1M4VA

Crystal structure of set3, a superantigen-like protein from staphylococcus aureus
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
200
structure length
196
Chain Sequence
AKYENVTKDIFDLRDYYSGASKELKNVTGYRYSKGGKHYLIFDKHQKFTRIQIFGKDIERLKTRKNPGLDIFVVKEAETVFSYGGVTKKNQGAYYDYLNAPKFVIKKEVDAGVYTHVKRHYIYKEEVSLKELDFKLRQYLIQNFDLYKKFPKDSKIKVIMKDGGYYTFELNKKLQPHRMSDVIDGRNIEKMEANIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The three-dimensional structure of a superantigen-like protein, SET3, from a pathogenicity island of the Staphylococcus aureus genome
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Immune system
molecule keywords SET3, superantigen-like protein
total genus 54
structure length 196
sequence length 200
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
A PF09199 SSL_OB Staphylococcal superantigen-like OB-fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1m4vA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1m4vA01
4RGTA 1SE4A 1JCKB 2QEJC 1DJRD 1SEBD 2WV6D 5ELEA 4DXGA 2TSSA 1SE3A 3BVMA 1PTOH 5ELCA 1LT6D 1XXGA 1KTKA 1L0YB 1PTOB 1ESFA 1YN5A 4C56C 1PZID 5I4DA 1CHQD 1G8ZD 4UDUC 3KLSX 1HQRD 3BYTB 4RGMA 3BVGA 1S5BD 5ELFA 1LTAD 1TY2A 5D3IB 4TSSA 2NTTA 4L63B 1B1ZA 2RDGA 1BXTA 2AQ3B 1LT5D 2NTSA 1I4HA 4O1NA 2ICIA 5FKAC 3SEBA 1EU3A 1V1PB 1LTSD 4K6LA 4RHSA 1FNUA 1S5CD 2XRSD 1MD2D 1RCVD 1GOZA 1V1OA 1SE2A 2RDHA 1D5MC 1B44D 2J4XA 3MC0B 4RGOS 4BWGB 1ET9A 1YN4A 2AQ1B 1RF2D 1PTOD 4RH6A 1BCPC 1PRTB 1AN8A 1PZJD 1FNWA 4RGNA 1JWMD 4OHJA 2IPKD 1BCPB 1LT4D 1LLRD 3OWEB 1CT1D 5ELBA 1HA5A 2O2LD 1RDPD 4DXFA 1LTGD 1QILA 1SBBB 2XNAC 3DWQA 1PRTF 1JQYD 1TS2A 2IJ0A 3R8BA 3TSSA 3DWAA 1FGBD 1T5XD 1D5ZC 1BCPF 1F77A 1LTRD 1PZKD 1I4QA 2CHBD 2Z8LA 1SXTA 2AQ2B 1I4RA 1LTBD 1RD9D 1TS3A 3URYA 1CQVA 1LTTD 1PRTC 1TS4A 3O13A 1EFID 2QILA 4RHRA 1SJED 2G9HD 5ELDA 1LTID 1TS5A 1TY0A 3R2TA 1YN3A 1PTOC 1EU4A 3EFXD 3CHBD 3DWPA 4L6TB 2R61A 1LO5D 2XN9C 1FNVA 1V1PA 3W2DA 4ZYSA 3R2IA 2XRQD 1JR0D 1EEFD 1CK1A 1XTCD 5TSSA 4Z9CB 1D6EC 3BZDB 1ET6A 1AW7A 1EEID 3V05A 1D5XC 1UUPA 2SEBD 4RFBA 1I4GA 5FK9C 1M4VA 1PRTD 5D3DA 1KLUD 1EWCA 3EA6A 1STEA 3BVZA 1SJHD 1ENFA 1L0XB 4RCOA 1HTLD 1S5FD 1S5DD 3MFGA 1JWUD 3BYYB 1CHPD 1FD7D 1KLGD 4NZLB 1LT3D 1BCPD 1DYQA 1S5ED 1UNSA 1I4XA 1PTOF 3GP7A 1PYWD 1I4PA 1JWSD 1HXYD
chains in the Genus database with same CATH superfamily
2C9WB 4ME5A 1F2YA 3A8IE 3TEZA 2K5VA 3I4NB 1DJRD 2XEWA 2V3SA 5GADC 5IWAL 5EPJA 4WORA 3S14B 1V97A 1MGSA 1N5WA 1S4ZA 4KLKA 1WGRA 4B3TL 3BVMA 2KO3A 5BR8Q 2Y0SG 3P63A 4A3JH 2Z9HA 3OW2A 5BN4A 4DUZL 1PFDA 2KDFB 1PH6A 1CHQD 1CI3M 1YHAA 3KLSX 4QF4A 1R7SA 1V86A 2LGDA 4M8MA 4C2MB 2N7DA 5JVG3 2ZCCA 4Y7NB 1WGKA 4M02A 1VQIA 1UEBA 2V1CC 4WJOA 2CS4A 2EXDA 4L63B 1F9PA 2NN6H 4FVMA 2ZPNA 3W5UB 3K81C 1G51A 1OQQA 1U4RA 2LY7A 2NTSA 1Y1WH 5JOBA 4HKQA 3M7GA 1UH6A 3OTOQ 2BS2B 3AI5A 3U52E 5C4XG 1X3PA 2D9UA 3AEAB 2BWFA 3AE2B 1BBWA 5IP7G 3U9OA 1NNXA 3NS8A 4A9AA 2KHJA 1UWXA 4HCSA 2H89B 4FJVB 4A3JB 1B44D 1LACA 1TWFB 2J4XA 4DN4M 1A2TA 2BQQA 2MHVA 3NS1A 3ZQ4A 4XYQA 4ULLA 5JPMC 1Z7TA 4A3BG 1I94L 1KRHA 1WGYA 1AN8A 1TWGB 2EYOA 1M1KC 3RLOA 5KNCA 1GVPA 1JWMD 5E1FA 5IYBH 3N1YC 4GN3B 1HJPA 2ZW0A 1CM9A 2JQOA 3E9HA 3W1GA 2K14A 5C44H 2HTME 4JI2L 3OAWA 3HG9A 1VQ4A 2KN4A 1WYDA 5KIXA 4TKNA 1G6JA 5JXVA 3RNCC 5G3LF 3P1MA 4K14A 1XMOL 4PT5A 1NI2A 5DM73 4W9JA 4W9CA 3PHXB 3IFDA 3M62B 2DENB 2CHBD 3AYHB 2BA0A 5MPOA 3Q6SA 5NUCA 3PO3H 4JI7Q 2KQ3A 2E2JB 2KX3A 2KWCA 4R4QA 1ISNA 3GTGB 1PQSA 1EFID 1Y56A 4BY1H 3HVDA 2RD0A 3RD2A 5KNBA 2NBVB 4BBRB 5ELDA 5E6OA 1TIID 2EXZA 1AZPA 1I50B 2JN4A 2W3RA 5EQ0A 5FOBB 3RNFC 2AMCB 2WXRA 4NMZA 4MSQB 3TP8A 4DV1L 3TREA 2OOBB 4X57B 1SYFA 2B2YC 3QJYA 2KVRA 1WOCA 2B2TC 1F1HA 2QEXA 3HOWG 1A70A 2BYEA 4Z9CB 2BH2A 1D6EC 1VF5C 3BZDB 1TKWB 4POFA 2VXWA 1UUPA 2MP2A 1E1OA 2VZAA 2SNMA 1EL0A 1YNND 4POGA 4M1UB 1K28A 4UP8A 3TMEA 1G2TA 2IY0B 3PIOA 2QCPX 5GMVA 4XDDA 1N8RC 3V3XA 1EY7A 2K04A 1WRDB 2FCQA 3KWLA 3HKZB 2IO1B 2L55A 1E10A 1XMQQ 1WI0A 1IZ6A 1S5FD 5EBCA 4A3JG 3GTMH 1GXDC 2GI9A 2N4FA 4F8MA 3ZJUA 1LT3D 3T3OA 2VY3A 4A3BB 1IYVA 1SYDA 2A19A 2EYLA 4DV3Q 3D32A 3RZOH 4K2KA 1STHA 1LTLA 3JAMc 1GG3A 2BB6A 2UYZB 3HHMA 1T5EA 3VR9B 5G3LD 4BKTA 3H7SA 2K5HA 3DUZA 2M17A 1IBXA 4A76A 2ATWA 1KIXA 1EO6A 1W2BA 3TP5A 2K28A 2IBIB 1TWCB 2DYMA 1EQTA 2R7ZH 2M2LA 1J7CA 1PTOB 3HM3A 5AZGA 4A55A 1WSPA 1LQBA 5IA7A 4WJPA 3T8MA 1ZPSA 5BYRA 5ELNA 3A9KB 3HZXA 4WAAA 5IOIA 2MO1A 4JWSC 1SFOB 5AZFA 3VTWA 2B3AA 4MH8A 2F0SA 3D4DA 3NELA 2WX0A 2Z6KC 3UDXA 4UHVA 4YXDB 2R7DA 2O6VA 2NZHA 1DGJA 2JZPA 1RM6C 4HPPA 3DBHI 3L2PA 3PO2G 5LMUQ 1OTCA 2KXJA 4PYUA 2I2YA 4IN3A 2L32A 3Q3FA 3TEYA 1P8LA 2KUMA 1S5CD 2MBBB 4W9HA 1B53A 1RCVD 3K7UC 2NPTA 2E2IH 1VZ8A 3B1LX 1NCVA 3ML9A 4ZAIA 4DFAA 5CC4A 3A0JA 2DWQA 2HE7A 2R2QA 4HJ5A 5CORA 4FO2A 4APVA 2C5LC 4LCDE 1Y8NB 2DYOA 1BUVT 1PZJD 1FNWA 5CMDA 2CJNA 1WXMA 2KCTA 3M9BA 2OHFA 1TWAH 4JBKA 4GN1A 1EIFA 5IT9E 2JQRB 1E8YA 1AFPA 2DZMA 2M00A 3W9CB 4CJ2C 2KQ7A 2WNMA 3ERSX 4NB3A 5J22A 1STYA 2KJHB 3DM1A 5CHFA 2BGFA 2E2HH 3I4MH 4KY7A 1GKHA 1QILA 2JF5A 4IFDI 3Q8EA 2KT7A 2XIWA 1A3VA 3P4RB 2M8SA 4DR1Q 2UXBL 1PYSB 2W55A 4K8IA 