1M4VA

Crystal structure of set3, a superantigen-like protein from staphylococcus aureus
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
200
structure length
196
Chain Sequence
AKYENVTKDIFDLRDYYSGASKELKNVTGYRYSKGGKHYLIFDKHQKFTRIQIFGKDIERLKTRKNPGLDIFVVKEAETVFSYGGVTKKNQGAYYDYLNAPKFVIKKEVDAGVYTHVKRHYIYKEEVSLKELDFKLRQYLIQNFDLYKKFPKDSKIKVIMKDGGYYTFELNKKLQPHRMSDVIDGRNIEKMEANIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SET3, superantigen-like protein
publication title The three-dimensional structure of a superantigen-like protein, SET3, from a pathogenicity island of the Staphylococcus aureus genome
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Immune system
total genus 54
structure length 196
sequence length 200
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
A PF09199 SSL_OB Staphylococcal superantigen-like OB-fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1m4vA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1m4vA01
1SJED 2G9HD 1LTGD 2XNAC 2Z8LA 2RDHA 5ELDA 1T5XD 1TS4A 2ICIA 1CHPD 1QILA 1TY0A 2AQ2B 1LTSD 1TY2A 1SXTA 1S5DD 1TS5A 5TSSA 1CHQD 1V1PA 4RFBA 1EU3A 1I4HA 1S5ED 1PRTB 4O1NA 5ELFA 3R2TA 1LTAD 3KLSX 1JQYD 4L6TB 4BWGB 1PTOF 1JWMD 1CT1D 1KLUD 3MC0B 1FNWA 1ENFA 2O2LD 1PRTD 1AN8A 4DXFA 3O13A 2IJ0A 1SE3A 1I4GA 1SE4A 1CQVA 1PYWD 1S5BD 2IPKD 4C56C 5D3IB 1GOZA 2R61A 2TSSA 1PRTC 1BXTA 1KLGD 1DYQA 1ET6A 1FGBD 3BYTB 1UUPA 1G8ZD 1D5ZC 2QEJC 1SBBB 1UNSA 4RGMA 1PTOB 1JCKB 1LTBD 1EU4A 5ELCA 1MD2D 5FKAC 2WV6D 3URYA 1V1PB 1LT3D 2AQ1B 1HA5A 1D5XC 3R8BA 2CHBD 4DXGA 2NTTA 2AQ3B 4ZYSA 1PTOD 1RCVD 1LT6D 1I4RA 1FD7D 1JR0D 4RHSA 1YN4A 4NZLB 1PTOH 3GP7A 3OWEB 1LTID 3TSSA 1JWUD 1FNVA 1PTOC 1LLRD 4RHRA 1BCPF 1BCPD 3R2IA 1HTLD 2XRSD 1EFID 1L0YB 3EA6A 3DWAA 1SEBD 2XN9C 4RGOS 3BZDB 3BVZA 3CHBD 1PZKD 2QILA 4L63B 3BYYB 1EEID 5ELEA 1YN5A 1BCPC 1FNUA 1LT4D 3DWQA 2NTSA 1AW7A 1LO5D 1HXYD 1S5FD 1TS3A 1XXGA 4RGNA 1TS2A 1L0XB 1HQRD 2RDGA 1I4XA 1PZJD 4RGTA 1BCPB 3W2DA 5D3DA 1RDPD 3DWPA 1ESFA 1SJHD 1RF2D 5I4DA 1ET9A 1V1OA 4K6LA 1YN3A 1EEFD 1LTRD 5ELBA 1M4VA 3BVGA 1KTKA 2SEBD 4RCOA 2XRQD 1JWSD 4RH6A 1EWCA 1F77A 1SE2A 1DJRD 1S5CD 3BVMA 1I4QA 1I4PA 4TSSA 4Z9CB 3V05A 3EFXD 1B44D 1CK1A 3SEBA 1STEA 1PRTF 1PZID 3MFGA 4OHJA 1XTCD 1RD9D 2J4XA 4UDUC 1D5MC 5FK9C 1LTTD 1D6EC 1B1ZA 1LT5D
chains in the Genus database with same CATH superfamily
1LM0A 4JI6Q 3GTLH 4QQBX 1J7CA 4ZRIA 3J80L 1YHQA 2MA9B 4QMGA 1EWHA 1GUOA 1GUAB 4HMIA 4NXML 2ZCCA 1ESRA 4XT3B 2L8JA 2XK5A 1N36Q 4XDDA 5ISRA 1FXAA 1KABA 4C80A 2SNSA 1VQJA 4A3DB 2VRRB 1RRBA 4ZUIA 4ZRKA 1K8AC 1HZ6A 4DWFA 1EQRA 3DMUA 3HOXH 4II3B 4KX6B 4H02A 1D7QA 2DYBA 1X3EA 4IJHA 3KUDB 1GUSA 1ILQA 4C2MB 4QIWE 2NVTB 4Y7NB 4IWOA 5CBEE 1S4ZA 4PQXA 3C8YA 3M4YA 3O13A 1FMAD 3PS6A 3VR3A 3I5JC 1C79A 1PYWD 1F2ZA 2GBMA 4GNXA 1SE9A 2EYJA 4MGIE 3X23A 1WGGA 1JB7A 4J6HA 3PRMB 2D3AA 2VUMG 2IGHA 3GTMB 1FM0D 2L11A 5C44B 4FJZA 4OELB 4DR4L 1N5WA 1SBBB 1UNSA 2F0QA 2LKVA 4RGMA 3SK5A 3A8KE 3VR2A 2UUBQ 4BY1H 1N32L 1CKNB 3HEJA 3I57A 3Q8EA 2K3UA 4JI0Q 1LT3D 4XT1B 4LFBL 4W9DA 4HAEA 1QVFA 3DM3A 2NVXB 4Q5VA 2WXPA 4YSXB 3MVVA 3EHVA 1CJEA 1XNQL 2O6VD 1Q5WB 3CSTA 3MJ5A 1XLQA 5C0XI 1DGJA 5IP9G 2FINB 2JWUA 2F52A 3RZOH 1S72A 1VRAB 2LVOA 3TEXA 3J81c 3QC8B 3PLVA 2LXAA 4K2KA 3HOYH 1MI0A 1WCMH 4ARIA 2AMCB 3RNGC 4K5WA 2IWHA 4EZLA 1X1MA 3CHBD 1I5FA 2F0LA 3BYYB 4IN3A 3C2PA 5FO9B 4EQOA 1C4PA 3OJ4B 3E0JA 2KXJA 4A20A 2VH2A 4YCUA 3K57A 2KQ4X 1A15A 1UGJA 3VHTC 3S1RB 1WSPA 3GE3C 1D1IA 3I91A 1MVKA 4M8NA 1YNJC 2CFMA 4ZKBB 3WAMA 4CJ0B 1STGA 4BFRA 3BDLA 4ZRJA 2JN4A 5IGGA 1Z5SB 3VR8B 1GUGA 2NVYB 4LK0M 4NY0A 2GVAA 1TWCH 1YN3A 1ICWA 4NJCA 3VVWB 2KECA 1VQ8A 4C3IG 5CV7A 4A3GG 1KDBA 1LV9A 3H8HA 4GZYC 2Y5BB 1JJCB 3PO3H 4P72A 5IA7A 4PG3A 4LMQD 4Z9CB 4U673 5ELOA 3CD6A 2PEAA 4GLXA 2X8XX 3TBLD 3LB8C 1Y8NB 1PFNA 4DUZQ 3B0AA 3KF8A 4LF5Q 3DBLI 3P2BA 2J4XA 1PH6A 1FL0A 1D6EC 1WVLA 1FRRA 3PF4A 2OEOA 4ACFA 3FKIH 2RCFA 1Q12A 2UU9L 1Q46A 2M19A 1WR1A 4DR2Q 4W9CA 1EYGA 2BVCA 3Q8FA 4DFAA 4YT0B 2ICEC 5H1SE 5IODA 4A3EG 4DQOC 1N61A 1SMXA 1WXQA 1OFFA 2MLBA 2PLPA 1XLOA 3H6MA 1STNA 5KGUA 4FADA 1S5DD 1T6BX 2L83A 4BKSA 1FEHA 4A3IH 3KOJA 2NN6I 4HJ7A 3S1MH 2KJRA 1SR3A 2PMZB 2YU9H 4AYBG 4US9A 4FJVB 2B2UA 3H09A 4R8IA 3E9IA 3SDLC 2L0CA 1J6QA 2PNHA 1QOAA 4LFAQ 1QOGA 2K03A 1L6VA 2PIAA 5BN5A 1VDZA 3PO2B 4A3DH 4A93G 2UU7A 4S0RA 3QIJA 1WTHA 5CR3A 2ZT9C 4E71A 4XE0A 1G6JA 4KKIA 4C2MH 2BWES 2FBWB 3NEMA 2F0NA 4Y7NH 2R7ZG 4P1BC 4CHTB 1EY6A 4YY3L 4WJPA 3VH3B 3NTIA 3GQBA 1L0VB 3ZRFA 2Q2IA 1H9SB 2PZUA 3D0FA 3GTOB 1JCKB 1O7LA 4LUOA 3BU2A 4A3FG 4HLEA 2L0FA 2ASBA 1OO9B 1EWIA 1ZXIA 3TBIB 4NNJB 2LASA 4JI4L 2WGSA 2KA7A 1RCVD 1UAPA 4K6DA 1LQBA 3GTMH 3CKIB 4A3MB 1V5OA 2LZ6A 4HJGE 3SR6A 3K0XA 4RHSA 5C44H 2KC1A 3TCAA 1YN4A 2E6XA 2L7RA 2GA4B 2N7DA 4M8MA 2JXMB 5IGEA 3TSSA 2K5QA 1K8RB 1QNUA 1Y1WH 4J15A 1Z9FA 2Q2HA 1AP0A 1O7YA 2KVZA 2EY1A 4FF1A 1KM7A 3APFA 4URKA 1SYGA 5M5WB 2QJLA 4C00A 2JT4B 3LGJA 4FO2A 3CRKC 3TJPA 2N78A 4IUVA 2WXKA 3RT3B 2OOBB 4BS9A 1YOVB 3UI3A 1QZGA 2KHSA 3J81j 2V3PA 4E6IA 3NHHA 3UIOB 4DDGD 1XXGA 3K9PB 2VH1A 3WALA 2K5NA 4K5XA 1GUNA 4OO1I 3S2HB 4B3RL 3EIVA 