1M4VA

Crystal structure of set3, a superantigen-like protein from staphylococcus aureus
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
200
structure length
196
Chain Sequence
b'AKYENVTKDIFDLRDYYSGASKELKNVTGYRYSKGGKHYLIFDKHQKFTRIQIFGKDIERLKTRKNPGLDIFVVKEAETVFSYGGVTKKNQGAYYDYLNAPKFVIKKEVDAGVYTHVKRHYIYKEEVSLKELDFKLRQYLIQNFDLYKKFPKDSKIKVIMKDGGYYTFELNKKLQPHRMSDVIDGRNIEKMEANIR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SET3, superantigen-like protein
publication title The three-dimensional structure of a superantigen-like protein, SET3, from a pathogenicity island of the Staphylococcus aureus genome
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Immune system
total genus 54
structure length 196
sequence length 200
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
A PF09199 SSL_OB Staphylococcal superantigen-like OB-fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1m4vA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1m4vA01
1JWMD 1CQVA 3BYTB 3EA6A 1LLRD 1I4RA 1HA5A 3O13A 1CT1D 1BCPF 1PZID 1JWUD 1PRTC 1TS5A 1PZKD 1V1PA 4DXGA 4RHSA 1I4QA 1D5MC 2NTTA 4OHJA 1L0XB 1V1OA 2Z8LA 1SE4A 1EEFD 2RDGA 1GOZA 2IPKD 4Z9CB 1SE3A 2TSSA 5D3DA 1BCPC 2G9HD 3EFXD 1TS2A 1D5XC 1G8ZD 1XXGA 1PRTD 1YN3A 1PRTF 1RD9D 1M4VA 3KLSX 3TSSA 5I4DA 1EU3A 5ELEA 1S5DD 4RH6A 1JQYD 1SJHD 2J4XA 1QILA 3BVGA 1S5CD 1YN5A 1PRTB 3BVMA 2SEBD 1BCPD 1PTOH 5FKAC 4O1NA 1JWSD 1ESFA 1PTOD 2RDHA 1PTOF 2XNAC 4RFBA 1EWCA 1YN4A 2AQ3B 1LTGD 1V1PB 3DWAA 1BCPB 3BZDB 2XN9C 2NTSA 1EFID 1BXTA 5TSSA 3R8BA 1LT5D 5ELFA 1SXTA 1F77A 1PTOC 4RGOS 1EEID 1LTBD 2CHBD 1T5XD 4K6LA 2R61A 4NZLB 1LT3D 1TS3A 1MD2D 4RCOA 1FNWA 3V05A 3DWPA 2QILA 1L0YB 2AQ2B 3OWEB 1HXYD 1RCVD 1LTSD 1SJED 1I4HA 1FNUA 3GP7A 3R2IA 1ET9A 1HTLD 4C56C 3BYYB 1LT4D 1ET6A 1JR0D 3W2DA 1I4GA 2WV6D 1S5FD 2IJ0A 1KTKA 1S5BD 3BVZA 5ELCA 1SEBD 1JCKB 2XRQD 1LTTD 1PTOB 1STEA 5ELDA 5ELBA 1FD7D 1D6EC 4TSSA 1I4XA 1S5ED 1LT6D 1CHPD 1TY2A 1DJRD 1KLGD 5D3IB 4RGTA 2O2LD 5FK9C 1CK1A 3MFGA 1AW7A 4L6TB 3URYA 1TS4A 4DXFA 2XRSD 1RDPD 4RGMA 1DYQA 4RHRA 4UDUC 1FNVA 3MC0B 1HQRD 1AN8A 1PYWD 3SEBA 1B1ZA 1I4PA 1LO5D 1SBBB 1XTCD 1B44D 1UUPA 2ICIA 1UNSA 3CHBD 4BWGB 1FGBD 4L63B 3DWQA 1PZJD 4ZYSA 1LTRD 2AQ1B 4RGNA 1EU4A 1ENFA 1RF2D 1LTAD 1LTID 1TY0A 2QEJC 1KLUD 1D5ZC 1SE2A 1CHQD 3R2TA
chains in the Genus database with same CATH superfamily
3EA6A 2Q8IB 5D65A 1CMXB 1WE7A 1LLRD 3Q23A 3J9CA 1CM9A 1EUJA 3L2PA 4FYDA 1K0SA 2R2QA 5EGTA 2DZJA 4HVBA 4WURA 5C4JB 1I4QA 4GIVA 4OHJA 1RRBA 3K59A 3PO2H 3WAOA 5KYIA 2JA8B 3WOEA 5KNBA 1XLQA 2FCSA 3QQ8B 1XMQQ 5L83A 3FHWA 1DXMA 3AU7A 3I73A 4JK1C 3K5MA 4BY1H 2KWDA 3NVZA 5FR6A 5BYSA 3A5ZB 1YJ1A 2Q2TA 1KJTA 5CV6A 1GJZA 2Z4IA 1D5XC 3U50C 1KAAA 1QLBB 3UI3A 1EZ8A 3MVVA 4LUVA 2FNJB 4BBSG 1B2TA 1GUWA 2PMZE 3L4PA 4YHHL 3V6CB 3QR8A 4NJ7A 2V0GA 3WANA 1SJHD 4S17A 1HTQA 4BXXH 1GJXA 2D2QA 1MHXA 1X56A 1EQTA 1O7YA 2WXQA 3BVMA 4H7BA 1WR1A 2IY1B 3V3XA 2ZXRA 1RLFA 4D2KA 4HPLB 2LXJA 2HIXA 1NMFA 2QIEB 1PTOF 3Q8AA 1EWCA 1LTGD 1Q90A 1IYUA 5I9OA 4IFDI 4TKNA 2JA7H 4A3JG 3HOZH 1QOFA 2IDYA 4HEDA 4KGSA 3BZDB 2KA7A 3UI2A 3K5NA 1SE8A 3V62A 4BKSA 1EYGA 4ITKA 1DOMA 3P2BA 2B29A 1LT5D 3QG1A 2D0PA 2HJ8A 1MPEA 5JZEB 5C3JB 3AFPA 4A3PA 2PMZB 4POGA 3M4PA 5IA7A 1HTPA 4WORA 1NYQA 1YMHE 4GLSC 4N59A 2KQSA 2W9NA 2I2YA 1I35A 2RHQB 4DK5A 3KLRA 2AQ2B 3D4DA 4KV6A 3Q6BA 4HJ7A 2PVGC 3VVWB 2JVCA 2BYTA 4DDGD 5NUCA 3QB3A 3BJUA 3ZGZA 3GP7A 3RCZA 1Y1WH 4KN7C 3IAM1 4XX5A 2NVTH 4TQUS 3A5UA 1JRUA 4E6IA 4WJ4A 4XYQA 1S3OA 3WWVA 4JI4L 1C9FA 1J0GA 1UE1A 1OQQA 3RPFC 1Q46A 2DBYA 2HQLA 1STEA 2K5DA 3F2BA 1TYGB 1V2YA 4TSSA 3H3VC 2WXGA 2K03A 1V43A 3IT6B 2WP8J 3U2SC 2B39A 2CJOA 5L37A 5C4HA 3VR5A 4CQNA 2F4VQ 3B08A 3K9OB 4N9F4 3SR1A 2RVLA 4CO7A 2I1JA 3P4QB 2HDMA 2OJRA 2F3WA 1D1IA 2V3PA 2WLBA 4R4QA 3W3AA 3OWFA 2EE1A 2GI9A 4RKLA 5ISRA 4MGYE 1XLOA 4MSQB 1FR3A 2MWSB 3APFA 4MT5A 3FPUB 4KLKA 4A3EB 2DZKA 4EKUA 4AUQC 3P4PB 4LNOA 4GOPB 5FO8B 5E6JA 4C3HG 2AEHA 3PTFC 4FJZA 4HJGE 4CKCA 4WQOB 4DV1L 2VQFQ 4A3KG 1QOBA 3ZJUA 1U9RA 1YNND 2J53A 3BY4B 1AH9A 2QA4A 1KLUD 2J7ZA 2QDFA 3R3OA 3U9OA 5J22A 4R8NA 1YJNA 3GTQH 1VQJA 3U30A 3WAMA 3S14H 4M0WB 1L6UA 3KUCB 4DXGA 3OPOA 4LF5L 2E76C 3NVVA 1BR9A 4IUPA 1HZ5A 3CRKC 3AE6B 5EPJA 3BU2A 5M5WH 3IG3A 1BKBA 3OTOL 4I6PA 4REZA 5C4XB 3AULA 5DPRA 4X3UA 2PPBC 3EROA 2L12A 1VDZA 1T0YA 2B76B 1ROEA 4R4TA 2ALYB 4B3SL 4HMIA 2MW5A 2KACA 1IGDA 2YU9H 2G5DA 1VF7A 2QSDA 2WHIA 1RD9D 1M4VA 2OQ0A 1ASYA 3GTOH 2CU1A 3KLSX 1KXLA 1GNUA 3W5VB 3KDFA 2N0SB 4PMWA 2VZKB 3FILB 4IUNA 4TKOB 5CV9A 2FMCA 2YTVA 1VQMA 5EKKA 2B63G 3CPWA 2AWOA 4NXNQ 2X6LA 3B6YA 2EYPA 5IGBA 2BQQA 1JWSD 4HAEA 2EKEC 4JCVE 1X3EA 3HOUH 3M3YB 3KUDB 3CU7A 3A74A 1J9OA 3UDGA 1SB3C 3HM3A 2LXCA 4H02A 3KW5B 3M9BA 1UE7A 2A6EC 2JPHA 3Q3FA 5IKCM 2LGXA 2NMQA 1SLJA 2KFJA 2F0VA 1QCBD 1WIAA 3IL8A 5IOIA 3G6EA 4DHJB 2UUCQ 3HOVG 5IP7H 3E0JA 3PO2B 5IWAL 1T5XD 1NEKB 3IFWB 4RMFA 4L23A 1AE2A 4KMUC 2IW3A 1V81A 3HKZB 2N7JA 5LXHA 2F0JA 1HZCA 2YEPF 1DM0B 1L6VA 4IKGA 3M4QA 1YNJC 4DGZA 4BY1B 1IPGA 2J52A 1A3VA 4K14A 3J7YW 5AZGA 3A8KE 3LDZE 1GUNA 2JK8A 4B3TQ 1XNRL 1RJTA 2EYLA 1ASZA 4ICVA 4URKA 