3UE0A 3HOUB 3A5ZB 1VZ7A 4KGSA 2X69A 2VUMG 3DHQA 2K33A 2WAQE 4KX6B 1WJUA 2KTRB 3URYA 3OSOA 4XTCS 4A3KH 2IDYA 3L16A 1F52A 2KDEB 4EGVA 4K7WA 2QILA 4C3IB 2D0OA 1ROEA 2MBOA 2JRHA 3GE8C 3K5OA 1JW9D 2AEHA 1BBXC 4P71A 2JVCA 3IBEA 2LGIA 3K59A 1SYGA 3MVVA 1VQLA 4IUVA 5GQOA 1XPOA 3P20A 2XGTA 3W3AA 4GN4B 2IGHA 2N9EB 1A5RA 2RBMA 2O5JC 4LDTD 3NUCA 3B6YA 2WP9B 2KA7A 4IJLA 1UEAB 2RVLA 1RODA 2B63G 2OF1A 2B63H 4PNYA 4K3CA 1ZKOA 4OL7A 4FXKC 4JI5L 2ENBA 2N9PC 3CCUA 1EIHA 1I6HH 1WGDA 5LMNW 4HRSA 3ECIA 5HGTA 2C60A 2WWZA 2UUBQ 1KL9A 3MXGA 3RNBC 2Z0DB 1HZCA 3J7YW 4YT0B 2LRWA 3BYYB 1MJDA 3LYYA 1SIFA 4XQNA 2BW2A 5HGQA 1YMHE 3KLRA 3EBEA 4DAPA 4A3KB 4LDTB 3K5LA 4OWTB 5JVH3 1CZWA 4R1JA 4WH4A 3L08A 1JCKB 4KHPQ 5FLXc 4KDIC 3UGBB 1FCLA 2WXJA 2C35B 1QOHA 1XNRQ 2KKCA 3P4QB 1PTOH 5ELCA 3KJPA 1LT6D 1ENCA 4LJZC 4EEWA 3U9SA 5I4DA 2B2VC 3AU5A 3LJ3A 3M7NA 4A3DG 2PW5A 1BVSA 4K5WA 1S5BD 5EDSA 1WTRA 2VUMB 2INNE 4LUZA 4DF7A 3AECB 1Z2MA 3NBHA 1BR9A 2NTTA 2IL8A 3I4NH 4LF9L 1WMHB 2E76C 1HH2P 3TN2A 4HROA 3Q8DA 5HY6A 2ZJDA 3NY5A 4WJ3M 4P2CB 5C23A 5LXHA 1EU3A 5T1IA 5M5WB 1XPUA 2PYKA 2KJ6A 5DM63 4DR2L 1P9DU 4XXEA 3WOFA 4LF7L 1F9RA 2DBYA 4NJCA 3VR8B 4C3JB 2OTJA 2AUKA 3GTQB 2FIDA 3LNNA 2J0KA 1EYGA 3STBD 2K32A 4RF1A 2CH4W 5A2QE 1FRRA 3JAME 1PGBA 4A93B 2PNHA 1PTOD 3S17B 1X1MA 4B0MA 1WCMG 2BCOA 4YSZB 5IOCA 5DNFA 4W9IA 1KOTA 4AIMA 1FO4A 4K1RB 3DPDA 5C0XH 1FPYA 4F7XA 3HOXG 1KFYB 3HUIA 4C3IH 4P72A 2KMCA 2INCC 4DR5L 5C2TB 4GZYC 2JA5G 3H0GH 3M3JA 1K52A 3CF6E 2IJ0A 3VYUA 3J80L 3TSSA 3DHHC 4DU9A 3PS6A 1MVKA 4DV0L 1Y8RC 2VUMH 1JT8A 4LNKA 4LFCQ 2NPTB 3I73A 4GNXB 5HFYA 1Q0WB 1ML0D 5JEAH 4BA2I 5LMUL 2EPBA 2EKEC 3IAS1 4KJNA 3IVFA 1STBA 4RHRA 2IWHA 3ENEA 4GDLB 4MEMA 2W3SA 1SB3C 2KLGA 2NCNA 5LLIA 3U4ZA 3ZJVA 4MT5A 1Y69U 2NN6G 4C4VB 4L2YA 5FO7B 4HVBA 2IX3A 4DV0Q 4M0WB 1E8ZA 1EU4A 1KDCA 3EFXD 3R66C 2LGXA 4BA1I 2ONQA 1A0IA 3NHEB 3P75A 1SR3A 1X3GA 2EYFA 4DPGA 1GC6A 4ASWC 3AM9A 1PFNA 2JXMB 2GOWA 5FR3A 3CMMB 4URKA 1GPXA 1BDOA 1FFVA 4JI4Q 1P1AA 4DDGD 4XT3B 1EEID 1FCCC 4DK1A 1OO9B 2N9LA 4RFBA 5CV5A 5D94A 1QE6A 4IUUA 3RFZB 5FK9C 1UGMA 3A5UA 1KLUD 1JMCA 1EWCA 4NDXA 2CW0C 1PH7A 4BXXH 2DY7A 2MH7A 3S16H 3AB9A 1TGZB 4XDXA 3BVZA 1J7BA 4CKCA 2IHEA 2KAJA 3TMPB 2IO3B 4B9XA 2KACA 1QKZA 4F87A 1GM5A 3MTSA 4F88A 3QWNA 3R93A 2I5MX 4W9DA 5KYIA 1YI2A 3IL8A 3ZLZA 4D2KA 1PTOF 1U4PA 1PHJA 1PYWD 4C1NK 5IGFA 1QT9A 3NENA 1ZP0B 1EFWA 2KVMA 4F7ZA 3AV8A 2F0DA 4XC2A 4K6DA 1UF0A 4IUMB 4ZRIA 4ZOHC 4OIKA 1KNAA 2NMQA 1NYQA 2L11A 2PZUA 1XPRA 3IAYA 3BZCA 1WY8A 2D3BA 4W9FA 2EJFC 1TWFH 2B76B 4RMAA 2EMSA 4FF2A 4JQWC 3BVGA 1V9JA 1JOQA 2Q2TA 2JA6B 2HCIA 2EYJA 3FMCA 1U0LA 3RR5A 2HHHL 5IYBG 3GQBA 5J3BA 4PS3A 2I0QA 3AQQA 3MEHA 3ND8A 5BYQA 4DHJD 4UY8C 1A63A 3TUOA 1DOYA 1C4QA 1ZOYB 3VUWA 4CGYB 2E6XA 1Q7YC 1N9WA 3K80C 1MD2D 2PZWA 3GTQH 1KM7A 1V8QA 1YJIA 2HJ8A 1Q86C 2RDHA 4XYOA 4JI6Q 4LF4L 3EECA 3IXSA 1JB3A 2WP8J 4IZ8A 1HE8A 5HHDG 3ZNID 2AQ1B 3VR4A 4FJYA 1ZXTA 5M3FH 1WR1A 3SK6A 2IGDA 4Q0FA 1K51A 1JALA 1U4LA 4X62Q 2JXTA 3TBLD 2KX0A 3KUZA 3RZDB 1IW7D 2KWUB 3CMEA 5M9OA 4KV2A 1MJEA 4LJPB 5C4ZA 1D3ZA 5I9OA 2K6DB 2GBJA 2XK5B 1WE6A 1JWBD 1NYRA 1AE3A 2A1AA 3DWQA 3QIAA 4MM3A 3DBRB 3RZFA 3HOVB 1DZ1A 1WX7A 2F0UA 4JI4L 2C7NB 2P5ZX 3GB1A 1TXYA 1UWMA 4HJAA 1BNZA 4A3GB 2B2WA 3J80i 4DBGA 1EWHA 3OHXC 1B9MA 5DPTA 3FPPA 3W1SC 4OO1G 5JEAG 1TT5B 5JJKA 3L4PA 1EYCA 1WXSA 4OW0A 3M4QA 3GO5A 3CXCA 4JBWA 4A3FH 1FM0D 2AWOA 1SLJA 3L7ZC 3ICEA 1Q82C 4XDCA 1SJED 1YD8U 2N1VA 2LS01 1WJ4A 4HKZE 5CBAE 4XWTA 1VQOA 3MXUA 3LGJA 2R7FA 3NOBA 2F0MA 2YEPF 1QUQB 4I7AA 5LL6S 2WXNA 3BINA 4R3DA 2V3NA 3T9LA 4HIKA 3Q23A 2ZW1A 4EFOA 4ZYSA 2H88B 4LNOA 1IXRA 2XRQD 4HEA1 3A9JA 4X66Q 4DR4Q 2QSDA 1OXTA 4H2AA 1ET6A 4TVAB 1AW7A 5IWAQ 5K36G 4WWOA 5E7NA 3ZTCA 1EZ6A 2K8BA 4AS1A 3A56A 3N32A 4YL8A 3CPFA 5CV7A 3EA6A 4YCUA 4AJWA 1V5OA 3NZUA 4NQKE 3J81E 2EY6A 2NZ1D 4DWFA 4E6IA 3N9YC 1X3FA 4MZ9A 4B3RQ 4GLSC 5L37A 1PA6A 5EJWA 4IM3A 5C5MA 3T56B 1SIJA 1CKMA 1J9OA 1NE3A 4JI8Q 4TQUS 2E2JH 1PDXA 2BDNA 4RKLA 3H91A 1YQ3B 2L5TA 1N32L 4HN7A 2QDBA 2PEAA 2K52A 3X0WA 1HXYD 4HEDA 4YY3Q 3AEVA 4OO1I 4LF7Q 4ZRZA 4NXNL 5CV9A 3S14H 2WV6D 4I7ZC 1W6JA 1I6HB 3RULA 2WXKA 3GTGH 5KHQA 3A54A 5EPKA 1VQFA 1CQFA 2LJ5A 1IBMQ 3MXNA 1UE6A 2A73B 2D5DA 3KJOA 1F9JA 3G71A 3U8ZA 1KDBA 2Z4HA 2RDBC 3TIXA 1VQPA 3CC2A 1SNMA 3JYUA 2LUMA 3P4PB 3HOWB 2XK5A 1KD1C 1Y1VB 3PMFA 1MKHA 1WTVA 1X3QA 5KNDA 1R9TB 2WDRB 3FRPB 3SHLA 4HAEA 1DD2A 3K0YA 5JH5C 1G291 3H7PB 1SMYC 2NUCA 3OMCA 3KF6B 4O1NA 1TJEA 2PE9A 4UAIA 4FHJA 2XRSD 2EJGC 4MNOA 1BQQT 4KGRA 2UXBQ 4MGKE 1V1OA 4PZ8A 3BIID 5H8YE 1IYJB 2FMMA 2MX2A 2I38A 2QKIC 3OOCA 1CZGA 3VR2A 3Q8BA 4KJOA 4XWWA 4RH6A 4A3GH 2GB1A 3DHGC 4K5XA 3CU7A 4LF5L 5EAYA 3HOZG 1VQKA 2WGSA 1P16A 1VRAB 3R7QA 1A62A 1UE7A 5KHOA 3TDQA 3LWEA 1SGHA 4HMJA 4MHEA 4LAAA 2K5PA 3TBIB 5C6AA 2DZJA 2WDQB 1LTGD 1VQAA 3WCQA 3H94A 1WX9A 1TS2A 3FVQA 4DR6Q 1FXTB 1VMCA 1EQRA 1GUWA 4RF0A 1N60A 2JZ3B 1S3SG 5HG2A 1LTRD 1PZKD 1I4RA 4M00A 3VDZA 1XJVA 1UE5A 1ZE3D 4OZCA 1Y14B 1V2YA 3O13A 4DV2Q 2WX1A 2UWQA 1EY6A 1ZDXA 4K81A 3RN9C 1X3EA 1VQ7A 4FF3A 4ZHOA 3KDFB 3K5MA 3DBLB 1TS5A 1K9MC 3N20C 4X65L 1SNOA 3RYTA 3VFKA 1L1OB 1TT2A 