4B3MQ 1I4XA 4IUMB 3KWLA 1XLNA 3ENEA 4PK1A 1QUQA 4LDTD 1WRDB 1FVIA 2CQAA 1WJ4A 2WDVB 3AE8B 5FLMH 1J0GA 1ET9A 1DD2A 2EYLA 2MP1A 2FAZA 1TQOA 2NBVB 3U4VA 2RPQA 2YVCA 3QX1A 4HJ8A 2PMZE 2WXIA 5EKLA 4DV1L 4EQPA 4WJOA 1HZCA 3A54A 4OO1H 1HHVA 4KKJA 4ZRQA 3HOXG 2N9PC 3MC8A 2JVCA 3L16A 4NDXA 3GTQB 2PMVA 5E4XA 3VYTA 1K8OA 4FNFA 1J7BA 1TWAH 1KRSA 4X3KA 2NVYH 4KK7A 5CYUA 4MIUA 1YNNC 1PRTF 3HRDD 4DR3Q 4KY6A 2LHEA 1RD9D 5J22A 2UYZB 2RPVA 3UDXA 2E2HB 3ZO5B 2K0PA 3VAWA 1SE8A 4KKUA 1VQ4A 4NXNL 4TKNA 4DHJB 1KAAA 1Q3LA 4R4CA 2PE9A 3UIPB 1NI2A 4GKJL 2B3GA 3AEAB 3AEBB 3U9OA 1TS4A 3MEFA 2J42A 3H91A 3T16A 4BY1G 1J8CA 3MXGA 3MTNB 3ZNZB 2KWUB 4IG7B 2MHJA 3PIP3 1XD3B 1HNZQ 4RFBA 4CDFC 4TQ1A 1LACA 2XVSA 4IZ8A 1VMCA 3KLSX 2AKWB 1VQEA 4G4KA 3B9JA 2KQSA 3HHMA 3R7QA 4US8A 3V96A 1E9MA 1B4OA 4RKBA 4HJKA 2N4FA 2KQ7A 2NBUA 2WKCA 2BW2A 4ZLTF 1X32A 2B29A 2LMCB 2A8VA 2Z9HA 2AWNA 3WOFA 2BF8B 3A9KA 4G11A 2K1BA 1HZBA 1P98A 1CTMA 3MA2B 1QLBB 3MC9A 2R61A 2KDBA 1Y8OB 4B6WA 3HOYG 2F0SA 1VQBA 1RM6C 1DYQA 3EGRA 3Q8CA 3UE1A 1XJVA 2W3SA 3J80E 4OVZA 1IL8A 1CSPA 2K14A 3I3CA 2JYTA 4OW0A 4OWXB 3WA0A 1IP9A 4P1CC 3PO2H 2K8HA 2BS4B 4E74A 2J52A 5JHAA 3UDFA 1HJPA 1WE7A 4JI6L 3OLMD 1PGXA 5IT9L 2KUMA 2EZVA 1ZYRC 1WMHB 3R8BA 3GDEA 3M63B 5NUCA 3QWNA 2NUCA 3NWSA 1LT6D 3MTSA 3A9JB 4QL5A 3MP9A 1N36L 3T3OA 1KRHA 4F1SA 2A5HA 1EY5A 2DN8A 1X3QA 5J39A 1YJ9A 3A0JA 3KQ4A 1X54A 4TQUS 4DA2A 3GTOH 1C76A 2KEDA 1EQTA 3A4RA 4MDKE 4B9KA 2BB5A 5BMHA 1VDVA 1C9OA 3KUZA 1NSNS 2VS1A 3RNBC 3PO3G 4B0MA 3BVZA 1V9JA 1AZQA 4K2LA 4A6QA 4ARCA 4NQLB 2EJGC 1F2MA 1CMXB 1YNJD 4USAA 3AMUA 1LO5D 1PH5A 3EECA 3NZ3A 4DUYQ 4WJQA 1WX9A 1L4ZB 5DPSA 2Y0SB 2GBJA 1WFYA 2O2VA 2WXGA 2D0PA 4YIJA 2CH4A 4J1MA 3WIMA 4R1JA 4LF6Q 3FKIG 2A19A 1SNQA 2V3SA 4R8NA 4KGRA 4ANVA 5M5WH 1TZ1A 2RBMA 2UUBL 1E2ZA 2SAKA 2RSUA 4FXCA 5IGDA 2BA1A 1CA6A 4EQNA 1U4RA 2K5WA 3OPOA 1IW7C 3R3OA 4FF2A 5M5YB 4PZ8A 4JI0L 1SYEA 4M01A 4A3IG 2R93B 4ZRZA 3J7A5 3S2HH 1AE2A 5FR3A 3NPPA 1PMRA 2D3GA 3AE4B 1A70A 4ICUA 4QJFA 2KAJA 2F0TA 1SE2A 3PMFA 3QR8A 1HRJA 3PSIA 4M1UB 4MGKE 1B44D 1CK1A 2CJNA 5LXHA 3EUB2 4A3DG 2NCNA 1YX5B 1Y56A 3A7AB 2K22A 4G50A 1B3QA 2KCMA 3QG1A 1VQ5A 3GTQH 1DOXA 3M9BA 3BZCA 4OXPA 4YWLA 3QOJA 3GTGH 2F0IA 2ICIA 2D3CA 1FR3A 3PRZA 1V8QA 3NTKA 1Q81C 3K6OA 2KWCA 3HOVB 2R7DA 5JJKA 3DVNU 2MO1A 2BPSA 4GDKB 2IO2B 3PIPA 1VQIA 5ELFA 4R9WA 3NBHB 4BBRB 2E2HH 3IT6B 4L6TB 1BBWA 4WORA 3IT4B 1HTOA 3TP5A 4RF1A 5J18A 4JIOU 1EUJA 4PS7A 4IUTA 1KLUD 3MC0B 3PQIA 5C44G 3U7ZA 3M7GA 4ULLA 1V49A 1WI0A 3TEYA 4A3CH 4AH6A 3CCUA 2DZIA 4GDLB 5LMUQ 1LXDA 3M3JA 5CBAE 1Y1WG 4MGZE 2MCNB 1PRTC 5IP4D 3BK1A 3OW7A 1QCBD 1J8IA 2OXPA 3BYTB 1ASYA 1A0IA 1EY4A 4DUZL 4LF5L 3RYTA 4AP4C 3TRZA 4OWTB 2Y0SE 3S1QB 2DUDA 1V97A 2VQFQ 3NQTA 2YTYA 1I6HB 4CDCC 1V1PB 3A8JE 3PVLA 2JQOA 4DR2L 2MO0A 2IHFA 1Y14B 2LWPA 1B9NA 3ONSA 4DK0A 2NTTA 5E7NA 1WTWA 4W9LA 3PT2B 2MHVA 2N49A 5FLMG 4GLVB 1TWGB 3JAML 4BY7H 4L8JA 3VUWA 3UI2A 3K5NA 2LGIA 2C5LC 5JAVA 1VZ7A 4JQWC 4ANUA 4OO1G 2JP1A 1UWMA 1TU2B 2CH4W 1OEYJ 2F3VA 5HHDG 1SEBD 4JI2Q 4B3SL 1A3TA 5BMIA 5ELEA 4YWMA 2LUMA 2J0KA 4IUUA 2J7ZA 1TS3A 1F9SA 2BE5C 4R4TA 3UINB 1ZXTA 3HOUH 3SFDB 1YZ6A 1VQ6A 3RI7C 2L52A 2A74C 2L55A 4H2AA 1JICA 2BQQA 1PZJD 4PNYA 4KSKC 1DOYA 2TMPA 1NR2A 3MXUA 4GLAC 4XIGS 1ZKHA 4MACA 3IFTA 2W55A 3P42A 2C5CA 3I56A 1KL9A 2YTVA 3T53B 1AZPA 1R7SA 2E2IB 4JCVE 1CZWA 1V2YA 1G2SA 3PZ7A 3CCJA 2BYEA 3F2UA 1YNND 3AI5A 5D94A 2IW3A 3KF6B 2LGXA 4K8IA 1N6ZA 1KF6B 2B2YC 4EFOA 1C3TA 3T9LA 2DBYA 1HZ5A 4IWPA 2F0GA 3IFWB 2KOLA 2F3IA 5M5YH 3Q23A 4GOPC 1JE4A 2B39A 4LNIA 3OWFA 2WB1B 2R93H 3I70A 3GTJB 3DVGX 2D2CC 4NPSA 4KY5A 4N8FA 3LXFA 3VQIA 1HTLD 2R92B 1EOVA 1B1ZA 1E22A 3QK0A 2BDNA 2G9HD 4DAPA 1D3ZA 2RQXA 3W3AA 5EE3A 1P9DU 1CFMA 3QHTA 1RTOA 1DZ1A 2K6DB 2C7NB 1EF5A 5M3MB 3PO2G 1LUZA 4B3ML 2EIFA 4DU9A 3ZVVA 2WXQA 2XK5B 4I6PA 1X56A 2KFKA 2KT7A 3R7RA 1E6EB 1QNKA 3PHWB 3E56A 5IWAQ 5D14A 3ZJYC 2D07B 1U4LA 5GMVA 1W2BA 4HCEA 2E3TA 1C0AA 4XYCA 4K14A 2G45B 1NE3A 1ENFA 4P7IA 2N88A 3HOVH 1LGRA 4M00A 3SR1A 2CU3A 5E6NA 2FJ2A 2WINB 3ULPA 3AXCA 1SDFA 1NJIC 4KV2A 2KX3A 2IPKD 3OW2A 4AQYQ 2VZAA 4BBRH 2ZPNA 2ZM6Q 3APDA 2PNRC 4K8JA 1SFOH 3AULA 3Q3FA 1QG7A 4ME5A 4WIPA 1XPRA 4I65A 1WM2A 4L23A 4DR3L 1ZYRD 3DHQA 5TR5A 3DPDA 1C4CA 2O6VA 5G5HA 2ZJPA 2OTJA 1VCBA 1YJNA 1VD2A 3JSVA 4EVOA 4HEDA 2KDEB 2MQJA 2PW7A 2ZPYA 1NEKB 5DLQE 2JXTA 2MJ8A 4Y52H 3DBRB 1M90C 1ILPA 5FO7B 4FN2A 3A1QA 4YL8A 3A8IE 3CCLA 1I7HA 5HURA 1JB3A 1FD7D 1S1QB 4IM3A 3TEZA 2F0MA 1HNZL 2OEDA 1FXTB 1LTID 2JJQA 3S1QH 1YHAA 1ZUD2 4WWOA 2Y3AA 4LNKA 1I6HH 4JBMA 1KIXA 1MSGA 2R3ZA 2JE6I 3WWVA 5L37A 4C7ZA 4MNOA 1EFID 4I7ZC 1A63A 4F88A 2D2QA 1W6JA 1NMGA 5C3EB 3CPWA 2KACA 4N8X1 1VF7A 1TWGH 4L63B 1CZGA 2E5LQ 2XBBC 2WB1E 3RNUA 2N9KA 5M9OA 1Y1VB 3J80i 1UF0A 1X3GA 3LYYA 4XGAB 2A4ZA 5EE9A 4Q0FA 1PVOA 1L0XB 1UWVA 2HTME 1IW7D 1HQRD 2MWSB 1YBYA 2Z6KC 4UAIA 5IT9E 5C3XA 2CCZA 1EOTA 3I9V1 2K01A 2Y5CA 1AARA 1BCPB 2D5GA 1SN8A 5DM63 1RDPD 1WTRA 2ZZPB 2QHOA 2FE8A 3Q3JA 2KMAA 3GV6A 4GXBA 2CVRA 5FOBB 2JA5B 2M56B 1WD0A 1U4AA 2KWDA 4A3OA 2PI2A 5C1ZA 2LFIA 5EPKA 3EVQA 1A2UA 1EIYB 2K1FA 4CHKA 2I5HA 2EY5A 2JA7B 1EFWA 1KAWA 2IX1A 