2E2HH 4QIWE 4X66Q 4XZ4A 1DZ1A 1PDXA 1SYDA 1AE3A 4OZAA 2R93G 2IO0B 4LW1A 5J3BA 5BN5A 4CDFC 1DCZA 1K50A 2KXJA 5C2TB 3VTUA 4IM3A 1JWBD 3AECB 4FN2A 3P20A 2EJFC 1WY8A 4JE3B 2Q2UA 2UU9L 2V3SA 1RWSA 3AU5A 2BPSA 1Q86C 2I38A 3PIOA 1IW7D 4B3MQ 3RLNA 2EPBA 2DZMA 5JJKA 2UYZB 3I7FA 5LNK1 2B2WA 1WJJA 3OAWA 5AUKA 3M95A 4BVUC 2BW2A 4FP5D 1VQOA 1K8RB 3PLVA 2F0UA 1KNEA 2F0NA 3DM1A 3HOZB 2JA7B 4DR3Q 4ICUA 1IBML 5BN3A 1EWHA 1VQLA 1NR2A 5IGCA 1KM7A 2B2WC 1AN8A 3EGRA 4QIWB 3RUIB 4W9IA 2M0XA 3CCRA 1TGZB 1FJGL 3U4EG 3QJZA 1ML0D 2GA4B 1X3GA 1X32A 3RFZB 5JJIA 2X6GA 2IX0A 5F2DA 3Q8FA 4PZ8A 4A3FG 2MHVA 4P73A 3CQZH 1C78A 1HZ6A 4LNFA 2I46A 5IGDA 5KIXA 2IO3B 4C7YA 1Y1WB 3IFDA 3C8YA 2NVTB 3PVLA 1VQGA 4CHTB 5IGGA 4IDIA 4EVOA 3T9LA 5CC4A 3T1HQ 1ICFB 1AP0A 1KDAA 1TWGH 1QF6A 2KANA 3CCMA 2KYWA 3N1XC 1KH0A 2OQKA 4LFBQ 4AYBE 2EXDA 4OIKA 2JRHA 2F0QA 3APDA 1FYCA 4K7WA 1AZQA 4B0MA 1WFQA 1X54A 2JQOA 3HOWH 3RNFC 1JOQA 4DAPA 1SF0A 4LDTD 2KENA 1SSNA 3JC66 4DBGA 1G8ZD 1WCMG 5K36H 5FO9B 1YOVB 2G45B 2PIAA 1CKNA 4BBRH 1XMOL 3U7ZA 3G6JB 3PO3H 1KF6B 4A3OA 1EIFA 2X69A 3L3OC 3ZYYX 1V6EA 2NBWB 3R3MA 4FULA 4A90A 1YEZA 2JZ3B 1F9PA 3BS1A 2M2LA 3VYSA 4HKZE 1MI2A 2L0FA 4DHZE 1EQVA 4IZ8A 4AYBB 2N88A 1ZUD2 1PTOD 3D6WA 4K1RB 4MH8A 2BE5C 5LHY1 4JVZA 4OO1G 3PCOB 2Y0SE 1B50A 2IO1B 5CV7A 1LXDA 4FXGC 1UBQA 4QUFA 4XGAB 2XN9C 3GTQB 3FDTA 4ZYNA 2CH4W 4X64Q 4FF3A 4V190 3S14B 1WGKA 4EEWA 2CR5A 3QAQA 3T1YL 1VZ7A 2IO2B 4ARIA 3C19A 4WJOA 1MG4A 3S1RH 4B6WA 2D0OA 4KJNA 5M5WB 2A8VA 1MD2D 4KHVA 5FR3A 3V05A 2F0KA 3K57A 2JJQA 4X65L 4XYCA 2DYBA 1FM0D 4DHZB 1P8LA 3ZTCA 2KFKA 2GVBA 4CJ0B 1E1OA 4JI2L 5E4WC 2YU9B 1C4QA 3RLFA 4IFDJ 1C4PA 1HR0L 2PE6B 3GTOB 5GMVA 2M0AA 3WA0A 2Y0SB 4DDID 3S17H 3K7AH 4IPHA 5DEHA 4KHZA 3T4AC 3A9JA 2F03A 4BKSD 4Q2JA 4RKBA 5HGQA 3E0EA 2N1VA 5JPNC 4LF7L 5CX3A 1HNWL 4W9FA 2KTFA 4KDIC 3I56A 3HIZA 3L17A 1WX7A 4A3EG 3ZJVA 1UEBA 3I4LA 1PH8A 1G2SA 1KLGD 2Q8RE 2V1YA 3I8ZA 4YCUA 2Q2IA 1V9JA 3OLMD 4H0LC 3G7LA 3H0GH 3J7ZC 1F2RC 3VXWA 3CC4A 2DJGC 4XDDA 4FNFA 3J81L 3SGIA 3I4OA 2LRWA 1H9MA 1KAWA 4WJ3M 2OWOA 1LQBA 2ICEC 1QOGA 2JEAI 2FCMA 3NY5A 1N5XA 4ZRJA 1A70A 2WKCA 1SYFA 5I9PA 4K3CA 2CHZA 4XQQA 3RD4A 3NELA 4GXBA 1P9DU 2DLBA 1I42A 3BWUD 3QIJA 3C3LA 3B1LX 4GZYC 1EOTA 2KMMA 1GUOA 3A4SC 1VZ6A 3H94A 5C4XG 3KH0A 2E2HB 4KIKA 1CHQD 1S1QB 2ZTCA 5LMNQ 4KX6B 2VQEL 2B2YA 2KQ3A 1IBLL 3GTMB 5BYRA 1JQ4A 2NN6I 5IYBH 2KC2A 1SSOA 1PRTC 1Z6HA 2K5PA 1MJEA 3DBLB 2NTTA 1RHPA 3K5OA 3E9HA 2B2YC 2FIDA 1V1OA 3TDQA 4JOIA 2PTLA 1G291 4GKJL 3EFUA 2XBBC 3PZ7A 4C00A 2IWHA 2R7ZH 1SYBA 2TSSA 5I6YA 4DK3C 3S16H 2BYFA 2F0LA 3H09A 2KLGA 1Q3LA 4YTNB 4KHPL 3STBC 4JOIC 3EFXD 4OEMB 3AFQA 3JAMi 1X3FA 4QCLA 4MM3A 1K51A 2SDFA 1CUKA 1L5PA 1T0QC 3HRZC 1PRTF 3SK5A 5AJ3Q 5KNCA 3KFUA 1FXAA 2WINB 2EELA 2G4SA 5M3FH 3PSEB 2KK8A 5IP9G 1GD7A 2J4XA 3BVGA 1YN5A 1NJIC 2Y5PA 3A1QB 1E6EB 2MX2A 2ONQA 2B2UA 1Z5SB 4LCDE 5GADC 1WJNA 4GSWA 1PYSB 1UWVA 1X9NA 2L1BA 4ASWC 1MJCA 3CQZB 3ZNID 4IUTA 2XK5B 2BDOA 3NP8A 3ML9A 3AEBB 1I6VC 4JI3Q 3SFEB 3AE3B 3A7AB 4JYAQ 1L1OA 2PI2A 2L52A 1XPOA 3ERSX 1R4MI 3OW7A 3RT3B 1UZXB 1IGCA 1NENB 1WE6A 2M17A 5EBDA 1RTOA 3NHEB 4C3JG 3MAQA 1VQKA 2KTRB 1L1OC 1X55A 3J80E 2M1MA 3P7JA 3TMEA 3C1FA 3J80c 1ZDVA 3E6ZX 2RHSB 4R3DA 4AJYB 1SNCA 4BXXG 2A6ED 5E7NA 3HOWB 4Q5VA 2JXXA 4A3CG 1PUTA 3L10B 1S40A 4B3RQ 3DHHC 2MQHA 3PUYA 3H3VH 1LTSD 2PQAB 1EUVB 5CR3A 4CGYB 1SJED 4DUYQ 2FINB 2R7DA 1K8GA 4BBRB 1HTLD 2JSOA 5BMGA 1F2YA 3IRBA 3PO3B 3S2AA 2VUMH 1STHA 5IE8A 1K73C 3RNGC 2JA7G 3HOZG 3NBHA 1FO4A 4HCNB 1CA5A 1LUZA 2VNUD 1R4PB 2INDC 3MXGA 4X3SA 1N32Q 2K52A 1F9RA 4NAWB 1EOVA 3I91A 4DKAC 2LJ5A 3PGEA 3VRBB 4C4VB 2JE6I 1YNXA 2HTME 1IBXA 4KZCA 1TT2A 2R3ZA 4ZRZA 4BBNC 1N9WA 3MFGA 4GLVB 4JI8Q 3W1GA 5C0XI 4RGMA 4K81A 1DYQA 1NY4A 3LX0A 1SE9A 2EMTA 2K01A 1FRRA 2WXFA 3SEBA 5M5YH 3EUB2 3D31A 2MBOA 4P1BC 5K5PA 1E7UA 3S1RB 4IWOA 4CBVA 4YY3L 4MIUA 1TXYA 2DNEA 1C1YB 2ZM6L 2KX0A 1LM8B 3SXHA 3M62B 1IHZA 1LTRD 1PMRA 4QY7A 3X3NA 3CKIB 1I94Q 4FLHA 3UGBB 3Q8CA 1ENFA 2B3GA 2JA8H 1QVCA 1I6HH 4LF7Q 2ASQA 3UE1A 3TMPB 1KD1C 1UH6A 1PV4A 3GTPB 2DNCA 4R4CA 1JWMD 2JA5H 3BYTB 3BK2A 2IX1A 3FP9A 5FO7B 3S17B 3K7AB 1HZ9A 1XYIA 4N8X1 3AE7B 1XCTL 4G3XB 2KCMA 1FL0A 1TS5A 1XMQL 3IT4B 3VUWA 5C44H 1TR5A 2CVRA 2Z8LA 1PH2A 4OVVA 3ULLA 3AH7A 2RDGA 2QCZA 2CHXA 1SDFA 5HY6A 3PQIA 5KRUA 1WGDA 3HS0C 3UE0A 3CSFA 1A15A 4WJPA 5H8YE 3RI7C 3T53B 2G9HD 2A68C 4J6HA 5C3XA 3RN5A 2LVPA 1QQRA 4F8MA 1C76A 3H0GB 3DDCB 2WB1E 2LEKA 3L0WB 2B3AA 2BA1A 2DY8A 2RPQA 1AEXA 2BCOA 1VQ9A 1EYCA 1KQSA 1D8LA 3S1QH 3NS8A 3CRLC 2KWVB 2HD5B 3HM6X 4A93B 3N52A 5FLXE 4MSMB 2J0TD 1VJKA 4DR4Q 5FLXc 2KVRA 4US9A 2A73B 2JWUA 3KOJA 3NWSA 2YV5A 2K75A 5JEAG 3QOLA 1EQRA 5D94A 4NQLB 1TKGA 2O6VA 1KRHA 3IXSA 3TQYA 2OHFA 3GTLH 3I9V1 3NZSA 1F77A 1J8CA 2JA6H 4HCEA 1QUQA 4LF9Q 3PT2B 4LK1C 1LABA 2N3SA 4HJ8A 2A6HC 3UDXA 3RN9C 3UQAA 2BE5D 5DM63 4UHVA 3QARA 2ZXOA 2WS3B 2R7ZB 3ZVVA 3ENEA 3S16B 1PQSA 2K28A 2ZW0A 3PV1A 3RNAC 3QOJA 2DY7A 5E6NA 5CBAE 4IO9A 3V61A 2MEKA 1FRDA 5BR8Q 3HOUG 4IM0A 3R2IA 3JW0X 4OVZA 4RMAA 3TS2A 2OCEA 1QZEA 2GLSA 2WACA 4N8FA 1EQQA 5M3FB 4WWOA 4IPGA 3ZRFA 3OOCA 2IJ0A 2WFWA 3AE8B 2MBEA 2KHSA 