1M4WA

Thermophilic b-1,4-xylanase from nonomuraea flexuosa
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
197
structure length
197
Chain Sequence
DTTITQNQTGYDNGYFYSFWTDAPGTVSMTLHSGGSYSTSWRNTGNFVAGKGWSTGGRRTVTYNASFNPSGNAYLTLYGWTRNPLVEYYIVESWGTYRPTGTYKGTVTTDGGTYDIYETWRYNAPSIEGTRTFQQFWSVRQQKRTSGTITIGNHFDAWARAGMNLGSHDYQIMATEGYQSSGSSTVSISEGGNPGNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three-dimensional structures of thermophilic beta-1,4-xylanases from Chaetomium thermophilum and Nonomuraea flexuosa. Comparison of twelve xylanases in relation to their thermal stability.
pubmed doi rcsb
source organism Thermopolyspora flexuosa
molecule tags Hydrolase
molecule keywords endoxylanase
total genus 58
structure length 197
sequence length 197
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2002-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00457 Glyco_hydro_11 Glycosyl hydrolases family 11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1m4wA00
3WQ0A 1HV1A 2D98A 4XQ4A 4S2HA 2DCYA 1H0BA 4HKOA 1W2UA 3AKPA 2DFBA 1H4HA 1BVVA 2JICA 2QZ2A 5K7PA 2NLRA 1QH6A 2VG9A 1AXKA 1REEA 1IGOA 1UU5A 3MFAA 1UKRA 3HD8B 4S2DA 3B7MA 1KS5A 3LB9A 2C1FA 2BVVA 1UU4A 2VULA 2F6BA 3AMMA 2JEMA 2DCZA 2JENA 1TE1B 1NLRA 4XQWA 1H8VA 1BCXA 1F5JA 2DCKA 3WQ1A 3MF9A 3VZOA 2BW8A 2BWAA 4S2FA 3WR0A 2QZ3A 3RI9A 3WXPA 1T6GC 1XNDA 3WX5A 3MF6A 3VZLA 4HK9A 1C5HA 1C5IA 3WQ7A 2VGDA 3WP6A 4XPVA 2B45X 3VZMA 1UU6A 2B42B 3AKRA 3VHOA 1KS4A 1OA3A 3EXUA 1YNAA 5K9YA 3RI8A 3VZJA 3VZNA 4NPRA 2BWCA 3M4FA 1HV0A 4IXLA 4S2GA 3VL8A 3VHNA 1PVXA 3WY6A 1OA2A 4HK8A 4HKWA 2DFCA 3B5LB 1XNBA 3VHPA 3VL9A 1XNKA 4HKLA 3VZKA 1H4GA 3AMNA 3WT3A 1XYOA 1REFA 3AMPA 3VLBB 1XYNA 2Z79A 1HIXA 3WP4A 1M4WA 3AKQA 4H7MA 3MFCA 2NQYA 3WP3A 1XYPA 1OLRA 3AMHA 1QH7A 3LGRA 2DCJA 5EJ3A 4XQDA 1REDA 2D97A 1OA4A 1XXNA 3ZSEA 1BK1A 3AMQA 1OLQA 3AKTA 2B46X 1ENXA 3O7OA 3AKSA 1H1AA 2VUJA 3VGIA 3WP5A 5HXVA 1XNCA
chains in the Genus database with same CATH superfamily
1WLDA 4Z82A 1SHWB 4Q4Y2 3W9AA 4AAXA 2A6WA 4BQ2A 3TEXA 1O3QA 4K1ZA 3AKPA 5IYYA 1QJU2 3AYCA 4CEYB 2JDZA 4FOWA 4HVOA 1EAH3 4JKMA 1D0GA 1JH5A 4IESA 2BFUS 2VCMA 4L97A 2YB7A 3IIAA 1Z7S2 3NSTA 3RFRA 2C26A 2UWAA 4WV8A 1QQP2 4DFSA 2VQTA 2WSUA 1UAIA 3OUIA 2HWB3 4Q0UA 2JJ6A 1DLLA 1VBC3 3BTAA 2V73A 1G86A 1S0EA 1S0GA 1GR3A 2BVVA 4OYUA 2F6BA 5KHGA 3MO4A 3UGGA 2PHDA 4QM8A 1QWRA 1A8MA 5K0UA 3ZSLA 4GMP3 4ZY9A 2VTXA 4CDWB 1BMV2 1ODMA 1ZBE3 1D2QA 4NVPA 4AGVA 4UT5A 1RUE3 5BNNB 4NIHA 1RUH1 2XL9A 5JSPA 1BBT3 4ES9A 4RS5B 4NJ4A 2WO2A 2A3YA 4FOQA 4KI5M 3ZFFA 1OSGA 4LHNA 3S7EA 1DG6A 1GNHA 4PI2A 3E6DA 4JDOA 2ZEWA 4Q4W1 1E5HA 1VAVA 3WW3A 1C5IA 1Y9GA 2DVDA 4NOTA 4EE2A 4IETA 5FZLA 3WQ7A 1CX4A 1QKQA 2QUOA 3ZYIB 4LK7A 4E27A 2B42B 2OVUA 1QOTA 5F32A 4INDA 1G7YA 1W2AX 3BKZA 4ASKA 4KWUA 1DQ5A 2WZR3 2WUHA 4RQPC 5CKQA 1BVP1 1OVSA 2JG8A 2R071 3NW4A 5FZ3A 2BV4A 1J3RA 1ZZCA 3VBUA 1RUC1 5DN2A 3FWEA 2VZQA 3ABZA 3VDAA 3VDCA 4QPYA 5L7OA 2H6BA 1FMD1 1UD1A 1RUI2 2O1QA 1RUI1 2CGNA 2XJRA 3SQOA 3ZSKA 2DU0A 2W1SA 1U5XA 4K20A 2BDRA 5T50A 4QGNA 2Y34A 1HXS1 1EP0A 2PHTA 4KBZA 1AR91 5BXXA 1SG3A 1Q56A 3B02A 5A1AA 2BTVC 2E26A 2JD9A 1L7QA 4QXHA 4RGGA 2EXHA 4XAEA 3M3OA 4P02B 4XDQA 4YPJA 2FZ2A 1NCRA 3IDCB 1MACA 4MGIE 2R073 5CYYA 1AUYA 3FE5A 2PLV2 3A23A 4C1WA 5FYZA 5IVCA 3U1XA 1WBFA 1ENXA 4O9GA 2RDRA 2P3KA 3NJYA 2X05A 1LGBA 2HBUA 4GQ7A 4L8QA 3QLQA 1SLIA 4WM7C 4DZGA 1QNWA 3MIFA 2D3RA 3B00A 4I0WB 3O1OA 1JN2P 3H7YA 4MGTA 3NVCA 4GJYA 5D8AA 1G9DA 1IQDC 5EV7A 2YBSA 4MVTA 3AYAA 1VRH1 3VKOA 1IG0A 3LSDA 5L9RA 1JZ7A 1RUF2 1VBA1 2XHNA 1AR71 2NLRA 1J58A 1FOD1 2IWGB 2DUOA 1QIQA 1IGOA 2D5FA 5JZGB 1ZBE1 5C4WB 4J6GA 4X8PA 3ZFFB 3HD8B 2ARAA 5BUVA 4S2DA 2YDEA 2ZGSA 4OUEA 5A6XA 2CWSA 4DNYA 5BV6A 3S0MA 2VUAA 3KS7A 3ETPA 3R6SA 3GZAA 2ZTNA 2WQ4A 5F9TA 3M3CA 2F4LA 4HZFA 3H8XA 2JEMA 1YI9A 5L19A 3Q8BA 4EN8B 5FY8A 5GZGA 4URTA 4XZUG 5D21A 1PGW2 1LEDA 1JYXA 4XYXA 4QKNA 4BQ3A 2VNVA 3CMGA 1WKYA 2W1UA 3MF9A 4WVMB 5I91A 2ZZQA 2Y6GA 3OD0A 1W8UA 2D7FA 3WNNA 1JHNA 2D3PA 2Y6FA 3PUIA 2J42A 5FPLA 3NMBA 2DCTA 4XF3A 1C8M1 3S30A 3WG3A 3TEZA 5DZFA 4XMAA 2UYAA 5KHKA 1UKGA 1C1FA 3UGFA 1ND3B 3NJZA 4FVVA 1ZRIA 1B09A 4CCDA 4XURA 5JXJA 2ARCA 3BTYA 3WW4A 1OOPC 1UYZA 1DZRA 4UF0A 4IL7A 4NHMA 1OLME 5FK7A 1RUF3 3SCGA 3OGJA 2DV9A 5JMOA 3J7HA 1ZRRA 2MPFA 3DN7A 4NWVA 5I93A 4BOWA 1SFNA 1OQDA 1GQHA 1D4M3 4FFGA 5I8YA 1HKDA 1KDKA 2TBVA 1RVF3 3BIWE 1MEC2 4LKDA 4LKSA 1GLHA 4NRQA 5DAVA 1F4HA 4W50A 1QEXA 4XXAA 4COVA 1OD3A 1AL21 3M3IA 4Z07A 1ASJ1 3N7KA 4PDWA 5APAA 4LA2A 3WY6A 2B39A 4GB32 2Q5TA 5FY1A 3J4UH 4BIFA 1D2SA 3AZXA 1ND2A 5C4WC 1K5MB 4LKEA 4BPZA 4HANA 1CONA 1F15A 1ZZ9A 2QCSB 3KGLA 2QTWB 4CU8A 3ORJA 1SBDA 4KU7A 3TYJA 4WM8A 4PF5A 4TXWA 5FXXA 1J59A 1XE7A 1UYYA 3JXSA 5BNPC 3KSCA 1W9YA 5D8AB 4BQ4A 1AJKA 3VBFA 1A3KA 2DWRA 4QQHA 3LD8A 1FOD2 4U36A 3HVDA 2AH2A 2HWE2 3MBWA 4P08A 4FTBA 3CJIC 1RHI1 1WW6A 4LBOA 4P9XA 3T2TA 3E6BA 1VBB1 4UI9L 2BERA 3VKFC 