2NBFA 4IFDJ 2K5VA 5CV5A 1E8YA 3QB3A 1TKGA 2YV5A 4OL7A 2PPHA 3GB1A 4N6EB 4A3CG 4IWQA 5CHVC 1SYCA 2E2IH 3VRBB 4LTUA 1XPUA 1L2NA 1TIFA 3ERSX 2I1JA 5HI1A 2K39A 1YEZA 4P74A 3TP7A 3K5MA 1SJED 5AUKA 2BTEA 2L3ZA 1I50B 1F2LA 4QF4A 4A4IA 1UEBA 2J0TD 1LTGD 4KD4A 3J80c 4DAYA 1FPYA 4K7SA 1RL2A 3T4AC 2B63B 2LXKA 1PDQA 3W1SA 3P1HA 4DUYL 2IY5B 4CJ2C 3HKZG 3S1NB 2REXA 2UXBQ 2H89B 1JOOA 2R6GA 4LF6L 1H9MA 1GHKA 1IUEA 1S3SG 2JA9A 3HM6X 1LTAD 1YNTE 5KHQA 4AS1A 2NZHA 3JVZX 3PV0A 4CQNA 4XDCA 3L0WB 1CI3M 1XT9B 3IHPC 4HIDA 1K0SA 3J7ZC 1RWSA 1EWYC 2LXCA 4BY7G 2B2VA 4HROA 1ASZA 1PRTD 1HNXQ 2K52A 1ZDXA 3LNNA 3MXPA 4X64Q 4HEA1 4JE3B 1A8VA 3NP8A 3C0RB 3KW5B 3F2BA 2CHWA 3PV1A 4LNQA 2HDLA 2BCOA 1KLGD 2K05A 3I4NB 1WM3A 3ML9A 3PIOA 2M1MA 3DQVA 3Q22A 2HQLA 4EZKA 2B2WA 2WX1A 1PTOB 2M4NA 3D32A 3PSEB 2LVPA 2EYFA 5ELCA 2SDFA 3HOUG 1E7VA 3GO5A 3URYA 1STHA 3H0GB 2G3QB 1HA6A 2BWFA 4G7ZC 2FUG1 1UELA 1EF1A 3B08A 3AE2B 3CU7A 2KENA 4OIJA 3GS2A 1QVGA 2VB3X 3W9CB 4FF4A 2L32A 1AH9A 3AEGB 4NZLB 1CSQA 1XX8A 2ALYB 4CKBA 4MHEA 4JOIA 4DNRB 1PGAA 1PLFA 4EKUA 2ZTCA 3BY4B 2XGTA 2Y0SG 1YITA 4HMJA 4PV1C 3SDZA 4KGSA 1P8LA 2H88B 4NP5A 2BE5D 2LGSA 4B0EA 4B9XA 1VJKA 3AE6B 2WXFA 5CV9A 4DAVA 2JA6B 4MGYE 3H6NA 3NK9A 1SNMA 1BCPC 4C3HB 5LMUL 4ITKA 4B3TQ 2GB1A 2WWZA 1M8AA 1HXYD 1PH3A 2R93G 2HDMA 1WD1A 3Q6SA 4PYZA 1EYAA 4NAWA 3ERQA 1P16A 1WFQA 3HKSA 3PHXB 3KJOA 1WIAA 1TKEA 2KYWA 3C19A 1BKBA 5CV4A 4F8MA 5C3EH 1FO4A 1A2TA 3J7AV 4G7OC 2JRIB 4MSQB 1QUQB 2LVQA 4MM3A 5KIXA 1GO3E 1SMYC 1V1OA 4OGQC 3JAME 2VQFL 2FUHB 2M2LA 4JG2A 5D2MB 1EEFD 5E6PA 1Y1VH 4JI3Q 1KXLA 4JBKA 3N9YC 3Q3MC 4GSWA 2PQAA 1P3QU 5DPTA 2Z0SA 4RH6A 3R93A 2EOTA 4DN4M 3L2PA 1X6OA 2BKFA 3BVMA 3T3NA 1UBQA 1I4PA 2VY3A 2AWTA 1DOMA 2K04A 3I55A 3AE5B 1AFPA 1DOLA 3FC4A 4XYOA 3S2DB 4WJ4A 3HOVG 1G291 1D1KA 3OSOA 3HVDA 1JMLA 1GVPA 3F2CA 5CV8A 2JA5H 1AEXA 2RKSA 4P75A 4HKQA 3MXNA 3M95A 1EZ8A 1O7IA 4BBRG 4M0WA 2DWQA 2KZRA 3QJYA 2Z8LA 3H15A 2JA7H 2WX0A 5EKIA 4WQOB 2CR5A 1ICFB 2NB0A 4GS3A 4PMCA 4HKZE 1YNXA 1TS5A 5K36H 1CHQD 3ND8A 3QO2A 3P63A 3R2TA 2I07B 3PCOB 4RWSC 5GAEC 1I50H 2CHZA 2VZKD 5JPMC 5A2QL 4LF7Q 1NAPA 1JWMD 3D31A 4C3JB 1ZDVA 1EY0A 2O2LD 5CGKA 2V3NA 3Q24A 1UE6A 4DR7Q 3PUWA 4MTKA 3I4LA 2JXXA 1SE3A 4F87A 3S15B 4GU2A 1X3PA 2HCCA 3MFYA 3A9KB 5IOIA 4OONA 2TSSA 1XYIA 3NRZA 3NWTA 1QJOA 3P7JA 1E8WA 1GUTA 3J81L 5M3FB 3AFQA 2KOXA 4XX5A 1W6KA 3HOWB 3S17B 3L08A 4IM0A 1E0BA 4BAXA 1OXUA 3C3LA 1X3FA 4CBVA 2ZW0A 2K50A 4LLGM 2V1CC 2QW7A 3PUVA 1LM8B 5JXVA 1E10A 1GNUA 4HXDA 2CHBD 4DXGA 1NYRA 1P1AA 1TKYA 3AN1A 2K5HA 3CP0A 3I4NH 1SNPA 3KBXA 5GROA 1QOHA 5G2NA 1YQ3B 5BN3A 1PTOH 1WTXA 1QWYA 1OQYA 2PPBC 4POGA 1FNVA 2VB2X 1LLRD 5EGTA 1T0QC 1FJGQ 5IWAL 3H0GH 3EFCA 1WXAA 2CS4A 2N9EB 3ECIA 3S9WA 3PO0A 2D5DA 2NVTH 4AOFA 4BBSB 1PHJA 4KY7A 2B8GA 1J5EQ 4W9EA 2NWGA 1HUMA 1FD6A 3HIZA 1FNUA 2EKEC 3ZLZA 4AQYL 1G2TA 2B8FA 1YHBA 2ZM6L 3CMAA 2JRHA 3HFZB 4P2CB 2O2VB 3BIID 1NBWA 3W2DA 5D3DA 2JA6H 2KLGA 5JEAJ 1F9JA 1SJHD 4G3XB 4LUVA 3S14B 3SD5A 4FA6A 1IYFA 4C3HH 3G71A 3NS1A 3TL5A 4K6LA 4OZCA 1VQMA 4EUTA 2KCTA 2EY6A 2LFNA 1MPEA 4RCOA 4OZBA 3G6JB 2NVXH 1WYGA 4DV6Q 3BINA 1T3QA 5H92C 4P16A 2PVGC 1V9PA 3AU4A 2VQEQ 3GZNB 3V05A 2DNCA 5C4HA 1Y8RC 1V43A 3UDGA 2W82A 3P4SB 1UH6A 5BYSA 5I2YA 2HHHQ 2EKIA 2DHZA 3ULJA 1SRUA 5G5GA 3TEHB 2G4SA 4HR7B 3ZYYX 1WGRA 5F2DA 3SK6A 3PGZA 4JI7Q 1LT5D 5J1ZA 3CIRB 4WWMA 2IL8A 1EIFA 4K3CA 2E5LL 4HDOA 4LJOB 1EZ6A 1C77A 1EIGA 3E5SA 3KLWA 5G3LF 3U30A 5CC4A 4V0BA 2YTXA 3GOEA 3S2DH 2L1AA 4OX9Q 1CKNA 2V9HA 4L5QA 1WRIA 3S1RH 5G55A 2OJWA 2QF7A 3FHWA 2MBQA 2LGYA 1A5RA 3VH4B 4ZHPA 4HRSA 1RKNA 3CCSA 2N7JA 3K5OA 3ZDTA 3FVQA 3BDCA 3TDQA 3VFKA 4IFDI 5C6AA 1PUTA 2EYPA 3KWVA 5ELNA 2WDTB 4GMVA 2MRPA 2ZXOA 2RDFA 1S5BD 4RF0A 3L7ZC 4WH4A 1Y69U 2BS3B 5CHFA 2IX0A 4X62Q 2KHJA 3CPFA 3V6EB 3VTUA 1ET6A 3QWZB 3A55A 4C3JH 2DLBA 4HJAA 1QKZA 5JHBA 1QZHA 1D5ZC 1UE7A 3BG3A 4IFDH 3K5LA 2MJDA 5CORA 1EQQA 5C4XB 3S15H 4N9TA 2N8NA 1L4DB 2Z6BA 2BYFA 1U4PA 3H1UA 4L2YA 3CC2A 3IG3A 3W5OA 1BVSA 2JK8A 3GD7A 5C3EG 5M3FH 1K53A 2IO1B 3VUYA 1R4MB 4IURA 2UXBL 4DF7A 2GOWA 5EJWA 3HOWH 3S17H 1NCVA 1RHPA 2KC2A 3GP7A 2JA8B 2AHOB 3I72A 3BWUD 1IBKQ 5HG2A 2HUGA 3MZ5A 4KGTA 1KC8C 5FJ8H 4IOCA 3AM9A 3ITPA 1F9PA 3VR4A 1BCPD 1MBYA 4XXEA 3ZQ4A 1WCMG 4LNFA 4RM9A 4JK1C 1Z2MA 1KDCA 4POFA 2V4DA 4PZ7A 1HNXL 2A5UA 2HTHA 4F8CB 4X64L 3W5UB 3WAOA 1YN5A 1LT4D 3NVZA 4P71A 4ASWC 3Q8DA 5BR8Q 2JA5G 3DEOA 3HGBA 4HCSA 1HEZE 5JVH3 3ICEA 4IJLA 2NBWB 1SMYD 1H9RA 3WCQA 4E3CA 2LJIA 1M1KC 1IHZA 3K0YA 3AMZA 2QMTA 4BBSH 4A90A 3OAWA 2F3WA 2JA7G 2ID0A 4MSMB 1SYFA 3V2TA 1PXUA 2KVMA 1VCIA 4J6IA 1IBXB 2MUYA 2DGYA 1TVXA 3HK0A 1B8AA 4X57B 2I46A 1KQSA 2WXRA 5K36G 3A5ZB 3GTKB 2LEKA 2MBEA 1GJZA 1JMCA 1JWSD 1P0RA 1YIWA 2LRUA 2DENB 4A3MH 2DZMA 4BXXH 3L0OA 3HM3A 3NVYA 3ALBA 1TTNA 5JVG3 1WR6E 2BT6A 3GZNI 3S14H 2DX5B 2ONQA 4PS3A 3RD2A 2LSSA 3N6RA 4XQNA 2BS2B 1GD7A 1XTCD 3Q69A 1PH4A 4WJ3M 3V62A 2AYOB 5FK9C 3ML8A 3T51B 2GI9A 2JEBI 1N8RC 1KD1C 4YHHQ 2WU5B 4A3PA 2E76C 3CCVA 1PV4A 1NI3A 3H7PA 2HD5B 4B3TL 3H3VC 1ZW7A 3IFDA 4KI0A 1PH1A 3TZDA 1K8MA 2N1VA 4K5VA 4DNIA 3JW0X 4LFCQ 1EU3A 3VDYA 3AB5A 3HRZC 1TIID 3JAMi 1GUWA 