3HOVG 2HDLA 1GC7A 3HP3A 3BDCA 3W1BA 1I94Q 3KF6A 2J53A 4K7UA 4DHZE 3NZ3A 1N33Q 4CYEA 1I5FA 2ICEC 1GJZA 4OEMB 1PH5A 3FEWX 2UUAQ 1N6ZA 3Q14C 4B3SL 2SEBD 4LF8L 2D3AA 2VL6A 1H9SA 2WACA 4P73A 2L7RA 3PLUA 4DHZB 2KCMA 4OXPA 5KYLA 1FR3A 4JI8L 3D4WA 3HEJA 1PH3A 1W3SA 1V8CA 5L83A 2L4NA 3PCOB 1OEYJ 2NBUA 2N55A 3HK0A 2KEDA 4NXNQ 1E7ZA 1KNEA 3MXNB 4DV7Q 2A74C 3ULPA 3ER0A 3M85A 2WKDA 3WALA 4CO7A 1ENFA 1L0XB 1K8AC 4OWXB 2F0JA 5M3MH 2NN6I 3HKZE 4EQNA 3H0GG 3S1QB 4QMGA 4LF4Q 2O5IC 4NJ6A 4W9EA 1YNJC 3A55A 2K4KA 3K8AA 3CC4A 4ARCA 2ZT9C 2F03A 2K1FA 3HOZB 3VVWB 4DHJB 1VQCA 1R9TH 2KCNA 3AEEB 2RPVA 4V190 2MGSA 1C48A 1MG8A 4LFAQ 4ANVA 1WTHA 5M5WH 4IO9A 3ERQA 1JOKA 2IYDB 3V62A 1WZ0A 2YU9B 2XWJB 4JI5Q 3H3VC 2K6QA 1WM3A 2K1BA 1SNCA 2D0PA 4JBJA 2WXGA 3TJPA 3ZXVA 5AEKB 2V4DA 3A33B 4OO1H 1PV4A 4IJHA 2K7VA 1WF9A 1YNTE 3BYTB 2DZKA 3TL5A 1K8RB 2IY5B 2AL3A 1CSQA 3ZVVA 5C4JB 3CCVA 2B29A 1LTAD 2RSNA 3K7AB 3QOJA 1PFBA 1J5EQ 2YTYA 1SMYD 2ZTEA 4DR5Q 2KC1A 1LT5D 3VR3A 4UP7A 1QOGA 3J81c 4BAXA 4WJ4A 2ICIA 1WXAA 3KYDD 3DHIC 1V1PB 2NWGA 2LVPA 4K6LA 1CKOA 1JRUA 1QUQA 2EELA 2M19A 1D5MC 4YTPB 2A5UA 3T13A 5IT9c 2KC2A 1V9PA 4JWUC 3HKSA 4S17A 2KANA 3VRBB 2KEEA 3NJTA 1STAA 4IPGA 3NP8A 3TS0A 2N3SA 4A3EH 1KC8C 3BWUD 1C76A 2Q8RE 1HR0Q 2CVRA 2M4NA 1E1TA 1YHBA 2PQEA 1O78A 2GVAA 2A4ZA 2B2TA 2F3WA 3MTNB 1HA5A 3MP9A 1Q12A 1WTWA 2JA5H 3F2CA 5C4XB 1XCTL 1MBYA 3ZW3A 1E2ZA 5CBEE 3F8TA 1BCPF 3S2DB 3I56A 1I4QA 1SXTA 4MN3A 2V4IB 2YEPB 1T0RC 2JZZA 3AEBB 5A35A 4JV5L 4YWGG 2R92B 4LNIA 4NJ7A 5IYCG 2OCEA 3D4RA 4A3IG 4S0RA 1KHIA 2ASQA 2UUBL 4NAWA 3RUIB 1TKGA 2ZZPB 1FJGL 3AE9B 4CHKA 2PLPA 4LFCL 4IPDA 4NP5A 4A3MB 2NVTH 3M3YB 1SE9A 2KDMA 4R8IA 4BBSG 3WA0A 2LXAA 1AARA 2DNCA 3TZDA 5DEHA 3QB3A 3FILA 4B08A 1R4MB 1YIWA 4JPBW 5FR6A 1MSGA 1D8LA 4TQ1A 3S24A 1JRPA 3N3KB 1D5XC 1II3A 3NK9A 2V1YA 1P7FA 3X23A 5DLQE 1SAPA 4QIWE 1A6XA 2W9NA 1I4GA 1K50A 1MIUA 1VJKA 3QARA 1WD1A 2GA4B 3EJIA 3PHWB 3HOXB 1EM7A 2I1JA 3MHSD 1EQQA 1LABA 3CCLA 2K22A 2PI2E 4LW1A 1E22A 4J6IA 2DJFC 1QZHA 3UQAA 1HZ5A 2MQHA 5M3MG 1YOVB 3C3LA 2KHSA 5IY0A 4EOYA 5DCNA 3F2UA 3PUVA 3G48A 4OIJA 4JI0L 1DYQA 1S5ED 3QR8A 4HR7B 2UXCQ 2MLBA 1B4OA 3SR6A 3RN2A 2MBHA 5EPLA 1ENAA 2JA8G 1I4PA 4O2DA 1ZUD2 4WJQA 2BE5C 4BKSA 4JLCA 2GN5A 5I9PA 4DA2A 2E5LQ 1EUVB 1FGUA 2JYTA 2VH1A 4X3TA 2N1WA 1SE3A 4LF9Q 4JI6L 5IP7H 1FXAA 2GLSA 2WXFA 4LNNA 3RMKC 1YNJD 1RJTA 3Q3MC 4Y52H 3PSEB 1RHPA 1B9RA 4HCNB 5I6YA 5D2MB 1W6KA 3C1EA 1XMQL 3SDZA 1Y1WB 3I4OA 3X3NA 1XLPA 4TSSA 2MJDA 1WIAA 2KOLA 3I72A 4GDKA 2WXMA 4A3IB 5C3WA 3P7JA 4XYCA 4K2LA 5JZEB 5EKLA 5JHBA 1JC7A 1LTSD 3GTPH 3BK2A 3S1RB 1QF6A 4RHSA 1FNUA 5ELOA 2ZJRA 3S16B 3OLMD 1NVID 2K0PA 1KQSA 3RPFC 1YNXA 2MO0A 4X64Q 1I7HA 2WB1B 1NR4A 4QQBX 2YTXA 5BN5A 1ET9A 4DUZQ 1JOOA 1RTNA 1RF2D 2B39A 2CQOA 1WTOA 4LUVA 5C44B 5GROA 4WQOB 1H9SB 2QHOA 3W5OA 5C4XH 3I3TB 4FHKA 1LM0A 4KY6A 1M94A 2MA9B 2NYZD 3CCMA 1AP0A 3VYTA 2JA7H 2SDFA 4DAMA 1VQGA 4JOIA 4YCVA 2N0SB 1KAWA 2A69D 1JQYD 1PRTF 4A3CH 1OFFA 3R8BA 3SXHA 2FUG1 4FP5D 3APFA 3S2DH 4WIPA 2BWES 2I46A 3QWZB 2BYTA 4W9KA 1YHQA 3W5VB 1PYBA 1H9KA 1RD9D 5IGCA 1O7ZA 3CD6A 1PRTC 1SNQA 2CU1A 3EQLC 1JWAD 4NY0A 1B2TA 4DGZA 1HZAA 4PS7A 4AJYB 4DR2Q 3W1SA 1J8CA 2G9HD 2PIAA 1LTID 2G4DB 4KDLB 2FAZA 1SN8A 3ND9A 5HI1A 2R7ZG 3Q24A 1HFGA 3EN2A 3CHBD 4EUTA 5IGGA 4G7ZC 4R4IA 3VAWA 4S3SA 3R3OA 1V1PA 2EIFA 2E2HB 2YYZA 1JR0D 1EEFD 3NVVA 4HJ9A 3HOUG 1E2WA 5EBDA 4YY3L 3FAHA 3E0JA 2NBFA 1FD6A 1G91A 3A8KE 3E5SA 3IKJA 2OEOA 2L12A 3GTLH 2JJQA 3CRKC 2MBQA 4ZRKA 2IW3A 4XGAB 2K5DA 2YLMA 2Y5PA 4ZHPA 3NEMA 1H95A 1PDQA 4G57A 1WTXA 2G45B 2GBNA 3CW2C 3IHPC 3NVYA 4GOPB 3R3MA 1C4CA 4BVUC 3I55A 1N63A 2LZ6A 4A3MG 2SAKA 1LFDA 3VR6A 1QZGA 3NRZA 4EE2A 2Z6BA 4FA6A 1SNPA 2F0TA 3D31A 1OQYA 1KLGD 1O7IA 4WRDA 2F0HA 1UELA 2MJ8A 4OWWB 4A93G 2NVYB 2E75C 1EIGA 4A93H 1Y8PB 3GP7A 5I2YA 1K73C 3ITPA 2IGGA 4CJ0B 3H09A 4K8JA 4X66L 2REXA 2KYWA 4LFBQ 4UP9A 1F2RI 3A1QB 2R93H 5C0XG 4C7ZA 2PPBC 5ELEA 3SK4A 5DPWA 3L10B 1RIPA 2KDIA 1SFOH 3ZNGC 1J7AA 4KI0A 1XTDA 5I2XA 3PUZA 1PH4A 4A3CG 1Q3LA 1ZEQX 2L3ZA 1LV9A 2YU9H 5G55A 3X3MA 1QOFA 3S1MB 4Y7NH 1A3TA 3UIOB 2F3VA 4II2B 2JSOA 1NEKB 1Q8KA 5D3IB 2D2CC 4MGYE 2LFNA 2ZTDA 3E6ZX 3KLWA 1R4QB 4MACA 4PYZA 4MSMB 1CUKA 3I8ZA 1E2VA 5FKAC 3J81L 3BDOA 3TP7A 2EE1A 3CQZH 4KKTA 1BKBA 1NJIC 2WDTB 1Q1EA 1UWVA 4RAUC 2FHTA 5JEAJ 2QJLA 4OZBA 5DAUA 3OG5A 3APDA 5JHAA 4C00A 5I6WA 2VRRB 2SOBA 5BN3A 1IHZA 1VQ9A 1T0QC 2KZRA 4ANXA 5IT9L 3D3RA 4JYAL 3JW0X 1H9RA 3DVNV 2WDVB 3PRZA 1P7EA 2EJMA 3KF8A 1HNXQ 2CQAA 2HJ1A 3AFPA 1F2LA 3QJZA 2NS5A 1WD0A 1GUGA 2MRPA 4GKJL 3I7FA 1BCPB 3NWTA 4GU2A 1KH0A 1LLRD 1ZXIA 4KKJA 5AJ3L 1K53A 2F0IA 2DNFA 3CKIB 1MHXA 3E9SA 2CW0D 2Y0SB 5FJ8H 4DUYQ 2XNAC 5IGEA 2JEBI 2AYOB 3GZNB 4MELA 1NR2A 3EFCA 2Y5CA 4J1MA 5J2RA 1T5XD 1OQRA 2WXLA 2G5DA 1WZ3A 1AZQA 3QIJA 4HIMA 5C1ZA 4X64L 4RNAA 1K83H 1EY9A 2KFKA 2ASBA 4B0EA 1CQVA 1LTTD 1C77A 3TRZA 1WX8A 3KH0A 2D2QA 4LLGM 1FRDA 4XX5A 3DLLA 3DQVA 2AHOB 3ZDTA 4NW2A 3PV0A 4GSWA 1SSOA 1S72A 3U58A 4OX9Q 4QB4A 4BS9A 4ODGA 1PTOC 3UDIA 1DOKA 2JA5B 2UU7A 4QAYA 3T3NA 1L1OA 1KRTA 1JB7A 3STBC 3T4AC 2MQJA 4AQYQ 2K8HA 5IIFA 1S3OA 3WOEA 1QOBA 4WAFA 3RI7C 4HLEA 