3O1MA 4KNCA 3H8UA 5JZGA 1QJX3 3I2JA 5FZGA 1H2NA 1W6QB 1Y9QA 2GC2A 3OPTA 4GH4A 3OJBA 1ZRDA 3V0BB 1HJGA 1UOBA 4NE9A 1HDKA 5TSWA 2PHRA 1UWWA 3FBMA 4BU2A 4YW6A 1GICA 5F5IA 3UKNA 4Y3OA 3MW4A 3V0AA 3FX3A 1G9FA 1DIWA 5F3EA 4CCKA 1BEV3 2W47A 4FP2A 4IEYA 3UKVA 1HX6A 2QQIA 4FBFA 3LOIA 3ACHA 3PIGA 4K3UA 2FZ1A 4CDWC 2WN3A 3J8F2 1MS9A 1KD7A 2R30A 4ASMB 4F7ZA 3QD6A 4YNIA 2QZ2A 3AZVA 2RS31 2PHFA 1OMIA 1QXRA 3DF0A 5LK7B 4IV3A 3UGHA 3QH7A 3VHRA 2XWBB 3ZSJA 4QWNA 1Z0HA 1GZ9A 2GH2A 3CBNA 4AG4A 1H2MA 1X82A 4WVVA 1UNBA 3LEGA 1MVEA 1UU4A 2VW1A 4XW3A 2QVSB 4AVBA 1LR5A 4NMIA 4I0BA 5FK8A 3QH6A 1H8TB 5HBAA 4OI0A 3UL2A 1QJU1 2JENA 1CZVA 3FHQA 2MEV1 3MUY1 4WVZA 1ULGA 3BGAA 3RZZA 3IWZA 4MXVA 4RR3A 3WQ1A 4MUVA 1UYPA 3ON7A 2Q1ZB 5FLIA 3C7OA 2UY8A 3K51A 1F4AA 3FBYA 3ZFFC 4P9LA 3UYJA 3RZGA 5E1RA 1LENA 5IUQA 1GNYA 2DVFA 4GA9A 5IK7A 2GAUA 1SQ4A 3USUA 4SLIA 3KT7A 1HRV1 1C5HA 2TUNA 4PDWB 5FZ9A 2AZ5A 3I2KA 2ZKNA 1CR7A 1ZYBA 5DABA 4LIUA 3I7DA 3VZMA 4LKFA 4AGRA 2PHLA 3AFGA 4A3XA 1OC1A 1TMF3 2WNVC 1W8TA 5FO8B 5FY7A 4P00B 5K8SA 5HCFA 4BK5A 4YM3A 4WM8B 3FL7A 3ZM8A 1PGW1 4AI9A 3RI8A 3AP6A 5EJ1B 3KMHA 4LBMA 1MZ5A 1VAKA 4DINB 4ONUA 4DXTA 2WFF1 4MADA 1MQTB 3CF6E 2WBKA 4IXLA 4LHSA 4Q0PA 4PQ9A 4OHYA 2SBAA 4GAZA 2XXZA 3VBHA 1QJY2 2XJSA 1OA2A 2HWF3 1DP0A 1VRBA 5LCWL 2TEPA 1PO13 4O61A 4MXWA 3SKJE 4AF9A 4BJ0A 2VZVA 4FQZA 2AC1A 5KXEA 4XVHA 4XMIA 5FZOB 4CYDA 1PIV1 1COV2 2ZAAA 1Y9MA 5DQ0A 5A7SA 1EV11 1HIXA 4K8FA 1OXCA 5LY1A 1LB2A 1W9SA 2CHHA 4GIQA 1Q8SA 4ET7A 1JBCA 1OUXA 5JI7A 4DXRA 2PMWB 3DYOA 2VZPA 3H1WA 4BQWA 2EXJA 5FZAA 4QXKA 4IEWA 4LTAA 1UO9A 1OOPA 3I59A 3D3AA 5DDJ1 5ERLA 3ZYGA 1RL3A 5BNOA 1GZWA 1L7LA 2XGXA 1LCLA 2ZHNA 3H1YA 2VJXA 3OBAA 4IV3B 2H0VA 4N53B 4QPIA 2VR4A 2G9ZA 3OYWA 1ASJ3 2RMU2 4W6WA 1VPHA 4N7UA 5AVPA 5A6YA 4YM1A 5J36A 1V9U2 4C0BA 1QJFA 1S2BA 4YZ2A 2CAUA 1WZXA 3PNAA 5D8AC 4ZU7A 4A44A 1PNGA 3JCIA 2RDNA 2ILMA 3BU0A 1VB2A 1W0PA 3MICA 2IXCA 3FFZA 4NO4A 5GLZA 2CV6A 2WA3A 3TNPB 3EQEA 3OCPA 1LRHA 2IXHA 4TZDA 3KF5A 5FZCA 3LPGA 3AXDA 1DF0A 1YQ6A 1HRI2 4Q4X1 3RDIA 4D8MA 4AEDB 1R1ZA 1ND2C 4Q5OA 1ODNA 5C4WA 3LIGA 3B7MA 1RUE2 5FWEA 5DDJ2 2Q1MA 1OH4A 2I07B 2XONA 3POYA 4QDRA 3RRDA 2UYBA 5T5OA 3USUB 3CJXA 4CUBA 5CG8A 1CJPA 3EYPA 5JIAA 1TG7A 4AFMA 3GHMA 3WD5A 5A70A 3H3ZA 4LJHA 3VBFC 2J1SA 1UZYA 4L9BA 3RJ2X 1R083 4NRMA 4A45A 2J1TA 2QFEA 5JSRA 5EZWA 2FQPA 4Q1PA 1ZBA2 3NJVA 3A4UA 1GP5A 4LR4A 4R9DA 1LU2A 4GD4A 4ES8A 2XR4A 1STMA 3MIHA 1C8NA 1ZM1A 2DF7A 2XLGA 4GKXA 4JVAA 3D5OA 4GH4C 2B5HA 2GZWA 3M3EA 3P3PA 2D40A 2G9GA 2E31A 1JTZX 3GBGA 5M0TA 3GALA 2P6HA 4D7SA 4M00A 4WVWA 2Q1FA 5KBFA 3PU8A 2VGDA 3O12A 4RA0A 2GN7A 5K0UB 3W5NA 1VBE1 5E88A 4D94A 1EUTA 1FV2A 1UXZA 3POGA 4L99A 4M0NA 2V72A 4ORFA 5DDJ3 1W03A 3T3YA 4GALA 3QCWA 3PUAA 2G1MA 1BMV1 2V4AA 2VW2A 4UW6A 3ENRA 2LUWA 4RS5A 1O4ZA 1KJLA 1R093 2X09A 1Y43B 5AC92 3ZDSA 1PMJX 1H6YA 2YG0A 4MYEA 2JG9B 1HRV2 2X10A 5J3UA 1W39A 4PDWC 3RZJA 1VMFA 1DDLA 4EN7B 5BNOB 3O1TA 1KXGA 1GZWB 2Y8KA 1I1EA 1CGPA 1V6JA 1W6PB 2ES3A 4N53A 4QPIB 4E4ZA 1UZWA 1NX9A 2PLV3 4HKLA 5LBEA 4GB31 3KZ4C 4OI2A 5ACA3 1XSQA 1NLQA 3ZN6A 3AYEA 5I0RA 4OMCA 5GKAC 3ALQA 5BPXA 1R1A3 4JCKA 2BZDA 1MS5A 3IMNA 3JD72 4K7JA 1BQPA 1Y7BA 1UY1A 1WMDA 3J7LA 5CFCB 3N9LA 3AMHA 3UJQA 4M3CF 5D2AA 1NXD1 4B7KA 1HXS3 2WO1A 5T55A 4ZU5A 4YW2A 4XXPA 4JQRA 4JDMA 5KWRA 5GZFA 5FZ4A 1KRIA 1RUI3 3LKJA 5C5UA 4FPCA 3AKSA 4C0HA 2BBAA 1H1MA 5EQUA 4HSJA 1B35C 2DTYA 1HQWA 1XNTA 5FXWA 1W6OB 3K4ZA 2YY1A 4OULA 4ATEA 5FUIA 1HRV3 2VMHA 3CHXA 4FAGA 1OF4A 2D98A 4QT6A 5IWFA 1VRH2 1R091 3IIIA 4AFBA 2A3WA 2WZEA 3HQUA 3TEWA 1FYUA 1H8TC 2BRTA 4QMAA 4RR3C 1DHKB 4QU2A 2X53S 4MGQA 2A3XA 1YQCA 3TN93 2JICA 4HMZA 2W91A 3LA7A 4QHZA 4ISRA 3J9SA 1SMVA 3NQHA 4UFMA 3NRUA 5I0TA 3OUJA 4BK4A 4CEWC 4IE5A 1UMHA 1QGLA 1XU2A 4IEXA 1MZEA 1G6NA 5F2WA 3KV5A 5IVFA 2BQPA 4YZ3A 5F5QA 4P5YA 2VMEA 3M1HA 4NWWA 5LK5A 3T30A 1SLCA 2RG4A 3GXUA 4G4FA 4XJAA 3VUOA 4LT5A 5A6ZA 2JDNA 3I3DA 2YPDA 3FN9A 5T54A 1PZ9A 2W2IA 1ZBA1 5CBLA 5FOBB 5C5TA 2CTVA 1V6OA 2VVFA 1N1TA 3Q9OA 5FY4A 4M4PA 3ZXAC 5J48A 3OB8A 2DCKA 2A1XA 3FUQA 1POQA 4KQ7A 3IKWA 3NNMA 4V2WA 2UURA 3WCSA 1TEIA 5FY9A 2WQ8A 1UF2C 2YHJA 1E5RA 4GMP1 3WOGA 5JOXA 4EWEA 3VD7A 3LOBA 2WWSA 2RJLA 3T4VA 2JG9A 2C9AA 2ID4A 4I30A 4LEJA 4Q4X2 3WF0A 2VL4A 3BIEA 4L92A 1CZTA 5B4XA 2VBPA 2ZX0A 3LPFA 4CXWA 4IE6A 2PQSA 2YC0A 4IGPA 1EY2A 1Z7S3 2OZ6A 1ULCA 1H2LA 1W6PA 3PUQA 2P6CA 3N7LA 4IEQA 3ZMNA 1YI7A 3ZR6A 1IPSA 3UETA 1CIYA 2IXIA 3KV4A 2VMCA 1VJ2A 2A73B 4BQXA 4GJZA 1FV3A 2B7YA 4N43A 4RHV2 4B4RA 5A3PA 3GF6A 4WVMA 2FBEA 3EXUA 2OZJA 3GHNA 1O3TA 1LOFC 1VR3A 2G4IA 4W6YA 3WDXA 2WWUA 4AZZA 2J1UA 4CEWA 2MEV3 5CFCA 3WZ1A 5HCAA 1POV0 3HNYM 5AVAA 2ZZJA 4XDPA 3ETQA 1QDCA 3LSEA 4BB3A 4R52A 2XUEA 1MS0A 1KGYA 4UF0B 3SEEA 3WNMA 1RB8G 1PGL2 2XOMA 4WZFA 4BHPA 3CQOA 2VE1A 5H9RA 2EIBA 2D6OX 2Y26A 3J7MA 5CIRA 1W6OA 5A7QA 3ZXGA 2CAVA 4OQ8A 5L36A 4CUAA 1M4WA 4YW7A 5FIXA 5FBJA 2WNUB 3JD73 1EV12 1UCXA 5FP7A 2BOIA 1COV1 2FDGA 