4KLKA 3U58A 3NOBA 2PKOA 5BN4A 3H3VI 2JX5A 2WP8J 3VA5A 2RF4A 3BJUA 3EJIA 3I4NG 4IPDA 3KVFB 4EQ5A 4WFN3 3C1EA 1WJJA 4JI3L 2UXDQ 2KDMA 2OQ0A 1KLVA 1H4RA 2ZVNA 4C1NK 1STYA 3FMCA 1HUNA 5HGQA 2PJHA 3RPFC 3H0GG 4P73A 2ACZB 4HPPA 4H13C 1G51A 1PA6A 3K58A 3H3VH 2PW9A 3CCEA 1C8CA 3NZUA 1BUVT 3A4SC 4DKAC 3L4PA 1J19A 4ZHOA 3RFZB 2GBKA 1PFMA 1P7FA 1A3UA 3KDFB 2NZOA 1C4QA 1W3SA 5E3FA 3DLLA 4A3KB 4LF8Q 4DR6Q 3L10B 1F52A 3NZSA 4PZ6A 5DM73 2D10A 2O6VB 2BB6A 4JX1C 1MD2D 2PQEA 2WQYB 3Q3OC 1TWHB 3JSVB 3J7AF 3PUYA 2MBBB 1XNRQ 4ANWA 1ML0D 2UUCQ 4MH8A 2KO3A 2B2TC 3RLFA 3NTHA 2JA6G 1A62A 3JAMc 1JR0D 1OQRA 4A55A 1VQLA 2KTFA 3RNFC 3A1QB 4C3HG 2Q2TA 3RCZA 2PYKA 1IBMQ 5C4XH 2DAJA 5E1FA 4KIKB 4ZOHC 1MJCA 2C7HA 4RHRA 4KSLC 4BBNC 2N55A 3G7LA 4LF7L 3AB9A 1VQ7A 3F1ZA 1JOQA 2RDBC 3RUIB 3EA6A 2LY7A 1R9TB 2K32A 4CGYB 4DR7L 4X6AH 5KNDA 3J81E 5AEKB 4DNTB 2EJFC 2IGGA 3ZNHB 4GKKQ 4FYDA 1STAA 5K5PA 1S5FD 4B9WA 1MI2A 3DHHC 1WTOA 1QOBA 1NR4A 3SK8A 2BH8A 1N62A 2L00B 4KN4C 4DR1Q 4TVAB 2H1EA 2CKZB 2UUAQ 1L1OB 3E9HA 2JSVX 3GE8C 3B6YA 3VYRA 3A33B 2DYMA 2A68C 4D2KA 1NYQA 1BO0A 3NS8A 4NPNA 2A6EC 2Z4HA 4XQJA 4LFAL 3DBHB 1I42A 1Z7TA 4RMFA 2K8BA 2R7FA 5LMNQ 1BBXC 4PS8A 3HG9A 2CJOA 3U7DA 4LK1C 1T0RC 2CKHB 2EYMA 1N34Q 4OIKA 2WLBA 2D11A 1T0SC 2BYVE 5C0XJ 2AL6A 4N59A 2YEPB 3ZTCA 3F2DA 1ENCA 5DPRA 1DM0B 3GTKH 4C4VA 1VMPA 4DV3Q 4JI1Q 2YLMA 3DXJC 5JPNC 1BNZA 1Q1OA 2EJMA 4DV0Q 4IUPA 1XMOQ 1SB3C 2MW5A 3AEEB 3DHGC 3DOWA 1J5EL 2J53A 2NVQB 4AYBB 4UY8C 5IYDH 5AZHA 3CXCA 2R2OA 2PZWA 2MBHA 3U8ZA 4C3JG 2QCPX 2IY1B 1TY0A 2K6AA 4DAYB 4IFDG 2E75C 3FRPB 1IKLA 5EKKA 2KNBA 1WX7A 2RGFA 1UEAB 2KK8A 2XSCA 2V1YA 2KDIA 4IC7B 3G6EA 1TYGB 4IPGA 4TMAB 4KJNA 1WF9A 3I3TB 1JT8A 4OEMB 5I6WA 2AUKA 5M3FG 3A9JA 3MHZA 3L3OC 5EQ0A 1HTQA 3KYHC 4TQ0A 1WJ6A 4GOCA 5JEAH 3FILB 3HOWG 1RLFA 3RZFA 1BF4A 3R66C 1CQFA 3BZKA 4DV6L 3KH0A 5IOCA 5E6JA 5H8YE 3X3MA 1CQVA 5FJ8G 3NVWA 1OTCA 1SYBA 4DAMA 5I2XA 3TMEA 2FNJB 2VQEL 1CKMA 3R3MA 5D6JB 3RULA 4A3LH 2HJ1A 1GPXA 2HHHL 3MEHA 4IUNA 5IYCH 5D7GA 1H9KA 2QEJC 2I1KA 3Q8AA 2M00A 1N5XA 5KHOA 4JI8Q 3TREA 3JC66 4AIMA 4IOAA 2CHXA 1TZOA 2GLSA 3FDTA 2L76A 4LF9Q 4BZAA 1KNAA 4YSYB 3PREA 2Z59B 1WY8A 2WU2B 4BBSG 1OTRB 1OXVA 2VL6A 3HS0C 4OX9L 1PGBA 5CV6A 3DDCB 2SOBA 5LNK1 3D8GA 2K9XA 3X3NA 1HPCA 1LYLA 4A3KH 3NENA 2J0MA 1WTVA 5IP9H 1OXTA 3KLRA 4HIMA 1IL2A 2WHIA 1BCPF 3AE3B 3P75A 5CX3A 1TWHH 4GNXB 2PI2E 1DOIA 2ON8A 4A3MG 2VW9A 4BXXG 1GM5A 1CA5A 1MG8A 5MPOA 3I8ZA 2WDQB 3E3XA 2QDBA 1PZKD 1VQFA 1E5WA 5CMDA 3C46A 2I0QA 2HCIA 2K5DA 4LDTB 1B9RA 3DCGA 4A3JB 3DWGC 4IQZA 1L1OC 4U68A 5IGCA 4RGNA 5LMNW 3T1YQ 2B2YA 1WTQA 3TS2A 1CKOA 2I5LX 1EL0A 2FCMA 3EC8A 4X62L 1IYUA 1E7ZA 1ACCA 4WAAA 4WURA 4B08A 4WRDA 4I6LB 3M7NA 1VQPA 4GOPA 1WTPA 1R9TH 2MNAA 3IAM1 4NAWB 4OZAA 3ZGZA 4ILWA 1WJNA 1ESFA 1F2RC 4IKGA 5E6OA 3RNEC 4EEWA 3QCAA 1EUVB 4FHKA 4FULA 4YXDB 3J9CA 3C1FA 3VXWA 3QARA 2Q8IB 3OHXC 4MEMA 4MM3B 4JPSA 3NBHA 1EY7A 3BS1A 3Q8BA 1WI5A 1IKMA 2PQAB 4AUQC 5DPWA 1R4PB 4FLHA 1CUKA 4A76A 4TSSA 1JWBD 4L5TA 2N0SB 1YJIA 3T1HQ 1IBKL 4NJ7A 1I35A 4MJSA 4MN3A 4FJYA 2KANA 4GDLA 4V190 3BDOA 5AJ3Q 1D5MC 1QOFA 1TT5B 1VZ6A 4W9FA 2XWJB 1Q86C 3E0EA 3KJPA 3MXNB 2A69C 1VS0A 1WGYA 4PT5A 4BA2I 3MWYW 3PRPB 4R4OA 4XQQA 2K25A 4M0WB 5FLXL 3B2GA 1LTLA 5BR8L 3CRLC 3RMHA 2N1WA 2NPTA 3DHIC 2F0UA 2EELA 4H0LC 1B50A 1TGZB 1C48A 4GGQA 3M85A 1N63A 2IX3A 1V1QA 1V1PA 2KDFB 4DHJD 4IPCA 4DV7Q 3FPUB 1E1OA 4CDDC 4BOSC 2AEHA 3N1XC 1JRUA 1L7YA 3CSFA 2RSNA 4ZAIA 1OXSC 1PTOF 4JVZA 1D2BA 1JW9D 1RYJA 2LGDA 3PLUA 4JLCA 2IYDB 5C2TB 1Q90A 1VQ9A 2N9LA 2X6GA 1EY8A 2M8SA 5LL6X 2KCCA 1WYWB 4GLSC 1NDDA 5C4XG 3T56B 3KF8B 3ZXVA 1GC6A 5D3IB 1GOZA 2KKCA 3AU5A 3VDZA 4HPMB 5G3LD 1K83B 2Q2UA 4JV5Q 4FVMA 4JBWA 4MTNA 4CDEC 4WWPA 3GTJH 2DY8A 3CCMA 1F2YA 3I90A 2Q5WD 4YHHL 5EDSA 2R92H 2OTLA 1TWCB 1A6XA 1G6ZA 1K3RA 4JW0A 3VYSA 4IO9A 5IIFA 1RODA 2X38A 3VR5A 1NMFA 2QDLA 1SYDA 3OIPA 3ONAB 3VYUA 2AQ3B 3H94A 1OGWA 2D3BA 2EYHA 2C9OA 3GV3A 1HNWQ 2L1BA 3HZXA 3CC4A 3ETRA 1BMLC 4GNXC 2JY6A 2O5IC 3PO3B 3N3KB 3V3XA 4AWJA 5KYIA 4XWWA 4LFCL 5M3MH 2Z6KA 5BYRA 5KRUA 2PO4A 2MJ3A 4W9HA 1KJTA 1MG4A 3CCQA 1EO6A 4N9PA 1NENB 1IYJB 4XWTA 2XRSD 5GAGC 3N52A 1NNXA 2UXDL 3FKIB 2EVBA 5C3WA 5JZEB 2JWZA 4ALPA 4A3BB 3U4EG 2Z1CA 2WXJA 1EEID 1NTGA 3TZUA 5C23A 3AEVA 1V81A 4NKLA 1UD7A 2KN5A 1MKHA 3FPPA 2JYOA 1SSOA 2NTSA 1C78A 2FXQA 1JC7A 2QIEB 1Q8KA 1SNCA 2MJEA 1II3A 1TS2A 4PYUA 3DBLB 4PMWA 3DBRI 1WE6A 3AEFB 2A68D 2NYZD 5IYDG 2KQ3A 5C5MA 1Q7YC 3UF8A 4G7HC 2A6ED 2WFWA 4LF8L 3DWPA 1PYSB 4DR6L 3SFEB 2G5DA 2KTRA 5I6YA 2UWQA 2OCEA 4A3JH 4CKCA 4HCPB 4ODGA 3WOEA 1XNRL 1V6EA 3BVGA 2UUCL 3J7YW 1E0ZA 5IY0A 5C4ZA 3RN5A 4HVBA 3S16B 2WYQA 4W9GA 2Z4IA 1HR0Q 1BBUA 4LUZA 1QB5D 1I94Q 3NY5A 4RM8A 1IBML 2WACA 2XWBB 5JJLA 2JZ3B 4DV2Q 4ICVA 5JEAG 3VTWA 5M5XB 1YJWA 2IZVB 2JPHA 3P4QB 1PZID 3E9SA 4HN7A 4NQKE 2FCQA 3J81i 1KFYB 2QKIC 3A56A 4IUQA 4MT5A 3OTOQ 3N1ZC 2NZ1D 1P7EA 5JJZA 1FFVA 4ZKCB 4AJYB 4A3LG 4GKKL 3P4PB 5IYCG 1CHPD 4KKTA 4CKEA 2HJ8A 2PVOD 4N9F4 5CHWA 1SXTA 1C1YB 1IXRA 4KDIC 4DR1L 2JF5A 4YTMB 3QQ8B 3IVFA 3M4PA 5IGFA 4DV4Q 4ZUJA 2UUAL 2OWOA 1Y1WB 2MBOA 3Q2AC 3MJWA 2QSDA 2BH2A 1WX8A 1UGMA 1FNWA 