3VR5A 4A3MH 1LYLA 4MJSA 1MSHA 1RL2A 2TMPA 3NQTA 2E5LL 3ZNHB 2Q8TA 4N8FA 2JA6H 2Z0EB 3VYSA 4ZUJA 5FO9B 1SYBA 4X65Q 1VQ5A 2C7MB 2L52A 4BOSC 1SRUA 3RCZA 4A3EG 1HCZA 4NXMQ 1N32Q 4DV2L 1RAXA 1MI2A 3HOYH 4WQMA 4H13C 4N8X1 3TS2A 2QC8A 2PNRC 3JAML 1E7UA 3WAMA 2BTEA 5A2QL 3DVGY 3HOUH 2W82A 5G5GA 3NVZA 1E0BA 4DK0A 1IBXB 3H15A 3F2DA 1E6EB 3HFZB 3C8YA 1D1KA 2OEDA 3NBHB 3AMZA 2FFKB 2J0MA 3M4YA 3PUWA 1EYDA 1NUCA 4LNFA 2NVXB 3I63C 2BPSA 4ZRJA 1VMPA 2KK8A 2H5XA 4KTAA 1KF6B 5AUKA 3V60A 4HJ8A 1SDFA 5FLXL 2M56B 4MDKE 2R2OA 4YWMA 3DWGC 3QQ8B 2VS1A 4XIGS 1H8CA 2K50A 2Y0SE 1YEZA 1B70B 1N36Q 2CHWA 1XYIA 4H44C 3UINB 4J3OD 4M8AA 4C56C 4JGHB 3HVZA 4KZCA 2AX5A 1HZ9A 3TEHB 3AEGB 1H9JA 4L8JA 4GKJQ 2KLCA 2GBRA 3DOWA 4KKUA 3Q22A 1MPEA 1TU2B 2XSCA 3I90A 1XNQQ 1YQBA 3KFUA 3GTOH 4ZYNA 3U4EG 3MJ5A 3KYHC 2D5GA 2X38A 1TKEA 4DK5A 3WWVA 1J8IA 2KTFA 4ZDVA 2IO0B 4HJ7A 5JPNC 2OJWA 3IT4B 1PMRA 2WXQA 3HKZG 1OTRB 3ZIMA 3KBXA 1UBIA 1GOZA 1VR9A 1Q1BA 4LNQA 3SVMA 2ZJPA 3S17H 2WS3B 2RSUA 3ULLA 4O0AA 2UUCL 2KQ4X 5D14A 1AEXA 2Q8IB 5E6PA 3RZWC 4GKKL 4IOCA 2G9DA 4RKBA 1T6BX 3GDEA 3VA5A 2HQLA 3AMUA 4K0KQ 4BY1G 1J6QA 4IPHA 1V81A 1OXUA 1ZYRC 4LF6Q 2HD5B 4M8NA 1L7YA 1PVOA 5C3EB 5LXIB 1VQ8A 2N78A 3GTJH 2FE8A 3AEDB 3F1ZA 1NBFC 2QGQA 4MJSB 3M4OH 2L0CA 2JWUA 5FJ8G 2VQFQ 2JU6X 1D1IA 1PH9A 3LXFA 3NBIA 1AH9A 2KFJA 4ID6A 3A4SC 1XLOA 2MNAA 2NVQB 2QA4A 4AUQC 4YHHQ 1V43A 1M90C 5G2NA 2PE6B 4OVUA 4F8CB 2I1KA 2Z4IA 5D65A 3J80E 3UE1A 1OGWA 2QCZA 4WURA 4HTHA 4EQPA 4YCWA 4W9GA 4B6WA 3RZDH 4GNXA 2XWBB 1TY0A 3ULJA 3RNGC 4FF1A 3FP9A 1XX8A 1DONA 4E71A 2MJEA 3HOVH 3U7ZA 1PGXA 2D10A 1AWDA 1R4NI 4AYBB 1ZW7A 3EFUA 5TSSA 4XQQA 3A8JE 2BS4B 5IYCH 4TQ0A 1V6EA 2RKSA 4DDID 1HR0W 3RT3B 2LFIA 5K5PA 3NE5B 1T9HA 2F0GA 5AJ3Q 2N8NA 4IDIA 4L5RC 2G1EA 2YTVA 5D3DA 5COYA 4BOZB 3KF8B 5FLMH 2ES2A 4DV6L 2VW9A 3UF8A 3L13A 4R8NA 1K8OA 4RCOA 4MM3B 2GBKA 3P1HA 1CA6A 3QC8B 1GUSA 4KIKA 2BE5D 4WFN3 4BY7H 5DPSA 1PGAA 3VTVA 5KEEA 4JYAQ 5E6NA 4RCNA 3PF5A 4HDQA 4HDOA 2BS3B 2AL6A 4FN2A 1MI0A 5GXGB 2K39A 1SE4A 2CJOA 1I6VC 3PT2B 4OELB 2LVOA 3FKIG 2F3IA 3J7AF 2PVOD 3S1RH 2JSVX 3SR1A 3NTIA 2B2VA 4C3JG 4A75A 1XWEA 4JI0Q 4DKAC 3APCA 3N30A 3D6WA 1N34L 1UAPA 4PS8A 4IFDH 2EMTA 1Y8OB 2BH8A 4G7HC 4KV6A 1JMLA 1VCBA 4A20A 1TWAB 4B3RL 2B8FA 3WANA 2PPHA 3PIPA 1DOLA 2DJGC 2YV5A 3C0RB 2KFKB 1DGSA 2F0QA 2OQKA 3EGRA 4P6VF 3ZTDA 1PH1A 2WLBA 4LJOB 4DXAB 2D07B 3PGEA 5CX3A 1N61A 4RM8A 1VQJA 3OYYA 4IPCA 2LMCB 1C3TA 3TQYA 1TBEA 4F1SA 1YBYA 2KWVB 1TWHH 1ZKHA 1ZXHA 2HCCA 3GZNI 5IYDG 3Q3NC 4KVGB 3E0EA 3MC0B 3R7RA 4J6HA 1L4DB 2CWPA 2RF4A 4QGUA 1O7LA 3SK8A 3LDZE 5CV8A 3SFEB 1L0WA 4ITKA 4DK6C 2WXOA 1QNUA 3ONAB 2JPHA 3HOYB 1TQOA 4JI1Q 5BMIA 2MFIA 4JV5Q 1N36L 3CQZB 1JJCB 3H6NA 1VQNA 2BOSA 4DXFA 5F2DA 2R7ZB 1Z6HA 1PH8A 2X6GA 1IBLL 4JG2A 3GTKH 2R93G 2R6GA 2L76A 3J9CA 3PIO3 1YNNC 3G6EA 1D5ZC 5M5XB 4GNXC 1Q90A 2R3ZA 4B3SQ 2JT4B 3BS1A 3HOZH 4BZAA 1X32A 1SMXA 1WXVA 2R92H 1E8WA 3CRLC 3L3OC 4R4OA 4HSVA 4X3UA 4C1NI 4QUFA 3FKYA 4GB9A 4USAA 1TTNA 1KJTA 2E3TA 1BO0A 4IW0A 4K0KL 3FKIB 2KMMA 1EY0A 3S9WA 3CSFA 1HPCA 2BYFA 3PPAA 1HZ6A 1E24A 2BB5A 3DBRI 1Z47A 3VUYA 1A8VA 2KQSA 4BBSH 2F0EA 1D4BA 1I35A 2UXCL 4KSLC 4AWJA 1WRIA 3J7ZC 2VB3X 3DM3A 2IT1A 3I3CA 4CKBA 1WXQA 3GTMB 4DQOC 4AQ7A 3K7AH 2OJRA 2V3PA 1B7YB 1EOVA 3AN1A 3RMHA 1BOSA 1T0SC 4IOIE 1HNZL 1XNQL 2CHXA 2J7ZA 2BKRB 4DV5Q 1C79A 3V96A 3IG3A 2KBNA 4OX9L 1V49A 1Z5SB 2GBMA 3B9JA 4ZRQA 2HUGA 2O6VD 4IURA 4C4VA 5BR8L 2DX5B 4LWCA 4AYBG 3C46A 3DBSA 5E4WC 2LMCA 2F0KA 3AH7A 2MSED 5BYSA 3QAQA 1QZEA 4RG1A 5M5YB 1WCMH 2BDOA 3LX0A 2J0JA 1XLQA 2VZKB 3EHVA 4IQZA 4A3LG 4RGTA 4CHTB 1WYWB 4PG3A 3VTUA 2Z6KA 4R4TA 2ZEQA 4FLHA 5L95C 1EIYB 5D7GA 1RLFA 3HRZC 3PREA 2EY1A 3GV3A 5AUIA 2D3GA 1JJ2A 2K5NA 3AEFB 3KK7A 2UXDQ 1XXGA 5CHVC 3GS2A 4M01A 1YN5A 2PMZE 5C0XJ 1HQRD 2Q2IA 4IUNA 3EVQA 3PUYA 4ALPA 2LI5A 4MTNA 2OXPA 4I65A 4RGMA 4V0BA 4DV7L 2WXHA 4L1BA 3UI2A 5ELFA 3QOLA 2PJHA 1RKNA 4HCEA 3A74A 4JI3L 4NAMA 4JIOU 5IO9A 3KVFB 4FADA 1YJJA 3UI3A 2LXJA 4YHHL 5IP9H 1F2RC 2RDGA 2ZNVC 2AQ3B 4C3IG 4GOPC 3G4SA 1P0RA 2JA7G 4E3CA 2WAQB 4N9TA 2DLBA 1MHWC 2JRIB 1D2BA 3G6JB 4AP4C 1UD7A 5DPRA 3HGBA 1TYGB 1NDDA 1RTOA 1HNWL 3AE7B 2JYEA 2JE6I 2K01A 2NVYH 4AOFA 3HM6X 3L0OA 3NWSA 3S1NB 4I6NB 3OPOA 3VQIA 2Q5WD 3AXCA 2NBWB 2MP2B 4H0LC 1TWGH 5CTRC 1IGCA 4QL5A 3BU2A 1YVCA 2QDLA 1SSNA 3ZYYX 1L1OC 2JX5A 2Q2HA 1ESRA 4BY7B 2HTHA 2X8XX 5T8IA 4DR4L 2O4XA 3HOWH 4A3PA 3OWFA 4C3JH 3S15B 1OXSC 1QWYA 2A6HC 5K36H 1X65A 3MA2B 1YZ6A 5IGBA 3ZKJC 1UGJA 4B3MQ 1WR6E 4OVVA 2KJRA 1HNXL 1LUZA 2LHEA 2B2WC 3HOYG 3CCEA 2F0OA 1C78A 3KWVA 1YN3A 5C4HA 1KXLA 3VRAB 3D0FA 3F2BA 4B3TQ 4DR3Q 1ILPA 1RYJA 3VH4B 2C9OA 2MW5A 4DV5L 3TZUA 4G7OC 1G6PA 1WM2A 3DDCB 3ETRA 2DN8A 2N88A 1XTCD 4N9PA 4DV4Q 5JAVA 3NPPA 1HR0L 2PKOA 2KN5A 3KUCB 3VA7A 1N62A 4X6AH 5IYDH 3DEOA 4HK2A 3TEXA 1JE4A 3ZUNA 2WIIB 4JC0A 1QG7A 4GGQA 2ZVOA 1E3PA 5G5HA 2ALYB 3NTHA 2L0TA 1ILQA 3A7AB 4R9WA 2ZCBA 3ZNZB 2WKCA 1XLNA 5GAEC 3RNUA 2L00B 3OIQA 1GHJA 1NTGA 2B8GA 4JI3Q 1IBML 1J19A 3K9OB 2VB2X 4H7BA 4A4IA 1WCMB 1C1YB 1JWSD 2JWZA 3N1ZC 4G50A 4TUUA 4B9KA 3WAOA 1WFYA 1NMGA 3Q8AA 3PV1A 2FMCA 3GTKB 5IAAC 3DVNU 4XZ4A 4ACFA 