1PGBA 1SEBD 4A3BH 1XPUA 1T0RC 3DEPA 2F4VL 3DBSA 4PYUA 2LGYA 3EECA 2AUJD 3GOEA 4DNTB 4GLAC 3KYHC 3ZDTA 2H5XA 3G71A 1O80A 4DAYB 1AW7A 1ZGUB 4GNXA 1SFOH 3J7AF 1EO6A 2JXMB 3DWGC 4EZLA 4L5QA 3DHQA 4RHRA 1W3SA 3V2TA 2SOBA 1STBA 4DR6Q 4XWWA 2IT1A 5IODA 1IW7C 4PK1A 1SBBB 4GNXC 4ZKBB 4ABNA 3TP6A 2IZVB 1Y1VH 4AJWA 5EJWA 1EIYB 2N9EB 2ZZPB 4FJYA 4N58A 1YJJA 3KLWA 2VQFL 2ZJPA 1PA6A 5JXVA 2AQ1B 2DHZA 4X3KA 5GAHC 3T56B 5C3EH 2KCCA 1QVFA 3S1MH 2DENB 1WZ3A 3PPAA 1TKEA 3CF5A 3K9PB 5HI1A 3R7QA 1O7ZA 1VQCA 2N55A 4BAXA 2KUMA 3A9KA 3PHXB 3D3RA 1C0AA 1RFKA 1Z9FA 3O13A 1WX8A 3O65B 1EY8A 3TP5A 4LNIA 1BCPF 4TQ0A 4II2B 2RDBC 3KF8A 2LWPA 1V1PA 2E6XA 3CSTA 2G1EA 3MHZA 3DEOA 4FO2A 4YSYB 5IO9A 2QEXA 1ACCA 4C7ZA 1TZOA 3KYCD 5AZHA 1SE3A 1GVPA 5KYLA 2KCNA 1VMCA 4NP5A 1WM2A 4NPNA 4UY8C 4X3TA 5DAUA 2F0EA 1V86A 4OWXB 1PRTD 4NKLA 4KKSA 2JSVX 2MFIA 1BT0A 2Z0DB 2CWAA 1LGRA 2VB2X 5FOBB 5M5YB 2E75C 4S0RA 1P0RA 2K22A 2VB3X 4NXNL 2CKHB 5BMIA 1S5CD 1VCIA 2KN5A 1N8RC 3L7ZC 2L8JA 4ZDVA 1BVSA 1A6XA 3NRZA 4A3IH 2FBWB 1C79A 2K8CA 2NPTA 4M8NA 3STBD 1B8AA 2K25A 4I6NB 3ND8A 4ME3A 4WJQA 4RF1A 2KMAA 2BDNA 4WFN3 2HHHQ 2DUDA 2AQ3B 1I6HB 3E3XA 4FJVB 2Q8TA 3BIID 2MJDA 3HOWG 2JA5B 2WXRA 1VCBA 5BO4B 4K8JA 4JLCA 4KJOA 2UUAL 2NTSA 4J3OD 2VH1A 3MXUA 2UUCL 2KEEA 4JV5Q 3N9YC 5KGUA 5K36G 1MVKA 1E8WA 2IHEA 1B3AA 4BBRG 1PTOC 4OVUA 1QNUA 4TQ1A 1EEID 3PGZA 5C44B 3BDCA 1IZ6A 3VYUA 2GBNA 2INPE 4RCOA 2CJNA 5DNFA 5CHFA 2LUEA 4HWIB 4B3TL 5D6JB 4M00A 2KECA 1NAPA 3HFZB 3KDFB 3OWEB 3TN2A 1JJ2A 4X66L 1YNTE 3UINB 2LUMA 2E2IH 2BOSA 4IWQA 1BO0A 2M56B 5AEKB 1DOKA 2NYZD 1KDBA 4ZUIA 4C56C 2BBCA 3H1UA 2WYQA 4LJZC 3GD7A 2CH4A 1NVID 3EQLC 3S1QB 1S5FD 2XIWA 2KDBA 4RA8A 4XDXA 5HHDG 1KTKA 2JRIB 4B3ML 3CC7A 4P74A 2E3TA 2WU5B 1FXTB 3DBRI 4M8MA 3AE1B 3MP9A 3LJ3A 1LTLA 2C5CA 4K8IA 3U8ZA 1K28A 4DR3L 4HKQA 2FHTA 2PEAA 2UXBQ 5FK9C 3WAPA 2F4IA 5D2MB 3S1NH 2DNFA 1UAPA 2Z1CA 1V9PA 2RSOA 3F2UA 4UDUC 1WTOA 4OWWB 1SNOA 4RM9A 2PZWA 4CKBA 3P4RB 3GTLB 3Q2AC 1W2BA 1L4ZB 2JA6B 2HD3A 2FCNA 2KWCA 1E7ZA 4RWSC 2UXDL 5E4XA 2D3GA 3H9DA 5DPWA 1D4BA 1JC7A 5EBCA 1WI5A 4H13C 3E5SA 2AWNA 2K8HA 4E3CA 3A54A 2PPHA 1KOTA 3KJOA 1LTAD 2G9DA 2VXWA 2LI5A 3VRAB 4MH0E 4GS3A 2KEDA 3HHMA 5CYUA 5ELNA 4WAAA 2JF5A 3T1HL 1D7QA 1E8ZA 5C0XJ 2INCC 2L7RA 5EE9A 3MXNA 1JALA 1R7SA 1ZYRC 2MO1A 3PUVA 3VYRA 4LFBL 3A33B 1SROA 1RTNA 1TWHH 1AYFA 2MSED 2XTIA 1L0XB 1SMYC 3VH3B 3C46A 4A3BB 3MFYA 1L7YA 4BY7H 1YQBA 3QHTA 1U4LA 1VQAA 3VUYA 5IN7A 1LYLA 1C3TA 1DD2A 2D3AA 2W3RA 1KRSA 1DONA 2J0JA 4IUUA 4R4IA 4PG3A 4JC0A 1SFOB 1HCZA 2EY1A 4BA2I 4ACFA 1V80A 3DM3A 2WXHA 3TS0A 5I4DA 1L0WA 1EFWA 2LY7A 1JQYD 3HZXA 3H6NA 2EYHA 2YLMA 1Y1VB 1WMHA 2OOBB 1DOIA 1B70B 5IYBG 1A8VA 2JN4A 2WB1G 2A68D 5G5HA 4ARCA 1P7FA 3LWEA 4BA1I 5IYCG 5C3EB 4OO1I 1XF5L 3S1MB 3GO5A 1XWEA 5EDSA 2HIVA 4HMJA 3PS6A 4NMZA 2LJIA 2DN8A 2E74C 4X64L 1WOCA 2KHIA 1YZ6A 3HEJA 1M8AA 1YBYA 1OGWA 3KVFB 4MGKE 4QB4A 1JORA 3QK0A 5LMNW 4ID6A 1SXTA 3A7LA 1T9HA 4IWPA 2JU6X 3A4RA 1FMAD 1QT9A 2SNMA 5M3FG 1LT3D 3I55A 1O78A 4ANUA 1YD8U 1CKNB 4PZ6A 2UUBQ 3HKZE 4IOAA 3I3TB 3LB8C 2WXMA 1VZ8A 2NN6H 4DU9A 2CCZA 3NPPA 3FRPB 1II3A 2KBNA 1BNZA 4TRDA 2PW5A 2K6DB 2KC1A 2W54A 2ZVOA 1FNUA 3AN1A 2IY0B 1SR3A 1ET9A 1NE3A 3BYYB 3VR8B 1PH9A 2A6HD 5HG2A 1SAPA 2LVQA 2O6VD 4DNRB 1C8CA 3IKJA 4JI0Q 3DQVA 3SHQA 1S5BD 4M01A 5DM73 2KZRA 5M3MH 4JI1Q 4GDLA 4DA2A 2V1CC 4A3IB 1MJDA 1LTTD 1U4PA 2F52A 4O42A 1J7CA 2UUAQ 2X8XX 5JHBA 4F1SA 1I4XA 2MJ3A 3NEMA 2G4DB 4XYOA 3D4RA 3SDLC 5D3IB 1X1MA 4B95A 2EKIA 2GMIC 3CCEA 2Y3AA 1WM3A 2KHWB 2PKOA 4EX5A 2BWFA 2RQXA 3S24A 1EZ6A 2J0KA 1JT8A 2B2TA 1KRTA 2A74C 3LGJA 3J81i 3M63B 3ECIA 5LMUQ 2BGFA 3N20C 2NZHA 1EYDA 4CDDC 3CW2C 3I5JC 2J0MA 4KV2A 5EKIA 2VUMG 3GTMH 2KFKB 1V5OA 4HROA 1NBWA 2WX1A 2B2TC 1OEYJ 2Z6BA 2KLCA 2LGSA 2IGDA 2AMCB 4G11A 1WXSA 1TTNA 4JX1C 3E56A 4ANVA 1WTWA 3ZXVA 1FIQA 3MXPA 5LMNL 1MFWA 2E2IB 2RCFA 1LTID 5C6AA 1PFBA 3N3KB 2K33A 4RG1A 2F0TA 4K2LA 1EY4A 4MN3A 3RZOH 5KHOA 4NJCA 5G55A 1NTGA 3LWUA 2PNRC 4ZRPA 3K58A 4FHKA 4DV0Q 3X0WA 1H4RA 4LFCQ 3HP3A 2FIFA 2LRUA 5CV5A 4I7AA 1I5FA 1WGRA 2F0FA 1PLFA 1N63A 1WD0A 5GAEC 1SE4A 3NXWA 3QWNA 1J8IA 3CAMA 1V1QA 2WNMA 3D4WA 3PREA 2CWPA 1K0RA 5JAVA 3CCSA 3TJPA 4DV5Q 5AJ3L 2UXDQ 3S1NB 1YN3A 1BMLC 4GN5A 3GTJH 3L13A 2JA8G 1U4MA 2AHOB 4NW2A 3TSSA 2K5NA 4R1JA 3PZ8A 5G5GA 1L2NA 2MCNB 2XVSA 1YX5B 1C7YA 2NVXH 4AP4C 2HE7A 1PRTB 3NTKA 2Z0SA 1VQ7A 4WWNA 1KDCA 1VQ8A 3K5LA 4KIKB 4O1NA 2PMVA 4HRSA 1AZPA 3TCAA 1X3PA 4JI3L 5C44G 4DR1Q 3AYHB 4FF2A 1RL2A 2XNAC 1XPRA 3TREA 1HR0W 4JYAL 4YWMA 4K0KQ 2NBVB 1J5EQ 1U5KA 2QCPX 4GDKA 1BUIC 4IUMB 1D2BA 1F9SA 2NUCA 4LF6Q 4GU2A 2KAJA 1ZOYB 3K8AA 2BB6A 3J80L 1HFNA 2K9XA 2L0TA 1E2WA 1TWHB 2F0PA 5BN4A 2N49A 1WVLA 1W6JA 2KDEB 4MM3B 4LNKA 4K6LA 2NR2A 1MIUA 2FMMA 4BY7B 1R4QB 1NBFC 2D10A 4HDOA 1KLVA 1FNWA 2EYJA 3UDIA 4B3RL 3WCQA 2KOXA 2FJ2A 4DUYL 2F0GA 3KBGA 1N36Q 4JI7Q 2OXPA 3MC9A 1FFUA 1OXTA 5I2YA 1Y14B 4A3MH 3R66C 1VQIA 2C7HA 5G2NA 3K7UC 3HKSA 1X6OA 4KKUA 3TEYA 1N32L 2R2OA 1E24A 4V0BA 5EQ0A 1N33Q 1VQ6A 1U0LA 4JPBW 4BBSH 1GUAB 1ZXTA 4DV6Q 1L1OB 3Q8DA 1X65A 5FJ8H 2RD0A 3AE2B 4M8AA 1QNKA 1V5TA 4KGTA 2XGTA 1VMPA 2JA6G 4A3LG 1GXDC 