 3OMCA 3TP7A 4IUUA 4PZ7A 1KDBA 5ELEA 3SHLA 2HJ8A 3N20C 2HHHQ 5LMNQ 2MRPA 1D1IA 2YYZA 1OQYA 3CQZH 2VQFL 1WRDB 2AKWB 1N32Q 1S4ZA 1Q86C 1E1OA 3OTOL 2CHBD 3I73A 5GQOA 2B76B 4BBNC 1D1KA 5CV5A 1RM6C 2G9DA 1FFVA
chains in the Genus database with same CATH topology
4KGTA 2NVXB 3GTOB 2WV6D 3VR5A 2EY6A 1STHA 4YTNB 3VYSA 3TBIB 4C3JB 4CGYB 2PPBC 4M8AA 3IL8A 2LMCA 3M4OB 4HN7A 2A6HD 2IGGA 2Q8RE 1SXTA 5C3WA 2XRQD 3AE4B 4MIUA 1KFYB 2RKSA 1EY8A 3S9WA 3URYA 2L1BA 2WDQB 1TR5A 1WD0A 1FD6A 1E2ZA 1HQRD 2PMVA 2EYMA 2ZT9C 2PTLA 2M2LA 5A2QL 1OXSC 2Q8TA 2M19A 4NZLB 5HG2A 4BBRB 5IGCA 1Q1BA 4RF0A 3BVGA 4Q5VA 1V8CA 5EBCA 3HUIA 4TQ0A 1BR9A 2WKDA 1QF6A 1BCPD 4PMWA 3NS1A 5FLXE 1LV9A 1EYDA 4JPSA 5T1GA 4NMZA 2A73B 5E4XA 4KK7A 1YJIA 4AYBB 1L0XB 2E74C 5BMIA 4DF7A 3MP9A 4MN3A 5JPMC 5COYA 3TEYA 1GB4A 5BYQA 4XYQA 4OO1I 1LTTD 4LTUA 5HURA 2K5DA 1HFNA 5I9PA 4ZHOA 5EPJA 4A90A 1PRTB 1B50A 2AWOA 2F0KA 1LO5D 2RMMA 2MJ3A 1CZPA 4N9TA 2ZXPA 2MP1A 1DOLA 3VA7A 5IOCA 2L83A 1IKMA 2WXRA 3SK6A 2EJMA 3W1SA 2QIEB 4B0EA 2NMQA 2JQRB 1Z6HA 2E3TA 1LT6D 3ZGZA 2MJ8A 2DY8A 4KGRA 1KNEA 5BYSA 2BA1A 4K5WA 2WXGA 1GHJA 5JVH3 5E3FA 4WH4A 1LABA 4LK0M 2DY7A 3FVQA 4FO2A 3HVDA 3CWIA 2XWBB 5G3LD 1EQVA 1MBYA 4GLSC 1DCZA 3H6MA 3NZ3A 2F0IA 2L1AA 3OW7A 2R93B 2J0TD 1NYQA 3NK9A 4RWSC 1JWSD 2O5IC 4KHVA 3RZOB 3MHZA 3NUHB 1LTGD 1KH0A 5CV9A 3HEJA 2I07B 2X69A 1BOSA 2DYMA 2XNAC 1HPCA 4N59A 3NTHA 1GJXA 3MAQA 4IUPA 1WTVA 4D2KA 1G2SA 2Z4HA 5KNDA 1CHPD 4YSYB 1F2MA 2XIWA 1HEZE 4TMAB 1SSOA 4HJGE 2RDFA 3AE5B 1PDQA 4BY7B 1PFNA 3MXNA 3BS1A 1VF7A 5K36H 5IGFA 1N61A 1BXTA 3GB1A 3L7ZC 2WLBA 1WYGA 3P42A 2J7ZA 4MM3B 2PO4A 4A3FB 1S5BD 2ZXRA 4ZYSA 3U2SC 2WDRB 4QF4A 4YTMB 1QNKA 4HSVA 5T8IA 3U7ZA 2B2YC 1VMPA 1BNZA 3Q8AA 3AU7A 3K6OA 5JXVA 2F0HA 2V4IB 2JEBI 4DNRB 1ET9A 5J1ZA 1CQVA 1K53A 4AS1A 1KABA 3H94A 3AE3B 2BT6A 