4G11A 1VZ6A 5ISRA 1GUOA 4ZQ3A 3LWUA 4ILWA 2D11A 5EE3A 3T51B 3A1QA 4BKGA 1BT0A 1TWCH 1SF0A 2LSSA 2HDMA 4GDLA 4L5QA 1P3QU 2NVUI 3CSTA 3JAMi 1L2FA 2EYHA 3S2AA 1NMFA 2JA8B 2LASA 4KD4A 3V61A 2OT2A 2ACZB 4YSYB 1ZGUB 4FXDA 1HA6A 2K3UA 3FILB 4EKUA 4QY7A 2BKFA 4FJZA 4OZAA 1TZOA 4CDDC 3VDYA 3I91A 4LFAL 4HXDA 1CZPA 1YITA 2INDC 2A6EC 3QK0A 1SE2A 4CKEA 3KUDB 4N6EB 3MC9A 3IRBA 3MEFA 2L83A 3PO3B 3U30A 4JVZA 1RWSA 1O7YA 5GAHC 3IAM1 3M63B 3IFWB 4TV3A 1VF7A 1EY8A 4YTNB 3S15H 2K05A 2DGYA 4GLVB 1WYGA 2RR9A 4FXGC 3H6MA 2OWOA 5EE1A 1ONLA 4BBRH 1Q46A 2IPKD 2JY6A 3E9IA 4X3SA 3I4NG 1VCIA 2ZPYA 4OVZA 1VQDA 4RWSC 3T16A 3C2PA 1XQQA 4IM2A 1RFAA 2AWNA 4GKKQ 4BXXG 2ON8A 2RMMA 4US8A 2NR2A 2WB1E 2ZM6L 2V9HA 1IKLA 3DWAA 3OJ4B 1NI3A 2EQSA 2XBBC 1WJNA 1WJ6A 1M8AA 1IW7C 3CPWA 2UUAL 3QO2A 4REZA 3CCJA 3ML8A 1YJWA 3BG3A 3C1FA 3CCSA 3MHZA 2XTIA 3L17A 3EC8A 4P1CC 3CIRB 4N58A 1PFSA 2LJIA 1X54A 1SROA 4P7IA 4QCLA 1TVXA 1UBQA 1YJ9A 1N5XA 5J18A 5GAGC 4DR7Q 4ME3A 3Q69A 1GD7A 2F4VQ 2Q2UA 3SHQA 4PMCA 3C19A 4US9A 2JEAI 3PZDA 4CQNA 2K75A 2R61A 1LO5D 2XN9C 1WGHA 1CFMA 2K6AA 3SE0A 4DV6Q 4BY7G 1JORA 1QQRA 4IKGA 1IBLQ 1CK1A 5TR5A 4PQXA 5EKKA 4ABNA 4LF5Q 5JJLA 2MJ3A 3U50C 4AH6A 2Y5BB 3AE1B 2INPE 3P2BA 4KHPL 4A3OA 1B50A 1GUTA 2O2VA 2FXQA 1B8AA 3TCAA 1PRTD 2MUYA 4A3FG 2BBCA 3A9JB 3B08A 4WWMA 4IC7B 4NAWB 3QCAA 1AE2A 4HSPA 2E8GA 2J42A 4JK1C 1F9SA 1JJGA 3D6CA 2RSOA 4NPSA 4PMWA 1UZXB 1SJHD 1Y1VH 5KRUA 1FMAD 3GE3C 4J8QA 2N49A 4A8XC 1K3BC 4HWIB 1S40A 1A15A 4W9LA 2O6VB 4WJNA 3UQBA 1QJOA 1N34Q 4UPAA 5CGKA 2NVQH 3PSIA 1YQ4B 2Z59B 5FLMG 1Q10A 1GJXA 3VUXA 1WTPA 4ZK9B 2HDEA 4A6QA 2HIXA 2JYOA 1E8XA 2EZVA 4ICVA 3GV6A 2KWDA 4DXGA 3RLFA 1R4NB 2JK8A 4KN4C 2QW7A 3RLNA 3I70A 4TMAB 2X6LA 1PZID 4PZ6A 4UDUC 2KDBA 3KDFA 2LXCA 2AKWB 3RN5A 1VQHA 4A3GG 2JXXA 3KW5B 2KECA 3SD5A 3MXPA 1IPGA 3AE5B 4A3LH 3RNAC 4TKOB 1XD3B 3PRMB 3PQIA 1OXXK 2EVBA 1BXTA 2HD3A 2CWAA 2EDGA 3HOXH 1J0GA 3KBGA 5E3FA 2UU9Q 1PFMA 1HTOA 2R93B 5M5XH 1G2SA 2I5LX 3NQIA 4IFDG 1L5PA 1TZ1A 2FCSA 2KHIA 1EYAA 2F52A 1JE5A 1GHKA 2HHHQ 2LVQA 3NHHA 4DR3L 4B3ML 3CP0A 2ID0A 3AE8B 4OGQC 4FNFA 4KSKC 4PV1C 1EF5A 1CMXB 1TIFA 1PRTB 3TP6A 5IN7A 4HCPB 3I4LA 2LGYA 1Q5WB 1V5TA 1FYCA 3VYRA 5LL6X 4A3EB 4N59A 5IE8A 4A3FB 4FBJB 5ELBA 2CU3A 3GD7A 2O2LD 4NQLB 4LK0M 1RDPD 2F0VA 3PF4A 4KN7C 2F1MA 3EUB2 3J80c 1H9MA 4BBSB 3U4VA 4KHVA 3PZ7A 2J7QB 3PTFC 3DBLI 4IUPA 5CR3A 4N9F4 2D3CA 1BUIC 1R4PB 3T1HL 2AWTA 1RRBA 2A8VA 1NSNS 4C80A 3DMUA 2XVSA 3E56A 1OEYA 3K6OA 5EGTA 2ZVNA 1IBKQ 1I50H 4U673 2D62A 1PLFA 1BMLC 3B0AA 3J7AV 4IWOA 2NZOA 3NXWA 3U2SC 4C2MH 1HRJA 1IL8A 3CWIA 4GOCA 1U5KA 4LK1C 2LEKA 2PVGC 2K5WA 1E7PB 1F9QA 2DYBA 1KABA 1WI5A 4EQOA 1XMOQ 3K9PB 4P75A 2DY8A 2E2DC 1BF4A 2C5CA 2CH4A 3ZXRA 2F0LA 1IGDA 3V05A 4LMQD 4ZKCB 1I3QH 1U4AA 3T53B 2KHWB 3IT6B 4GS3A 1EY4A 2H1EA 1J5EL 4FF4A 1Q1OA 1L4ZB 1C0AA 3QA8A 2IX0A 1V80A 4A90A 2RCNA 5LMNL 3CAMA 1VLBA 4DR6L 3I4MG 4JPSA 4MH0E 5H92C 2M9VA 1E5WA 1F2ZA 1G6ZA 2M0AA 3N52A 1YIJA 4GMVA 2HIVA 3FC4A 4A3DB 1D7QA 1EZ8A 1ASZA 5C0XI 1EF1A 5HURA 4RA8A 1F2MA 2A68D 2EYPA 1I4XA 4GOPA 2HQEA 4IWQA 2QDFA 4MIUA 3DEPA 4XE0A 5EE9A 1FXIA 2G3QB 3AE6B 4BFRA 4LTUA 1MG4A 3KYCD 4GDKB 2QEJC 4XQJA 2RHQB 1SEBD 1XT9B 2IHFA 4YWKA 1L2NA 4YWLA 5FLXE 2FBWB 1L0YB 2WB1G 2ZJQA 1G8ZD 3UDFA 2DAFA 3DXJC 3NVWA 2EKIA 3MZ5A 2BF8B 2K5QA 3CF5A 1NBWA 1K3RA 3I9V1 5M3FG 1HFNA 2MCNB 3BJUA 4JCVE 2DNEA 4EZLA 5FO8B 2ZNVB 3FPUB 1QNKA 2WYQA 1B1ZA 3Q6BA 4K5VA 5IP9G 1DOMA 4A3IH 1VQEA 3SEBA 3GTLB 4BKSD 1PXUA 3D8GA 4AYBE 4TRDA 4IM0A 2FIFA 2DAJA 1GUNA 4KK7A 4K3BA 3GTPB 4GIVA 1QCBD 1E0ZA 3PLVA 1NAPA 2LKVA 2RGFA 3TEWA 2G4SA 1Y1VG 1PH2A 2B3GA 4U68A 1GNUA 2IY1B 5CV4A 2CR5A 5CHWA 3SDLC 3QG1A 1IBKL 2K25A 5AZHA 1CKNB 1JICA 4RGNA 1X55A 3OMGA 1QB5D 4H02A 3E3XA 4ZCKA 1VQ6A 2BT6A 1CA5A 2WFWA 2B2YA 1C7YA 3ALBA 1WWTA 1DOXA 4ZKBB 1SBBB 2PO4A 2KCCA 3V6EB 4JW0A 2BVCA 4DV4L 4FDBA 2OTLA 4X62L 4WWNA 2FINB 3MAQA 2ZXOA 3KLSA 2Z1CA 3P4SB 1C9FA 3JC66 4M0WA 2Z8LA 2AQ2B 1LTBD 1K8MA 1T0YA 2PQAB 4CDCC 4A3BH 3SFDB 3W1YA 4L5SA 3BDLA 4MGIE 2MWSB 2MBEA 3QX1A 1U9RA 2FNJB 5C3EH 3NUHB 3DCGA 5C3EG 2WAQG 5IODA 3I5JC 5E6JA 3RNEC 5D6JB 2F0NA 1GO3E 3FKIH 5C3JB 5E4XA 1L6VA 1IYUA 3L9AX 3DWPA 4C3HG 1KRSA 1O80A 2MP1A 2N9XA 5IKCM 1QOAA 2WHIA 3R2IA 5JJZA 3PVLA 4ZUIA 4WWPA 4IOAA 1EQVA 4R4CA 1LM8B 3Q3JA 3Q8FA 4XT1B 1VQMA 1GB1A 2NVXH 3SGIA 2GMIC 3AB5A 3NSWA 4IFDJ 1K8GA 3PO2B 2MPMA 1YX5B 4DAYB 2ZTCA 3T1YQ 1DCZA 4ANUA 2VQEQ 1FVIA 4BBRG 3VXWA 4KKIA 2ZM6Q 4YIJA 1YJ1A 4EX5A 1DXMA 1KAAA 5J1ZA 4DR7L 1IUEA 1RFKA 3PO0A 1HTLD 5LHY1 2WU5B 4I6LB 3MFGA 5IP4D 2FCNA 2M0XA 1ASYA 1CHPD 1FD7D 4NZLB 4YTMB 3FHWA 1QVFA 1EWIA 2PMVA 1QVCA 3A7LA 3SU8X 3G7LA 4AQYL 1L6UA 3T1YL 2CCZA 1HHVA 2EY5A 3GTOB 1K83B 1TR5A 1N33L 3ONSA 3OTOL 5CYUA 4BBNC 3I2ZA 1KLVA 1DM0B 2TSSA 2ZXPA 4X3KA 4JI1L 2HT1A 2GVBA 1QLBB 1A3UA 1KTKA 3I4MB 1IYFA 1ESFA 1MFWA 3CMAA 4FXCA 3PO3G 4I6PA 3K57A 2K9XA 4ICUA 4II3B 4BBNF 5C4JH 4K7SA 3CCQA 1Z9FA 3NG0A 5BMHA 3ZJYC 2KD0A 4GLXA 1X9NA 2R92G 5BO4B 4Q2JA 2WQYB 4DNIA 3S2HB 1IKMA 2L9HA 3IFTA 3PO2H 2VZKD 3FDTA 4JE3B 5EKIA 2JP1A 2LXKA 3OW7A 4YSXB 2YVCA 2CHZA 3GTJB 4MGZE 2EOTA 1PUTA 3JVZX 4O42A 1WTQA 2L15A 2C7HA 2A5HA 