2DJGC 2I5MX 4JYAQ 4BVUC 2VNUD 4A3KG 4DXFA 2C7MB 1F9RA 3U9SA 1E8XA 4RA8A 5LMNL 4JI2L 2J7QB 2RVLA 3SE0A 4HDQA 5J17A 1JE5A 1ONLA 1N34L 1C4AA 2LXJA 1YVCA 1R4NB 1TT2A 3RD4A 1SSNA 1ZXHA 1NBFC 1E7PB 2Q8RE 5IGBA 2B2UC 1PH2A 2NMQA 4DV3L 4JI1L 2EMSA 3UE0A 1WYDA 5C0XH 1G6PA 4DV0L 4ZRPA 1XMOL 5LL6S 2KJHB 4DGZA 1IBLQ 5FR6A 2MP2A 1H95A 1D5XC 4KKSA 2K75A 2B63H 3NG0A 4IPHA 4WWNA 1K83H 3D4RA 4DK6C 4K7UA 3TEWA 4J8QA 3S1NH 4I7AA 4F7ZA 2HT1A 1TWAB 2EYOA 3APCA 1JWUD 5D65A 1PTOC 3ZJTA 1EYCA 5HKHA 2Z0DB 2LRWA 1J9OA 1JWAD 1OEYA 2F0DA 3W1BA 1ZP0B 3ZJVA 3F8TA 2JEAI 3KYCD 3ZJUA 1B7YB 2XTIA 1RFKA 2AWOA 2FMMA 3CF6E 3N32A 4RGOS 2EMTA 2IT1A 4ZK9B 4X66Q 2G9DA 1HFNA 1XEEA 2WNMA 2Z0EB 2INCC 2HIVA 1V86A 4KD3A 3G48A 1X65A 4K0KQ 1TWFB 3VA7A 2GVBA 2KMCA 2RMMA 4ZDVA 3RN9C 1HR0W 2QC8A 4CO7A 2RDGA 3TP8A 4J3OD 4F7XA 2FIFA 3CMEA 1VQGA 3LJ3A 4YSZB 4JI8L 1FCLA 4UP9A 3HOZB 4A3BH 1HE8A 3DUZA 1PH7A 3W1GA 4LF9L 2G4DB 2KBNA 1LTRD 5ELBA 2AX5A 2WDRB 2V4LA 2JZPA 4APVA 4RKLA 2SEBD 4ZQ3A 1AE3A 1H9JA 2E2DC 1MSHA 4X65Q 3ZUNA 2CWPA 1G91A 2RA4A 3S24A 1VF5C 3H7SA 1HFGA 3PF5A 2V4IB 1SF0A 1Q8IA 3EFXD 3TN2A 3RZDB 2A69D 4AJWA 3K80C 1TJEA 4KDLB 3I73A 4B3SQ 4OHJA 4YWKA 3I4MB 3P20A 3SVMA 1Y8PB 4YCVA 4RAUC 1JORA 3AFPA 4GN5A 4KHPQ 2NS5A 3DBSA 3WANA 4TV3A 4G57A 2NN6H 3B2FA 1U5KA 3V60A 3N1YC 3S16H 4FXKC 2L05A 4A75A 1B9MA 1XMQQ 3SHLA 4L1BA 2FCNA 4HJ9A 3T1YL 5M5XH 3QAQA 5BO4B 2WB1G 3H7PB 1SGHA 3W5VB 1BQQT 5DEHA 1VQCA 4QUCA 1QF6A 2XIWA 2R92G 1LABA 1BR9A 3K59A 5DNFA 3TP6A 2GBRA 4BWGB 5KNBA 4QUFA 1PFBA 3STBC 1LFDA 3V6CB 1CT1D 3I4OA 1SAPA 3K7UC 1RFAA 4DHZB 5A35A 4RCNA 2WP9B 5M3MG 1AN8A 1ENAA 2EXDA 5IYBH 2D9UA 2K6QA 2ZNVB 1SE4A 5LHY1 4R4IA 5LLIA 4GB9A 2HQEA 1YMHE 2JYEA 3T1HL 1YD8U 1R4NI 3PUXA 2A6HC 1FFUA 3FEWX 4QY7A 1UUPA 1G8ZD 4GN4B 3K7AB 2WAQB 2KJXA 5FLXE 3G4SA 1WZ3A 3A5UA 1E8ZA 5AJ3L 1XF5L 3DWMA 3MHSD 4HCNB 4DBGA 2F0EA 1EU4A 1AYFA 2PE6B 2AQ1B 4W9IA 4IDIA 1F9QA 2CW0C 1YX6B 4DDID 4LJZC 3IBEA 4HSVA 4UP7A 3AECB 4BBNF 2ZJQA 4GIVA 4DV5Q 1FCCC 4NJ6A 2ENBA 3TQYA 2W9NA 3NELA 3RN2A 1KDAA 5HY6A 4DV7L 3OWEB 4A3JG 2IBIB 2N7EA 4OVUA 1SROA 1H8CA 1T5EA 4KZ0A 1SIJA 3AQQA 4A8XC 1IGCA 2HE7A 2KVRA 1MHWC 3BK2A 4K81A 1JQ4A 3R2IA 3D3RA 4MELA 4LW1A 5COYA 2F0OA 1DONA 3DWAA 2JSOA 2O5JC 4CJ1B 2XN9C 4LNOA 4QAYA 1PFSA 1X9NA 4JPBW 3L54A 3ZIMA 3HP3A 5BYQA 4K3BA 2DNEA 3GTGB 5KEEA 2K5PA 2OF1A 3AV8A 2BGFA 2F4VQ 3P4RB 2LS01 1AW7A 5IT9c 3KUCB 2AUJD 4GN3B 1NVID 1K8GA 4JV5L 1S3OA 2PTLA 1K51A 2B76B 2B3AA 3B1LX 4FF3A 2MSED 2G1EA 4EE2A 1N60A 4FBJB 2FMCA 4II2B 5I4DA 2RCNA 2SNMA 1Y1VG 1X55A 2WXLA 4RNAA 4L5SA 4BOZB 1TWFH 2E2JB 2XEWA 1M4VA 3EROA 4LAAA 1UBIA 1Q82C 1N33Q 1HNWL 2H5XA 1A3VA 1GJXA 3TMPB 3A7LA 2J0JA 1F77A 2LD9A 4DHZE 5L83A 4DR5Q 1S5CD 5EAYA 1I4QA 1OQQA 3NJTA 1YIJA 3HOZH 3Q14C 1TKWB 4M8AA 2INPE 4JI5Q 1MGSA 2M0XA 4Q2JA 1GB4A 2N3SA 3RR5A 1CZPA 2F0JA 3HKZB 1PH8A 1JJGA 2KLCA 3TS0A 4H7BA 1B70B 1EQVA 2F1MA 2BBCA 4C4VB 4K7WA 4QCLA 2FHTA 3Q0AA 1JOKA 2WAQE 5ELDA 4TUUA 4FP5D 1YQBA 1MIUA 3AE1B 3M62B 5EPJA 1QILA 2EE1A 3LDZE 3RZDH 4IOIE 1L5PA 2AQ2B 4BY7B 1VZ8A 2ZXRA 1CM9A 5C0XG 2ES2A 3I4MH 4MZ9A 4M02A 2K4KA 1ZEQX 5C5LA 3K9OB 1YI2A 1PRTB 3P1MA 2MX2A 1Q1EA 4ZCKA 2ZNVC 3VTVA 2B63G 1VQNA 1WXVA 2BOSA 1GG3A 4LNNA 3ABVB 1BOSA 2WXHA 3CWIA 2IGDA 1QE6A 1ZE3D 4DXAB 4HIKA 3I7FA 4BKSD 4KZCA 3ZW3A 4KN7C 1B3AA 2VXWA 3KUPA 5C4JB 3LX0A 4WJNA 2EDGA 1HR0L 1PQSA 3HOUB 1SLJA 3PZ8A 1I94L 3NVVA 3PZDA 4HPLB 1E1TA 4KHZA 4DV2L 1BXTA 2LJ5A 1FGBD 5E4WC 2L4NA 1O7ZA 1H9SA 3VR6A 1VQAA 1XTDA 5GADC 5GAHC 5GXGB 1Q10A 1Q0WB 3M3YB 3NUCA 3VR9B 1VR9A 4O0AA 2M17A 4LCDE 2BDOA 3OTOL 3T13A 4G0NB 2F0KA 3U4ZA 2L15A 2WV6D 1KRTA 1WZ0A 2MPMA 4WJWA 2I38A 3VRAB 2KFJA 2UXCQ 2KFKB 4EOYA 2PW5A 3QJZA 4MH0E 1KHIA 1PTOD 3OYYA 1QVCA 2VUMB 1ZGUB 4LF4Q 5CTRC 3L9AX 4A3BG 3K7AH 4OWWB 3RLNA 2ZVOA 2BKRB 2JQRB 2W3RA 4HWIB 2CWAA 1K50A 1N9WA 3SU8X 5KNCA 1C9FA 4DV4L 3T8MA 4HK2A 2EQSA 3OMCA 2K8CA 2DAFA 4JYAL 1XCQL 2C35B 4NAMA 3FKYA 4HJ5A 4CYEA 2I2YA 3K81C 2WKDA 1RAXA 1WH3A 3SXHA 3WAPA 1PYBA 1Q1BA 3HKZE 2N9XA 2KWVB 1ROEA 3H9DA 4WAFA 4NXMQ 1SIFA 2CQOA 3CQZB 3SK4A 2NN6G 1RJTA 4BA1I 1FGUA 2GN5A 2RD0A 1QT9A 3FP9A 4QB4A 4RGTA 1R4MI 5A2QE 2DJFC 2YEPF 3IKJA 4GOPB 1RF2D 4BKTA 1SNOA 2ZJDA 1WGHA 4N58A 1WJUA 2DZKA 1IBLL 3A74A 3E6ZX 4R3DA 3N20C 2MGSA 5GQOA 1J7AA 2V0GA 4ABNA 2IO3B 3AU7A 4A9AA 1NY4A 2BA0A 2MEKA 3RZWC 2KHIA 1SFOB 3IAS1 1IYVA 2LHDA 2E74C 3UQBA 5T1IA 5IE8A 2JA8H 2LI5A 2M9VA 5EE1A 4IALA 4JWSC 3MFGA 5IYBG 3D6WA 2QEXA 3EBEA 4X3TA 1S40A 2E2JH 1PFDA 4DR4Q 3EQLC 4MJSB 4FDBA 4C3IB 4A3GB 1N32Q 1ZOYB 3U52E 1Z47A 4JL9A 3TUOA 2KD0A 4X66L 1DGSA 2OHFA 5IP7H 2C60A 1B2TA 4LFBQ 4YTPB 2RDHA 2DZJA 4K0KL 2OT2A 3MAQA 1E2VA 5I9PA 1L6UA 2KX0A 3VUXA 4L5RC 1LTSD 1WWTA 2GBNA 2VZKB 5IN7A 3STBD 1XNQQ 5BMGA 1I3QB 2NPTB 3ZKJC 5DCNA 3AH7A 1E3PA 2OQKA 1I4HA 1S5ED 1HZAA 3NSWA 4O1NA 1GKHA 3ULLA 5JH5C 1K73C 3ZTDA 3LWUA 2OJRA 3NBIA 3KK7A 1I6VC 2DNFA 2INNE 1FRDA 2KHWB 1FJGL 2CU1A 2LMCA 4A3EB 1DOKA 4NMZA 4PMBA 5EE0A 4XZ4A 2IO0B 3ZNID 2A6HD 3ZXRA 4X65L 3QIAA 2IJ0A 3V61A 2B2TA 3PUZA 2DY7A 3IXSA 1EY9A 3AE9B 3OG5A 4JGHB 2X69A 3ER0A 4UPAA 1U9RA 3QA8A 3UGBB 1BDOA 5J3BA 1ISNA 2CW0D 1VQDA 4JC0A 2F0WA 3KLSA 4DK1A 