4QMGA 3Q6SA 4JI8L 4QAYA 3SR6A 1YHBA 1L2FA 4RGTA 1WR6E 2KDFB 2YTXA 3RNEC 4L6TB 3CCVA 2RGFA 2EXZA 2WAQE 3GTKH 3GZNB 4ZOHC 1WTRA 5IYDH 2L3ZA 1YQ4B 1JMCA 1OXXK 4OIJA 3QWZB 1CFMA 2VW9A 3NENA 5FLMH 2PW7A 1VS0A 3GTPH 2KMCA 1YJIA 4A3JH 1ZXHA 1JB3A 4KDLB 5JH5C 2C5LC 2NBUA 1I94L 3U4VA 5I2XA 2OTLA 4HPMB 2MHJA 4OELB 4F87A 2MP2A 3VH4B 3PIP3 3PRZA 3ZNHB 4C1NK 4W9LA 3PSIA 1IYVA 3WIMA 1Q8KA 3H15A 3NJTA 1NUCA 2WGSA 2MLBA 2I5LX 4LAAA 1CQVA 1Q12A 4GOCA 3BZCA 1HA5A 1K3BC 2Z9HA 4PNYA 1Q5WB 2A5UA 4F8CB 2F0DA 2WAQB 1YQ3B 3ER0A 1PZKD 2K5VA 2ZT9C 4WH4A 3QIAA 5M3MB 2QDBA 4O0AA 3QX1A 3HVZA 4LLGM 1IYJB 1H95A 1E10A 1SNQA 4RCNA 1TWAH 4XXEA 2JP1A 1Y1VG 3AE4B 4JW0A 4G57A 2ACZB 4A93H 4OL7A 2A69C 4EQOA 1CZPA 1SN8A 2JX5A 1ZYRD 1JICA 2CKZB 5C3EG 1TIFA 4JIOU 3Q24A 3QCAA 2JXTA 1SMXA 2JA9A 3CCUA 1SMYD 3PUWA 3WOFA 1Q7YC 1VRAB 4BZAA 3CP0A 5EE1A 3AXCA 2CQAA 4I65A 5FLXL 4NPSA 3J81j 4DR4L 3DVGX 3ULPA 3KYDD 1A63A 3RR5A 1PTOH 1QVGA 1R4MB 1EF5A 4GN3B 2WXOA 4C3IH 4GGQA 2ATWA 1TKYA 2QC8A 4GMVA 4XWTA 3RZFA 5EPLA 4P2CB 1YN4A 2O2VB 4KD4A 1WXAA 1R4NB 2LGIA 2I5MX 3S9WA 2MBQA 4JWSC 4TUUA 3DWAA 3RZOB 1XT9B 2LD9A 1JE5A 3OYYA 4N9TA 2JZZA 2L00B 1TIID 4A3KH 1EWIA 1VQPA 2GBKA 4LF9L 3ZO5B 1CTMA 3TZDA 1VQ5A 4OZCA 1PHJA 5C1ZA 3A8IE 2QDLA 1O7LA 4UPAA 4G7OC 4NNJB 4K3BA 3Q3JA 2PLPA 1T5EA 2QHOA 3OSOA 4WIPA 5GQOA 3VR2A 2KWUB 2A5HA 2BH2A 3AB5A 2LKVA 5BR8L 1T3QA 3FAHA 4FXCA 3NTHA 3NUHB 3K80C 1RKNA 1TWFH 2M8SA 4NJ6A 2GB1A 2SNSA 4A55A 3PO2G 2MPMA 3GTJB 4WAFA 2RPVA 1F2ZA 3HKZG 2ZTEA 1D1KA 2B2UC 5IGEA 1E90A 1L4DB 1ZKOA 4BY1G 2NVXB 2L0CA 2BS3B 2FUHB 4ZRKA 2K1BA 2F0MA 2K6QA 3OW2A 2LFIA 3ZIMA 1WGYA 3VR3A 4DR2Q 5GAGC 1NDDA 3H7SA 3TL5A 2FE8A 4OX9Q 4K5VA 2OEOA 3PMFA 1G6ZA 4CYEA 4A6QA 1QUQB 4DR6L 2XRSD 3ZJTA 2D3CA 1TBEA 3I63C 5D7GA 3MC0B 1S3SG 4WQMA 4CDEC 1XX8A 3CCJA 4NB3A 2O5IC 3SD5A 2QW7A 4KD3A 2WXJA 1WYWB 1H9JA 2LFNA 1PFMA 1E0ZA 3MTSA 4Y52H 2PQEA 2Z6KA 1X3QA 4DK1A 1HPCA 1V8CA 4RNAA 1ZE3D 2BB5A 1F9JA 4HLEA 3PRMB 3HK0A 4A3MB 5E1FA 4MJSA 4CHKA 1NSNS 2Z6KC 1EIGA 3EN2A 2V4IB 4K7UA 2VY3A 4DV2Q 3W1BA 5A2QE 3NZ3A 2GBRA 2JEBI 2V4LA 1JJCB 3DCGA 4ZAIA 2JY6A 4EQPA 1EY6A 3ITPA 1WSPA 2W55A 4BBSB 3I4MH 2R93H 4GNXB 1GUSA 1Y1WG 4DUZQ 1E5WA 1GOZA 1BF4A 1EF1A 2LASA 1G51A 5D3DA 4IFDH 3FKIH 1OXUA 5H1SE 3IAYA 2WDRB 2QGQA 2ASBA 3MHSD 1TS2A 1FVIA 2K04A 2DX5B 1XXGA 1PXUA 1GC7A 3GTKB 2EYOA 2RSNA 3K81C 4LUOA 4C2MH 2R92H 4I6LB 2WXKA 3WALA 3CD6A 3N1YC 4A3JB 2K3UA 1FCLA 3KWVA 4UP9A 3EJIA 4BOSC 4E74A 2H1EA 2D3BA 1FGUA 2EY5A 2HHHL 2PJHA 3A9KB 3LYYA 4B08A 2RDHA 3RZWC 1B9MA 4BY7G 1QJOA 1H9KA 4OZBA 1V1PB 2EOTA 4IOCA 4A3FH 4LF8Q 4JV5L 3BINA 4BKTA 1HUMA 2KO3A 3IBEA 4DAMA 4X62Q 2BWES 2L5TA 1EFID 1P1AA 4FBJB 3E9IA 3F8TA 3FKYA 1VQEA 4AYBG 1L0VB 2MGSA 3VHTC 1LTBD 4OONA 1HA6A 1P16A 1TKWB 5MPOA 2KKCA 4LNNA 3ZJYC 2L1AA 2PCFB 1TWAB 4LDTB 3AE5B 2XEWA 2BH8A 1CKOA 3I72A 3U9SA 1UE6A 2IL8A 2ENBA 3F1ZA 1KL9A 1O7IA 4HJ5A 2K32A 1YIWA 5TR5A 2KX3A 3H91A 2NVYH 1XCQL 2NPTB 1OXSC 2N78A 4EQNA 3GE8C 1PH3A 2NS5A 3PV0A 4S3SA 3SK4A 2ZXPA 3DOWA 1HE8A 1KIXA 5ELCA 1H9SA 3ULJA 3E9SA 3UIOB 3A1QA 2MP1A 1B53A 1PTOB 2REXA 4WJNA 1DGSA 4ZCKA 4B9XA 1D6EC 4G50A 2BS4B 4C3IB 1S5ED 2BF8B 3R7RA 1EWYC 3B0AA 2UXBL 1WTVA 1YJ9A 2Y0SG 3Q3MC 3TEZA 3ICEA 4KI0A 4JWUC 1N34Q 2MJEA 2MBHA 2XK5A 3H6MA 3MC8A 2JZPA 5AZFA 3RYTA 4LWCA 3NE5B 4DK6C 1TS4A 1SIJA 2D5GA 2M4NA 3HGBA 4C3HB 4IN3A 1HHVA 2IYDB 2L76A 4JBMA 4A3KB 4Q0FA 2WXNA 2EJMA 2C7NB 3NHHA 1XTCD 5CGKA 1MHWC 1B44D 3AEFB 3I57A 3N6RA 3CHBD 1R9TH 2EDGA 4BS9A 4LFAQ 4P1CC 1WI0A 2WAQG 3DBHB 5T8IA 2D2CC 3H7PA 3HOXH 5EPKA 3U52E 1RIPA 1BBUA 4P72A 5M3MG 4KGRA 2Z59B 3CCQA 5J39A 4KKJA 1YHAA 1PFSA 2F0OA 2K4KA 3M85A 4HJ9A 3ABVB 1WH3A 5DLQE 1TWFB 4L1BA 4NY0A 5IP7G 5H92C 2PQAA 1PFDA 1Q0WB 1TT5B 1LACA 1YITA 4K6DA 1KHIA 2KN4A 2WDVB 2EYMA 1CT1D 2Y5CA 3LXFA 1HZBA 3NWTA 1CJEA 1PZID 4JL9A 5GXGB 4RHSA 1ZW7A 3ZNGC 3FMCA 4NXMQ 4DHJD 2BS2B 4YXDB 3R93A 3J7AV 3DUZA 1EEFD 1A2UA 3Q0AA 4C4VA 1SIFA 3P75A 4XTCS 2EZVA 2EMSA 1HEZE 2MQJA 1BCPC 4AQYQ 2HDLA 3NOBA 4K5XA 1Q82C 3B9JA 4KVGB 3WDNA 4IPDA 3UIPB 1PGXA 4MEMA 1QE6A 4G7HC 5DPSA 2PO4A 1JOKA 4DV7Q 1K3RA 1PVOA 4W9KA 1QILA 2LHDA 3PUXA 4YIJA 2UXCQ 1PH5A 3PO0A 3P1MA 2A69D 3V6EB 4A9AA 2M00A 4QGUA 1WGGA 1XQQA 4LJOB 4PMCA 5D14A 2I5HA 2DYMA 1SYEA 4KY5A 1DOYA 3FVQA 2GVAA 3MXNB 4W9EA 2ZCCA 4PS3A 3RZDH 1N61A 2VZAA 4QUCA 3AI5A 1GM5A 2F1MA 4YT0B 1F0ZA 3K0YA 3QO2A 4XT3B 2MBBB 5J2RA 3T3OA 5IAAC 2BT6A 2GN5A 4IOIE 3NVWA 2VH2A 1IYFA 2ZNVC 3RNBC 3JSVA 4EZKA 1PH7A 4HJKA 1Q1EA 4DV3Q 3AV8A 3CMAA 2AWTA 3NVYA 2UUBL 2WQYB 1OO9B 1Y69U 3I4MB 5EE0A 2R93B 3HUIA 1KNAA 1LFDA 1OEYA 3FKIB 4LK0M 2K05A 3MEHA 3NQTA 2QILA 3MHBA 3ML8A 2MJ8A 4MGZE 2ZJRA 4A75A 2FXQA 1RCVD 2CW0C 3KF6A 4DR5Q 1SRUA 1ZDXA 3QA8A 1V97A 1A5RA 2E2JH 5JEAJ 2L15A 3DBRB 3KQ4A 4JI0L 4LMQD 2I1KA 4C2MB 1HH2P 2R92B 1MHHE 4JI1L 5DPTA 4NAMA 4JQWC 3ONSA 3TBIB 3TIXA 2IX3A 2QMTA 3ZW3A 1ONLA 1UD7A 1ENAA 1XNQQ 4K5WA 1ISNA 2KJ6A 5IP9H 4MACA 3PO3G 2RA4A 2LMCA 4M02A 2Y5BB 1IP9A 1CZWA 5HURA 2XWBB 3N30A 2OTJA 1MSGA 1C4CA 4KY6A 3VYTA 3SVMA 3H3VI 4A3FB 5C23A 5EAYA 2HQEA 3U58A 1JOOA 5LMUL 1HNXQ 5IGFA 2NVUI 4GLXA 1B1ZA 2E8GA 4A3MG 1P7EA 3AM9A 4HR7B 2YEPB 2LS01 1OQRA 