1C8CA 1B3AA 1CJEA 3AE4B 3ZDMC 3UDGA 1HUNA 4QUCA 1BBUA 1YN4A 4JI7L 4CBVA 4B95A 4IWPA 2PTLA 2L8JA 2F0PA 3NTKA 1BCPC 1C9OA 1B3QA 3KOJA 1WVLA 1IL2A 2PQAA 5JJIA 4HIOA 4Q5VA 1ACCA 4NKLA 2IZVB 2RDFA 4HPLB 3OWEB 4PMBA 1H4RA 4HJGE 1F0ZA 1STGA 2QIEB 3EROA 5LMNQ 1NENB 1XF5L 3VH3B 2UU9L 4KZ0A 5BMGA 1V1QA 2I07B 3MC8A 4DK3C 3I57A 4B9WA 1S1QB 5J39A 1C4AA 1K0RA 4LF8Q 2NB0A 2JA6G 1VDZA 1WMHA 1TS3A 3HRDD 3PRPB 4A3KG 1FIQA 1HZBA 3O65B 4E74A 1GB4A 1TS4A 4NXML 3S2HH 2RA4A 2VQEL 3OIPA 2AUJD 3ZRFA 2EYMA 1HTPA 1ZYRD 1AYFA 3N6RA 1E9MA 4JBMA 3J81j 2PI2A 4LUOA 1NY4A 1WH3A 1U4MA 4IG7B 3H8HA 4QJFA 1HEZE 4G0NB 5CV6A 3H3VH 4EZKA 4KHZA 2FCMA 2N7JA 1OXVA 4CJ1B 3BY4B 3L0WB 3W2DA 3WIMA 1FNVA 1B9NA 1WFQA 3BZKA 1XCQL 4HPMB 4EZJA 1P98A 4NNJB 1Y1WG 3U7DA 2Z0SA 2LWPA 3EIVA 4KD3A 2N9KA 3T1HQ 2B2UA 2E74C 1CTMA 1EUJA 3RZOB 5LNK1 1KDAA 1GUAB 3M4OB 1MHHE 3WAPA 3PIP3 4DUYL 2L1BA 4KGTA 2A6HD 1VS0A 1I42A 3ZGZA 2KMAA 4C3HB 2LRUA 1S5DD 2F4VL 1EY5A 1JWUD 2A69C 3MFYA 2CKHB 2QMTA 2N7EA 2WXIA 3KQ4A 3CCRA 4ANWA 4IUQA 4ZLTF 3S1NH 4J15A 4JX1C 3MWYW 2F0FA 5C44G 2A68C 2VH2A 1LGRA 3CC7A 1CKNA 1I3QB 2J0TD 2KNBA 2RPQA 4GXBA 2B63B 4EQ5A 3H7PA 2Y3AA 1EWYC 2KJXA 2K03A 3K58A 2A6ED 3V2TA 2GRIA 2K8CA 2M1MA 2OQ0A 3H3VI 3HIZA 3J81i 1HNWQ 1LXDA 1SE8A 1C4PA 3ZO5B 4HIDA 1HNZQ 3JSVB 2CKZB 3AU7A 1FEHA 2RQXA 4IALA 1FL0A 2PZTA 3GOEA 3ZRCA 4A3DH 5M3MB 4G3XB 3VHTC 4C3HH 5HKHA 3Q3OC 4KKSA 5C5LA 1TY2A 1JROA 4PK1A 5M5YH 3ABVB 4P16A 1A2UA 3K0XA 3HS0C 4IUTA 4EVOA 2JA8H 3QHTA 2KVZA 1I4HA 3MHBA 1TWHB 4PZ7A 1WE7A 1UE1A 2PMZB 2EY2A 3M3YH 2J52A 4LFBL 4LF6L 4DR1L 2PW9A 2BYVE 3A4RA 3AULA 1Q81C 3SK5A 4KIKB 4WJWA 1MJCA 2I5HA 4DAYA 1XNRL 1VDVA 1L0VB 1TKYA 3H1UA 4BWGB 4RGOS 4DV3L 4GLAC 1E7VA 4G4KA 1T3QA 4CDEC 1CSPA 4DAVA 2W54A 2LHDA 2B2UC 2FJ2A 1WGGA 2JUOA 2KTRA 3N1XC 1DOIA 4DNRB 2WU2B 4OHJA 1XO3A 1R4MI 2O2VB 3P42A 1LT4D 3K5NA 1ICFB 4DV1Q 2JA7B 1ZDVA 3AU4A 3NZSA 1CT1D 1X6OA 2F4IA 2LD9A 2H4OA 1X56A 3DWMA 4L23A 2JA9A 2QF7A 4L5TA 1FGBD 5AFWA 1IP9A 2IX1A 1K0SA 1F77A 1STNA 1FJGQ 3J7A5 3S1MH 1HUMA 2RCFA 2V4LA 2MHJA 4FULA 1YJNA 3DBHB 3RD4A 3LB8C 1GAQB 3H9DA 4HMIA 2FUHB 5T1GA 2PCFB 4CDFC 2L1AA 3V6CB 4FYDA 4RM9A 2KENA 4P74A 4NPNA 2F0WA 2SNSA 2L05A 2WXPA 4DNTB 2PW7A 3A9KA 1JQ4A 4ARIA 2LUEA 3L54A 2RHSB 2ZXRA 1SNDA 3R2TA 2E2IB 2L0FA 2V0GA 4GN5A 1SYEA 4L6TB 4JOIC 3AFQA 4JI2Q 2DZIA 3BK1A 1HQMC 1XEEA 2WINB 1EOTA 3H0GB 4MTKA 3S1QH 5J17A 1Q8IA 1HTQA 2CFMA 2KOXA 2DUDA 1YX6B 1FFUA 3JSVA 3OJ3A 4BY1B 3Q0AA 4KMUC 5KGUA 2MEKA 3WDNA 3ZJTA 4RMFA 3M95A 1M4VA 3KUPA 3B2FA 2VQFL 1E90A 1VQBA 3UIPB 3M4PA 4KY5A 3PUXA 4OONA 2NVTB 1SYCA 3DVGX 4ZRPA 3MJWA 4JL9A 3PZ8A 1STEA 4C7YA 2VNUD 1QVGA 3B2GA 3Q8CA 3Q2AC 1ICWA 5M3FB 2IO2B 5C3XA 5H1SE 2UUCQ 2UXDL 1BCPD 1UNSA 1WJJA 2BA1A 3PGZA 3RUZA 5EE0A 2DHZA 5IGDA 4HJKA 3AE3B 2LGSA 1VD2A 4QIWB 4P1BC
chains in the Genus database with same CATH topology
4ME5A 1F2YA 3A8IE 3TEZA 3I4NB 1DJRD 5EPJA 4WORA 3S14B 1V97A 1MGSA 1N5WA 1S4ZA 3BVMA 3P63A 4JX1C 5BN4A 1PFDA 1R7SA 1CHQD 1CI3M 4QF4A 3KLSX 4C2MB 5JVG3 4Y7NB 1WGKA 4L63B 1F9PA 2NN6H 4FVMA 3W5UB 1OQQA 1U4RA 2LY7A 2NTSA 5JOBA 4HKQA 3M7GA 2BS2B 3U52E 1X3PA 2D9UA 3AEAB 3AE2B 3U9OA 4A9AA 1UWXA 2H89B 4HCSA 4A3JB 1B44D 1LACA 1TWFB 2J4XA 4DN4M 1A2TA 3NS1A 2MHVA 3ZQ4A 4XYQA 4ULLA 5JPMC 1Z7TA 1KRHA 1AN8A 1TWGB 2EYOA 5KNCA 5E1FA 1JWMD 2ZW0A 1CM9A 3HG9A 2KN4A 5KIXA 5JXVA 5G3LF 3P1MA 4K14A 4PT5A 5DM73 3IFDA 2CHBD 2BA0A 5MPOA 3Q6SA 5NUCA 2KQ3A 2E2JB 3HVDA 3GTGB 1Y56A 1EFID 5KNBA 4BBRB 5ELDA 1AZPA 1TIID 2EXZA 1I50B 2W3RA 5EQ0A 5FOBB 2WXRA 4NMZA 3TP8A 1SYFA 2B2YC 3QJYA 2B2TC 1A70A 4Z9CB 1D6EC 1VF5C 3BZDB 1TKWB 2VXWA 1UUPA 2SNMA 1EL0A 1YNND 4M1UB 3TMEA 1G2TA 2QCPX 4XDDA 3V3XA 1EY7A 2K04A 3KWLA 3HKZB 2L55A 1S5FD 5EBCA 1GXDC 2GI9A 3ZJUA 4F8MA 1LT3D 3T3OA 4A3BB 1IYVA 1SYDA 2EYLA 4K2KA 1STHA 2BB6A 1T5EA 3VR9B 5G3LD 3DUZA 1IBXA 3TP5A 2K28A 1TWCB 2DYMA 1EQTA 2M2LA 1J7CA 1PTOB 4A55A 1WSPA 1ZPSA 5BYRA 3HZXA 4JWSC 1SFOB 4MH8A 2F0SA 3D4DA 4YXDB 1DGJA 2JZPA 1RM6C 2I2YA 4IN3A 2L32A 3TEYA 2KUMA 1S5CD 1B53A 1RCVD 1VZ8A 1NCVA 4ZAIA 4DFAA 5CC4A 2DWQA 5CORA 4FO2A 1Y8NB 2DYOA 1BUVT 1PZJD 1FNWA 5CMDA 2CJNA 2OHFA 1E10A 5IT9E 2JQRB 1AFPA 2M00A 3W9CB 4CJ2C 2WNMA 5J22A 1STYA 3DM1A 4KY7A 1QILA 3Q8EA 4IFDI 2XIWA 1A3VA 3P4RB 2W55A 4K8IA 3HOUB 1VZ7A 4KGSA 2X69A 3DHQA 2K33A 4KX6B 3URYA 3OSOA 4XTCS 2IDYA 4EGVA 2QILA 4C3IB 1ROEA 3K5OA 1JW9D 1BBXC 2LGIA 3K59A 1SYGA 3MVVA 4IUVA 3P20A 3W3AA 2IGHA 2RBMA 2O5JC 3NUCA 2WP9B 2KA7A 1UEAB 2RVLA 1RODA 2OF1A 4PNYA 1ZKOA 4OL7A 4FXKC 2ENBA 1EIHA 4HRSA 5HGTA 3MXGA 3J7YW 4YT0B 3BYYB 3LYYA 4XQNA 2BW2A 1YMHE 3KLRA 4DAPA 4A3KB 3K5LA 5JVH3 1CZWA 4WH4A 1JCKB 1FCLA 2WXJA 1QOHA 3P4QB 1PTOH 5ELCA 1LT6D 1ENCA 4LJZC 3U9SA 5I4DA 2B2VC 3M7NA 2PW5A 4K5WA 1S5BD 1WTRA 2VUMB 2INNE 4DF7A 3AECB 3NBHA 1BR9A 2NTTA 2IL8A 2E76C 3TN2A 4HROA 4P2CB 1EU3A 5T1IA 5M5WB 2PYKA 5DM63 3VR8B 4NJCA 4XXEA 3WOFA 1F9RA 2DBYA 4C3JB 2AUKA 3GTQB 3LNNA 2K32A 4RF1A 5A2QE 1FRRA 3JAME 1PGBA 4A93B 1PTOD 3S17B 4B0MA 4YSZB 2BCOA 5IOCA 5DNFA 1FO4A 5C0XH 4F7XA 1KFYB 3HUIA 5C2TB 4GZYC 1K52A 2IJ0A 3VYUA 3J80L 3TSSA 4DU9A 1MVKA 5HFYA 3I73A 1ML0D 5JEAH 4BA2I 2EPBA 3IAS1 4KJNA 4L1BA 1STBA 