2P5BA 2AEYA 3EO6A 3WW2A 1XQNA 2JG9C 1CQ9A 5FRAA 4CU7A 3ZYPA 2NMNA 3KVBA 3VD5A 4R4XA 1UL9A 4MOAA 1D4M1 1U5IA 1BEV2 1YQ8A 2D6PA 2PAEA 3M2MA 1OLQA 4OLLA 4V2VA 1RUD2 1W06A 3K4DA 2EALA 3AKTA 1QOSA 3GZTB 3C7FA 1SBEA 2BPA2 2IVIB 4F83A 2D6NA 1SLBA 1URXA 1ND2B 4YM2A 3J26N 2R1DA 2XHKA 4XCAA 3CU7A 1LOAA 5FXZA 4CDUA 2E33A 2DUQA 1OFSA 1DZQA 1B35A 1US3A 1VBB3 4LO7A 4A2UA 5BY5A 4QGMA 1OI6A 3IMMA 2VXRA 3BPZA 3IZOA 5GLVA 4CZSA 3PJQA 2QNKA 1H0BA 5EWSA 3VBFB 1C8M3 4Y20A 2OIIA 4OI1A 5K4LA 2PXJA 2GN3A 4AVAA 2J1AA 1DQ4A 2JDHA 3DYPA 4O65A 3ZYBA 1BVVA 1FI2A 1RC6A 2D6MA 1ULPA 2FCUA 3ILFA 5HXMA 3TB0A 1QH6A 2WR9A 1TNRA 1MS4A 4LPLA 5EHDA 3R4UA 1D4M2 1W6QA 5KXDA 3BUCA 4GH4B 3WW1A 1I3HA 1JXNA 1OKQA 4JGYA 4ZONA 5EXOA 4Q8KA 1GWMA 1H1IA 2QJVA 2C24A 3WHUA 4XETA 1AL23 3W58A 3U37A 5C3SA 1ZRFA 3GM8A 2EIGA 4P14A 4XUNA 4CPBA 4J1WA 2A6ZA 3EB7A 2VMIA 2MNGA 3H3UA 4E4DX 1BCXA 1RVF1 4AAPA 4N43B 3DL3A 4YZ4A 5BNNC 4RGAA 3VZOA 3SH4A 3WDWA 4XFBA 2UU8A 5BNQA 2LROA 1WUVA 3W59A 2I2SA 1RUE1 4LA3A 4CEWB 4PLNA 5F39A 2UY9A 4AWDA 4ARXA 4GMP0 4AEMA 1XNDA 3WX5A 1AHSA 5J7MA 3VBRB 4BLIA 1RMU3 5KXCA 2BYVE 1JODA 3KQ4B 2LS6A 4BXFA 1RUJ2 3T4HB 3WHTA 2HWB2 3RGBA 2IFRA 3G6JB 4K1YA 4UXAA 3WUDA 5IVJA 3RZLA 4B4PA 4JTOA 2ZGNA 1UU6A 1VIWB 2BNOA 1IG3A 4PHZA 4E9KA 3H8RA 4BE3A 2A71A 1NAEA 2ZGTA 2WLPA 4OHWA 2LM3A 5EP9A 3OY8B 4LK6A 5AC91 3WF2A 1RJ7A 1Q3EA 2FCTA 1XSRA 4RHV1 1QJX2 2WNUA 4NPRA 3KF3A 4FT8A 4COYA 4QXCA 2VCAA 2Y0IA 4L11A 4N8MA 3X29B 1YFXA 3OGVA 1NYWA 3DEMA 3TRSB 3PUHA 1DYPA 2ET7A 1GANA 2ADDA 3IAQA 2VZOA 2JE9A 2VCCA 4OHVA 4I02A 1OKOA 1PVXA 5LBFA 4JRAA 4XC9A 3OGGA 1GWLA 1FNZA 1K5JA 5T52A 4A4AA 3VL9A 4N9HA 1DYOA 2HWF2 2ZOEB 1H4GA 2W68A 2LTNA 3AMNA 3O5SA 5CADA 1PK6C 2GNTA 1DZTA 5F3GA 1B35B 1UY0A 1WCUA 3P3NA 4YGEA 1VBA3 1AF9A 2A75A 5IT6A 2VECA 4HXCA 1T6BX 4YVSA 5FYSA 2VZ1A 5JCTA 2GMPA 3T0BA 1XYPA 4XEZA 5JUVA 2QQMA 3ZYHA 1TME2 3PJYA 1I9RA 1QOOA 1UX6A 1UW8A 4CDXA 5IHRA 3B94A 1MQTA 4HG6B 1RUOA 5GZDA 5JXHA 2D97A 5FMCA 1W9TA 4W4ZA 4CVUA 2J1RA 2C5DA 3MGUA 2VPVA 4XF4A 4XOGA 4EN9B 5J96B 3ZYFA 2CDPA 3HJRA 5G05L 4MXWB 3DV8A 4YYOA 1QXPA 4JGYB 4WM7B 5LA0A 2PELA 4URAA 5LEKA 3I97A 3I2FA 4YW1A 1YIPA 3AJYA 4TLFA 4UOJA 3WP5A 5A1LA 1K45A 4IDZA 1TME3 3ZN5A 2JIJA 3KGZA 2B9UA 2WNUC 3RMXA 1JYWA 1OBNA 2HWC3 3MDPA 1X7NA 2PTMA 5FYTA 5C9AC 2VOVA 5I8SA 2JB8A 5J98B 1MS8A 1V6NA 4YARA 2DFBA 2DVGA 4XIOA 4AEKA 1R092 2XPJA 1UIJA 1C3HA 5B4NA 1BXHA 2VBDA 2YBKA 3AL6A 1OF3A 3I2GA 4LHKA 5FO7B 1S55A 1AXKA 1PZ8A 2QQNA 2BNMA 2RR11 5A7NA 5JSOA 5GJ6A 3O1SA 2GH8A 3OYWB 4LULA 1W6MB 5FYVA 4CCOA 2YU1A 3TBDA 4YZ5A 1NA1A 3ES4A 1VBC1 5FZIA 4CPBD 1OQEA 1RYYA 1IKPA 1N1SA 2WS93 5DG1A 2W52A 3MPBA 2D3SA 1HN1A 3M7AA 4GWNA 3KB5A 4YG3A 3TNQA 2WAOA 5FUNA 5I8TA 4MSVA 1ZA4A 3ZSMA 4CCEA 2VXJA 1NOVA 3WEZA 4YZ1A 1EAH1 4YM0A 2RV9A 5FV3A 1KFUL 3GZEA 1VALA 3DKWA 5IJRA 4AEDA 1PGSA 3KD4A 3ZXFA 1J1LA 4AVCA 1CPMA 1ND3C 1YQ5A 1NCQC 3OPWA 4JKKA 3PVOA 4XFAA 2XH6A 1M06G 2BGCA 2ZPXA 3OEAA 1ZBE2 2GMMA 4LO4B 3VZLA 1XBFA 1YFWA 1YQ2A 3I49A 3HNMA 3N9PA 3J7NA 1LU1A 1QJY1 2HH9A 5ISLA 1WA6X 2OW4A 2PAKA 2HBTA 1HB3A 3DKQA 5DZGA 3I54A 5EIYB 5KR7A 1OUSA 3K3OA 1JHJA 5KC5A 1SLTA 3IBMA 3R4DB 2E51A 1LOEA 5HV0A 3SHRA 1N1YA 2G19A 4LORA 2Q8OA 1SZBA 4B1MA 3PU3A 1CAWA 3S6PA 2P34A 1Q8QA 1SACA 4CP1A 1AR83 1UZZA 3CJIA 3KM5A 3RWKX 5IVBA 3WDTA 3MW3A 3MLJA 2GC0A 4HBNA 1JYIA 3N7JA 4KWJA 4BQ1A 3OD4A 4YSFA 4QD2A 2PAMA 1DQ2A 4IW3A 5A3UA 1HW5A 4Q4V2 1ST8A 2I74A 2OQ7A 3B5LB 1S0IA 2JXAA 3DXUA 3QBQA 4OZOA 4W6XA 5LATA 4WM7A 4BLJA 1T2XA 3GJAA 1REFA 1X50A 2WYSA 3POEA 2EICA 2R062 3HT1A 4AFAA 3MIDA 5FBZA 4AHZA 1GOFA 3GCXA 4FOYA 5F5CA 2OQ6A 4JHTA 4NIDA 1UXXX 1ZA7A 4XJUA 3GNEA 4OUMA 4FPEA 1F5FA 3BI3A 2J1VA 3S5QA 4X6RB 5EYXA 4NR1A 5EJ3A 5JPNB 3ILNA 3C3VA 2JB4A 3POSA 4QHOA 3LWCA 1UN1A 5FYHA 5C33A 1HB4A 3AK0A 4I01A 1C28A 1RITA 2YMZA 4MH0E 1WMFA 2RE9A 2NZ9A 5FMOS 5JR7B 1QF3A 2AACA 4WBBA 1W6MA 1X8EA 1CIWA 3ZN6B 3U0ZA 3ZO0B 2CGPA 4OCTA 4EJRA 2OA2A 1PVC3 3AP7A 1MEC3 2XVGA 2XVLA 3PVBB 3WQ0A 1NA1B 2EA7A 3RPQA 4AQ2A 1JYTA 1CAXA 3LZZA 2VQAA 3OTFA 4K8RB 2D6LX 3BYWA 4QDSA 5FZHA 1GOHA 2A7AA 2GU9A 1AYM1 3ZIXA 4E2GA 1SFPA 3VKMA 4B4QA 1AXZA 1UU5A 5A3WA 3EMRA 2GSYA 4JGYC 3ZLIA 4UFIA 2XJVA 3MZHA 5DAWA 4LUKA 5FZFA 3AB0A 5FPUA 3NV4A 4HLTA 4IE0A 4QPGA 3TAYA 1LGCA 5F5AA 3O1UA 1HB1A 3D82A 2IXKA 3O1VA 3LIHA 2GNBA 4CDXC 5FXVA 1TE1B 1VB4A 4OQ9A 1DGLA 4Y5SA 2OXBA 3WNLA 2TNFA 5A32A 1GNZA 2R0HA 4IV1C 2HYKA 1OVPA 1O7FA 4IUGA 3RNSA 4BIOA 5IFPA 4E2QA 3VBSC 3ZYJB 2HWD1 2YGLA 5SV8A 2ZHKA 1K42A 4Q8LA 5EFUA 1WCSA 1VBC2 1W9FA 4HPKB 4N90A 3CEWA 3VBOC 4Y33A 4HETA 4K9SA 4W8JA 5FDBA 1OFNA 3KVAA 1BHGA 1O4TA 3BCWA 3N9QA 4GZ9A 4B1LA 3FLTA 1UMIA 3DUIA 4E4HA 1S4CA 3WP6A 4XPVA 5FPZA 4LIVA 2GDFA 1JZ6A 3HQRA 3VHOA 2BUKA 1VP6A 5FZMA 5FR3A 3O0WA 3PIJA 5DZEA 3ATGA 3J8F3 3AM2A 1BYHA 4LO5B 4P5HA 1VRH3 4BQ5A 5J1XA 1KQRA 1LOGA 2V5YA 3ZMOA 5HPOA 2P17A 4HSLA 2ZEXA 2YYOA 1NZCA 1C8M2 4MLOA 4Q1RA 4Q26A 3N35A 4FPOB 2IC1A 4XTMA 3HOBA 4FPGA 2YXSA 5DPNA 