3DVNV 4L2YA 1UWMA 4AQ7A 4IJHA 5J18A 4CDCC 2W3SA 3HVDA 4HSVA 4XQJA 2HCCA 1CA6A 5G3LF 1TQOA 4C3JH 1JJGA 4RGNA 5IIFA 4EQ5A 4ALPA 1J19A 3X23A 3KBXA 2EY2A 5FJ8G 2LVOA 4PS7A 1WRDB 4JI5Q 4Y7NH 4G4KA 3U4ZA 2NCNA 3KLSA 4DR7L 2NVYB 4DV0L 2J7QB 1ZPSA 4FF1A 3ERQA 4GDLB 1I4RA 1Q1BA 4LFCL 5JJZA 4A3CH 3AEGB 2A4ZA 3B2GA 2D11A 4GKKQ 1MKHA 4DV4Q 2GBJA 1PGAA 1JWUD 4PQXA 1WCMB 4HXDA 3Q8BA 2LXAA 5IYDG 2D9UA 2JUOA 3QJYA 4OWTB 4FF4A 3RULA 3OMGA 1TVXA 4OXPA 1QG7A 5FLMG 1JRPA 2HTHA 2EIFA 2IPKD 4ZK9B 2V4DA 1IL2A 2TMPA 4DV5L 1BQQT 2C7MB 1VQ4A 1EY0A 3DPDA 2MA9B 3EBEA 3F2CA 4A3DH 2VL6A 4F88A 2E2DC 4DAYA 4QQBX 5C5LA 1XJVA 3JAME 1VF5C 1Q81C 4JBKA 5CBEE 4K2KA 5ELEA 3JAMc 1S5DD 1ZKHA 2ZJQA 2PNHA 2X38A 2O5JC 1JMLA 1F2MA 1R9TB 1Y8NB 2D5DA 4R4OA 2RCNA 5LXIB 4DR1L 4MTKA 3HOXB 3H0GG 4K0KL 1ESFA 1VDVA 4A76A 1J5EL 1IBKQ 2FUG1 2KNBA 2YVCA 1I3QH 4KY7A 4US8A 4IUQA 4LF6L 2EQSA 1CZGA 4YCVA 3PLUA 2M9VA 3MJWA 2CS4A 4P75A 5CORA 3RN2A 1G2TA 3NZUA 4JI6Q 5CV8A 4A93G 1ZP0B 2RDFA 3TP7A 2LSSA 3J80i 5TSSA 3I4NH 3N32A 4YTPB 2E5LQ 4KSLC 5JVH3 4WWMA 2BYEA 5M5XB 2GOWA 3BZKA 3NTIA 4P71A 4NZLB 3OG5A 1J7AA 5C3WA 1N6ZA 1N36L 4JI7L 2V3NA 2WDTB 3GQBA 5IY0A 3UQBA 4FA6A 3VR6A 2WXLA 4C3IG 3DXJC 1YIJA 1W6KA 3A56A 2K1FA 1HNZQ 3BDLA 4FDBA 2ON8A 4EUTA 3M4OH 1N33L 2R7ZG 2XWJB 4DPGA 3L54A 3N1ZC 4G7ZC 4W9HA 3VDZA 4DV6L 1RODA 3RMKC 5IT9E 4GDKB 3PIO3 2KQ4X 2XRQD 1JCKB 2A1AA 2F0HA 5IT9c 2LGDA 3ETRA 4JPSA 4ZLTF 3IAS1 5E6OA 1LT6D 1CHPD 2H4OA 3TBLD 4LF4Q 1TY2A 2KCTA 3TEHB 2KDMA 1C9OA 1SYCA 3KJPA 4MDKE 1STYA 1HZAA 3RZDB 2KOLA 3M4YA 2IGGA 2OT2A 3I90A 1Z7TA 1EY9A 3L08A 1WZ0A 2ZTDA 4PMBA 5AUIA 4LNQA 2WU2B 4P7IA 1TWCH 4U673 2PZTA 4A3GH 4IW0A 2L9HA 5JEAH 1STGA 2A19A 4C1NI 3H8HA 2KJHB 3BK1A 3DHIC 1A62A 2K39A 4KSKC 3SU8X 2HUGA 3DWMA 4X6AH 1WRIA 3CIRB 1S72A 3VR9B 4ZYSA 4XIGS 4HEA1 1EU4A 1BBXC 2RMMA 4G0NB 4YWGG 3URYA 3DLLA 1HJPA 2E2JB 1F2LA 2JYEA 1QOHA 5CHWA 4EE2A 3TEXA 4MTNA 2INNE 1Y8OB 3G4SA 1D5MC 4IM2A 3AEDB 2AKWB 3L16A 3UDFA 4IQZA 2RBMA 5CV4A 1WXVA 3IVFA 3I3CA 1XEEA 1MGSA 2C9WB 4IC7B 2P5ZX 1G91A 4DK0A 2GBMA 2N9XA 1V49A 4YCWA 1U4AA 5E3FA 1G6PA 3A9JB 5CTRC 3VDYA 3J7A5 1N62A 4ILWA 4KKTA 2MP2B 2QJLA 3X3MA 1M90C 4RH6A 3EC8A 3NS1A 2F3IA 3GDEA 4YHHQ 4L8JA 2CFMA 1A3UA 3S2HH 4LJPB 1T6BX 4DR7Q 3RNCC 1BCPD 4NDXA 2M19A 3S15H 5HFYA 2N9KA 3KK7A 1FD6A 1GKHA 4DF7A 4C3JB 1QZHA 2DZIA 1QOAA 1JE4A 1QB5D 4RFBA 5IOCA 4JBJA 5JVG3 1A3TA 3I4MG 3M7NA 1DOXA 1F9QA 4RAUC 2RR9A 4Y7NB 3W5OA 4IFDG 1E3PA 3FKIG 1WWTA 3ZKJC 4J15A 2EVBA 3ND9A 2B8GA 2FCQA 3DHGC 4YTMB 5JJLA 1C77A 4RF0A 3RD2A 3FC4A 1PH6A 2R92G 3ZUNA 2GRIA 1XD3B 1TS3A 1OFFA 2ID0A 3ZDMC 2JA5G 3HOYH 2NB0A 1WXQA 1UEAB 3DWPA 1AWDA 4KK7A 2LZ6A 2K14A 5C0XH 5EE3A 2EJGC 3F2DA 4A3DB 3FEWX 1QKZA 5CHVC 1WTXA 5COYA 2Z4HA 4GOPA 1B9NA 2IBIB 1ET6A 1BDOA 1JR0D 3L9AX 2N1WA 3ZNZB 4TV3A 1PDQA 4AOFA 2WV6D 3B2FA 1U4RA 1SNMA 2LHEA 4JI4Q 3A0JA 4GOPC 4QL5A 2WP9B 3Q69A 4DR2L 1EIHA 1KABA 5ELBA 1T0SC 4J8QA 2ZJDA 2CW0D 2FFKB 4DQOC 2PI2E 4OX9L 4HK2A 2WDQB 4L5SA 1XLPA 2JT4B 4M0WA 1I3QB 3PUZA 1OTCA 1GHKA 2KJXA 3RMHA 3C1EA 1M1KC 1E22A 1E0BA 2UU7A 1YJWA 1QZGA 1IL8A 1Y56A 4GN1A 1RDPD 1EY7A 1HTOA 4IUVA 1SNPA 4BOZB 3D8GA 4U68A 1HQRD 2N8NA 3I4NB 1K53A 4MGIE 4X57B 5C5MA 3MEFA 4FXKC 2K8BA 2ICIA 1UNSA 1IKMA 4BWGB 4JBWA 1F2RI 1HFGA 1E2VA 3V60A 3DVGY 3DWQA 1B3QA 4DFAA 5G3LD 3FILA 1GAQB 2V9HA 4W9DA 1VR9A 4ODGA 2B8FA 2HCIA 4XT1B 1MSHA 1UBIA 4USAA 1TY0A 3ZLZA 4DV1Q 2RKSA 4DV2L 1IUEA 4ZUJA 2DAFA 4JGHB 5A2QL 3M4OB 1E7PB 4UP7A 2K6AA 2D62A 3G48A 4HCSA 2RF4A 3GS2A 4RM8A 2PVOD 5L95C 4DUZL 1STAA 1B9RA 4II3B 3TUOA 4LF5Q 1WYGA 1GC6A 2OJWA 3OTOQ 3MJ5A 4QF4A 1IXRA 1FPYA 4EZJA 1WTHA 4MZ9A 3Q22A 1GB1A 3HOXG 2G3QB 5T1IA 4B3SQ 4A3BG 3NBHB 1TU2B 1K52A 1EU3A 1C4AA 3ZXRA 1TZ1A 1TWCB 3GTGH 2K5QA 1AFPA 4A3GB 1BBWA 4EGVA 3C0RB 3GV6A 2MO0A 3L0OA 2IHFA 2K7VA 2SEBD 4I7ZC 3CXCA 4MJSB 3BG3A 1RFAA 3EHVA 1IBXB 1A0IA 1GUTA 3BDOA 1LV9A 4IURA 4KN4C 4EOYA 1JB7A 3T8MA 3DMUA 4LF8L 5ELOA 3GV3A 4HPPA 4X62L 4YSZB 2F0WA 3T13A 1SGHA 1VQBA 3T3NA 1NMGA 1NCVA 1BXTA 1PH1A 4HDQA 3R8BA 3V96A 1DOLA 3VA7A 3SDZA 1MG8A 2YYZA 3HOUB 1Q1OA 2CHBD 4XC2A 4A8XC 4P6VF 2CHWA 2R61A 2ZVNA 4UP8A 3S2DH 4MELA 5IWAQ 1OTRB 3CC2A 4ZRIA 2R7FA 3NG0A 5E6PA 1UE5A 3KUPA 4DN4M 5CMDA 4ZHOA 3RNUA 2D07B 4AIMA 3VTWA 3A8JE 2IY5B 1WF9A 4C80A 4EFOA 3OIPA 1VQFA 1XNRQ 4YSXB 1GO3E 1ESRA 3CMMB 1KFYB 1VD2A 3W2DA 3GZNI 3PZDA 4UAIA 3AU4A 1KC8C 4WJWA 4C3HH 1FXIA 1SNDA 2NVQH 3HG9A 2QF7A 3T16A 1K83H 3VR4A 3PF5A 3S2HB 3MTNB 3S15B 1NI2A 1OXVA 2VS1A 1N34L 2UU9Q 5DCNA 2O4XA 3SE0A 5JHAA 4XQNA 1VQDA 4B9KA 1DJRD 1WFYA 2N7EA 1CK1A 1E1TA 1WD1A 5IYCH 1WTPA 4A3IG 3K0XA 1Y8RC 1IBMQ 4O2DA 2KT7A 1LO5D 4IPCA 2PW9A 1G6JA 4LFAL 1PH4A 4OGQC 2PYKA 1FJGQ 2ZPNA 1STNA 1WXMA 2XSCA 3HOYB 1ILQA 3VUXA 1CQFA 2DGYA 3MA2B 1OQYA 1F1HA 4IJLA 4N6EB 1E9MA 3PIPA 4FVMA 1K8OA 2W82A 2K5WA 2C35B 2C60A 1H9SB 2HT1A 2O6VB 5LL6S 1RYJA 1ICWA 5KHQA 3EVQA 2B63H 1J7BA 4MNOA 4NXML 1XO3A 4PV1C 1AARA 4APVA 3LNNA 4XDCA 1E8YA 1HUNA 3KUZA 3C2PA 3VQIA 4HCPB 2L55A 2MUYA 2DJFC 2BTEA 2K50A 2PE9A 4Z9CB 4AQYL 1WJUA 4ZHPA 4GN4B 1GPXA 2K5HA 1RM6C 4HSPA 4CJ2C 4HIDA 3DBLI 5AFWA 4R8IA 2B2VA 4LUZA 4POFA 3KWLA 1TWGB 1WJ4A 1R4NI 4KKIA 