4RHRA 2IWHA 4GDLB 2W3SA 1SB3C 3ZJVA 4MT5A 1Y69U 2NN6G 4L2YA 5FO7B 2IX3A 1EU4A 1KDCA 3EFXD 4BA1I 2ONQA 3P75A 2EYFA 3AM9A 1PFNA 2JXMB 5FR3A 1GPXA 1BDOA 1FFVA 4XT3B 1EEID 1FCCC 4DK1A 1OO9B 2N9LA 4RFBA 5CV5A 1QE6A 4IUUA 3RFZB 5FK9C 1KLUD 1EWCA 4NDXA 2CW0C 2DY7A 2MH7A 3AB9A 4XDXA 3BVZA 1J7BA 4CKCA 2KAJA 4B9XA 2KACA 1QKZA 4F87A 3MTSA 4F88A 3QWNA 3R93A 5KYIA 3IL8A 4D2KA 1PTOF 1U4PA 1PYWD 4C1NK 5IGFA 1QT9A 1ZP0B 2KVMA 3AV8A 2F0DA 4K6DA 4ZOHC 4OIKA 1KNAA 2NMQA 1NYQA 2L11A 2PZUA 3IAYA 2EJFC 2B76B 4FF2A 3BVGA 1JOQA 2JA6B 2HCIA 2EYJA 3FMCA 3GQBA 3MEHA 3ND8A 5BYQA 3TUOA 1DOYA 1C4QA 1ZOYB 4CGYB 2E6XA 1MD2D 2PZWA 1V8QA 1YJIA 2RDHA 4XYOA 3IXSA 1JB3A 2WP8J 4IZ8A 5HHDG 2AQ1B 3VR4A 1ZXTA 2IGDA 3SK6A 4Q0FA 1K51A 1JALA 1U4LA 2JXTA 3RZDB 1IW7D 5M9OA 5C4ZA 5I9OA 1JWBD 1NYRA 3DWQA 3QIAA 3HOVB 1DZ1A 2F0UA 3GB1A 1UWMA 1BNZA 4A3GB 2B2WA 1EWHA 3OHXC 1B9MA 3FPPA 4OO1G 5JEAG 3L4PA 1EYCA 4OW0A 3GO5A 4JBWA 1FM0D 4XDCA 2AWOA 3L7ZC 3W1SA 1SJED 2LS01 4HKZE 5CBAE 3MXUA 2F0MA 2YEPF 5LL6S 4R3DA 2WXNA 2V3NA 3Q23A 2ZW1A 4ZYSA 2H88B 2XRQD 4HEA1 2QSDA 1OXTA 4H2AA 1ET6A 1AW7A 5K36G 1EZ6A 4AS1A 3A56A 5CV7A 3EA6A 3J81E 2EY6A 2NZ1D 4E6IA 3N9YC 4GLSC 5EJWA 5C5MA 3T56B 1SIJA 1J9OA 4TQUS 1PDXA 2BDNA 4RKLA 3H91A 1YQ3B 2L5TA 4HN7A 2QDBA 1HXYD 4HEDA 4OO1I 4ZRZA 5CV9A 2WV6D 4I7ZC 1W6JA 1I6HB 2WXKA 3A54A 5EPKA 1CQFA 3MXNA 2A73B 2D5DA 1KDBA 2Z4HA 1SNMA 3P4PB 3HOWB 1Y1VB 3PMFA 1WTVA 1X3QA 5KNDA 1R9TB 2WDRB 3FRPB 3SHLA 4HAEA 1DD2A 3K0YA 1G291 1SMYC 2NUCA 3OMCA 4O1NA 1TJEA 4UAIA 2XRSD 2EJGC 1BQQT 4KGRA 1V1OA 3BIID 5H8YE 2FMMA 2I38A 2QKIC 3OOCA 1CZGA 3VR2A 3Q8BA 4KJOA 4XWWA 4RH6A 2GB1A 4K5XA 3CU7A 1VRAB 3TDQA 3LWEA 4HMJA 4MHEA 4LAAA 2K5PA 3TBIB 5C6AA 2WDQB 1LTGD 3WCQA 3H94A 1TS2A 3FVQA 1VMCA 1GUWA 4RF0A 1N60A 5HG2A 1LTRD 1PZKD 1I4RA 1ZE3D 4OZCA 3O13A 1EY6A 1ZDXA 4FF3A 4ZHOA 3K5MA 1TS5A 1SNOA 1TT2A 2HDLA 3HP3A 3BDCA 2J53A 3NZ3A 2ICEC 3FEWX 2SEBD 1H9SA 2WACA 5KYLA 1FR3A 3D4WA 3HEJA 1V8CA 2L4NA 2N55A 2KEDA 1KNEA 2A74C 3M85A 2WKDA 1ENFA 1L0XB 2F0JA 2NN6I 4EQNA 3S1QB 4QMGA 2O5IC 1YNJC 3A55A 4ARCA 2ZT9C 2F03A 3HOZB 3AEEB 2KCNA 2RPVA 4V190 2MGSA 1C48A 3ERQA 1JOKA 2YU9B 2XWJB 3H3VC 2K1BA 1SNCA 2WXGA 2V4DA 4OO1H 2K7VA 1YNTE 3BYTB 5C4JB 1LTAD 2RSNA 3K7AB 3QOJA 1PFBA 1SMYD 1LT5D 3VR3A 1QOGA 2ICIA 1V1PB 2NWGA 4K6LA 2EELA 2M19A 1D5MC 4YTPB 3T13A 4JWUC 3VRBB 2KEEA 1STAA 3NP8A 3BWUD 1C76A 2Q8RE 2CVRA 2PQEA 1O78A 2B2TA 2F3WA 1HA5A 3MP9A 1Q12A 1WTWA 5C4XB 1XCTL 1MBYA 1E2ZA 5CBEE 1BCPF 3S2DB 1I4QA 1SXTA 4MN3A 2V4IB 2YEPB 3AEBB 5A35A 4YWGG 2R92B 3D4RA 1TKGA 3AE9B 2PLPA 3M3YB 4NP5A 4A3MB 2LUMA 2KDMA 4R8IA 2DNCA 3TZDA 5DEHA 3QB3A 3FILA 4B08A 1MSGA 4TQ1A 1JRPA 1D5XC 1II3A 3NK9A 1P7FA 1SAPA 1A6XA 1I4GA 1K50A 1VJKA 1WD1A 2GA4B 3EJIA 3HOXB 1EM7A 1LABA 2K22A 1HZ5A 3C3LA 2KHSA 3F2UA 3PUVA 4OIJA 1DYQA 1S5ED 4HR7B 3SR6A 1B4OA 5EPLA 1ENAA 1I4PA 1ZUD2 2BE5C 5I9PA 4DA2A 2JYTA 4X3TA 1SE3A 1FXAA 2WXFA 1YNJD 1RJTA 1RHPA 1B9RA 5I6YA 1W6KA 3C1EA 3SDZA 1Y1WB 3X3NA 1XLPA 2MJDA 4TSSA 2KOLA 3I72A 2WXMA 4A3IB 5C3WA 3P7JA 4K2LA 5EKLA 1JC7A 1LTSD 3BK2A 1QF6A 3S1RB 4RHSA 1FNUA 3S16B 1NVID 2K0PA 3RPFC 1I7HA 2WB1B 1NR4A 5BN5A 1ET9A 1JOOA 1RTNA 1RF2D 2B39A 1WTOA 5C44B 1H9SB 4KY6A 2NYZD 1AP0A 3VYTA 2SDFA 2N0SB 2A69D 1JQYD 1PRTF 1OFFA 2FUG1 3R8BA 3SXHA 4FP5D 4WIPA 2I46A 2BYTA 3W5VB 1H9KA 1RD9D 5IGCA 1O7ZA 1PRTC 1SNQA 3EQLC 1JWAD 1B2TA 4DGZA 2G9HD 2PIAA 1LTID 3ND9A 5HI1A 3Q24A 1HFGA 3CHBD 5IGGA 4G7ZC 4S3SA 3R3OA 1V1PA 2E2HB 2YYZA 1JR0D 1EEFD 3NVVA 1E2WA 5EBDA 3FAHA 3E0JA 2NBFA 1FD6A 1G91A 3A8KE 3E5SA 3IKJA 2OEOA 2L12A 3CRKC 2IW3A 2K5DA 2Y5PA 4ZHPA 1PDQA 4G57A 1WTXA 3NVYA 1C4CA 1N63A 2SAKA 3VR6A 3NRZA 4EE2A 1SNPA 2F0TA 3D31A 1KLGD 4WRDA 2F0HA 2HTME 2MJ8A 2NVYB 2E75C 1EIGA 1Y8PB 3GP7A 5I2YA 3ITPA 2IGGA 4CJ0B 3H09A 4K8JA 1F2RI 5C0XG 4C7ZA 2PPBC 5ELEA 3SK4A 1J7AA 4KI0A 5I2XA 3PUZA 1Q3LA 1ZEQX 1LV9A 3X3MA 1QOFA 3S1MB 1A3TA 2F3VA 2JSOA 1NEKB 5D3IB 2D2CC 2LFNA 3E6ZX 1R4QB 4MACA 3I8ZA 1E2VA 5FKAC 3J81L 3BDOA 3TP7A 2EE1A 4KKTA 1Q1EA 4RAUC 2FHTA 5JEAJ 2QJLA 4OZBA 5DAUA 5I6WA 2SOBA 5BN3A 1IHZA 5IT9L 3D3RA 1H9RA 2WDVB 1P7EA 2EJMA 3KF8A 2CQAA 1F2LA 1WD0A 1GUGA 1BCPB 3NWTA 1KH0A 1LLRD 1ZXIA 4KKJA 1K53A 2F0IA 3CKIB 1MHXA 3E9SA 2CW0D 2Y0SB 2XNAC 5IGEA 2JEBI 1NR2A 2Y5CA 4J1MA 1T5XD 1OQRA 2WXLA 1AZQA 4RNAA 1EY9A 4B0EA 1CQVA 1LTTD 1C77A 4LLGM 1FRDA 4NW2A 3PV0A 1SSOA 4QB4A 4BS9A 4ODGA 1PTOC 1DOKA 2JA5B 3T3NA 3T4AC 5IIFA 1QOBA 3WOEA 4WAFA 3VR5A 1MSHA 2TMPA 3NQTA 2Q8TA 4XWTA 3VYSA 4ZUJA 5FO9B 1SYBA 2L52A 1HCZA 1MI2A 4WQMA 4H13C 2PNRC 3JAML 2BTEA 5A2QL 2W82A 5G5GA 3NVZA 1E0BA 4DK0A 1IBXB 1E6EB 3C8YA 1D1KA 2OEDA 2FFKB 3M4YA 3PUWA 1EYDA 1NUCA 2NVXB 1VMPA 5AUKA 4KTAA 1KF6B 1SDFA 5FLXL 2M56B 3DWGC 4XIGS 1XYIA 4H44C 4J3OD 4M8AA 4C56C 3HVZA 2AX5A 3AEGB 1H9JA 4L8JA 4KKUA 3Q22A 1MPEA 1TU2B 2XSCA 3I90A 3U4EG 3MJ5A 2D5GA 2X38A 1TKEA 1J8IA 5JPNC 3IT4B 1PMRA 2WXQA 3KBXA 1GOZA 1VR9A 1Q1BA 2WS3B 3SVMA 2KQ4X 5D14A 1AEXA 2Q8IB 2G9DA 4RKBA 1T6BX 3VA5A 3AMUA 1OXUA 1ZYRC 5C3EB 2FE8A 3AEDB 2L0CA 2JWUA 2JU6X 1D1IA 3LXFA 3NBIA 4ID6A 1XLOA 2NVQB 1V43A 2Z4IA 5D65A 3J80E 4WURA 4HTHA 4EQPA 2XWBB 1TY0A 4FF1A 1DONA 1XX8A 2MJEA 3U7ZA 1PGXA 