3PHMA 1CJDA 4EROA 2Y6LA 2JE8A 2VZTA 1OLMA 4Y4YA 1XYNA 3LF7A 4LMFA 3A0NA 4BXSV 2IFWA 1JOPA 4IV1A 2EXIA 4PQQA 3ZXKA 5C8CC 1OPMA 1CAXB 4H7MA 1LHWA 5CEHA 4QQPA 1UY4A 2NQYA 1JMUB 1GWKA 1KEXA 1KFXL 4DUVA 3WP3A 4MGZE 3MPPG 3KCYA 4IEUA 3JD71 1ULEA 2RS11 5L9BA 2XJUA 3VBUC 2ZGLA 1LODA 3GBWA 1KITA 1N3QA 2ZGKA 4P9GA 1OA4A 4XAAA 1IHMA 3IM0A 4D6RA 5FOJB 1WCKA 3NNFA 5IW0A 1LNSA 3A0KA 4JRLA 5A3TA 1WW7A 1JZ3A 2FDIA 1EUUA 2ZMKA 4N53C 2BNNA 3THDA 1V00A 2GALA 4B29A 1YYNA 4CXXA 3IAPA 4XE9A 4A6OA 4AI1A 2I45A 4E8CA 2K46A 2VMDA 2VUJA 1AR82 2JECA 5H9PA 3VGIA 3I2HA 4NHXA 5HXVA 1SFYA 4Q0VA 1RGSA 4CSWA 3VDDA 2VMFA 4AE2A 1FMD3 2E53A 3J8F1 1DU3D 5A3LA 1N47A 5CISA 5FPBA 2DCYA 1VBA2 5GALA 4E2SA 1W2UA 2NPIA 4CA9A 1R64A 4CCMA 1QMJA 3V64A 3N7MA 4NPMA 3S7IA 5CB7A 3UT0A 3ASIA 2OX0A 4Y1YA 5A6QA 4QKFA 2PYTA 2W1QA 1NLSA 5A32B 2B9VA 5CG9A 1ZRCA 4AEDC 5FP8A 4YWAA 1REEA 2WS92 5A7OA 1SLAA 5KHIA 1W0OA 3MFAA 1HRI1 1UKRA 2Z69A 4TSVA 2G9FA 2VBBA 1F8VA 2FDHA 4BZ4A 2YZ4A 1PZ7A 3NJXA 2W39A 4CDUB 4HPKA 1S0CA 1H9PA 2FHRA 3LB9A 4ZZ5A 5LBCA 2PHWA 5AFEA 1AR81 3BTXA 3MEPA 2OT7A 2Q8DA 3ZXDA 5GM0A 3VN4A 5LY2A 1GSLA 4Y20B 1L7RA 4UFKA 3SCHA 2PHUA 1CAVB 5DUUA 4YG0A 3T1LA 4H2AA 4MZUA 1BZWA 3O14A 1O4YA 2YBPA 5DUWA 1VBE3 4QB6A 3OSDA 5KHJA 4YFWA 2JG8C 3PTYA 4XJWA 3WXPA 3ZOIA 4XJ8A 3RZHA 2HWC1 1AR63 1E57A 1ZZBA 3RJRA 3WG1A 5GZEA 4UFLA 2NYYA 3GYDA 3OGSA 4PIXA 4K21A 3D0SA 2R043 2C4XA 3ZN4A 2XBO1 3POIA 1AL22 5E6HA 1GP6A 5LASA 2R061 4QHBA 5K0UC 4MGKE 4AHYA 1W8FA 4FPJA 4PBOA 4PIYA 5DXDA 3L2HA 2XMLA 5ABJC 4B8EA 2B8MA 4IV1B 4Q2FA 4QXBA 3EBRA 3VBSB 2J22A 2BWCA 2OKXA 3M4FA 1PX4A 1GU3A 4Q4W2 5A7PA 2AEZA 2RM23 2V09A 4DXSA 3VBRA 2VUDA 1NUKA 5GZCA 1BK0A 1SCRA 1WA4A 3FMGA 4QPIC 3NNJA 1JI6A 4HK8A 3AYDA 3AX4A 4FP3A 3O1RA 5DAPA 2IUWA 5DUVA 4R9AA 2ZX4A 4E4SA 4FFHA 1QHDA 3LDBA 2ZGMA 1NE6A 2DURA 4UFHA 3H7JA 1AL0G 3OY8A 3RQ0A 3VDDB 3WP4A 5IATA 1VBD3 3D4KA 3MFCA 3SMHA 1UX7A 3HAGA 1A6CA 1OLRA 1UPSA 3HN1A 5IVYA 5I0DA 4XF9A 1IPJA 2DCJA 1REDA 2QBXA 5FO9B 2WZR1 3JUUA 1COV3 1E5IA 2WO3A 2OYZA 2R1BA 2XUMA 3NO8A 2VH9A 3Q8EA 1TME1 3AZWA 4ZZ8A 1PMIA 4FFFA 3FHAA 4YW5A 1EPWA 4UWDA 3C7HA 1PO12 3A7QA 1F35A 2NP0A 4L2NA 2ZX1A 4ZS2A 4ASLA 4Q4V3 3POFA 2Z5WA 2QE3A 4PLMA 1UOJA 2R041 4YVSB 5F3IA 4Q4W3 3I2IA 4XQ4A 5IAXA 3KCXA 3VV1A 5I0SA 3HBKA 5LA9A 1J1TA 3A21A 3JBG2 1IS6A 2W92A 4RGKA 4CDXB 4C90A 2QQKA 3B01A 4XJZA 1AX1A 5C3OA 3NKGA 1AYM2 1PO23 2E6VA 1QJY3 3I3MA 2CSGA 2OS2A 4OZXA 2RS32 5F6LB 2E63A 1A8DA 3HIFA 4MX3A 4Y4RA 1IKQA 3N4MA 1WW5A 4IQPA 2P1BA 3BB6A 4AOCA 1XJAA 2ZCWA 3RVHA 1ONAA 2ADEA 2QQLA 3B9IA 4OI4A 5FP4A 5FREA 3VBOB 4DPNA 3AXEA 5JR2A 4QPGC 5KC6A 2WFF3 2J7MA 3IB3A 2ZGQA 4I09A 1IPKA 5FQ0B 1RTVA 1AX2A 1TQ5A 2HEWF 2W46A 3K46A 3CNAA 2FDFA 3RS6A 3VBSA 4N9IA 2ZHMA 5CVRA 3WDVA 2KM2A 4CP2A 4CDUC 2W95A 1LJ7A 2EIDA 2O0OA 3HN3A 4UBGA 3DCQA 3ELNA 2XB6C 3B9CA 1IZ3A 4LE4A 2W9XA 3PL0A 3IDAA 2BGOA 4KU8A 2FCVA 2R7EB 4YGBA 4UW3A 4FQ4A 4Q0QA 4P9YA 1DFQA 3INAA 5A3MA 5E16A 3U10A 4NHKA 3SKVA 4E8DA 5JMCA 4IEOA 3VZJA 3OBTA 5C8CB 3UKTA 2BEOA 4AL9A 4O9EA 1ENSA 5JI9A 3OBRA 4NHYA 3TN91 1QJU3 4J1XA 2JIGA 1QNYA 4CCLA 4ZKTB 5JXGA 4KH9A 2VOXA 4Y5Z0 1UPIA 2VQ0A 2H6CA 2WFF2 2D6KA 2ERFA 4DIQA 4XACA 2QQUA 1QJEA 1V6IA 1K5MC 4IEVA 4CDQB 3VHPA 3WT3A 2YFZA 4EV0A 1YIFA 4R9BA 2W1WA 2W5FA 3VKLA 2RS33 4NROA 4QDQA 2VZSA 2RM22 2VC9A 4FXGB 5BNPB 1V6MA 1V9U1 2WT1A 4D7TA 3L9JT 4D3WA 3D6EA 1H6XA 3HNBM 3KWVA 1CAWB 1DQ6A 1YUDA 5F1RA 4NIGA 1BEV1 3JBG3 3CJIB 4XQDA 1MR5A 1WWYA 5FWJA 3C7EA 1XU1A 1MZFA 2XL7A 2LALA 3M8LA 4J25A 4Z2WA 3D8CA 1UOGA 4HONA 4CE8A 2UWBA 1VBD2 1G9BA 2ET1A 3R4SA 1ASJ2 2RMU3 1FPN3 4JHZA 1HJFA 5FPAA 2R042 3ZVXA 2WINB 4QX1A 2MEV2 1X9TA 3MV11 2FDKA 2PFWA 3Q8CA 5ANNA 3VBOA 3WNPA 3NKTA 4FSJA 3ZXEA 2WZ8A 3ZFEA 1HLCA 1GFF2 1FAYA 1MS1A 4RHV3 4COUA 2ORZA 3CDZB 3HMYA 4JAAA 5FQ0A 5AC93 1W99A 2W3JA 2HJIA 2XQXA 4KGGA 4DB5A 3S57A 1U5YA 3F95A 4XUPA 4EWAA 1SDDB 5K7PA 3ZYRA 4UAPA 2WABA 4A7ZA 1TNFA 1J84A 1ZBA3 4GKYA 4K40A 4YVSC 4FTSA 1K3IA 3ZKUA 1VBE2 4M4RA 5CZKA 2VULA 4LO6B 3H1MA 3AMMA 4P9WA 1O59A 5FFOC 5FP3A 3MIEA 3USSA 3E5XA 1CZSA 3I8TA 4OMDA 5LRSA 4KGQA 1FNYA 1XOYA 1NLRA 4N43C 4XQWA 5FYIA 2VM9A 3MIGA 2IXLA 5FTTC 2Q8CA 1QY4A 3Q8FA 3TN92 5DUXA 3K4AA 4CXYA 1J3PA 2VOWA 2D44A 3AL5A 1JZ2A 2CWMA 4HFSA 1GUIA 1Q43A 4LLOA 4PBPA 4MHRA 2VTFA 1V0AA 3RYRA 2AUYA 4HVQA 3F2ZA 1LHNA 1RUG1 2K9ZA 2D43A 1IS3A 5KXBA 1PX3A 4YW3A 5IVEA 4LE3A 2XJQA 2XWJB 4A3ZA 1PVC1 2VQUA 2XKPA 3VBHC 1YFYA 3OUHA 4QPGB 4DRVA 1NXMA 1S0FA 4PLOA 4UW4A 4GWIA 4BQYA 1AR92 4A7YA 4XBLA 3KT4A 2DVBA 1NQDA 2WNVB 1APNA 3JB8A 2RR13 1XE8A 5DMYA 1S0JA 3LA3A 5K9YA 1Q8VA 5F6KA 3E6CC 3VDDC 2A6XA 4QKBA 3VZNA 3L2YA 4NAOA 4MV2A 4QB2A 1LHUA 4FO9A 3POWA 1MQTC 1PVC2 1WW4A 2BP6A 2JWPA 2WN2A 3GCWA 3LDRA 5C71A 3FFQA 4PIZA 2XDVA 3DXTA 4Y1XA 1WMEA 2QQPA 3RZKA 4PT6A 1US2A 4H7LA 2HYXA 2P4EA 1W3VA 5HI0A 3IDEA 3WF1A 4GB33 5ACA1 4KMQA 2KXLA 2OUHA 1TVGA 3AMPA 2DVAA 2XLFA 3PMSA 3WINE 2YFUA 2WRAA 2RDQA 5DG2A 2MHFA 4QX2A 3JBG1 3PUSA 