4TRDA 1BUIC 3I63C 4KHPL 1LTBD 4TKOB 4UP8A 4A93B 1IPGA 1WMHA 3X0WA 5C4JH 3U2SC 2PZTA 4AQ7A 1XMQL 1WXMA 2FCSA 1U4MA 2L5TA 1I4RA 2R7ZB 1IBXA 2P5ZX 4HIOA 4IM2A 3TIXA 1HH2P 3PGEA 1T9HA 4NW2A 3M3YH 3UDIA 3KFUA 2HDEA 1PDXA 5FO8B 3MHBA 4A3FB 3D6CA 2QCZA 3CC7A 3M4OB 3IL8A 3Q3NC 3U50C 5JJIA 2WXMA 1KOTA 4S3SA 2MQHA 4B95A 1HCZA 1K3BC 4LJPB 5KYLA 2ATWA 3BZDB 1UE5A 2VUMH 1WGDA 2UU9Q 1YQ4B 2F4IA 3HOZG 3EFUA 2INDC 3O65B 3NQIA 2ZXPA 4P6VF 4JI7L 5IKCM 1WXSA 2WS3B 3CF5A 3PPAA 2F0PA 1PH9A 1E7UA 1MJDA 3M4QA 1WOCA 4RMAA 2ZTEA 3WDNA 2KMMA 1L0WA 2MH7A 1EYDA 1R4QB 3FAHA 1K0RA 2PCFB 3DM1A 2QA4A 2QGQA 2K33A 2QDFA 3PTFC 3ND9A 3RLOA 2D0OA 2L0TA 1T0YA 1HZ9A 4O2DA 1V80A 2JU6X 3GTPB 3I4MG 2Y5PA 1AWDA 3JYUA 1U0LA 1JJ2A 2KTRB 1SNDA 5EBCA 2O4XA 3CQZH 1IZ6A 1KTKA 2RSOA 2XRQD 2IDYA 1O78A 2A73B 3I2ZA 4W9JA 4DV5L 1VLBA 4LWCA 1MFWA 1EWCA 2DYOA 3KBGA 5IO9A 3GTLB 1M94A 4ME3A 2EY2A 3OIQA 2F0VA 1VQKA 4I6NB 3K8AA 5C3JB 1EM7A 4XYQA 2HD3A 4YCWA 3IAYA 2ASQA 1DCZA 2A1AA 1MHHE 2GMIC 4YY3Q 4X3SA 1MJEA 4AYBE 3CMMB 1TBEA 3NUHB 3UQAA 2D62A 3HOXB 1GAQB 1YJ1A 4C7YA 1FXIA 2F0FA 5T1GA 1DXMA 2XNAC 3RUZA 5FLXc 1L2FA 3PIO3 2F4VL 1T5XD 4JI4Q 3KDFA 4DPGA 4GDKA 2MFIA 4YWGG 3ZDMC 4UHVA 1TY2A 5TSSA 3HVZA 3DBHI 4C3IH 1E24A 1F2RI 4A3GH 1C7YA 3OJ3A 1ZPSA 1QZEA 2RR9A 3DVNV 4DK3C 1JQYD 2ZW1A 1GB1A 2NR2A 2WIIB 1FYCA 2LUEA 2R2QA 2C9WB 4WQMA 4NB3A 3IRBA 3D4WA 1D8LA 1XPOA 4EGVA 1XWEA 4XTCS 2WAQG 4ANXA 3DVGY 1E2WA 4BY1B 2EPBA 1HTPA 1D4BA 4EZJA 4KIKA 1I3QH 4KV6A 4EX5A 1STBA 1N33L 1XQQA 1I4GA 4XC2A 2X6LA 3W1SC 4C56C 4DR5L 2AL3A 4REZA 2IY0B 4X3UA 4DK5A 4BKGA 1F1HA 1JROA 4B3RQ 1GHJA 1VQHA 4JI5L 1Z6HA 3HUIA 1XO3A 1JALA 4A3EH 1TR5A 2BYTA 5L95C 3OMGA 1IGDA 3OOCA 1RIPA 3RZOB 1GC7A 1RTNA 1UE1A 2B2VC 5FKAC 1E90A 1TXYA 2HIXA 1HA5A 2ZEQA 4OVVA 2NVQH 4DV1Q 3AE7B 4HTHA 4YTNB 2EXZA 3HOYB 2KJ6A 4ZYSA 1O80A 2MP2B 1WCMB 1L1OA 3RNCC 1XCTL 3QOLA 3L13A 3NHEB 4C1NI 4QIWB 1KH0A 4ID6A 5HFYA 4QGUA 4FHJA 1K9MC 1WGKA 5J2RA 4A93H 2KN4A 4FXDA 2ZCBA 4KMUC 2B2WC 3AEDB 2Q8TA 3SGIA 2FIDA 5IAAC 5T8IA 1L0YB 1GXDC 3SHQA 4K1RB 2KEEA 3CW2C 1F0ZA 2K7VA 1V5TA 4R4QA 3KYDD 2R7ZH 5LXIB 1UZXB 4H44C 2QILA 3D4DA 4XDXA 4NXNQ 2JA8G 2KCNA 4GN1A 1EIHA 3S2AA 2K28A 5HGTA 4GKJQ 3N30A 3L17A 1K28A 3DWQA 3AYHB 4A3FH 3M4OH 4KHVA 1FIQA 3ZNGC 3CAMA 2L12A 5AFWA 1KNEA 2E8GA 2L9HA 2YYZA 3EN2A 4JOIC 4KJOA 5IP7G 1NUCA 1K52A 4W9KA 5AZGA 5EBDA 1BT0A 5DAUA 3Q6BA 3NXWA 4KTAA 3CCRA 2WXOA 2H4OA 3ZRCA 2WXNA 2F0HA 2IHEA 1HQMC 1B53A 2UXCL 4HSPA 4IW0A 2NVUI 3KF6A 3RMKC 2M0AA 4O42A 4JWUC 1ZKOA 4RG1A 4S17A 2F03A 2JUOA 3RNAC 4LF4L 1JRPA 3LWEA 1UWXA 1OXXK 4FXGC 2RHSB 1DJRD 3DEPA 2GRIA 5I9OA 3FILA 4ZYNA 1QQRA 2W54A 2JZZA 2ZJRA 3NE5B 1STEA 3SEBA 1YJJA 3W1YA 5AUIA 3GTPH 4JBJA 2ZTDA 5AZFA 2RHQB 4A3IB 1VQOA 3S1MB 1XLPA 2FFKB 4UDUC 4KVGB 5EPLA 1V8CA 1LTTD 2YU9B 5JOBA 1MHXA
chains in the Genus database with same CATH topology
1J7CA 3J80L 4QMGA 1EWHA 1GUOA 4HMIA 1ESRA 4XT3B 4XDDA 4C80A 5ISRA 1FXAA 1KABA 2SNSA 4A3DB 4ZUIA 1HZ6A 3DMUA 4KX6B 1GUSA 1ILQA 4C2MB 2NVTB 4Y7NB 5CBEE 1S4ZA 4PQXA 3C8YA 3M4YA 3O13A 1FMAD 3VR3A 1C79A 1PYWD 1F2ZA 2EYJA 4J6HA 2IGHA 3GTMB 1FM0D 2L11A 5C44B 1N5WA 1SBBB 1UNSA 2F0QA 2LKVA 4RGMA 3SK5A 3A8KE 3VR2A 3I57A 3Q8EA 3HEJA 2K3UA 1LT3D 4XT1B 4HAEA 2NVXB 4Q5VA 2WXPA 4YSXB 3MVVA 1CJEA 3MJ5A 1XLQA 5C0XI 1DGJA 2FINB 2JWUA 1VRAB 3TEXA 4K2KA 1MI0A 4ARIA 4K5WA 2IWHA 3CHBD 2F0LA 3BYYB 4IN3A 3C2PA 5FO9B 4EQOA 1C4PA 3E0JA 3K57A 2KQ4X 1A15A 1UGJA 3S1RB 1WSPA 1D1IA 3I91A 1MVKA 1YNJC 4ZKBB 4CJ0B 1STGA 3BDLA 5IGGA 3VR8B 1GUGA 2NVYB 4LK0M 1YN3A 1ICWA 4NJCA 2KECA 4C3IG 5CV7A 1KDBA 1LV9A 3H8HA 4GZYC 4LMQD 4Z9CB 4U673 3LB8C 1Y8NB 1PFNA 3KF8A 2J4XA 1D6EC 1WVLA 1FRRA 2OEOA 1Q12A 2M19A 3Q8FA 4DFAA 4YT0B 2ICEC 5IODA 4DQOC 1N61A 1WXQA 1OFFA 2PLPA 1XLOA 3H6MA 1STNA 5KGUA 1S5DD 1T6BX 2L83A 1FEHA 2NN6I 2PMZB 4US9A 2B2UA 3H09A 4R8IA 2L0CA 1QOAA 1QOGA 2PIAA 2K03A 1L6VA 5BN5A 1VDZA 3PO2B 5CR3A 2ZT9C 4XE0A 4KKIA 2FBWB 2F0NA 4CHTB 1EY6A 3NTIA 3GQBA 1L0VB 1JWBD 1H9SB 2PZUA 3GTOB 1JCKB 1O7LA 1OO9B 1ZXIA 3TBIB 2KA7A 1RCVD 1UAPA 4K6DA 3CKIB 4A3MB 4HJGE 3SR6A 4RHSA 1YN4A 2E6XA 2GA4B 2JXMB 5IGEA 3TSSA 2K5QA 1QNUA 1AP0A 1O7YA 2EY1A 4FF1A 1SYGA 5M5WB 2QJLA 4FO2A 3CRKC 4IUVA 2WXKA 4BS9A 3UI3A 2KHSA 2V3PA 4E6IA 3NHHA 1XXGA 4K5XA 1GUNA 4OO1I 3S2HB 1I4XA 3KWLA 1XLNA 2CQAA 2WDVB 3AE8B 1ET9A 1DD2A 2EYLA 2MP1A 1TQOA 2WXIA 5EKLA 4EQPA 1HHVA 3A54A 4OO1H 4KKJA 4ZRQA 4NDXA 3GTQB 2PMVA 5E4XA 3VYTA 1K8OA 4FNFA 1J7BA 4X3KA 4KK7A 5CYUA 4MIUA 1YNNC 1PRTF 3HRDD 4KY6A 2LHEA 1RD9D 5J22A 2RPVA 2E2HB 2K0PA 4KKUA 1KAAA 1Q3LA 3AEAB 3AEBB 3U9OA 1TS4A 2J42A 3H91A 3T16A 3MXGA 3PIP3 4RFBA 4TQ1A 1LACA 2XVSA 4IZ8A 1VMCA 3KLSX 4G4KA 3B9JA 4US8A 3V96A 1E9MA 1B4OA 4RKBA 2WKCA 2BW2A 4ZLTF 1X32A 2LMCB 2AWNA 3WOFA 2K1BA 1CTMA 3MA2B 1QLBB 2R61A 1Y8OB 2F0SA 1RM6C 1DYQA 3EGRA 3Q8CA 2W3SA 3J80E 4OVZA 1IL8A 4OW0A 3I3CA 2JYTA 2BS4B 2J52A 1PGXA 5IT9L 2KUMA 2EZVA 1ZYRC 3R8BA 5NUCA 3QWNA 2NUCA 3NWSA 1LT6D 3MTSA 3MP9A 3T3OA 1KRHA 2A5HA 1EY5A 2DN8A 1X3QA 5J39A 3KQ4A 4DA2A 4TQUS 1C76A 2KEDA 1EQTA 2BB5A 5BMHA 1VDVA 1NSNS 4B0MA 3BVZA 1AZQA 4K2LA 4A6QA 4ARCA 2EJGC 1F2MA 1YNJD 4USAA 3AMUA 1LO5D 3NZ3A 1L4ZB 