3ETRA 5ELCA 5M5YB 3KLRA 1UWXA 1PFBA 4YWGG 1LLRD 2D5DA 4G7HC 4PT5A 1UWMA 1HTPA 1X32A 4I7ZC 5LL6S 5CC4A 4B9WA 1W6KA 4XQQA 1IW7D 5DNFA 2MPMA 3X3MA 3M85A 4RAUC 3Q69A 3SK4A 2BW2A 1TKGA 1XLPA 2EY1A 2KUMA 5GXGB 1TKEA 1V1PB 5EGTA 1A15A 2F1MA 1I4PA 2BB5A 3Q8BA 1J9OA 3AECB 4ARCA 2A69C 4C7ZA 1XXGA 2EKIA 1U9RA 2Y5PA 3GTMB 1Q3LA 5JEAH 2IPKD 4ARIA 1AZPA 5IGBA 4IFDH 4KKIA 1UUPA 2L52A 4XWTA 5JVG3 4WIPA 2F0FA 5EE1A 1JOOA 5I2YA 5CORA 4KMUC 1JOQA 3OHXC 3DEPA 3OSOA 2KEEA 1SYBA 1PDXA 4V190 1PXUA 1F77A 4JK1C 1RJTA 1C4AA 3T51B 1EYCA 4IURA 2YU9B 3I72A 3AB5A 1JRPA 2A68C 1AEXA 1ZYRD 3L4PA 1PTOH 4XT3B 4KTAA 1F9QA 1QE6A 2OHFA 3NQTA 2EJGC 1ACCA 1AFPA 1FYCA 2F0DA 1IW7C 2KCCA 1I7HA 5HI1A 1CT1D 4U68A 2QDBA 4NDXA 1L4DB 1XCTL 2A74C 4KN7C 1SYFA 3BYTB 1H9MA 1QNUA 2ENBA 1XO3A 5K5PA 4NW2A 4H13C 3TP8A 1NCVA 2EVBA 5K36G 1SMYD 1RCVD 2PW9A 3L3OC 5JOBA 3EQLC 3OOCA 2MJDA 2D2CC 3GP7A 3DWQA 5DM63 3SR6A 2A69D 4DFAA 4RGTA 3GQBA 2Q5WD 4OZBA 3VYRA 1V43A 5DEHA 3J9CA 3I3CA 1Y1WB 2F3VA 3NHHA 4LJZC 1EWYC 2PW5A 3RZDB 1SMYC 1EU3A 1K52A 1G8ZD 3J80E 2E2IB 1EOTA 4OIKA 2LFIA 2GA4B 5ELBA 4DA2A 1ESFA 1C4QA 4QB4A 5C0XG 5EE3A 1C4PA 3K7AB 3KQ4A 1BMLC 1XYIA 3D8GA 2X6GA 3N6RA 3MWYW 3HOZB 2KACA 1QQRA 5KIXA 1WXQA 5ISRA 1ENCA 1KLGD 5TSSA 1FRDA 2FBWB 1OFFA 1ZXTA 4L8JA 5M5WB 2J42A 2L9HA 4ZKBB 3VR8B 1UAPA 2R92B 2Y5CA 3NTIA 3R3OA 1EY6A 3S1NB 2RPVA 2Y0SB 1HUMA 2ID0A 2LMCB 2F03A 2RDGA 2N9KA 1DOMA 1B9RA 2Y3AA 3U9SA 2OXPA 1OQRA 4B08A 1AYFA 5KEEA 1STBA 3A7AB 1MSGA 2WXIA 5KNCA 1XTCD 4RHSA 3DM1A 2KA7A 2NB0A 1DD2A 4KJNA 3T3OA 4DK1A 4LK1C 3V2TA 3KBGA 2F0WA 3IFDA 4L2YA 3W9CB 3CU7A 2RA4A 4RFBA 1AP0A 4F8MA 1UGJA 1TKWB 2J4XA 2B2VA 3P7JA 2JX5A 4KI0A 3MVVA 1KF6B 5J22A 1BQQT 3LB8C 1ESRA 4H7BA 2F0SA 1MI2A 5C6AA 3AEDB 3V05A 2JYOA 4K2LA 1CTMA 4LMQD 1EZ8A 3X3NA 3M4YA 3C1FA 3T56B 2WXOA 2D9UA 3RUZA 