4JTNA 2HKXA 5LEJA 2ZKLA 1NE4A 3BN6A 4JV4A 4Y1UA 3ZFEB 1RXFA 1V9U3 1LHVA 4QX7A 4RFT0 2WLQA 1WD4A 2X5IC 5CFDB 2WA4A 4H3WA 4X6QB 2E7TA 3T0AA 4CP9A 1BLZA 4BMEA 5L7OC 2HWE1 2ZEZA 4Z2AA 2AENA 3T2PA 2QDNA 3ACGA 1H1AA 4IV3C 1W05A 2VUCA 5JWPA 3E5QA 3W20A 4JGZB 1PO11 3WF4A 4LHLA 1PMHX 1IS5A 3DPRA 3OGRA 4HL0A 4JKLA 3AP5A 1UY2A 2W08A 1S2EA 5JOWA 1JS9A 5H9SA 2Y38A 1SEFA 2WZR2 3WF3A 2RDSA 1D0HA 4NUBA 4Y26A 4MHUA 1I5PA 3WV6A 4AVVA 1D7PM 2IVJA 4ISQA 4FCAA 4DXZA 4CEYC 1R1A1 4SBVA 3ZFGB 4XF1A 4XBQA 1AR72 1Z7S1 1JUHA 1SPPA 1SLLA 4IERA 2VCBA 1LHOA 3ZXLA 1NCQA 3SISA 1RXGA 3M3QA 3HQXA 5FMOL 3THCA 3G7DA 2IXJA 1FXZA 5F8PA 3QOPA 3T2OA 4DRRA 1OT5A 1H8VA 2R6QA 2WDBA 1TMF2 4D6QA 4AEJA 2C9KA 1R082 4D69A 2WNVA 5BYNA 4I3PA 3MLKA 2BW8A 1YFUA 3DYMA 3FHIB 1JYNA 2K2SA 2XQRA 4FPLA 2KD7A 4XFIA 1CX1A 2SLIA 2CL2A 3MLLA 3NV2A 3OOXA 5GLWA 1U12A 3P5BA 1XNAA 3ZX7A 2LW8A 4LLFA 4AI2A 3U14A 1O8PA 2VVEA 5C8WA 3N9MA 4AFCA 1PHMA 2ZXQA 2C0ZA 5FZKA 2Y60A 2BVBA 3OF1A 3WUCA 1AR61 3NV1A 4DMIA 4F8AA 2BBVA 1FMD2 1GBGA 5D1IA 1G9AA 5FJKA 1PGL1 1CAVA 4EN0A 1J83A 5LB6A 3RMYA 2CYFA 3UV9A 1O5LA 4PJYA 1YNAA 2KA3A 2R072 3LE0A 2ZX3A 5JVVA 3CO2A 2DBIA 2Y64A 4MO3M 2GNMA 2YUEA 5LRRA 3WQBA 3ZPYA 1YXWA 4AXOA 4IEPA 1X33A 3U78A 4ARYA 4YGDA 1VLNA 3MIBA 4LUMA 5CFDA 3H3LA 2A6VA 2XJPA 3AVSA 1LTEA 4Q4V1 4DO0A 1XRUA 1W0NA 2R0FA 2XKOA 4CP9B 5IK8A 1AZDA 3B69A 5C3QA 4HKWA 1LESA 2VNOA 2ZACA 4PCRA 4FPKA 1L3JA 4M01A 4QAWA 5F37A 3KHBA 4ZXKA 3EJKA 2HWF1 4I0AA 5FZ1A 1F31A 1C4RA 1WLWA 1SCSA 1ZZ8A 2X8KA 1W8NA 4YRDA 1F9KA 2JDUA 4ITCA 2WT2A 1FATA 1LAJA 1SBFA 3CZJA 3THPA 1ZX5A 1F2NA 2FD8A 3LCPA 5CFCC 1Q5OA 2DUPA 1JZ4A 2CU5A 3P6BA 4LOSA 4CP0A 1XXNA 5IK5A 3NAPB 4KBBA 3ZFGA 3ZR5A 4RSUA 4XUOA 5A7WA 1ZREA 3K3NA 2W0XA 3WCRA 2PLV1 3ZPOA 2ZABA 2YC4A 4CRQA 2P3YA 2NN8A 3B3QE 4OHZA 2EF6A 2HWE3 2YROA 2D5HA 3VD3A 1NA1C 1XNCA 3O1PA 4IGOA 3ZIWA 1EPZA 1YO8A 3O0XA 4RYDA 1ACCA 2ZGRA 2GC1A 3PVNA 3FZ3A 2W87A 2RS12 1VMJA 4TYSA 1JUIA 3ZFEC 2ORXA 4NIIA 4S2HA 3H8OA 5CKMA 1CVNA 5G04L 3HWJA 5CFDC 1AVBA 5FCCA 3I2DA 2Y6HA 1RVF2 4CUCA 1C57A 4FTEA 1PIV3 2E7AA 3AJZA 4N7IA 1QDOA 3LEKA 5DAQA 2R063 1CN1A 1KDMA 2WZPP 5JZGC 3ZDVA 1N3OA 5LWBA 3E5UA 5IAVA 1AR62 3MYXA 3N3HA 1CAUA 4XTPA 5FMBA 3MHZA 2VNGA 1V6LA 2ZMLA 3RYPA 1KS5A 4HN1A 2EAAA 1RUNA 2ZS6B 3LA2A 2JX9A 5L73A 2K0GA 3PURA 2DCZA 5CA6A 1JU3A 4RFRB 2JKXA 3W21A 1RUH3 2DBNA 2J1EA 3RWNA 3ZFGC 5JDBA 1O3SA 2Y0OA 1DGRA 2BWAA 1WMXA 1R081 2JD4A 2WIIB 4QB1A 4Z92B 3WR0A 1TMF1 1Q8PA 3ACIA 1HQLA 1BBT2 1LOFA 3OBZA 4P9JA 3U07A 3ACFA 1SDWA 3HR9A 1T6GC 1ENQA 1RMU2 4NRPA 3BPSA 1D4VB 5FYBA 5FYUA 1PM7A 5HCHA 5LW9A 3OPZA 4HT1T 2JDMA 1YEWA 4HK9A 1MPXA 4CUGA 2HWD2 3Q8AA 2VY0A 4YFZA 1PIV2 2VU9A 1LKNA 2R49A 1FPN1 2ZGUA 1PO22 1UZ0A 3N9OA 4GWMA 4KG0A 1GOGA 2QQWA 2WNOA 3AKRA 4F3JA 1KS4A 4FAHA 1PO21 3BOPA 3IT8A 1GV9A 4HVRA 1FOD3 2JKBA 4NIAA 4C91A 5CAZA 5FZ7A 4QQOA 5JPMB 1W04A 1BKZA 1P8JA 1EYBA 4Q27A 3PVEA 2X5IA 2ZMNA 1EAH2 2UWCA 1LGNA 4H55A 1A34A 4S2GA 3VL8A 5A3NA 1W9WA 5T3NA 3LFMA 4FPYA 3NAPA 3T1MA 2ZJCA 1VE0A 2ATFA 2N7GA 5A7WB 5C3RA 3C7GA 3VHNA 3KV6A 2HWC2 2R32A 4NN0A 4AFDA 3WG4A 3ME2A 3GGLA 1GQGA 1XYOA 1ENRA 4PF1A 5KHHA 3FUOA 3SC7X 1J3QA 1HQNA 1H2KA 2DYCA 4QX5A 4CCCA 4DOUA 1Y4WA 2WNEA 4RL7A 4JGZC 2ZEYA 1LECA 3VKNA 4AQTA 3KV9A 4DY5A 4XJ9A 5C8CA 2ARXA 4YLZA 4EZHA 1YC61 4NHLA 3MW2A 3AP4A 1UY3A 4IEZA 1VBB2 4JX0A 4U2AA 3LGRA 2BOJA 5LBBA 4A42A 3H0OA 3AZYA 4CEYA 2YPJA 1NZIA 4KL1A 2GNDA 3NWKA 1W8OA 1S0DA 2EXKA 3WNKA 1MS3A 5FLJA 5FYYA 1RUD3 3LAGA 2RMU1 4CDQA 1DBNA 4R8HA 3E97A 1H30A 2PA7A 1CAUB 2CNAA 2FMYA 3I3EA 1PK6A 1RIRA 2Q4SA 3HT2A 5BNPA 3SH5A 4Y24A 5FMDA 4FOVA 2VZRA 5HV4A 3OEBA 3SXWA 4YW4A 2OPKA 3GDBA 1FX5A 4HOOA 2WWJA 3P1IA 4UBHA 1JZ5A 1W8WA 2VG9A 2WJSA 2WQZC 2CY6A 5F2SA 3U11A 3V56A 4D6SA 3SNMA 1JZ8A 3VDBA 5C7GA 1WLCA 1ZZ6A 1DLCA 4YVWA 2YV8A 2EAKA 2JDKA 4LBQD 4M0HA 4Q29A 1S2KA 4BDVB 3UNPA 5FPXA 1MVQA 5FJHA 3RYKA 2FMDA 2HWD3 2RJKA 4KG8A 3NV3A 4AI3A 4BM8A 4COWA 4KWKA 5SV5A 4A41A 4R9CA 3URFA 1LOCA 4C8DA 4FFIA 2VOKA 4XUQA 3AZZA 1RINA 5B2GB 3ZKYA 1V6KA 4QX0A 5A33B 4AR2A 4Y22A 5JIUA 1BBT1 4GWJA 4OFGA 1W8ZA 3ILRA 3TEYA 2JG8B 3HEIA 3KLSA 4XHXA 4UW5A 3BU7A 3POJA 1RUH2 1UOFA 1JW6A 3ZXJA 3ACLA 3SEPA 2VVDA 3AP9A 3MF6A 1DGRN 3VBRC 3GZUC 3WNXA 4LBNA 3AC0A 1I5ZA 2RS53 3U75A 1YLLA 3CZUA 1RUJ3 5FYMA 1OURA 2AR6A 2F4PA 4DS0A 4ZHNA 5FZ8A 4Z1VA 2OPWA 2HWB1 2HLEA 1AX0A 1N1VA 4QM9A 3UJOA 4XZPA 4DEVA 5ABJB 1QQP3 1CPNA 1O5UA 1FPN2 1LEMA 1X9PA 3ROUA 2Z4FA 3H9AA 3APBA 4D0QA 4WM8C 1W3XA 2VZ3A 1JYCA 1NCRB 3OG2A 4AVSA 4AI8A 1HV0A 2WO7A 3WVJA 3UK9A 1MEC1 2XBO2 2ZBJA 3SH3A 1VBD1 1W8HA 2E9QA 5JAXA 1FT9A 4QGLA 3QACA 1S0BA 1VMHA 1XE0A 2E7QA 2VNRA 3NAPC 3ITQA 2DFCA 4QQLA 1JOBA 1XNBA 4XFFA 5FKCA 4LO8A 1ZVFA 1XNKA 3K48A 3LFIA 1OPOA 2Z79A 1AR73 2AREA 1IOAA 1PK6B 4P9IA 5LZ6A 2ZAHA 2ZHLA 3AKQA 4QKDA 4EWDA 1ULDA 2FDJA 2RM21 3LDKA 4XFCA 1KJRA 3RG0A 4OUSA 1QU0A 2Z42A 1YJLA 4I2OA 3B93A 1XB9A 3IDBB 3CLPA 4QU1A 5E89A 2ZA9A 3JB4C 3S5AA 4TN7A 2L9LA 