2Y0SB 2WXGA 4YIJA 4J1MA 1SNQA 4R8NA 4KGRA 2RBMA 2SAKA 1E2ZA 4FXCA 5IGDA 2BA1A 1CA6A 4EQNA 1U4RA 2K5WA 3OPOA 1IW7C 3R3OA 4FF2A 5M5YB 1SYEA 2R93B 4ZRZA 5FR3A 3NPPA 1PMRA 3AE4B 1A70A 2KAJA 2F0TA 1SE2A 3PMFA 1HRJA 4M1UB 1B44D 1CK1A 2CJNA 3EUB2 1Y56A 3A7AB 2K22A 3QG1A 1DOXA 3QOJA 2F0IA 2ICIA 1FR3A 1V8QA 3NTKA 3K6OA 3HOVB 4GDKB 5ELFA 4R9WA 4BBRB 3IT6B 4L6TB 4WORA 3IT4B 4RF1A 3TP5A 4IUTA 1KLUD 3MC0B 3U7ZA 3M7GA 4ULLA 3TEYA 4GDLB 5CBAE 1PRTC 3BK1A 3OW7A 1QCBD 1J8IA 2OXPA 3BYTB 1EY4A 3S1QB 1V97A 3NQTA 1I6HB 1V1PB 3A8JE 1B9NA 4DK0A 2NTTA 1WTWA 2MHVA 1TWGB 3JAML 4L8JA 3UI2A 3K5NA 2LGIA 5JAVA 1VZ7A 4OO1G 2JP1A 1UWMA 1TU2B 2F3VA 5HHDG 1SEBD 1A3TA 5BMIA 5ELEA 2LUMA 4IUUA 2J7ZA 1TS3A 1F9SA 2BE5C 1ZXTA 3SFDB 2L52A 2A74C 2L55A 4H2AA 1JICA 1PZJD 4PNYA 1DOYA 2TMPA 1NR2A 3MXUA 4XIGS 4MACA 3IFTA 2W55A 3P42A 2C5CA 3T53B 1AZPA 1R7SA 2E2IB 1CZWA 1G2SA 3PZ7A 3F2UA 1YNND 2IW3A 4K8IA 1KF6B 2B2YC 2DBYA 1HZ5A 2F0GA 2KOLA 3Q23A 1JE4A 2B39A 3OWFA 2WB1B 3I70A 3GTJB 2D2CC 4KY5A 3LXFA 3VQIA 1HTLD 2R92B 1B1ZA 2BDNA 2G9HD 4DAPA 2RQXA 3W3AA 5EE3A 1CFMA 1RTOA 1DZ1A 5M3MB 4DU9A 2WXQA 1E6EB 1QNKA 3E56A 5D14A 1U4LA 4HCEA 2E3TA 4K14A 1ENFA 2N88A 3SR1A 2CU3A 2FJ2A 2WINB 1SDFA 2IPKD 2PNRC 4K8JA 4WIPA 1QG7A 4ME5A 4I65A 4L23A 1ZYRD 3DHQA 1C4CA 5G5HA 4EVOA 4HEDA 2PW7A 1NEKB 2JXTA 2MJ8A 1ILPA 5FO7B 3A8IE 1I7HA 5HURA 1JB3A 1FD7D 3TEZA 2F0MA 2OEDA 1LTID 1ZUD2 2Y3AA 1MSGA 2R3ZA 2JE6I 4C7ZA 1EFID 4I7ZC 4F88A 1W6JA 5C3EB 2KACA 1VF7A 4L63B 1CZGA 2N9KA 5M9OA 1Y1VB 5EE9A 3LYYA 4Q0FA 1L0XB 2HTME 1IW7D 1HQRD 5IT9E 4UAIA 5C3XA 3I9V1 1EOTA 2K01A 2Y5CA 1BCPB 2D5GA 5DM63 1RDPD 1WTRA 2FE8A 3GV6A 2CVRA 5FOBB 2JA5B 2M56B 1WD0A 2KWDA 2LFIA 5EPKA 3EVQA 1A2UA 2EY5A 2JA7B 2IX1A 2NBFA 4IFDJ 5CV5A 3QB3A 1TKGA 4OL7A 4N6EB 3GB1A 3VRBB 1SYCA 4LTUA 5HI1A 3TP7A 3K5MA 1SJED 5AUKA 2BTEA 1I50B 1F2LA 4QF4A 2J0TD 1LTGD 4KD4A 4DAYA 3T4AC 2B63B 1PDQA 3W1SA 3P1HA 4CJ2C 3S1NB 2H89B 1JOOA 2R6GA 1H9MA 1GHKA 1IUEA 1LTAD 1YNTE 4AS1A 3PV0A 4CQNA 4XDCA 1CI3M 1RWSA 1EWYC 4HROA 2B2VA 1PRTD 1ZDXA 3LNNA 3MXPA 4HEA1 4JE3B 3NP8A 2HDLA 2BCOA 1KLGD 2K05A 3I4NB 3Q22A 2B2WA 1PTOB 2EYFA 5ELCA 2SDFA 3GO5A 3URYA 1STHA 3H0GB 1HA6A 4G7ZC 2FUG1 3AE2B 3CU7A 4OIJA 3GS2A 2VB3X 3W9CB 4FF4A 2L32A 3AEGB 4NZLB 1XX8A 4CKBA 4MHEA 4DNRB 1PGAA 1PLFA 4HMJA 4PV1C 3SDZA 4KGSA 2H88B 4NP5A 2BE5D 4B0EA 4B9XA 1VJKA 3AE6B 2WXFA 5CV9A 4DAVA 2JA6B 3NK9A 1SNMA 1BCPC 4C3HB 4ITKA 2GB1A 1M8AA 1HXYD 2HDMA 1WD1A 3Q6SA 1EYAA 3ERQA 1TKEA 5CV4A 4F8MA 1FO4A 1A2TA 3J7AV 4G7OC 5KIXA 1V1OA 1SMYC 4OGQC 3JAME 2M2LA 1EEFD 3N9YC 4RH6A 3R93A 2EOTA 4DN4M 3BVMA 3T3NA 1I4PA 1DOMA 2K04A 3AE5B 1AFPA 1DOLA 3FC4A 4XYOA 3S2DB 1G291 1D1KA 3OSOA 3HVDA 1JMLA 5CV8A 1AEXA 2RKSA 4HKQA 3MXNA 1EZ8A 4M0WA 2DWQA 3QJYA 2Z8LA 5EKIA 2NB0A 4PMCA 4HKZE 1TS5A 5K36H 1CHQD 3ND8A 3QO2A 3P63A 3R2TA 2I07B 4RWSC 2VZKD 5JPMC 5A2QL 1NAPA 1JWMD 3D31A 4C3JB 1ZDVA 1EY0A 2O2LD 5CGKA 2V3NA 3Q24A 3PUWA 3I4LA 1SE3A 4F87A 3S15B 1X3PA 2HCCA 3MFYA 1XYIA 2TSSA 3NRZA 3NWTA 1QJOA 3P7JA 1GUTA 3J81L 5M3FB 1W6KA 3HOWB 3S17B 1E0BA 1OXUA 3C3LA 4CBVA 2ZW0A 4LLGM 3PUVA 5JXVA 1E10A 2CHBD 4DXGA 1NYRA 3AN1A 1TKYA 1SNPA 3KBXA 1QOHA 1YQ3B 5BN3A 1PTOH 1WTXA 1QWYA 2PPBC 1FNVA 2VB2X 1LLRD 5EGTA 3S9WA 3PO0A 2D5DA 4BBSB 4KY7A 2B8GA 2NWGA 1HUMA 1FD6A 1FNUA 1G2TA 2B8FA 4P2CB 3BIID 3W2DA 5D3DA 5JEAJ 1SJHD 3S14B 3NS1A 4K6LA 4OZCA 2EY6A 2LFNA 1MPEA 4RCOA 4OZBA 3G6JB 1WYGA 1T3QA 5H92C 4P16A 2PVGC 3V05A 2DNCA 5C4HA 2W82A 1V43A 3P4SB 5BYSA 5I2YA 2EKIA 5G5GA 4HR7B 3ZYYX 5F2DA 3SK6A 3CIRB 1LT5D 5J1ZA 4WWMA 2IL8A 1EZ6A 1C77A 1EIGA 5G3LF 3E5SA 5CC4A 4V0BA 2L1AA 1WRIA 2QF7A 4ZHPA 4HRSA 1RKNA 2N7JA 3K5OA 3FVQA 3BDCA 3TDQA 4IFDI 5C6AA 1PUTA 2EYPA 3KWVA 2ZXOA 2RDFA 1S5BD 4RF0A 3L7ZC 4WH4A 1Y69U 2BS3B 2IX0A 1ET6A 3A55A 2DLBA 1QKZA 1D5ZC 3BG3A 4IFDH 3K5LA 2MJDA 5CORA 5C4XB 4N9TA 1L4DB 1U4PA 4L2YA 3GD7A 1K53A 4IURA 4DF7A 5EJWA 1NCVA 1RHPA 3GP7A 2JA8B 3I72A 3BWUD 5HG2A 2HUGA 3MZ5A 4KGTA 3AM9A 3ITPA 1F9PA 3VR4A 1BCPD 1MBYA 4XXEA 3ZQ4A 4JK1C 1KDCA 2V4DA 3W5UB 1YN5A 1LT4D 3NVZA 3DEOA 3HGBA 4HCSA 1HEZE 5JVH3 1SMYD 1H9RA 3WCQA 2LJIA 1IHZA 3K0YA 3AMZA 2QMTA 4A90A 2F3WA 2ID0A 1SYFA 3V2TA 1PXUA 2KVMA 1VCIA 1IBXB 2MUYA 1TVXA 2I46A 2WXRA 5K36G 3GTKB 2LEKA 1JWSD 3NVYA 2BT6A 5JVG3 2ONQA 3N6RA 4XQNA 2BS2B 1XTCD 3Q69A 5FK9C 3T51B 2GI9A 2JEBI 2WU5B 2E76C 1NI3A 3H3VC 3IFDA 4KI0A 3TZDA 1K8MA 4K5VA 1EU3A 3AB5A 3HRZC 1TIID 1GUWA 2PKOA 5BN4A 2JX5A 2WP8J 3VA5A 3EJIA 4WFN3 3C1EA 2KDMA 4C1NK 1STYA 3FMCA 1HUNA 3RPFC 2ACZB 4H13C 2PW9A 3K58A 1C8CA 1BUVT 3L4PA 4ZHOA 3RFZB 1PFMA 1P7FA 1A3UA 1C4QA 5E3FA 4A3KB 5DM73 4JX1C 2BB6A 1MD2D 2PQEA 2WQYB 1TWHB 3J7AF 3PUYA 1ML0D 4MH8A 2B2TC 3RLFA 3NTHA 1OQRA 1JR0D 4A55A 4C3HG 2PYKA 5E1FA 4ZOHC 4RHRA 2N55A 3G7LA 3AB9A 1JOQA 3EA6A 2LY7A 1R9TB 2K32A 4CGYB 5KNDA 3J81E 4DNTB 2EJFC 2IGGA 4FYDA 1STAA 5K5PA 1S5FD 4B9WA 1MI2A 1WTOA 1QOBA 1NR4A 3SK8A 1N62A 4KN4C 2H1EA 2JSVX 3VYRA 2DYMA 2A68C 4D2KA 1NYQA 1BO0A 2A6EC 2Z4HA 4XQJA 1Z7TA 1BBXC 3HG9A 2CJOA 4LK1C 2EYMA 4OIKA 2WLBA 5C0XJ 4N59A 2YEPB 1ENCA 1DM0B 1VMPA 3DXJC 5JPNC 1BNZA 1SB3C 2EJMA 4IUPA 3AEEB 2J53A 2NVQB 4AYBB 2PZWA 4C3JG 2QCPX 1TY0A 2K6AA 4IFDG 