2A6ED 2WXHA 3I8ZA 1NR2A 2WQYB 2INPE 1FNVA 3ERQA 2DNEA 2WACA 1YN4A 2ONQA 1EU4A 1A2UA 4WWMA 1ZUD2 2FUG1 4L23A 3ABVB 3K5NA 1OXUA 4FP5D 3NQIA 1EY4A 1II3A 1CFMA 2BS4B 5AUIA 1STEA 3QOJA 1C76A 5CBAE 1ONLA 4C1NI 5FR3A 5EKLA 1L6UA 3I91A 1SSNA 5A2QE 4FNFA 3EFXD 3TP6A 2EELA 3DEOA 1FEHA 4N58A 5FOBB 2LY7A 2IX0A 1XLOA 3S1QB 1A3UA 1GXDC 4PQXA 2JA7B 4CJ0B 4X3TA 3MXUA 4Q0FA 3MTSA 2E6XA 5E4WC 1QT9A 5H8YE 1N60A 1NYRA 2VB2X 3QB3A 3PIO3 4J8QA 3SK5A 4G57A 3UI3A 1IL8A 2M9VA 1YNJD 3DHQA 3TMEA 3NVZA 1FXAA 5EE0A 4KY6A 1OO9B 1F9SA 3SVMA 3ZQ4A 4J3OD 3W5VB 3SDZA 5KNBA 2QCPX 3BVZA 4C1NK 3QG1A 5C0XH 4KKSA 3OIPA 3UI2A 1WCMB 1Y1VB 3FC4A 3K5OA 2PLPA 2G1EA 2B2UC 2F0MA 1VJKA 4IKGA 1BUIC 5JPNC 2IX3A 4KD3A 3E56A 2RSOA 2SOBA 4A3EB 2MEKA 4DXFA 4FXDA 2G9HD 3PUZA 3F2UA 5M5XB 4XDDA 2W82A 5HHDG 3P4RB 3HP3A 2WP9B 2QF7A 3TEXA 2F0TA 4ZLTF 2AQ2B 3DWGC 2H4OA 1E2WA 4RCOA 2JA5B 2L5TA 1VZ8A 5CV4A 3P1HA 1LTSD 3IT4B 3EUB2 3H0GB 1PGBA 4B0MA 2SAKA 1SJED 1XLQA 1WTPA 2IL8A 2BBCA 4PV1C 3FMCA 5CV6A 4JE3B 5H92C 3K57A 2A6EC 3DWAA 1GUGA 2IGDA 1UEAB 2F0GA 4XXEA 1H9SB 2A6HC 1VDVA 1N63A 1ZYRC 5IT9E 2KCNA 3GTQB 1EZ6A 1PLFA 4IZ8A 3M7NA 1STNA 1EM7A 1VZ7A 1PZID 1O78A 4F7XA 2GI9A 4IQZA 1U4MA 1QG7A 2VXWA 1QILA 3TSSA 1CQFA 2RVLA 1SNQA 2F0EA 4ID6A 1YQ4B 4MH8A 3H3VC 1B9NA 1U4RA 2K5WA 4MHEA 1UNSA 3I4MB 3VR9B 2ACZB 1TWHB 3KK7A 2JYEA 1QOAA 3A7LA 2VB3X 3V96A 1MHHE 2CJNA 3I70A 5IGDA 1YN3A 1KLUD 2HDLA 3W3AA 2L55A 1IGCA 3IXSA 2XVSA 3K5LA 2FE8A 4R8NA 2JXTA 1C8CA 3AEEB 4KHZA 4JWUC 4YT0B 1E7PB 1RHPA 5CR3A 4US8A 1FNUA 2HUGA 1YNJC 3K58A 4IALA 3B2FA 1YQ3B 1O80A 4XT1B 1G2TA 2M0AA 3FPUB 3VQIA 3AE2B 2WU2B 4HKZE 1Q90A 1XEEA 1TY2A 2N9LA 4RKBA 2QMTA 5C3JB 4ZUJA 4B9XA 1DXMA 1I4HA 2PW7A 2HDEA 3NBIA 1V1PA 1E6EB 2WB1B 2H89B 1L0YB 1CJEA 1H9KA 1I3QB 3FRPB 4FF3A 1ILPA 1FO4A 1ZXIA 1QOFA 4A3DB 2K05A 1HCZA 1M8AA 