3MUZ1 4IE7A 1OHFA 1WD3A 4FXKB 4K6BA 5ANQA 1AYN3 2RVAA 3AMQA 2H0BA 1JYVA 3NNLA 5FAXA 3O7OA 1EV13 4MGYE 3H50A 3POBA 3PDQA 2O8QA 4YVWB 1HXS2 2P37A 2YU2A 3BALA 3PLQA 4ZU4A 3KQRA 3CL1A 1G9CA 5FZDA 3I3BA 2QKDA 2XBO3 3HPNA 2Y6JA 2C6SA 2ENRA 3M70A 5C9AB 2BGPA 4RQPA 1O91A 2JE7A 3UESA 1R1A2 2HEVF 4V1PA 3TWIA 5LA2A 4RN5A 2QQOA 4AK3A 5CKNA 4YG6A 1CD3G 1YJKA 3GJBA 1AR93 5A33A 4DEQA 4LXLA 4Y22B 3WLUA 2VAUA 3FC0A 1ALYA 1RUG2 5JOZA 1DYKA 1RUF1 2VO5A 1GP4A 3RSJA 1K12A 1Q8OA 2ZX2A 4BH9A 4EZ4A 4XUTA 3TOJA 4CCJA 1I6XA 2JDAA 1ZZ7A 5IVVA 1ND3A 3LEIA 3BOWA 4M3CE 5FZEA 4JGZA 1DQ1A 2CDOA 1IS4A 3PTRB 4Y1ZA 4HN0A 2C1FA 2ETEA 4ZXEA 3DPRB 4XCBA 3SCFA 3KHCA 2A6YA 5JOYA 3FJSA 1YHFA 3NL1A 2X29A 3WSOA 1RUG3 4DY3A 5ABJA 1F5JA 4QQ2A 4LQRA 4Q4X3 1NY72 4AW7A 1WLTA 3WDUA 1O3RA 4MG2A 3C2UA 5JLVA 2BJSA 4S2FA 3R05A 2R16A 5I0UA 2QZ3A 2RS52 5CNAA 3RI9A 4ZS3A 3C8XA 3I3QA 4Z8BA 3SLIA 3R0RA 1ULFA 1WCDJ 1W90A 1SPPB 4IGQA 1RUJ1 5C70A 1NCQB 1YWKA 2RS51 4NAMA 3N9NA 4AGGA 3MI8A 1AJOA 1UZVA 2P2KA 1UIKA 1WGPA 4LBLA 4UYBA 4COZA 1O8SA 3JQXA 2PN5A 5LA1A 1HN0A 2F17A 1K5MA 3CKHA 2B45X 5EJZB 2PHXA 4Y1VA 1VAMA 2NM1A 5FY0A 5A3OA 3T08A 3VD9A 1YCIA 2D93A 1DQ0A 1OA3A 4ZPIA 5IK4A 5H9QA 2QQJA 4LBKA 4WZCA 4C1XA 3O0VA 1GZCA 5FZ6A 1X8MA 1GYKA 1H9WA 2AGSA 4LNVA 1GZTA 3EHKA 4EQVA 1N3PA 2V4VA 1X36A 2W94A 2VD7A 1E5SA 3JU9A 4GXLA 4DQAA 4CDQC 3DECA 4XIKA 5BNOC 1DCSA 2VOTA 3VZKA 2A5ZA 2GMEA 3T09A 1GQPA 1TZOA 5F7UA 3V0BA 1AYN1 2Z2SB 4CTEA 5T5JA 5HCBA 5A80A 1JU4A 2GP5A 1QXJA 4XHBA 4AHWA 4AQ6A 4G3YC 4JZRA 5AFBA 1W28A 4Y5TA 5C9AA 1CWPA 4RQPB 3V0AB 1A78A 3LEMA 3I2OA 3T0DA 1G8WA 1OD5A 1RHI3 3BTZA 2RJ2A 5J37A 5T5LA 1W6NB 2JDPA 4CU6A 1QH7A 4LOTA 4AYUA 4M3CA 4META 4B7EA 4EN6B 5T5PA 3AFKA 5FPVA 3V65A 1BK1A 2P3IA 2OUJA 3GBFA 1GMMA 2LRPA 2VW0A 3MV01 3WNOA 1PM4A 2RHPA 1POV1 1RUD1 2RR12 4JC1A 4R4ZA 3H42B 3ECQA 1S1AA 5C6CA 4TWTA 5ACA2 1RUC3 3SITA 1HV1A 2DU1A 2AYHA 2DTWA 2WL1A 2YGMA 1W2TA 2WFPA 2XLAA 1AYN2 1H8TA 1UMZA 3U4SA 5GLTA 5E8AA 1W2NA 4HKOA 4CCNA 3ZSEA 5C3PA 2Y6KA 4LBQA 1O6UA 2XG3A 2ZGOA 1H4HA 4RR3B 1JOJA 1QQP1 1ZNPA 5A1FA 4XBNA 3IPVA 4KWLA 4B3NA 2GP3A 3U4XA 1OH3A 1RJ8A 1W2OA 1V70A 2EIEA 3K2OA 4XFHA 4FPHA 4YGCA 4FI9A 4RS5C 4IE4A 4YVWC 2XVKA 5F3CA 2O8OA 2WYFA 4G9SB 5L9VA 3CIHA 3K75B 1GKBA 1ULOA 2VTXJ 5FLHA 4TTGA 4JDNA 2CGOA 3BODA 1RMU1 2DDUA 3BVCA 4Q4Y1 5EYYA 5FP9A 4H14A 4NPLA 4BWOA 3JQWA 1AXYA 2VZUA 4GULA 5FYCA 3D0JA 4QPWA 4LBJA 1MZ6A 5DAXA 4BMBA 4DUWA 1WCQA 1NG0A 3NNGA 1U5ZA 1IQAA 1NT0A 1NY71 2WT0A 2V5DA 4XILA 3W5MA 4BISA 3AVRA 3I4IA 4UFJA 1NCRC 1PNFA 3DGTA 4AQSA 4QX8A 4XDOA 2WS91 4DUXA 2QQVA 2WSVA 4BYYA 5IFTA 2WKKA 3VBHB 3DPRC 4AHXA 2Q30A 4O7XA 3VB9A 1HRI3 3KCCA 4XF0A 2YC2A 3T2QA 1POV3 4BCUA 4XABA 4A7KA 2P3JA 2EVXA 4CDWA 2Q0AA 1QJX1 3A22A 5FZOA 2JDYA 4OVEA 4L0PA 3K77A 5BNNA 1CESA 1Z78A 2O14A 1RHI2 1RUC2 2HEYF 3JZVA 4TLGA 5GLUA 1W6NA 3FLPA 5FZ0A 2GC3A 3KT1A 3THTA 5JXIA 4M3CB 3E1F1 1XPWA 3LQCA 4FPFA 4AI0A 4CU9A 4Q4Y3 5FKBA 5J09A 1OOPB 3I59B 1U0AA 1UYXA 1C1LA 2E32A 4LITA 5FUPA 2PQQA 1DGWA 1WBLA 4Q0SA 5FY5A 4AVTA 4EYUA 3VLBB 5CU1A 2VMGA 1Y3TA 1NQJA 1YRZA 2QDRA 1AYM3 3WDYA 2Y33A 4I3GA 2RS13 3ST7A 4XFGA 3RZMA 2KR2A 4ATFA 2BFUL 3FLRA 3IN9A 4PI0A 3HBZA 4W65A 2X5IB 2BU9A 1LULA 2IZWA 4LBQB 3VBUB 4A6SA 3PMEA 2NMOA 3VD4A 1HB2A 3IPVB 4QX3A 1UQXA 4JQTA 1LOBA 1OQ1A 2ARBA 4RD7A 4BA6A 5L7OB 2WAAA 2WC2A 4OHXA 2B46X 1NKGA 1XC6A 2B4KA 1QJZA 3N36A 4X8NA 4MGSA 2ZGPA 5EPAA 5FZBA 4D7YA 2A70A 3WG2A 1BJQA 2XJTA 3ES1A 2Q8EA 1DGWX
chains in the Genus database with same CATH topology
1WLDA 4Z82A 4Q4Y2 3W9AA 2A6WA 1O3QA 4K1ZA 3AKPA 1QJU2 3AYCA 4CEYB 2JDZA 4FOWA 4HVOA 1EAH3 1D0GA 1JH5A 4IESA 2BFUS 4L97A 3IIAA 1Z7S2 3NSTA 2UWAA 4WV8A 1QQP2 4DFSA 2WSUA 1UAIA 2HWB3 4Q0UA 2JJ6A 1DLLA 1VBC3 3BTAA 2V73A 1G86A 1S0EA 1S0GA 1GR3A 2BVVA 5KHGA 2F6BA 2PHDA 4QM8A 1QWRA 1A8MA 5K0UA 3ZSLA 4GMP3 1BMV2 4CDWB 1ZBE3 1D2QA 4NVPA 4AGVA 1RUE3 5BNNB 1RUH1 2XL9A 5JSPA 1BBT3 4ES9A 4RS5B 2A3YA 4FOQA 3ZFFA 1OSGA 4LHNA 3S7EA 1DG6A 1GNHA 3E6DA 4JDOA 4Q4W1 1VAVA 3WW3A 1C5IA 4NOTA 2DVDA 4IETA 3WQ7A 1CX4A 1QKQA 2QUOA 3ZYIB 4E27A 2B42B 2OVUA 1QOTA 4INDA 1G7YA 1DQ5A 2WZR3 4RQPC 1BVP1 2JG8A 2R071 3NW4A 1J3RA 1ZZCA 3VBUA 1RUC1 3FWEA 4QPYA 5L7OA 2H6BA 1FMD1 1UD1A 1RUI2 2O1QA 1RUI1 2CGNA 2XJRA 3ZSKA 2DU0A 1U5XA 4K20A 5T50A 4QGNA 1HXS1 1EP0A 2PHTA 1AR91 5BXXA 1Q56A 3B02A 2BTVC 4RGGA 2EXHA 4XDQA 3M3OA 2FZ2A 1NCRA 3IDCB 1MACA 4MGIE 2R073 1AUYA 3FE5A 2PLV2 4C1WA 1WBFA 1ENXA 4O9GA 2P3KA 1LGBA 4GQ7A 4L8QA 3QLQA 1SLIA 4WM7C 4DZGA 1QNWA 3MIFA 2D3RA 3B00A 4I0WB 1JN2P 3H7YA 3NVCA 5D8AA 1G9DA 5EV7A 4MVTA 3AYAA 1VRH1 3VKOA 3LSDA 1RUF2 1VBA1 1AR71 2NLRA 1J58A 1FOD1 2IWGB 2DUOA 1IGOA 2D5FA 5JZGB 1ZBE1 4J6GA 4X8PA 3ZFFB 3HD8B 5BUVA 4S2DA 2YDEA 2ZGSA 2CWSA 4DNYA 5BV6A 3S0MA 2VUAA 3KS7A 3R6SA 3GZAA 2ZTNA 2WQ4A 5F9TA 3M3CA 4HZFA 2JEMA 1YI9A 4EN8B 5GZGA 4URTA 1PGW2 1LEDA 4XYXA 4WVMB 3MF9A 5I91A 2ZZQA 3OD0A 2D7FA 1JHNA 2D3PA 2DCTA 4XF3A 1C8M1 3S30A 3WG3A 5DZFA 4XMAA 2UYAA 