3HOVH 4DV7L 4PZ7A 1E8XA 3H7PB 2UXCL 1XMOQ 2B2VC 1YI2A 3JYUA 1JW9D 3NQIA 3TRZA 5HGTA 3JVZX 4F7XA 3SK8A 1Z47A 1GHJA 3NUCA 2FAZA 3ALBA 1H8CA 1BUVT 1I50H 3SK6A 2MH7A 3AEAB 4TMAB 3P42A 5BYQA 3P1HA 2L4NA 4J6IA 3P63A 4IALA 4NQKE 3CPFA 3OJ3A 1BCPB 1SYGA 1YNJD 4YWKA 2WKDA 3W9CB 1NI3A 2OEDA 4FXDA 4JG2A 1FFVA 4GB9A 4DV3L 4A3DG 1C48A 1ZEQX 2BVCA 1J6QA 3CMEA 2N9PC 5ELFA 3M7GA 4RGOS 2I07B 3T1YQ 1DGJA 4BKGA 1P98A 4WRDA 2L32A 1GUGA 2NZ1D 3FPPA 2MNAA 3D32A 4DR5L 4W9GA 1NNXA 1L0YB 2SAKA 4X65Q 1BOSA 2ZEQA 1HXYD 1WYDA 2L05A 2J42A 1I4HA 1ILPA 1GG3A 5LLIA 4JI2Q 4H2AA 4PT5A 1LT4D 2AUKA 4H44C 4W9CA 4OW0A 1HR0Q 3KF8B 1D3ZA 1V8QA 2KDIA 3GTGB 3QC8B 4BBNF 2K0PA 3BVZA 3TZUA 5C4JH 1XNQL 2IGHA 2ZNVB 1VQHA 5I6WA 3IFTA 3I4NG 1CSQA 5ELDA 3TEWA 5KNDA 1LM0A 1FD7D 2F0IA 3VA5A 4WWPA 1QWYA 1HNWQ 3PF4A 4KTAA 3OIQA 4FADA 3RLOA 3RUZA 3JSVB 3D6CA 2BA0A 2O2LD 2O2VA 1PFNA 2KHJA 2YTYA 2I0QA 1EM7A 1E2ZA 1HNXL 4DXFA 2JWZA 2NWGA 3I70A 3ZRCA 1HQMC 1YNNC 1FNVA 5JPMC 5M9OA 1PYWD 1Z2MA 1EL0A 1RAXA 2F3VA 1I4PA 3D0FA 3VAWA 4HIOA 3M3JA 1Q8IA 3J81E 3KF6B 5KEEA 2PZUA 1F52A 1FGBD 3A55A 3J81c 3S2DB 1FCCC 2WWZA 1CKMA 3APCA 3VFKA 4AWJA 4ANWA 1PZJD 1WCMH 5GROA 1Q10A 4LTUA 4ANXA 4BFRA 3AMZA 1M94A 4JI5L 2ZW1A 4F7ZA 3Q3NC 3AMUA 2EYFA 4ME5A 2QEJC 2NBFA 1N60A 2BKRB 1SE2A 3AB9A 4GKKL 4DV4L 1P3QU 1YX6B 2VRRB 2R6GA 5BMHA 4A4IA 1WJ6A 5A35A 3ZQ4A 2VQEQ 2JQRB 1IBLQ 2LMCB 4B9WA 1ZXIA 2QKIC 4HIMA 2NN6G 4IG7B 2Q2HA 3ZTDA 2NVQB 1K83B 4E71A 4OO1H 1VLBA 2N4FA 5IP4D 4A3GG 3NK9A 4DAVA 4GKJQ 1E7VA 4AS1A 1A2TA 2F0SA 2KTRA 2VZKD 4HTHA 4TVAB 1NR4A 3NSWA 2WB1B 3JAML 1I7HA 3SHLA 1UGJA 4KHPQ 4A20A 3HRDD 4A3LH 2AX5A 3UF8A 4J1MA 1MI0A 3K6OA 1TJEA 5HKHA 4HIKA 1K8MA 3GE3C 4P16A 2MRPA 2UWQA 4B0EA 3W5UB 1B4OA 1IBKL 5FKAC 4DXAB 2ZPYA 2DAJA 3PHWB 2AL6A 2Q5WD 3GB1A 1EY5A 4PS8A 5M5XH 2BYVE 2L83A 1CSPA 2CQOA 4JI6L 5C4ZA 3AQQA 4NAWA 4HN7A 1N5WA 1CI3M 2HJ1A 2ZCBA 5LL6X 4XE0A 3AEVA 3SFDB 1ENCA 3CCLA 2BKFA 2E5LL 2B63B 1YVCA 2C9OA 4ULLA 2OF1A 1JROA 2WXPA 1B7YB 2EY6A 4ZKCB 3OHXC 5T1GA 1FEHA 3T51B 4A3EH 2ES2A 3IHPC 5J17A 3AE9B 1XLNA 2KD0A 1EYAA 3DVNU 1MBYA 2LXKA 1S4ZA 1HRJA 3EFCA 1HNZL 3EIVA 2DYOA 2JYTA 1NYRA 4CKEA 3HOVB 4AH6A 2AL3A 4YL8A 1VQNA 2DWQA 4R9WA 2WX0A 1I4GA 3MWYW 4YWLA 5IT9L 3ONAB 2N9LA 2L11A 2H89B 4L5RC 4W9JA 5J1ZA 3W1SA 3OJ4B 2NZOA 4LF4L 1WX9A 5C4XH 4DNIA 2KQ7A 1WTQA 3CF6E 1I50B 3NBIA 2WIIB 1K8AC 3DBHI 3W1YA 4ZRQA 2VUMB 1UELA 3W1SC 4HJAA 3HOYG 2HDEA 3TP8A 2KVMA 4KZ0A 1UF0A 4L5TA 2WXIA 1GB4A 2RSUA 5C0XG 5JOBA 2KVZA 2CU3A 4CJ1B 3P4SB 1Y8PB 2JYOA 1WGHA 1WMHB 1K9MC 1UUPA 4N9PA 4ZQ3A 2AYOB 4DWFA 1PYBA 3VTVA 1UGMA 4MHEA 1JWAD 3AEEB 4QJFA 1IKLA 3Q3OC 3CWIA 3Q14C 3PRPB 4L63B 4M1UB 4K7SA 1UWXA 2Z0EB 3I2ZA 4YY3Q 1XTDA 1YHQA 3M3YH 2H88B 2ZM6Q 4FHJA 2KJRA 4PYZA 3Q8EA 1H9RA 1RF2D 3U7DA 3MZ5A 3OMCA 2N7DA 1D5ZC 5EKLA 3R2TA
chains in the Genus database with same CATH topology
3EA6A 2Q8IB 5D65A 1LLRD 3Q23A 3J9CA 1CM9A 4FYDA 5EGTA 4WURA 5C4JB 1I4QA 4OHJA 3K59A 5KYIA 2JA8B 3WOEA 5KNBA 1XLQA 1DXMA 3AU7A 3I73A 4JK1C 3K5MA 2KWDA 3NVZA 5BYSA 5CV6A 2Z4IA 1D5XC 3UI3A 1KAAA 1QLBB 1EZ8A 3MVVA 1B2TA 1GUWA 3L4PA 2V0GA 1SJHD 1GJXA 1MHXA 1EQTA 1O7YA 2WXQA 3BVMA 4H7BA 3V3XA 2ZXRA 4D2KA 2QIEB 1PTOF 3Q8AA 1EWCA 1LTGD 1Q90A 1IYUA 5I9OA 4IFDI 1QOFA 2IDYA 4HEDA 4KGSA 3BZDB 2KA7A 3UI2A 3K5NA 4ITKA 1DOMA 1LT5D 3QG1A 1MPEA 5C3JB 2PMZB 1HTPA 4WORA 1NYQA 1YMHE 4GLSC 4N59A 2I2YA 3KLRA 2AQ2B 3D4DA 4KV6A 2PVGC 2BYTA 5NUCA 3QB3A 3ZGZA 3GP7A 4KN7C 3IAM1 4TQUS 4E6IA 4XYQA 1C9FA 1OQQA 3RPFC 2DBYA 1STEA 2K5DA 1TYGB 4TSSA 3H3VC 2WXGA 2K03A 1V43A 3IT6B 2WP8J 3U2SC 2B39A 2CJOA 5C4HA 3VR5A 4CQNA 3SR1A 2RVLA 3P4QB 2HDMA 2F3WA 1D1IA 2V3PA 2WLBA 3W3AA 3OWFA 2EE1A 2GI9A 4RKLA 5ISRA 1XLOA 1FR3A 4MT5A 3FPUB 4A3EB 3P4PB 5FO8B 5E6JA 4C3HG 4HJGE 4CKCA 1QOBA 3ZJUA 1U9RA 1YNND 2J53A 1KLUD 2J7ZA 3R3OA 3U9OA 5J22A 4R8NA 1L6UA 4DXGA 3OPOA 2E76C 3NVVA 1BR9A 4IUPA 1HZ5A 3CRKC 3AE6B 5EPJA 4REZA 5C4XB 4X3UA 2PPBC 3EROA 2L12A 1VDZA 2B76B 1ROEA 4HMIA 2KACA 1IGDA 1VF7A 2QSDA 1RD9D 1M4VA 3KLSX 3W5VB 2N0SB 4PMWA 2VZKB 3FILB 4IUNA 4TKOB 5CV9A 2FMCA 5EKKA 2AWOA 2X6LA 2EYPA 5IGBA 1JWSD 4HAEA 3M3YB 3CU7A 1J9OA 1SB3C 2A6EC 2NMQA 2F0VA 1QCBD 3IL8A 3E0JA 3PO2B 1T5XD 1NEKB 4L23A 4KMUC 2IW3A 3HKZB 2N7JA 2F0JA 2YEPF 1DM0B 1L6VA 4IKGA 1YNJC 4DGZA 4BY1B 2J52A 1A3VA 4K14A 3J7YW 3A8KE 1GUNA 1RJTA 2EYLA 1DZ1A 1PDXA 1SYDA 4OZAA 5BN5A 1DCZA 1K50A 5C2TB 1JWBD 3AECB 3P20A 2EJFC 4JE3B 1RWSA 2I38A 1IW7D 2EPBA 5LNK1 2B2WA 5AUKA 2BW2A 4FP5D 2F0UA 1KNEA 2F0NA 3DM1A 3HOZB 2JA7B 5BN3A 1EWHA 1NR2A 5IGCA 2B2WC 1AN8A 3EGRA 4QIWB 3U4EG 1ML0D 2GA4B 3RFZB 1X32A 2X6GA 2IX0A 5F2DA 3Q8FA 2MHVA 1C78A 1HZ6A 2I46A 5IGDA 5KIXA 4C7YA 1Y1WB 3IFDA 3C8YA 2NVTB 4CHTB 5IGGA 4IDIA 4EVOA 5CC4A 1AP0A 1KDAA 1QF6A 1KH0A 4OIKA 2F0QA 1FYCA 1AZQA 4B0MA 1JOQA 4DAPA 1SF0A 1SSNA 1G8ZD 5K36H 5FO9B 2PIAA 3U7ZA 3G6JB 1KF6B 2X69A 3L3OC 3ZYYX 4A90A 1F9PA 3BS1A 2M2LA 3VYSA 4HKZE 1MI2A 1EQVA 4IZ8A 4AYBB 2N88A 1ZUD2 1PTOD 3D6WA 4MH8A 2BE5C 5LHY1 4OO1G 1B50A 5CV7A 4FXGC 4QUFA 2XN9C 3GTQB 3FDTA 4FF3A 4V190 3S14B 1WGKA 1VZ7A 4ARIA 4KJNA 5M5WB 1MD2D 4KHVA 5FR3A 3V05A 2F0KA 3K57A 1FM0D 4CJ0B 5E4WC 2YU9B 1C4QA 3RLFA 