2OF1A 3QIAA 2D62A 1C48A 4FXGC 4US9A 1TS2A 5D65A 1B44D 4WQMA 1LTID 1YNND 1JICA 5LL6X 3AMZA 1XWEA 2PZWA 3PO0A 4ZRPA 4WFN3 1LT4D 1OXVA 3HVZA 4IOIE 4X3SA 1ENAA 4K6DA 1WD1A 3ZYYX 3EJIA 3AMUA 2I2YA 2WXMA 2E2DC 1SNMA 1BF4A 1JWMD 3TUOA 2EE1A 3P75A 4DN4M 2X6LA 2JA6B 1JE4A 2MHVA 1WTXA 3DWPA 3AB9A 5BYRA 3AE6B 3AE9B 1NR4A 1DONA 4ZUIA 2QSDA 3MXGA 3D4DA 4KKUA 5IIFA 1SBBB 1SF0A 3GO5A 4WAFA 1X3PA 3U9OA 1E0ZA 1ZDVA 1EY0A 4OVZA 2KMMA 4GZYC 2ICEC 3PV0A 1SNCA 4IUQA 2B2TC 2PZTA 4C56C 3GS2A 1PUTA 5I6YA 1D6EC 4EQNA 4GDKB 1NSNS 3D31A 2FFKB 1H9SA 5BMGA 2FMMA 1GUTA 4QIWB 3HOXB 4NAMA 1KTKA 3GTJB 3AEGB 3QOLA 4Z9CB 1MGSA 2H1EA 1IYUA 3J81E 2WAQB 4ZRZA 1AZQA 2IX1A 2F0NA 4HMJA 1L4ZB 1D5MC 1DM0B 1HA5A 3EROA 5AUKA 1EY9A 1PYWD 5MPOA 4RHRA 1B3AA 1DGJA 3MA2B 4HROA 2LEKA 2WXFA 3BK1A 4XWWA 1TT2A 4BA2I 3C8YA 2LKVA 1KRHA 3QO2A 3S17B 3ZJUA 2RQXA 4A6QA 1VR9A 1JR0D 2BYTA 4LLGM 4RGOS 1HQMC 1A70A 2JWUA 2ICIA 2AX5A 1B1ZA 1IHZA 2NVTB 4BBSB 4YTPB 4EQOA 3AEFB 3TP5A 2EPBA 4H2AA 3LXFA 2EY5A 1O7LA 3GD7A 2BA0A 2V3PA 1JROA 3H09A 4IN3A 4Q2JA 4I65A 3J7AF 4JWSC 4FYDA 2R3ZA 5E1FA 2B8GA 3Q22A 4HMIA 1DZ1A 2IWHA 2K5PA 5CYUA 2EYLA 2N55A 1N5XA 2KOLA 3KWLA 1G291 1JWAD 1LT5D 5C44B 1MSHA 2C9OA 2K5QA 1C78A 1TKYA 3FILB 3E0JA 3O13A 1DOYA 1F0ZA 2WXKA 3SE0A 4FXCA 3T4AC 1EL0A 1HA6A 4HSPA 3CIRB 2K6AA 2LHEA 4USAA 2HCIA 1BCPB 3D6CA 4FF1A 3AM9A 3PUVA 3VYUA 1ZEQX 1VZ6A 3H8HA 1GPXA 3IAYA 3NWTA 2J52A 1D5ZC 1TVXA 1PTOF 4R9WA 3FEWX 4OW0A 1R7SA 1ZKOA 3DWMA 4DAVA 1M4VA 4J1MA 5CV7A 2OT2A 1W6JA 4ZKCB 1B53A 2LUMA 1SNPA 2CU3A 2B8FA 2FJ2A 3GTPB 1HXYD 1Y56A 4MACA 4KX6B 1JB3A 1I4QA 4C3JG 3LWUA 1BCPC 2PNRC 2PKOA 3S1RB 4XTCS 3NSWA 4PMCA 2V4DA 5C2TB 3HKZB 4DNTB 2DYOA 3VRAB 1E2VA 4XDXA 2EZVA 2HTME 3WOEA 1STGA 3A8IE 2F4IA 4A3IB 2K04A 2WNMA 2HDMA 2WXLA 4MT5A 4ITKA 3PUXA 2AUJD 1Y69U 3HOUB 2WDVB 3Q8EA 