5KHKA 1UKGA 1C1FA 1ND3B 3NJZA 4FVVA 1B09A 3WW4A 1OOPC 1DZRA 4IL7A 4NHMA 1RUF3 3SCGA 3OGJA 2DV9A 1ZRRA 2MPFA 3DN7A 4NWVA 5I93A 4BOWA 1SFNA 1OQDA 1GQHA 1D4M3 5I8YA 1HKDA 1KDKA 2TBVA 1RVF3 3BIWE 1MEC2 1GLHA 4XXAA 4COVA 1AL21 3M3IA 4Z07A 1ASJ1 3N7KA 4PDWA 4LA2A 3WY6A 2B39A 4GB32 2Q5TA 3J4UH 4BIFA 1D2SA 3AZXA 1ND2A 5C4WC 1K5MB 4BPZA 4HANA 1CONA 1ZZ9A 2QCSB 3KGLA 1SBDA 4KU7A 3TYJA 4WM8A 4PF5A 1J59A 1XE7A 5BNPC 3KSCA 5D8AB 1AJKA 3VBFA 1A3KA 2DWRA 4QQHA 1FOD2 4U36A 2AH2A 2HWE2 4FTBA 3CJIC 1RHI1 1WW6A 4LBOA 4P9XA 3T2TA 3E6BA 1VBB1 3VKFC 4KNCA 3H8UA 5JZGA 1QJX3 1H2NA 1W6QB 1Y9QA 2GC2A 4GH4A 3OJBA 1ZRDA 3V0BB 1HDKA 5TSWA 2PHRA 3FBMA 3UKNA 1GICA 3MW4A 3V0AA 3FX3A 1G9FA 1DIWA 1BEV3 4FP2A 4IEYA 3UKVA 1HX6A 4FBFA 3LOIA 4K3UA 2FZ1A 4CDWC 3J8F2 1MS9A 1KD7A 2R30A 4ASMB 4F7ZA 3QD6A 4YNIA 2QZ2A 3AZVA 2RS31 2PHFA 1OMIA 1QXRA 3DF0A 5LK7B 4IV3A 3QH7A 3VHRA 2XWBB 3ZSJA 1Z0HA 1GZ9A 2GH2A 4AG4A 1H2MA 1X82A 4WVVA 1MVEA 1UU4A 2VW1A 4XW3A 2QVSB 4AVBA 1LR5A 4I0BA 3QH6A 1H8TB 5HBAA 4OI0A 3UL2A 1QJU1 2JENA 3RZZA 2MEV1 4WVZA 1ULGA 3IWZA 4MXVA 4RR3A 3WQ1A 4MUVA 2Q1ZB 5FLIA 2UY8A 3K51A 3FBYA 3ZFFC 4P9LA 5E1RA 1LENA 5IUQA 2DVFA 4GA9A 5IK7A 2GAUA 1SQ4A 3USUA 4SLIA 3KT7A 1HRV1 1C5HA 2TUNA 4PDWB 2AZ5A 2ZKNA 1CR7A 1ZYBA 3I7DA 3VZMA 4AGRA 2PHLA 3AFGA 4A3XA 1TMF3 2WNVC 5FO8B 5K8SA 5HCFA 4YM3A 4WM8B 1PGW1 3RI8A 3AP6A 3KMHA 4LBMA 1MZ5A 1VAKA 4DINB 4ONUA 2WFF1 1MQTB 3CF6E 4IXLA 4Q0PA 4PQ9A 4OHYA 2SBAA 3VBHA 1QJY2 2XJSA 1OA2A 2HWF3 2TEPA 1PO13 4MXWA 4AF9A 4FQZA 5KXEA 4XMIA 4CYDA 1PIV1 1COV2 2ZAAA 1EV11 1HIXA 4K8FA 1LB2A 4GIQA 1Q8SA 1JBCA 5JI7A 3H1WA 2EXJA 4QXKA 4IEWA 4LTAA 5DDJ1 1OOPA 3I59A 3ZYGA 5BNOA 1RL3A 1GZWA 3H1YA 2XGXA 1LCLA 2ZHNA 4IV3B 4N53B 4QPIA 5L19A 2H0VA 3OYWA 1ASJ3 2RMU2 4W6WA 5AVPA 4N7UA 5J36A 4YM1A 1V9U2 4C0BA 1S2BA 4YZ2A 2CAUA 3PNAA 5D8AC 4ZU7A 1PNGA 3JCIA 2ILMA 1VB2A 1W0PA 3MICA 2IXCA 3FFZA 4NO4A 5GLZA 2CV6A 2WA3A 3TNPB 3EQEA 3OCPA 1LRHA 2IXHA 4TZDA 3AXDA 1DF0A 1HRI2 4Q4X1 3RDIA 4AEDB 1R1ZA 1ND2C 5C4WA 3B7MA 1RUE2 5DDJ2 2Q1MA 2I07B 3POYA 3RRDA 2UYBA 5T5OA 3USUB 3CJXA 5CG8A 1CJPA 5JIAA 4AFMA 3GHMA 3WD5A 3H3ZA 3VBFC 1UZYA 4L9BA 3RJ2X 1R083 2QFEA 5JSRA 5EZWA 2FQPA 4Q1PA 1ZBA2 3A4UA 4LR4A 4R9DA 1LU2A 4ES8A 3MIHA 1C8NA 1ZM1A 2DF7A 2XLGA 4GKXA 4JVAA 3D5OA 4GH4C 2B5HA 2GZWA 3M3EA 3P3PA 2D40A 2G9GA 1JTZX 3GBGA 3GALA 4D7SA 4M00A 4WVWA 5KBFA 2VGDA 3O12A 4RA0A 2GN7A 5K0UB 1VBE1 5E88A 4D94A 1FV2A 4L99A 4M0NA 4ORFA 5DDJ3 4GALA 3QCWA 1BMV1 2VW2A 4UW6A 3ENRA 2LUWA 4RS5A 1O4ZA 1KJLA 1R093 1Y43B 5AC92 3ZDSA 4MYEA 2JG9B 1HRV2 5J3UA 1W39A 4PDWC 1DDLA 4EN7B 5BNOB 1KXGA 1GZWB 1I1EA 1CGPA 1V6JA 1W6PB 2ES3A 4N53A 4QPIB 4E4ZA 2PLV3 4HKLA 4GB31 3KZ4C 4OI2A 5ACA3 3ZN6A 3AYEA 5I0RA 5GKAC 5BPXA 3ALQA 1R1A3 4JCKA 1MS5A 3IMNA 3JD72 4K7JA 1BQPA 1Y7BA 1WMDA 5CFCB 3AMHA 3UJQA 4M3CF 1NXD1 4B7KA 1HXS3 5T55A 4ZU5A 4YW2A 4XXPA 4JQRA 4JDMA 5KWRA 5GZFA 1KRIA 1RUI3 3LKJA 4FPCA 3AKSA 4C0HA 1H1MA 4HSJA 1B35C 2DTYA 1HQWA 1W6OB 2YY1A 4OULA 4ATEA 1HRV3 2VMHA 4FAGA 2D98A 4QT6A 1VRH2 1R091 4AFBA 2A3WA 1FYUA 1H8TC 4QMAA 4RR3C 1DHKB 4QU2A 2X53S 2A3XA 3TN93 2JICA 4HMZA 3LA7A 4ISRA 3J9SA 1SMVA 5I0TA 4CEWC 1XU2A 1QGLA 4IEXA 1MZEA 1G6NA 2BQPA 4YZ3A 5F5QA 5LK5A 3M1HA 4NWWA 1SLCA 4XJAA 4G4FA 3VUOA 4LT5A 5T54A 1PZ9A 1ZBA1 5CBLA 5FOBB 2CTVA 1V6OA 2VVFA 1N1TA 3Q9OA 3ZXAC 5J48A 2DCKA 3FUQA 4KQ7A 3IKWA 2UURA 3WCSA 1TEIA 2YHJA 1UF2C 4GMP1 3WOGA 5JOXA 4EWEA 3LOBA 2WWSA 2RJLA 2JG9A 2C9AA 4I30A 4LEJA 4Q4X2 4L92A 2ZX0A 2YC0A 1EY2A 1Z7S3 2OZ6A 1ULCA 1H2LA 1W6PA 4IEQA 3N7LA 3ZMNA 1YI7A 2IXIA 1VJ2A 2A73B 1FV3A 2B7YA 4N43A 4RHV2 4B4RA 3GF6A 4WVMA 2FBEA 3EXUA 2OZJA 3GHNA 1O3TA 1LOFC 1VR3A 2G4IA 4W6YA 3WDXA 4CEWA 2MEV3 5CFCA 3WZ1A 5HCAA 1POV0 5AVAA 2ZZJA 3ETQA 1QDCA 3LSEA 4R52A 1MS0A 1RB8G 1PGL2 4WZFA 4BHPA 5H9RA 2D6OX 2Y26A 5CIRA 1W6OA 3ZXGA 2CAVA 5L36A 1M4WA 2WNUB 3JD73 1EV12 1UCXA 1COV1 3EO6A 3WW2A 1XQNA 2JG9C 1CQ9A 5FRAA 3ZYPA 2NMNA 4R4XA 1UL9A 4OLLA 1D4M1 1U5IA 1BEV2 2D6PA 2PAEA 3M2MA 5H9QA 1OLQA 3ZSEA 1RUD2 2EALA 3AKTA 1QOSA 3GZTB 1SBEA 2BPA2 4F83A 2D6NA 1SLBA 1URXA 1ND2B 4YM2A 3J26N 2R1DA 2XHKA 3CU7A 1LOAA 4CDUA 2DUQA 1OFSA 1DZQA 1B35A 1VBB3 4LO7A 4A2UA 5BY5A 4QGMA 1OI6A 2VXRA 3BPZA 5GLVA 4CZSA 3PJQA 2QNKA 1H0BA 5EWSA 3VBFB 1C8M3 4Y20A 2OIIA 4OI1A 2GN3A 4AVAA 1DQ4A 1BVVA 1FI2A 1RC6A 2D6MA 3ILFA 3TB0A 1QH6A 1TNRA 1MS4A 3R4UA 1D4M2 1W6QA 5KXDA 4GH4B 3WW1A 1I3HA 1JXNA 1OKQA 4JGYA 5EXOA 4Q8KA 1H1IA 2QJVA 3WHUA 4XETA 1AL23 3W58A 1ZRFA 2EIGA 4P14A 4J1WA 2A6ZA 2VMIA 2MNGA 3H3UA 4E4DX 1BCXA 1RVF1 4N43B 3DL3A 4YZ4A 5BNNC 4RGAA 3VZOA 3SH4A 3WDWA 4XFBA 2UU8A 5BNQA 1WUVA 3W59A 2I2SA 1RUE1 4LA3A 4CEWB 4PLNA 2UY9A 4AWDA 4GMP0 4AEMA 1XNDA 3WX5A 1AHSA 5J7MA 3VBRB 4BLIA 1RMU3 5KXCA 2BYVE 1RUJ2 3WHTA 2HWB2 3WUDA 2IFRA 3G6JB 4K1YA 4UXAA 4B4PA 4JTOA 2ZGNA 1UU6A 1VIWB 2BNOA 4E9KA 4BE3A 2A71A 2ZGTA 2WLPA 4OHWA 2LM3A 3OY8B 5AC91 1RJ7A 1Q3EA 4RHV1 1QJX2 2WNUA 4NPRA 4FT8A 4COYA 2Y0IA 4L11A 3X29B 1YFXA 1NYWA 3TRSB 1DYPA 