2E75C 3FRPB 1IKLA 5EKKA 1UEAB 2XSCA 1TYGB 4TMAB 4KJNA 5I6WA 2AUKA 3MHZA 3L3OC 5EQ0A 4TQ0A 5JEAH 3FILB 1BF4A 1CQFA 5H8YE 5IOCA 5E6JA 3X3MA 1CQVA 3NVWA 1SYBA 5I2XA 3TMEA 1GPXA 3MEHA 4IUNA 5D7GA 1H9KA 2QEJC 3Q8AA 2M00A 1N5XA 1TZOA 3FDTA 1KNAA 4YSYB 2WU2B 1OXVA 3HS0C 1PGBA 5CV6A 2SOBA 5LNK1 3D8GA 2K9XA 3X3NA 1HPCA 1WTVA 1OXTA 3KLRA 3AE3B 1BCPF 3P75A 1DOIA 2ON8A 1CA5A 5MPOA 3I8ZA 2WDQB 2QDBA 1PZKD 5CMDA 3C46A 2HCIA 2K5DA 1B9RA 4A3JB 3DWGC 4IQZA 4U68A 5IGCA 4RGNA 1WTQA 2B2YA 1EL0A 4WURA 1IYUA 1ACCA 4B08A 4WRDA 3M7NA 4NAWB 1WTPA 3ZGZA 3IAM1 4OZAA 4ILWA 1ESFA 1F2RC 4IKGA 4YXDB 3J9CA 3C1FA 2Q8IB 3OHXC 4MM3B 4JPSA 3NBHA 1EY7A 3BS1A 3Q8BA 1IKMA 1R4PB 4TSSA 2N0SB 1YJIA 4MN3A 4V190 3BDOA 1D5MC 1QOFA 1VZ6A 2XWJB 2A69C 4PT5A 4BA2I 3MWYW 4XQQA 5FLXL 3B2GA 3CRLC 3RMHA 2F0UA 2EELA 4H0LC 1B50A 1C48A 3M85A 1N63A 2IX3A 1V1PA 3FPUB 2RSNA 4ZAIA 1OXSC 1PTOF 1JW9D 1D2BA 1RYJA 5C2TB 1Q90A 2N9LA 2X6GA 1EY8A 5LL6X 2KCCA 4GLSC 3T56B 5D3IB 1GOZA 5G3LD 1K83B 4FVMA 4JBWA 2DY8A 1F2YA 3I90A 2Q5WD 1A6XA 1TWCB 1G6ZA 3VYSA 5IIFA 1RODA 2X38A 3VR5A 3ONAB 3VYUA 1SYDA 3OIPA 2AQ3B 3H94A 2EYHA 2C9OA 3GV3A 2L1BA 3HZXA 3ETRA 1BMLC 2O5IC 3PO3B 3V3XA 5KYIA 4XWWA 5BYRA 5KRUA 2PO4A 2MJ3A 1NENB 4N9PA 4XWTA 2XRSD 3N52A 3FKIB 2EVBA 5C3WA 4A3BB 3U4EG 2Z1CA 2WXJA 1EEID 3TZUA 4NKLA 3FPPA 1C78A 2JYOA 1SSOA 2NTSA 1JC7A 2QIEB 1SNCA 2MJEA 1II3A 1TS2A 4PMWA 3AEFB 2A68D 2NYZD 2KQ3A 5C5MA 4G7HC 2A6ED 3DWPA 3SFEB 5I6YA 4CKCA 4ODGA 3WOEA 3BVGA 3J7YW 1E0ZA 5C4ZA 3S16B 2Z4IA 1QB5D 2WACA 2XWBB 5JEAG 5M5XB 3P4QB 1PZID 3E9SA 4HN7A 1KFYB 2QKIC 3A56A 4IUQA 4MT5A 2NZ1D 1P7EA 5JJZA 1FFVA 4ZKCB 3P4PB 1CHPD 4KKTA 4CKEA 2PVOD 1SXTA 4YTMB 5IGFA 4ZUJA 1Y1WB 2QSDA 1FNWA 2VNUD 4DXFA 1F9RA 3U9SA 4RA8A 2RVLA 3SE0A 1ONLA 1C4AA 1TT2A 3RD4A 1SSNA 1ZXHA 1E7PB 2Q8RE 5IGBA 2B2UC 2NMQA 5C0XH 4ZRPA 5LL6S 4DGZA 1D5XC 4KKSA 3D4RA 3TEWA 4J8QA 1TWAB 2EYOA 1JWUD 5D65A 1PTOC 3ZJTA 1EYCA 1J9OA 1JWAD 1ZP0B 2F0DA 3ZJVA 3ZJUA 2JEAI 1RFKA 2AWOA 2FMMA 4RGOS 2IT1A 4ZK9B 1XEEA 2G9DA 1HFNA 2WNMA 4KD3A 1TWFB 3VA7A 2RMMA 2RDGA 3TP8A 4J3OD 4F7XA 4YSZB 1FCLA 3HOZB 3DUZA 1LTRD 5ELBA 2AX5A 2WDRB 2JZPA 4RKLA 2SEBD 4ZQ3A 1H9JA 2E2DC 1MSHA 1G91A 2RA4A 1VF5C 1HFGA 2V4IB 1SF0A 1Q8IA 3EFXD 3TN2A 3RZDB 2A69D 1TJEA 3I73A 4OHJA 3I4MB 3P20A 3SVMA 1Y8PB 4RAUC 1JORA 4G57A 2NN6H 3B2FA 4FXKC 1B9MA 3SHLA 4L1BA 3W5VB 1BQQT 5DEHA 4QUCA 1QF6A 2XIWA 1LABA 1BR9A 3K59A 5DNFA 3TP6A 4BWGB 5KNBA 4QUFA 1PFBA 1CT1D 1SAPA 5A35A 4RCNA 2WP9B 1AN8A 1ENAA 2D9UA 1SE4A 5LHY1 2HQEA 1YMHE 2JYEA 3PUXA 2A6HC 1FFUA 3FEWX 1UUPA 1G8ZD 3K7AB 2WAQB 2KJXA 5FLXE 1XF5L 3DWMA 2F0EA 1EU4A 1AYFA 2AQ1B 4IDIA 1F9QA 2CW0C 4LJZC 4HSVA 3AECB 1FCCC 2ENBA 1KDAA 3OWEB 1T5EA 1SIJA 4A8XC 1IGCA 3BK2A 1JQ4A 3R2IA 3D3RA 5COYA 2F0OA 1DONA 3DWAA 2JSOA 2O5JC 4CJ1B 2XN9C 3HP3A 5BYQA 2DNEA 3GTGB 5KEEA 2K5PA 2OF1A 3AV8A 3P4RB 2LS01 1AW7A 2AUJD 1NVID 2PTLA 1K51A 2B76B 4FF3A 2G1EA 4EE2A 1N60A 2FMCA 5I4DA 2SNMA 2WXLA 4RNAA 2E2JB 1M4VA 3EROA 4LAAA 1A3VA 1GJXA 3A7LA 1F77A 1S5CD 1I4QA 1OQQA 1TKWB 4M8AA 2INPE 1MGSA 1GB4A 4Q2JA 1CZPA 2F0JA 3HKZB 4H7BA 2BBCA 1EQVA 2F1MA 4QCLA 2FHTA 3Q0AA 1JOKA 5ELDA 4FP5D 3AE1B 5EPJA 1QILA 2EE1A 4IOIE 1L5PA 2AQ2B 4BY7B 1VZ8A 2ZXRA 1CM9A 5C0XG 1ZEQX 5C5LA 3P1MA 1PRTB 1Q1EA 2BOSA 3ABVB 1BOSA 2WXHA 3CWIA 2IGDA 1QE6A 1ZE3D 4KN7C 1B3AA 2VXWA 3KUPA 5C4JB 3LX0A 2EDGA 3PZ8A 3HOUB 3NVVA 4KHZA 1BXTA 1FGBD 5E4WC 2L4NA 1O7ZA 1H9SA 3VR6A 5GXGB 1Q10A 3M3YB 3NUCA 3VR9B 1VR9A 2BDOA 3T13A 2F0KA 2WV6D 2MPMA 4WJWA 2I38A 3VRAB 2PW5A 1PTOD 2VUMB 3L9AX 2W3RA 2JQRB 1K50A 5KNCA 1C9FA 3OMCA 1XCQL 4NAMA 2I2YA 2WKDA 3SXHA 1Q1BA 1ROEA 4WAFA 3CQZB 3SK4A 2NN6G 1RJTA 4BA1I 1QT9A 4QB4A 4RGTA 5A2QE 2YEPF 3IKJA 1RF2D 1SNOA 4N58A 3E6ZX 4R3DA 2MGSA 1J7AA 2V0GA 4ABNA 3AU7A 4A9AA 2BA0A 2MEKA 1SFOB 3IAS1 1IYVA 2LHDA 2E74C 5T1IA 2M9VA 5EE1A 4IALA 4JWSC 3MFGA 3D6WA 4X3TA 1PFDA 3EQLC 4C3IB 4A3GB 1ZOYB 3U52E 1Z47A 3TUOA 2OHFA 1B2TA 4YTPB 2RDHA 2OT2A 3MAQA 1E2VA 5I9PA 1L6UA 1LTSD 1WWTA 2VZKB 5BMGA 1I3QB 3AH7A 1I4HA 1S5ED 3NSWA 4O1NA 3LWUA 3NBIA 3KK7A 1I6VC 2INNE 1FRDA 2LMCA 4A3EB 1DOKA 4NMZA 4PMBA 5EE0A 2A6HD 3QIAA 2IJ0A 2B2TA 3PUZA 2DY7A 3IXSA 1EY9A 3AE9B 2X69A 1U9RA 1BDOA 2CW0D 4DK1A 2F0WA 3KLSA 1BUIC 4TRDA 1LTBD 4TKOB 4A93B 3U2SC 2PZTA 4AQ7A 1U4MA 2L5TA 1I4RA 2R7ZB 1IBXA 4NW2A 2HDEA 1PDXA 5FO8B 3MHBA 4A3FB 3D6CA 3M4OB 3IL8A 2WXMA 4S3SA 1HCZA 5KYLA 3BZDB 1YQ4B 2F4IA 3NQIA 2ZXPA 4P6VF 2WS3B 2F0PA 3WDNA 2KMMA 2MH7A 1EYDA 1R4QB 3FAHA 2PCFB 3DM1A 2K33A 3ND9A 2JU6X 3GTPB 2Y5PA 1AWDA 1SNDA 5EBCA 2O4XA 1KTKA 2RSOA 2XRQD 2IDYA 1O78A 2A73B 1VLBA 1EWCA 2DYOA 3KBGA 3GTLB 2EY2A 3OIQA 2F0VA 5C3JB 1EM7A 4XYQA 3IAYA 1DCZA 1MHHE 4X3SA 3NUHB 2D62A 3HOXB 1GAQB 4C7YA 1FXIA 2F0FA 5T1GA 1DXMA 2XNAC 3RUZA 3PIO3 1T5XD 4YWGG 1TY2A 5TSSA 3HVZA 1F2RI 1ZPSA 1JQYD 2ZW1A 1GB1A 2WIIB 1FYCA 4WQMA 3D4WA 4EGVA 1XWEA 4XTCS 1E2WA 4BY1B 2EPBA 1HTPA 1D4BA 4KV6A 1STBA 1I4GA 2X6LA 4C56C 4REZA 4X3UA 1JROA 1GHJA 3HUIA 1Z6HA 1XO3A 1JALA 1TR5A 2BYTA 3OMGA 1IGDA 3OOCA 3RZOB 1RTNA 5FKAC 2B2VC 1HA5A 3AE7B 4HTHA 4YTNB 2EXZA 3HOYB 4ZYSA 1O80A 1WCMB 1XCTL 3QOLA 4C1NI 4QIWB 1KH0A 4ID6A 5HFYA 1WGKA 2KN4A 4FXDA 4KMUC 2B2WC