2B39A 1QJOA 4P6VF 2HCCA 4ODGA 4S3SA 1HFGA 2ZW1A 1A6XA 1VCIA 2O4XA 1IBXB 1ZE3D 5FLXL 4OL7A 1C4CA 3LX0A 4FF2A 2KQ3A 4O42A 4N6EB 5JJZA 3PUYA 3D4RA 5EKIA 1JORA 2X38A 4RGNA 2B2YA 2Z8LA 4IUNA 1SJHD 1BO0A 1T5XD 3SR1A 2K03A 1JALA 1XF5L 2FHTA 3P4PB 1MVKA 1S5FD 3DMUA 4J6HA 1K51A 4EE2A 2L12A 5C3EB 5C4HA 3P4QB 3T13A 3S1MB 1T5EA 1DJRD 2KDMA 5KGUA 3N9YC 3WDNA 3OPOA 2F0LA 4M0WA 3G7LA 1FXIA 5C4ZA 2PCFB 2ZXOA 3MFGA 5EPLA 2QKIC 4K6LA 4ZQ3A 4R3DA 1MI0A 1K8OA 5FKAC 1HHVA 5BN4A 3VR2A 5I9OA 3QWNA 1JWBD 4DAYA 1V1OA 1BBXC 4G4KA 2K22A 5HFYA 5E6JA 1NUCA 4RGMA 1XCQL 2CW0D 4K5XA 3M3YB 1L5PA 3S14B 1MHXA 4HKQA 1T3QA 4M1UB 2N7JA 1TYGB 1GUSA 3J81L 3T3NA 1SNDA 4CKEA 3D3RA 1CA6A 4NAWB 5G3LF 1I4XA 2D5GA 2W3RA 1CZGA 1EY7A 1U4LA 3QJYA 1SEBD 2OEOA 2K7VA 1JCKB 5D3IB 4C80A 2B2WC 4OO1H 1FNWA 2K9XA 4QMGA 1SYEA 1PGAA 2W55A 1Q10A 3KWVA 3A8JE 2SNSA 5EQ0A 1TQOA 1TZOA 3D6WA 1GAQB 2C5CA 1E0BA 2QEJC 2XWJB 4IFDG 4OZAA 2DWQA 2KEDA 1TWGB 5M9OA 1F9PA 4EGVA 2BE5C 3I4NB 4LAAA 1S5ED 1CK1A 2JXMB 3I4LA 1QLBB 2N88A 3Q24A 3EGRA 2MJEA 1YN5A 4RNAA 2W54A 3VRBB 2NN6G 3WOFA 5KYLA 3VR3A 4FF4A 3NVVA 1YNTE 3BIID 3T16A 1WRIA 1PZJD 1TJEA 3E9SA 1FCCC 1SFOB 4XIGS 4AQ7A 2BB6A 2I46A 2SDFA 2KAJA 1FMAD 4KKJA 3E5SA 3C46A 2BDNA 2LS01 2NTSA 4XQJA 4C7YA 3BDCA 2XRSD 3G6JB 2Q8IB 1WTRA 1J8IA 4ILWA 3MC0B 5FK9C 1FM0D 2OEDA 4HEDA 1ML0D 3P1MA 3I57A 3FPPA 1SYDA 3OMGA 5LNK1 2B63B 3A8KE 4OHJA 4G7ZC 1T6BX 1VF5C 2VUMB 1C77A 1JW9D 1L6VA 2EYHA 2K33A 2AUKA 1L0VB 4KGSA 4WURA 4A55A 1FD7D 2B2UA 5D7GA 1QOHA 4IDIA 1S5DD 1F2ZA 2O5JC 2KHSA 2F3WA 1AWDA 3JAME 3I9V1 1Q1EA 5LHY1 3IT6B 2WINB 1NI3A 5DAUA 4YXDB 2E2JB 1RWSA 3S2DB 1DOKA 1A2TA 4YSZB 4IUVA 1G91A 2MUYA 3AEAB 4ME5A 3TZDA 5FO9B 4NKLA 4XQNA 1A3VA 5FO7B 1HRJA 4NP5A 4QUCA 4PNYA 2NVYB 4ZRQA 2RDHA 1N62A 3JAML 2R7ZB 1LTRD 3KF8A 5M3MB 3HRZC 2EYFA 2DNCA 3CRLC 5NUCA 