4IFDJ 1C4PA 3GTOB 2M0AA 2Y0SB 5DEHA 4KHZA 3T4AC 2F03A 4Q2JA 4RKBA 5JPNC 3I4LA 1G2SA 1KLGD 2Q8RE 3I8ZA 4H0LC 3G7LA 1F2RC 4XDDA 4FNFA 3J81L 1H9MA 1QOGA 2ICEC 2JEAI 1N5XA 1A70A 2WKCA 1SYFA 5I9PA 4XQQA 3RD4A 2DLBA 3BWUD 3C3LA 4GZYC 1EOTA 2KMMA 1GUOA 1VZ6A 3H94A 2E2HB 1CHQD 4KX6B 2B2YA 2KQ3A 3GTMB 5BYRA 1JQ4A 2NN6I 1SSOA 1PRTC 1Z6HA 2K5PA 2NTTA 1RHPA 3K5OA 2B2YC 1V1OA 3TDQA 2PTLA 3PZ7A 1G291 2IWHA 1SYBA 2TSSA 5I6YA 2F0LA 3H09A 4YTNB 1Q3LA 3EFXD 4QCLA 1K51A 2SDFA 1L5PA 3HRZC 1PRTF 3SK5A 5KNCA 1FXAA 2WINB 2EELA 2J4XA 3BVGA 1YN5A 2Y5PA 1E6EB 2ONQA 2B2UA 2L1BA 3CQZB 4IUTA 2BDOA 3NP8A 3AEBB 1I6VC 3SFEB 3AE3B 3A7AB 2L52A 3OW7A 1IGCA 1NENB 5EBDA 1RTOA 4C3JG 3MAQA 3J80E 3P7JA 3TMEA 3C1FA 1ZDVA 3E6ZX 4R3DA 1SNCA 2A6ED 3HOWB 4Q5VA 1PUTA 3PUYA 1LTSD 5CR3A 4CGYB 1SJED 2FINB 4BBRB 1HTLD 2JSOA 5BMGA 1F2YA 3PO3B 1STHA 1FO4A 3NBHA 1CA5A 2VNUD 1R4PB 3MXGA 4X3SA 1F9RA 4NAWB 3I91A 3VRBB 2JE6I 2HTME 1IBXA 1TT2A 2R3ZA 4ZRZA 3MFGA 5C0XI 4RGMA 1DYQA 3LX0A 2K01A 1FRRA 2WXFA 3SEBA 3EUB2 3D31A 5K5PA 3S1RB 4CBVA 4MIUA 2DNEA 3SXHA 1IHZA 1LTRD 1PMRA 3X3NA 3CKIB 3Q8CA 1ENFA 3GTPB 2DNCA 1JWMD 3BYTB 3BK2A 2IX1A 5FO7B 3S17B 3K7AB 1XYIA 3AE7B 1XCTL 1TS5A 3IT4B 1TR5A 2CVRA 2Z8LA 3AH7A 2RDGA 1SDFA 5KRUA 5H8YE 3HS0C 1A15A 3T53B 2G9HD 2A68C 4J6HA 5C3XA 1QQRA 4F8MA 1C76A 3H0GB 2LEKA 2BA1A 2DY8A 1AEXA 2BCOA 1EYCA 3CRLC 4A93B 3N52A 5FLXE 2J0TD 1VJKA 4US9A 2A73B 2JWUA 3NWSA 5JEAG 3QOLA 1TKGA 3IXSA 1KRHA 3I9V1 2OHFA 1F77A 4HCEA 4LK1C 1LABA 2A6HC 2BE5D 5DM63 2ZXOA 2WS3B 2R7ZB 3S16B 2K28A 2ZW0A 3QOJA 2DY7A 5CBAE 2MEKA 1FRDA 3R2IA 4OVZA 2WACA 5M3FB 3OOCA 2IJ0A 3AE8B 2KHSA 1PGBA 1SEBD 3DEPA 2AUJD 4DNTB 1O80A 1AW7A 3DWGC 3J7AF 2JXMB 3DHQA 4RHRA 3V2TA 2SOBA 1STBA 4XWWA 2IT1A 5IODA 1IW7C 1SBBB 4ZKBB 4ABNA 3TP6A 5EJWA 4N58A 1YJJA 5JXVA 2AQ1B 4X3KA 3T56B 2KCCA 1TKEA 5HI1A 1O7ZA 2N55A 2KUMA 3D3RA 1RFKA 3O13A 1EY8A 3TP5A 1BCPF 4TQ0A 3KF8A 1V1PA 2E6XA 3MHZA 2G1EA 3DEOA 4FO2A 4YSYB 1ACCA 4C7ZA 1TZOA 1SE3A 5KYLA 2KCNA 1VMCA 4NP5A 4X3TA 5DAUA 2F0EA 1PRTD 4NKLA 4KKSA 2JSVX 2VB2X 5FOBB 5M5YB 2E75C 2K22A 2VB3X 5BMIA 1S5CD 1VCIA 3L7ZC 1A6XA 3NRZA 2FBWB 1C79A 3ND8A 4RF1A 2BDNA 4WFN3 2AQ3B 1I6HB 2Q8TA 3BIID 2MJDA 2WXRA 2JA5B 4K8JA 4KJOA 2NTSA 4J3OD 3MXUA 2KEEA 3N9YC 5KGUA 5K36G 1MVKA 1B3AA 1PTOC 1QNUA 4TQ1A 1EEID 5C44B 3BDCA 3VYUA 2INPE 4RCOA 2CJNA 5DNFA 2KECA 1NAPA 3OWEB 3TN2A 1YNTE 2LUMA 2BOSA 1BO0A 2M56B 1DOKA 2NYZD 1KDBA 4ZUIA 4C56C 2BBCA 4LJZC 3GD7A 1NVID 3EQLC 3S1QB 1S5FD 2XIWA 5HHDG 4RA8A 4XDXA 1KTKA 2E3TA 2WU5B 3AE1B 3MP9A 2C5CA 4K8IA 4HKQA 2FHTA 5FK9C 2F4IA 1UAPA 2Z1CA 2RSOA 3F2UA 4UDUC 1WTOA 1SNOA 2PZWA 4CKBA 3P4RB 3GTLB 1L4ZB 2JA6B 4RWSC 5E4XA 1D4BA 1JC7A 5EBCA 4H13C 3E5SA 2AWNA 3A54A 1LTAD 2G9DA 2VXWA 3VRAB 2KEDA 5CYUA 5C0XJ 5EE9A 3MXNA 1JALA 1R7SA 1ZYRC 3PUVA 3VYRA 1RTNA 1AYFA 1L0XB 1SMYC 3C46A 4A3BB 3MFYA 1U4LA 1DD2A 2W3RA 1DONA 4IUUA 1SFOB 1HCZA 2EY1A 4BA2I 2WXHA 5I4DA 2LY7A 1JQYD 3HZXA 2EYHA 1Y1VB 1DOIA 2A68D 5G5HA 4ARCA 1P7FA 3LWEA 4BA1I 5C3EB 4OO1I 1XF5L 3S1MB 3GO5A 1XWEA 4HMJA 4NMZA 2LJIA 2DN8A 2E74C 3HEJA 1M8AA 4QB4A 1JORA 4ID6A 1SXTA 3A7LA 2JU6X 1FMAD 1QT9A 2SNMA 1LT3D 1O78A 3LB8C 2WXMA 1VZ8A 2NN6H 4DU9A 3NPPA 3FRPB 1II3A 1BNZA 4TRDA 2PW5A 3AN1A 2W54A 1FNUA 1ET9A 3BYYB 3VR8B 2A6HD 5HG2A 1SAPA 4DNRB 1C8CA 3IKJA 1S5BD 5DM73 4DA2A 4A3IB 1LTTD 1U4PA 4O42A 1J7CA 1I4XA 2MJ3A 4XYOA 3D4RA 5D3IB 2EKIA 2Y3AA 2PKOA 2RQXA 1EZ6A 2B2TA 2A74C 1EYDA 5EKIA 4HROA 4JWUC 3ZJVA 2B2TC 2IGDA 4JX1C 3E56A 1WTWA 1FIQA 3MXPA 2E2IB 1LTID 5C6AA 1PFBA 2K33A 2F0TA 4K2LA 1EY4A 4MN3A 4NJCA 3LWUA 2PNRC 4ZRPA 3K58A 3HP3A 5CV5A 2F0FA 1PLFA 1N63A 1WD0A 1SE4A 3NXWA 3QWNA 1J8IA 2WNMA 3D4WA 5JAVA 3S1NB 1YN3A 1BMLC 1U4MA 4NW2A 3TSSA 3PZ8A 2XVSA 1PRTB 3NTKA 5G5GA 1KDCA 3K5LA 4O1NA 2PMVA 4HRSA 1AZPA 1X3PA 4FF2A 2XNAC 2QCPX 1BUIC 1D2BA 1F9SA 2NUCA 2KAJA 1ZOYB 2BB6A 3J80L 1HFNA 2K9XA 1E2WA 1TWHB 2F0PA 5BN4A 1WVLA 1W6JA 4MM3B 4K6LA 2FMMA 4BY7B 1R4QB 1FNWA 2EYJA 3WCQA 2FJ2A 2F0GA 3KBGA 2OXPA 1FFUA 1OXTA 5I2YA 4KKUA 3TEYA 4V0BA 5EQ0A 1ZXTA 3AE2B 4KGTA 4M8AA 1QNKA 1VMPA 1GXDC 4QMGA 3Q6SA 3SR6A 4RGTA 4L6TB 2EXZA 4ZOHC 1WTRA 1YQ4B 1OXXK 4OIJA 1CFMA 2PW7A 1YJIA 1ZXHA 1JB3A 5I2XA 4F87A 3PIP3 4C1NK 1IYVA 1NUCA 4LAAA 1CQVA 1Q12A 1HA5A 4PNYA 2F0DA 2WAQB 1YQ3B 1PZKD 2ZT9C 4WH4A 3QIAA 5M3MB 2QDBA 3HVZA 4LLGM 1E10A 1SNQA 4RCNA 4XXEA 2JP1A 3AE4B 4G57A 2ACZB 4OL7A 2A69C 4EQOA 1CZPA 2JX5A 1ZYRD 1JICA 3Q24A 2JXTA 1SMYD 3PUWA 3WOFA 1VRAB 5EE1A 2CQAA 4I65A 5FLXL 1PTOH 2WXOA 1TKYA 4XWTA 5EPLA 4P2CB 1YN4A 4KD4A 2LGIA 3S9WA 4JWSC 3DWAA 3RZOB 4N9TA 1TIID 1CTMA 3TZDA 4OZCA 3A8IE 1O7LA 4G7OC 2PLPA 1T5EA 3OSOA 4WIPA 3VR2A 2A5HA 3AB5A 2LKVA 1T3QA 3FAHA 4FXCA 3NTHA 3NUHB 1RKNA 2GB1A 2SNSA 4A55A 2MPMA 3GTJB 4WAFA 2RPVA 1F2ZA 1D1KA 2B2UC 5IGEA 1L4DB 1ZKOA 2NVXB 2BS3B 2L0CA 2K1BA 2F0MA 2LFIA 3VR3A 2FE8A 4K5VA 2OEOA 3PMFA 1G6ZA 4A6QA 2XRSD 3ZJTA 5D7GA 3MC0B 4WQMA 1XX8A 2O5IC 4KD3A 2WXJA 1H9JA 2LFNA 1PFMA 1E0ZA 3MTSA 2PQEA 1X3QA 4DK1A 1HPCA 1V8CA 4RNAA 1ZE3D 2BB5A 4A3MB 5E1FA 1NSNS 1EIGA 2V4IB 5A2QE 3NZ3A 2JEBI 4ZAIA 4EQPA 1EY6A 3ITPA 1WSPA 2W55A 4BBSB 1GUSA 1GOZA 1BF4A 5D3DA 4IFDH 1OXUA 3IAYA 2WDRB 1TS2A 