1AWDA 4AYBB 5TSSA 4XQQA 3A8JE 2BS4B 4TQ0A 2RKSA 2LFIA 5K5PA 3NE5B 2F0GA 4IDIA 2G1EA 5D3DA 5COYA 4R8NA 1K8OA 4RCOA 4MM3B 3P1HA 1CA6A 1GUSA 2BE5D 4WFN3 1PGAA 5KEEA 4RCNA 2BS3B 1MI0A 5GXGB 1SE4A 2CJOA 1I6VC 3J7AF 2PVOD 2JSVX 3SR1A 3NTIA 2B2VA 4C3JG 1XWEA 3D6WA 1UAPA 4IFDH 1Y8OB 4G7HC 1JMLA 4KV6A 1TWAB 2B8FA 1DOLA 2F0QA 3EGRA 4P6VF 2WLBA 1N61A 2LMCB 1ZXHA 2HCCA 3MC0B 4J6HA 1L4DB 1O7LA 3SK8A 5CV8A 3SFEB 4ITKA 2WXOA 1QNUA 3ONAB 3HOYB 1TQOA 5BMIA 3CQZB 2BOSA 4DXFA 5F2DA 2R7ZB 1Z6HA 2X6GA 2R6GA 3J9CA 3PIO3 1YNNC 1D5ZC 5M5XB 1Q90A 2R3ZA 3BS1A 1X32A 3CRLC 3L3OC 4X3UA 4HSVA 4C1NI 4QUFA 4USAA 2E3TA 1BO0A 3FKIB 2KMMA 1EY0A 3S9WA 1HPCA 1HZ6A 2BB5A 1Z47A 1D4BA 2F0EA 1WRIA 2VB3X 2IT1A 3I3CA 4CKBA 1WXQA 3GTMB 4DQOC 4AQ7A 2V3PA 3AN1A 3RMHA 1BOSA 4IOIE 2J7ZA 1C79A 3V96A 3B9JA 4ZRQA 2HUGA 4IURA 3C46A 5E4WC 2LMCA 2F0KA 3AH7A 5BYSA 5M5YB 2BDOA 3LX0A 2VZKB 1XLQA 4IQZA 4RGTA 4CHTB 5D7GA 3HRZC 2EY1A 3GV3A 5AUIA 3AEFB 3KK7A 1XXGA 3GS2A 1YN5A 5C0XJ 1HQRD 4IUNA 3EVQA 3PUYA 2OXPA 4I65A 4RGMA 4V0BA 2WXHA 3UI2A 5ELFA 3QOLA 1RKNA 4HCEA 4NAMA 1YJJA 3UI3A 1F2RC 2RDGA 2AQ3B 4C3IG 2WAQB 4N9TA 2DLBA 1D2BA 3G6JB 3HGBA 1TYGB 3AE7B 1RTOA 2JYEA 2JE6I 2K01A 3NWSA 3S1NB 3OPOA 3VQIA 2Q5WD 4H0LC 1IGCA 1SSNA 3ZYYX 2JX5A 1ESRA 4BY7B 5T8IA 2O4XA 3OWFA 3S15B 1OXSC 1QWYA 2A6HC 5K36H 3MA2B 5IGBA 1UGJA 2LHEA 2B2WC 2F0OA 1C78A 3KWVA 1YN3A 5C4HA 3VRAB 1RYJA 1ILPA 2C9OA 3TZUA 4G7OC 3ETRA 2DN8A 2N88A 1XTCD 4N9PA 5JAVA 3NPPA 2PKOA 3VA7A 1N62A 3DEOA 3TEXA 1JE4A 2WIIB 1QG7A 5G5HA 3NTHA 1ILQA 3A7AB 4R9WA 2WKCA 1XLNA 3OIQA 1GHJA 2B8GA 2VB2X 4H7BA 1WCMB 1JWSD 3Q8AA 2FMCA 3GTKB 1VZ6A 5ISRA 1GUOA 4ZQ3A 3LWUA 4ILWA 5EE3A 3T51B 1SF0A 2HDMA 2EYHA 2JA8B 4KD4A 2OT2A 2ACZB 4YSYB 4FXDA 1HA6A 2K3UA 3FILB 4OZAA 1TZOA 3I91A 1CZPA 2A6EC 1SE2A 4CKEA 4N6EB 2L83A 3PO3B 1RWSA 3IAM1 1O7YA 1VF7A 1EY8A 4YTNB 2K05A 1WYGA 4FXGC 3H6MA 5EE1A 1ONLA 2IPKD 4X3SA 1VCIA 4OVZA 4RWSC 3T16A 3C2PA 2AWNA 2ON8A 2RMMA 4US8A 1IKLA 3DWAA 1NI3A 1M8AA 1IW7C 4REZA 3QO2A 3BG3A 3C1FA 3MHZA 3CIRB 4N58A 2LJIA 4QCLA 1TVXA 1N5XA 3Q69A 4PMCA 4US9A 2JEAI 4CQNA 2R61A 1LO5D 2XN9C 1CFMA 2K6AA 3SE0A 1QQRA 4IKGA 1JORA 1CK1A 4PQXA 5EKKA 4ABNA 2MJ3A 3AE1B 2INPE 1B50A 1GUTA 1PRTD 2MUYA 2BBCA 4WWMA 4NAWB 4HSPA 2J42A 4JK1C 1F9SA 3D6CA 2RSOA 4PMWA 1SJHD 5KRUA 1FMAD 4J8QA 4A8XC 1A15A 1QJOA 5CGKA 1YQ4B 1Q10A 1GJXA 1WTPA 4ZK9B 2HDEA 4A6QA 2JYOA 2EZVA 3GV6A 2KWDA 4DXGA 3RLFA 4KN4C 3I70A 4TMAB 2X6LA 1PZID 4UDUC 2KECA 3MXPA 3AE5B 4TKOB 1OXXK 2EVBA 1BXTA 2EDGA 3KBGA 5E3FA 1PFMA 2R93B 1G2SA 3NQIA 1L5PA 4IFDG 1EYAA 1GHKA 3NHHA 2ID0A 3AE8B 4OGQC 4FNFA 4PV1C 1PRTB 3TP6A 3I4LA 1FYCA 3VYRA 5LL6X 4A3EB 4N59A 4A3FB 5ELBA 2CU3A 3GD7A 2O2LD 4LK0M 1RDPD 2F0VA 4KN7C 2F1MA 3EUB2 1H9MA 4BBSB 4KHVA 3PZ7A 4IUPA 5CR3A 1BUIC 1R4PB 1NSNS 4C80A 3DMUA 2XVSA 3E56A 3K6OA 5EGTA 4U673 2D62A 1PLFA 1BMLC 3J7AV 3NXWA 3U2SC 1HRJA 1IL8A 3CWIA 4LK1C 2LEKA 2PVGC 2K5WA 1E7PB 1F9QA 1KABA 4EQOA 2DY8A 2E2DC 1BF4A 2C5CA 2F0LA 1IGDA 3V05A 4LMQD 4ZKCB 3T53B 3IT6B 4FF4A 1EY4A 2H1EA 1L4ZB 4A90A 2IX0A 1VLBA 4JPSA 5H92C 2M9VA 1F2ZA 1G6ZA 2M0AA 3N52A 3FC4A 4A3DB 1EZ8A 5C0XI 5HURA 4RA8A 1F2MA 2A68D 2EYPA 1I4XA 2HQEA 4XE0A 4MIUA 3DEPA 5EE9A 1FXIA 3AE6B 4LTUA 4GDKB 2QEJC 4XQJA 1SEBD 5FLXE 2FBWB 1L0YB 1G8ZD 3DXJC 3NVWA 2EKIA 3MZ5A 2K5QA 3I9V1 1HFNA 2DNEA 5FO8B 3FPUB 1QNKA 1B1ZA 4K5VA 1DOMA 3SEBA 3GTLB 1PXUA 3D8GA 4TRDA 1GUNA 4KK7A 3GTPB 1QCBD 1E0ZA 1NAPA 2LKVA 3TEWA 4U68A 5CV4A 3QG1A 1JICA 4RGNA 3OMGA 1QB5D 2BT6A 1CA5A 2B2YA 1WWTA 1DOXA 4ZKBB 1SBBB 2PO4A 2KCCA 2FINB 3MAQA 2ZXOA 3KLSA 2Z1CA 3P4SB 1C9FA 4M0WA 2Z8LA 2AQ2B 1LTBD 1K8MA 3SFDB 3BDLA 1U9RA 3NUHB 5IODA 5E6JA 2F0NA 5C3JB 5E4XA 1L6VA 1IYUA 3L9AX 3DWPA 4C3HG 2MP1A 1O80A 1QOAA 3R2IA 5JJZA 4ZUIA 1EQVA 3Q8FA 4XT1B 1GB1A 3AB5A 3NSWA 4IFDJ 3PO2B 2MPMA 1DCZA 4KKIA 4YIJA 1IUEA 1DXMA 1KAAA 5J1ZA 1RFKA 3PO0A 1HTLD 5LHY1 2WU5B 3MFGA 1CHPD 1FD7D 4NZLB 4YTMB 2PMVA 3A7LA 3G7LA 1L6UA 1HHVA 2EY5A 3GTOB 1K83B 1TR5A 5CYUA 1DM0B 2TSSA 2ZXPA 4X3KA 1QLBB 1A3UA 1KTKA 3I4MB 1ESFA 4FXCA 3K57A 2K9XA 5BMHA 4Q2JA 2WQYB 3S2HB 1IKMA 2L9HA 3IFTA 2VZKD 4JE3B 3FDTA 5EKIA 2JP1A 3OW7A 4YSXB 3GTJB 2EOTA 1PUTA 4O42A 1WTQA 2A5HA 1C8CA 1B3AA 1CJEA 3AE4B 1HUNA 4QUCA 1YN4A 4CBVA 2PTLA 2F0PA 3NTKA 1BCPC 1WVLA 4Q5VA 1ACCA 4NKLA 2RDFA 3OWEB 4PMBA 4HJGE 1F0ZA 1STGA 2QIEB 3EROA 1NENB 1XF5L 5BMGA 2I07B 3I57A 4B9WA 5J39A 1C4AA 2NB0A 1VDZA 1TS3A 3HRDD 1FIQA 1GB4A 1TS4A 2RA4A 3OIPA 2AUJD 2EYMA 1HTPA 1ZYRD 1AYFA 3N6RA 1E9MA 1U4MA 3H8HA 1HEZE 5CV6A 4KHZA 2N7JA 1OXVA 4CJ1B 3W2DA 1FNVA 1B9NA 1XCQL 4KD3A 2N9KA 2B2UA 2E74C 1CTMA 3RZOB 5LNK1 1KDAA 1MHHE 3M4OB 3PIP3 2L1BA 4KGTA 2A6HD 3ZGZA 4C3HB 1S5DD 1EY5A 1JWUD 2A69C 3MFYA 2QMTA 2WXIA 3KQ4A 4ZLTF 4IUQA 3MWYW 2F0FA 2A68C 1I3QB 2J0TD 2B63B 2Y3AA 1EWYC 2KJXA 2K03A 3K58A 2A6ED 3V2TA 2GRIA 1C4PA 3AU7A 1FEHA 2RQXA 4IALA 2PZTA 5M3MB 4KKSA 5C5LA 1TY2A 1JROA 3ABVB 4P16A 1A2UA 3HS0C 4IUTA 4EVOA 1I4HA 3MHBA 1TWHB 2PMZB 2EY2A 2J52A 2PW9A 3SK5A 4WJWA 4DAYA 1VDVA 1L0VB 1TKYA 4BWGB 4RGOS 4G4KA 1T3QA 2W54A 4DAVA 2LHDA 2B2UC 2FJ2A 1DOIA 4DNRB 2WU2B 4OHJA 1XO3A 3P42A 1LT4D 3K5NA 2JA7B 1ZDVA 1CT1D 2F4IA 2H4OA 3DWMA 4L23