3AE8B 1O7ZA 2B2VC 4L1BA 2TMPA 2LJIA 1Q12A 3RMHA 2NZ1D 1QOGA 5BMHA 3N52A 1I50B 3TN2A 3BYYB 3TZUA 4A3JB 3VYTA 5JEAG 1SDFA 4DXGA 5D3DA 4XE0A 2ON8A 1PMRA 4C3HG 2R6GA 1SYGA 3L9AX 3IFTA 1TU2B 5C3XA 4HTHA 3R93A 4KY7A 1JC7A 2NN6H 5IGGA 3B9JA 3V3XA 2EXZA 4HR7B 1EQTA 3BVMA 4XDCA 3LWEA 4HRSA 3BZDB 4TRDA 4V0BA 1GHKA 4TQUS 3GTLB 1F9RA 4CBVA 2DLBA 5IT9L 4Y7NB 1J7BA 1IBXA 3HRDD 1I4GA 1SIJA 1GUWA 3NVWA 2JP1A 1BUVT 3PZ7A 1D4BA 3P63A 1WSPA 3U4EG 1R9TB 4RF1A 1DOIA 2IDYA 2XSCA 3ZJVA 4A3KB 2YEPF 1PTOB 3W5UB 3IKJA 3W2DA 3SFEB 2WKCA 2PYKA 2BOSA 1Z47A 1OXXK 3E6ZX 2V3NA 1K83B 2LHDA 2L11A 3H91A 2EJFC 3BDOA 4BS9A 4TKOB 1EWCA 5C0XI 5C0XJ 1ET6A 1ILQA 3NE5B 1EIHA 2INNE 1ZPSA 5M3FB 1H9JA 2QJLA 2RBMA 3HGBA 1NVID 2Z4IA 3R2IA 1F2RC 5BN3A 4OO1G 4KY5A 4PMBA 5I4DA 1K50A 1IYVA 1ICWA 3DXJC 4K14A 1N5WA 4FVMA 5CV8A 4ULLA 2WXQA 1BDOA 2YEPB 2FINB 1Y8NB 1PFMA 4K5VA 1QCBD 3J7AV 4A3BB 1WTOA 1E10A 1FGBD 3VR4A 5A35A 3BK2A 3C1EA 3KLSA 3KLSX 4TQ1A 5KRUA 4CKCA 4WORA 2WU5B 2CJOA 3ZJTA 2PZUA 1HZ6A 1BCPF 1FRRA 4FXKC 5C5LA 3K5MA 1WTWA 1CZWA 2B2TA 2F0PA 3HZXA 3NBHA 3C2PA 2AWNA 4DGZA 1C9FA 4UDUC 3FILA 2L32A 4H0LC 4BA1I 3SXHA 3NUCA 4EQPA 2EYPA 4DQOC 1F2YA 1WGKA 1TS4A 2CVRA 5I2XA 4P2CB 1G6ZA 2KECA 2TSSA 1IKLA 1WTQA 1PRTF 1P7FA 3B2GA 3NVYA 1JQ4A 2L0CA 1DOXA 4C3HB 1PTOD 4HCEA 1JOKA 1S5CD 1IUEA 5I6WA 2KN4A 3LNNA 4ZAIA 4CJ1B 1STYA 2BS3B 2J53A 1I4RA 4P16A 3IAM1 2DN8A 4QUFA 4CHTB 1E9MA 2XN9C 1EFID 2EDGA 2VZKB 1LT3D 3KUPA 4EVOA 4R8IA 3AEBB 5EE9A 3HOWB 2JYTA 2M56B 2AQ3B 2NTTA 5FO8B 1PGXA 2NUCA 5C4XB 5F2DA 1OXTA 1QOBA 1VDZA 1K8MA 4HCSA 2I38A 4C3IB 1KAAA 4ZK9B 3NPPA 1I6VC 3RPFC 1F2RI 1RF2D 2EYOA 3AH7A 5CGKA 2L4NA 2LGIA 3HOYB 3HG9A 4JBWA 3AE1B 2WXNA 1V97A 2F0QA 1RODA 3MHBA 4F87A 2K1BA 1CM9A 2NYZD 3ND9A 1ZDXA 1ZXHA 1CA5A 1LACA 3A55A 1TWAB 3PO2B 3I90A 3AE7B 4YSXB 1RKNA 2JZPA 