2K04A 1XXGA 1PXUA 3GTKB 2EYOA 2RSNA 2WXKA 4A3JB 2K3UA 1FCLA 3KWVA 3EJIA 2H1EA 2EY5A 3LYYA 4B08A 2RDHA 1B9MA 1QJOA 1H9KA 4OZBA 1V1PB 2EOTA 1HUMA 2L5TA 1EFID 1L0VB 2MGSA 1LTBD 1HA6A 1TKWB 5MPOA 2L1AA 2PCFB 1TWAB 3AE5B 3I72A 3U9SA 2IL8A 2ENBA 2K32A 3H91A 1XCQL 1OXSC 4EQNA 3SK4A 3PV0A 4S3SA 2ZXPA 3E9SA 5ELCA 1H9SA 2MP1A 1B53A 1PTOB 4B9XA 1D6EC 2BS4B 4C3IB 1S5ED 1EWYC 1WTVA 3TEZA 4KI0A 2MJEA 3H6MA 2JZPA 3NE5B 2D5GA 1TS4A 1SIJA 3HGBA 4C3HB 4IN3A 1HHVA 4A3KB 4Q0FA 2WXNA 2EJMA 3NHHA 1XTCD 5CGKA 1B44D 3AEFB 3I57A 3N6RA 3CHBD 2EDGA 4BS9A 5T8IA 2D2CC 3U52E 5EPKA 4KGRA 5J39A 4KKJA 3M85A 2F0OA 4L1BA 5H92C 3ABVB 1TWFB 1PFDA 1LACA 4K6DA 2KN4A 2WDVB 2EYMA 1CT1D 2Y5CA 3LXFA 3NWTA 1CJEA 1PZID 5GXGB 4RHSA 3FMCA 2BS2B 4YXDB 3R93A 3J7AV 3DUZA 1EEFD 1A2UA 3Q0AA 3P75A 4XTCS 2EZVA 1HEZE 1BCPC 2HDLA 4K5XA 3B9JA 3WDNA 1PGXA 1QE6A 4G7HC 2PO4A 1JOKA 1QILA 2LHDA 3PUXA 4YIJA 3PO0A 3P1MA 2A69D 4A9AA 2M00A 4PMCA 5D14A 2DYMA 1SYEA 4KY5A 1DOYA 3FVQA 1N61A 4QUCA 4YT0B 2F1MA 1F0ZA 3K0YA 3QO2A 4XT3B 3T3OA 2BT6A 4IOIE 3NVWA 1Q1EA 3AV8A 3NVYA 2WQYB 1OO9B 1Y69U 3I4MB 5EE0A 2R93B 3HUIA 1KNAA 3FKIB 4LK0M 2K05A 3MEHA 3NQTA 2QILA 3MHBA 2MJ8A 1RCVD 2CW0C 1ZDXA 1V97A 5JEAJ 3KQ4A 4LMQD 4C2MB 2R92B 1MHHE 4NAMA 3TBIB 2IX3A 2QMTA 1ONLA 1ENAA 4K5WA 4MACA 2LMCA 2RA4A 1CZWA 5HURA 2XWBB 1MSGA 1C4CA 4KY6A 3VYTA 3SVMA 4A3FB 2HQEA 1JOOA 5IGFA 1B1ZA 1P7EA 3AM9A 4HR7B 2YEPB 2LS01 1OQRA 4L2YA 1UWMA 4AQ7A 2W3SA 3HVDA 4HSVA 4XQJA 2HCCA 1CA6A 5G3LF 1TQOA 4RGNA 5IIFA 3KBXA 2EY2A 4G4KA 3KLSA 4GDLB 2NVYB 1ZPSA 4FF1A 3ERQA 1I4RA 1Q1BA 5JJZA 3AEGB 3B2GA 1PGAA 1JWUD 4PQXA 1WCMB 3Q8BA 2D9UA 3QJYA 4FF4A 3OMGA 1TVXA 1JRPA 1QG7A 2IPKD 4ZK9B 2V4DA 2TMPA 1BQQT 1EY0A 4F88A 2E2DC 4DAYA 5C5LA 3JAME 1VF5C 5CBEE 4K2KA 5ELEA 1S5DD 2X38A 2O5JC 1JMLA 1F2MA 1R9TB 1Y8NB 2D5DA 3HOXB 2FUG1 1ESFA 1VDVA 4KY7A 4US8A 4IUQA 1CZGA 2M9VA 5CORA 1G2TA 5CV8A 1ZP0B 2RDFA 3TP7A 5TSSA 4YTPB 5JVH3 4WWMA 5M5XB 3NTIA 4NZLB 1J7AA 5C3WA 2V3NA 3GQBA 3VR6A 2WXLA 4C3IG 3DXJC 1W6KA 3A56A 3BDLA 2ON8A 2XWJB 4G7ZC 1RODA 5IT9E 4GDKB 3PIO3 2KQ4X 2XRQD 1JCKB 2F0HA 4JPSA 3ETRA 4ZLTF 3IAS1 1LT6D 1CHPD 2H4OA 1TY2A 2KDMA 1SYCA 1STYA 3RZDB 2KOLA 3M4YA 2IGGA 2OT2A 3I90A 1Z7TA 1EY9A 4PMBA 5AUIA 2WU2B 4U673 2PZTA 2L9HA 5JEAH 1STGA 4C1NI 3H8HA 3BK1A 2HUGA 3DWMA 1WRIA 3CIRB 3VR9B 4ZYSA 4XIGS 4HEA1 1EU4A 1BBXC 2RMMA 4YWGG 3URYA 2E2JB 1F2LA 2JYEA 1QOHA 4EE2A 3TEXA 2INNE 1Y8OB 1D5MC 3AEDB 4IQZA 2RBMA 5CV4A 3I3CA 1XEEA 1MGSA 1G91A 4DK0A 5E3FA 1N62A 4ILWA 4KKTA 2QJLA 3X3MA 4RH6A 3NS1A 4L8JA 1A3UA 1T6BX 1BCPD 4NDXA 2M19A 5HFYA 2N9KA 3KK7A 1FD6A 4DF7A 4C3JB 1QOAA 1JE4A 1QB5D 5IOCA 4RFBA 5JVG3 1A3TA 3M7NA 1DOXA 1F9QA 4RAUC 4Y7NB 4IFDG 1WWTA 2EVBA 3ND9A 2B8GA 4YTMB 1C77A 4RF0A 3FC4A 2GRIA 1TS3A 1OFFA 2ID0A 2NB0A 1WXQA 1UEAB 3DWPA 1AWDA 4KK7A 5C0XH 5EE3A 2EJGC 4A3DB 3FEWX 1QKZA 1WTXA 5COYA 2Z4HA 1B9NA 1ET6A 1BDOA 1JR0D 3L9AX 1PDQA 2WV6D 3B2FA 1U4RA 1SNMA 2LHEA 3Q69A 2WP9B 1EIHA 1KABA 5ELBA 4J8QA 4DQOC 2CW0D 2FFKB 2WDQB 1XLPA 4M0WA 1I3QB 3PUZA 1GHKA 2KJXA 3RMHA 3C1EA 1E0BA 1IL8A 1Y56A 1RDPD 1EY7A 4IUVA 1SNPA 3D8GA 4U68A 1HQRD 3I4NB 1K53A 5C5MA 4FXKC 2ICIA 1UNSA 1IKMA 4BWGB 4JBWA 1F2RI 1HFGA 1E2VA 3DWQA 4DFAA 5G3LD 3FILA 1GAQB 1VR9A 4ODGA 2B8FA 2HCIA 4XT1B 1MSHA 4USAA 1TY0A 2RKSA 1IUEA 4ZUJA 5A2QL 3M4OB 1E7PB 2K6AA 2D62A 4HCSA 3GS2A 2PVOD 1STAA 1B9RA 3TUOA 1WYGA 3MJ5A 4QF4A 3Q22A 1GB1A 5T1IA 1TU2B 1K52A 1EU3A 1C4AA 1TWCB 2K5QA 1AFPA 4A3GB 4EGVA 3GV6A 2K7VA 2SEBD 4I7ZC 3BG3A 1IBXB 1GUTA 3BDOA 1LV9A 4IURA 4KN4C 3DMUA 3GV3A 4YSZB 2F0WA 3T13A 3T3NA 1NCVA 1BXTA 3R8BA 3V96A 1DOLA 3VA7A 3SDZA 2YYZA 3HOUB 2CHBD 4A8XC 4P6VF 2R61A 3KUPA 4DN4M 5CMDA 4ZHOA 3A8JE 4C80A 3OIPA 4YSXB 1ESRA 1KFYB 3W2DA 4UAIA 4WJWA 1FXIA 1SNDA 3S2HB 3HG9A 2QF7A 3T16A 3VR4A 3S15B 1OXVA 2O4XA 3SE0A 4XQNA 1DJRD 1CK1A 1WD1A 1WTPA 1LO5D 2PW9A 4OGQC 2PYKA 1STNA 2XSCA 3HOYB 1ILQA 1CQFA 3MA2B 4N6EB 1E9MA 4FVMA 1K8OA 2W82A 2K5WA 1H9SB 5LL6S 1RYJA 1ICWA 3EVQA 1J7BA 1XO3A 4PV1C 3LNNA 4XDCA 1HUNA 3C2PA 3VQIA 2L55A 2MUYA 2BTEA 4Z9CB 4ZHPA 1GPXA 1RM6C 4HSPA 4CJ2C 5AFWA 4R8IA 2B2VA 3KWLA 1TWGB 4KKIA 2B2VC 1JW9D 3NQIA 5HGTA 4F7XA 3SK8A 1Z47A 1GHJA 3NUCA 1BUVT 3SK6A 2MH7A 3AEAB 4TMAB 3P42A 5BYQA 3P1HA 2L4NA 3P63A 4IALA 1BCPB 1SYGA 1YNJD 3W9CB 2WKDA 1NI3A 2OEDA 4FXDA 1FFVA 1C48A 1ZEQX 5ELFA 3M7GA 4RGOS 2I07B 1DGJA 4WRDA 2L32A 1GUGA 2NZ1D 3FPPA 1L0YB 2SAKA 1BOSA 1HXYD 2J42A 1I4HA 1ILPA 4H2AA 4PT5A 1LT4D 2AUKA 4H44C 4OW0A 1V8QA 3GTGB 2K0PA 3BVZA 3TZUA 2IGHA 5I6WA 3IFTA 5ELDA 3TEWA 5KNDA 1FD7D 2F0IA 3VA5A 1QWYA 4KTAA 3OIQA 3RUZA 3D6CA 2BA0A 2O2LD 1PFNA 1EM7A 1E2ZA 4DXFA 2NWGA 3I70A 1HQMC 1YNNC 1FNVA 5JPMC 5M9OA 1PYWD 1EL0A 2F3VA 1I4PA 1Q8IA 3J81E 5KEEA 2PZUA 1FCCC 1FGBD 3A55A 3S2DB 1PZJD 1Q10A 4LTUA 3AMZA 2ZW1A 3AMUA 2EYFA 4ME5A 2QEJC 2NBFA 1N60A 1SE2A 3AB9A 5BMHA 2R6GA 5A35A 3ZQ4A 2JQRB 2LMCB 4B9WA 1ZXIA 2QKIC 2NN6G 2NVQB 1K83B 4OO1H 1VLBA 3NK9A 4DAVA 4AS1A 1A2TA 2F0SA 2VZKD 4HTHA 1NR4A 3NSWA 2WB1B 3JAML 1I7HA 3SHLA 1UGJA 3HRDD 2AX5A 4J1MA 1MI0A 3K6OA 1TJEA 1K8MA 4P16A 4B0EA 3W5UB 1B4OA 5FKAC 2Q5WD 3GB1A 1EY5A 2L83A 5C4ZA 4HN7A 1N5WA 1CI3M 5LL6X 4XE0A 3SFDB 1ENCA 2B63B