2NVQB 4XYOA 3SFDB 3J7YW 2FMCA 3TDQA 2DBYA 4GDLB 1GOZA 1JQYD 2QILA 5T1IA 3DUZA 1SB3C 2A68D 4BY1B 2JE6I 1AW7A 3Q0AA 2PVOD 1C79A 3T53B 4HEA1 2IJ0A 3K0YA 1ZP0B 1KDAA 1RD9D 3J80L 4NJCA 1A3TA 3A56A 3NTKA 1NAPA 4QCLA 4L6TB 1QKZA 4RA8A 4DU9A 2BS2B 3Q8FA 1GB1A 1TS3A 1J7CA 4RH6A 3MEHA 2RSNA 2GRIA 2N0SB 2NWGA 3PMFA 1NENB 2K0PA 1XLNA 3CKIB 1FFUA 2IT1A 1H9RA 5JAVA 3CQZB 1STAA 3K59A 2CQAA 2E75C 1PTOC 2K28A 2K01A 2M00A 4O1NA 1SAPA 3NXWA 5D14A 5EKKA 2BE5D 2JU6X 4ZOHC 1MPEA 3NP8A 2MH7A 3GTGB 5CBEE 4CKBA 4K8JA 4F88A 1P7EA 4KN4C 3WCQA 1X3QA 1B9MA 3M7GA 1ENFA 1TWFB 3IAS1 1SE2A 3AV8A 2ZW0A 3SEBA 1EEFD 4L63B 1OQQA 3S16B 1IGDA 4G7OC 1DYQA 1RDPD 3FKIB 4KD4A 1ROEA 2E76C 2IGHA 3RD4A 3R8BA 4X3KA 5BN5A 3Q23A 4A8XC 3MJ5A 3S15B 1GUNA 5JEAJ 3PUWA 2HQEA 4ZHPA 3U52E 3P20A 3GTKB 5G5HA 2BCOA 3EVQA 2EYJA 1I6HB 1Q8IA 1NEKB 1J7AA 3RLFA 1MD2D 1EWHA 1O7YA 3R2TA 1SNOA 1YNNC 3PIP3 2MGSA 1ZOYB 3FAHA 2PIAA 4DK0A 3MXPA 3S2HB 5IGEA 1RYJA 4WJWA 2A5HA 4OZCA 4HAEA 3NRZA 1TS5A 2KJXA 2B2WA 4N9PA 2IW3A 1EY5A 4H44C 1LTAD 1TY0A 1VRAB 2JA8B 3EA6A 1JMLA 1CI3M 4C2MB 2V0GA 4K2KA 4DAPA 2SNMA 4RCNA 1KDCA 4KJOA 3FDTA 4K8IA 4JX1C 1Y8OB 2JSVX 1SYCA 4X3UA 1PRTD 1Z7TA 3RFZB 2CW0C 3HOVB 2JEAI 2NBFA 1TIID 3MZ5A 1PFDA 1GUOA 1EYAA 1Y8PB 3P4SB 5J39A 2BTEA 5HGTA 2EOTA 4CJ2C 1FIQA 1D2BA 1YJJA 1PZKD 1CHQD 3KBXA 1VLBA 2W3SA 1EIGA 3C3LA 4IUTA 2SEBD 2PMZB 5CMDA 1VMCA 1YMHE 2GB1A 4A9AA 4YIJA 4KKTA 3Q6SA 1WVLA 1U4PA 1JWUD 2Z1CA 1EEID 3D4WA 1PRTC 1WWTA 3OWFA 2K32A 4CQNA 2LFNA 3Q8CA 1FR3A 1SE4A 5KYIA 3SK8A 5ELDA 4A93B 4OGQC 1QWYA 2KWDA 2E2HB 4A3MB 2KQ4X 4RKLA 3VR6A 5IODA 1TWCB 1HTLD 1V8QA 3TEWA 1R4PB 2WP8J 2F0JA 4WRDA 2O2LD 3OIQA 1AN8A 1D5XC 3GV6A 2VNUD 4ABNA 2WIIB 5G5GA 2BDOA 1F2LA 2NN6I 2K3UA 4C3IG 1B4OA 4E6IA 4U673 1HZ5A 2F0OA 3LYYA 3CHBD 3BWUD 2WS3B 2F0UA 3AN1A 2JSOA 2PVGC 3TEZA 1B2T