2ET7A 1GANA 2JE9A 4OHVA 4I02A 1PVXA 4JRAA 3OGGA 1FNZA 5T52A 3VL9A 4N9HA 2HWF2 2ZOEB 1H4GA 2W68A 2LTNA 3AMNA 3O5SA 5CADA 1PK6C 2GNTA 1DZTA 1B35B 3P3NA 4YGEA 1VBA3 1AF9A 2A75A 5IT6A 2VECA 4YVSA 5JCTA 2GMPA 1XYPA 4XEZA 1TME2 3PJYA 1I9RA 1QOOA 1UX6A 1UW8A 4CDXA 1RUOA 3B94A 1MQTA 5GZDA 2D97A 2C5DA 3MGUA 2VPVA 4XF4A 4XOGA 4EN9B 5J96B 4MXWB 3DV8A 4YYOA 1QXPA 4JGYB 4WM7B 5LEKA 2PELA 4YW1A 3WP5A 1YIPA 3AJYA 4TLFA 1TME3 3ZN5A 3KGZA 2B9UA 2WNUC 3RMXA 2HWC3 3MDPA 1X7NA 2PTMA 5C9AC 2VOVA 5I8SA 5J98B 1MS8A 1V6NA 4YARA 2DFBA 2DVGA 4XIOA 4AEKA 1R092 2XPJA 1UIJA 1C3HA 1BXHA 4LHKA 5FO7B 1S55A 1AXKA 1PZ8A 2BNMA 2RR11 5JSOA 5GJ6A 2GH8A 3OYWB 4LULA 1W6MB 3TBDA 4YZ5A 1NA1A 3ES4A 1VBC1 1OQEA 1IKPA 1N1SA 2WS93 5DG1A 2W52A 3MPBA 2D3SA 3M7AA 4GWNA 3KB5A 4YG3A 3TNQA 5I8TA 4MSVA 1ZA4A 3ZSMA 1NOVA 4YZ1A 1EAH1 4YM0A 1KFUL 1VALA 3DKWA 4AEDA 1PGSA 3KD4A 3ZXFA 1J1LA 4AVCA 1CPMA 1ND3C 1NCQC 3PVOA 4XFAA 2XH6A 1M06G 2BGCA 2ZPXA 1ZBE2 2GMMA 4LO4B 3VZLA 1YFWA 1LU1A 1QJY1 2OW4A 2PAKA 5DZGA 3I54A 5KC5A 1SLTA 3IBMA 3R4DB 2E51A 1LOEA 3SHRA 1N1YA 2Q8OA 1CAWA 3S6PA 2P34A 1Q8QA 1SACA 4CP1A 1AR83 1UZZA 3CJIA 3KM5A 3WDTA 3MW3A 3MLJA 2GC0A 4HBNA 1JYIA 3N7JA 4KWJA 4BQ1A 3OD4A 4YSFA 4QD2A 2PAMA 1DQ2A 1HW5A 4Q4V2 2I74A 3B5LB 1S0IA 2JXAA 3QBQA 4W6XA 4BLJA 4WM7A 1REFA 1X50A 2R062 3HT1A 4AFAA 3MIDA 5FBZA 4AHZA 4FOYA 4XJUA 3GNEA 4OUMA 4FPEA 1F5FA 4X6RB 5EYXA 4NR1A 5EJ3A 5JPNB 3ILNA 3C3VA 3POSA 3LWCA 1UN1A 5C33A 3AK0A 4I01A 1C28A 1RITA 2YMZA 4MH0E 1WMFA 2RE9A 2NZ9A 5FMOS 5JR7B 1QF3A 4WBBA 1W6MA 1X8EA 1CIWA 3ZN6B 3U0ZA 3ZO0B 2CGPA 4EJRA 3AP7A 1PVC3 2OA2A 1MEC3 2XVGA 2XVLA 3PVBB 3WQ0A 1NA1B 2EA7A 3RPQA 4AQ2A 1CAXA 3LZZA 2VQAA 3OTFA 2D6LX 2A7AA 2GU9A 1AYM1 3ZIXA 4E2GA 3VKMA 4B4QA 1AXZA 1UU5A 2GSYA 4JGYC 2XJVA 3MZHA 4LUKA 3AB0A 3NV4A 4HLTA 4QPGA 3TAYA 1LGCA 3D82A 2IXKA 2GNBA 4CDXC 1TE1B 1VB4A 1DGLA 2TNFA 5A32A 1GNZA 2R0HA 4IV1C 2HYKA 3RNSA 1O7FA 4BIOA 4E2QA 3VBSC 3ZYJB 2HWD1 2YGLA 5SV8A 2ZHKA 4Q8LA 5EFUA 1WCSA 1VBC2 4HPKB 4N90A 3CEWA 3VBOC 4HETA 4K9SA 5FDBA 1OFNA 1O4TA 3BCWA 3FLTA 3DUIA 3WP6A 4XPVA 5FPZA 2GDFA 3VHOA 2BUKA 1VP6A 3O0WA 5DZEA 3ATGA 3J8F3 3AM2A 1BYHA 4LO5B 4P5HA 1VRH3 1KQRA 1LOGA 2V5YA 3ZMOA 2P17A 4HSLA 2YYOA 1NZCA 1C8M2 4MLOA 4Q1RA 4Q26A 3N35A 4FPOB 2IC1A 4XTMA 4FPGA 2YXSA 3PHMA 1CJDA 4EROA 4Y4YA 1XYNA 3A0NA 2IFWA 4IV1A 5C8CC 2EXIA 3ZXKA 1OPMA 1CAXB 4H7MA 1LHWA 4QQPA 2NQYA 1KFXL 5LEJA 3WP3A 4MGZE 3MPPG 3KCYA 4IEUA 3JD71 1ULEA 2RS11 3VBUC 2XJUA 2ZGLA 1LODA 3GBWA 1KITA 1N3QA 2ZGKA 4P9GA 1OA4A 5FOJB 1IHMA 3IM0A 1WCKA 3A0KA 4JRLA 1WW7A 2ZMKA 4N53C 2BNNA 1V00A 2GALA 4B29A 1YYNA 4AI1A 4XE9A 2I45A 2VUJA 3VGIA 1AR82 2JECA 5H9PA 5HXVA 1SFYA 4Q0VA 1RGSA 3VDDA 4AE2A 1FMD3 2E53A 3J8F1 1DU3D 5A3LA 1N47A 2DCYA 1VBA2 5GALA 4E2SA 1W2UA 2NPIA 1QMJA 3V64A 3N7MA 3S7IA 5CB7A 3ASIA 4Y1YA 5A32B 2PYTA 1NLSA 1ZRCA 5CG9A 4AEDC 1REEA 2WS92 1SLAA 5KHIA 1W0OA 3MFAA 1HRI1 1UKRA 2Z69A 4TSVA 2G9FA 1F8VA 4BZ4A 2YZ4A 1PZ7A 2W39A 4CDUB 4HPKA 1S0CA 1H9PA 2FHRA 3LB9A 2PHWA 5AFEA 1AR81 3MEPA 3ZXDA 5GM0A 3VN4A 1GSLA 4Y20B 3SCHA 2PHUA 1CAVB 5DUUA 4YG0A 3T1LA 4MZUA 1BZWA 3O14A 1O4YA 5DUWA 1VBE3 5KHJA 4YFWA 2JG8C 3PTYA 4XJWA 3WXPA 4XJ8A 2HWC1 1AR63 1E57A 1ZZBA 3RJRA 3WG1A 5GZEA 2NYYA 3GYDA 3ZN4A 4PIXA 4K21A 3D0SA 2R043 2XBO1 1AL22 2R061 4QHBA 5K0UC 4MGKE 4AHYA 4FPJA 4PBOA 4PIYA 5DXDA 3L2HA 5ABJC 4B8EA 2B8MA 4IV1B 4Q2FA 3EBRA 3VBSB 2BWCA 3M4FA 4Q4W2 2RM23 2V09A 3VBRA 5GZCA 1SCRA 1WA4A 3FMGA 4QPIC 4HK8A 3AYDA 3AX4A 4FP3A 5DUVA 4R9AA 2ZX4A 4E4SA 1QHDA 2ZGMA 1NE6A 2DURA 3H7JA 1AL0G 3OY8A 3RQ0A 3VDDB 3WP4A 1VBD3 3D4KA 3MFCA 3SMHA 3HAGA 1A6CA 1OLRA 1UPSA 3HN1A 4XF9A 1IPJA 2DCJA 1REDA 5FO9B 2WZR1 3JUUA 1COV3 2OYZA 2XUMA 2R1BA 3NO8A 2VH9A 1TME1 3AZWA 1PMIA 4YW5A 1EPWA 1PO12 2NP0A 4L2NA 2ZX1A 4ASLA 4Q4V3 2Z5WA 2QE3A 4PLMA 2R041 4YVSB 4Q4W3 4XQ4A 3KCXA 3VV1A 5I0SA 1J1TA 4CDXB 3JBG2 1IS6A 4C90A 3B01A 4XJZA 1AX1A 3NKGA 1AYM2 1PO23 2E6VA 1QJY3 4OZXA 2RS32 5F6LB 2E63A 1A8DA 3HIFA 4MX3A 1IKQA 3N4MA 1WW5A 4IQPA 3BB6A 2ZCWA 1ONAA 4OI4A 3B9IA 4DPNA 5FREA 3VBOB 3AXEA 4QPGC 5KC6A 2WFF3 2ZGQA 4I09A 1IPKA 5FQ0B 1RTVA 1AX2A 1TQ5A 2HEWF 3CNAA 3RS6A 3VBSA 4N9IA 2ZHMA 5CVRA 3WDVA 2KM2A 4CP2A 4CDUC 1LJ7A 2O0OA 4UBGA 3ELNA 2XB6C 3B9CA 1IZ3A 4LE4A 4KU8A 4YGBA 4UW3A 4FQ4A 4Q0QA 4P9YA 1DFQA 3INAA 5A3MA 5E16A 3U10A 4NHKA 5JMCA 4IEOA 3VZJA 3OBTA 5C8CB 3UKTA 2BEOA 4O9EA 1ENSA 5JI9A 3OBRA 3TN91 1O3SA 1QJU3 4J1XA 1QNYA 4ZKTB 4KH9A 2VOXA 4Y5Z0 1UPIA 2VQ0A 2H6CA 2WFF2 2D6KA 2ERFA 1V6IA 1K5MC 4IEVA 4CDQB 3VHPA 3WT3A 4EV0A 1YIFA 4R9BA 3VKLA 2RS33 2RM22 4FXGB 5BNPB 1V6MA 1V9U1 2WT1A 4D7TA 3L9JT 4D3WA 3D6EA 5F1RA 1CAWB 1DQ6A 1YUDA 1BEV1 3JBG3 3CJIB 4XQDA 1MR5A 1XU1A 1MZFA 2XL7A 2LALA 3M8LA 4Z2WA 3D8CA 2UWBA 1VBD2 1G9BA 2ET1A 3R4SA 1ASJ2 2RMU3 1FPN3 2R042 3ZVXA 2WINB 2MEV2 2PFWA 3VBOA 3NKTA 4FSJA 3ZXEA 3ZFEA 1HLCA 1GFF2 1FAYA 1MS1A 4RHV3 4COUA 3HMYA 4JAAA 5FQ0A 5AC93 2HJIA 4KGGA 4DB5A 1U5YA 4EWAA 5K7PA 3ZYRA 4A7ZA 1TNFA 4GKYA 1ZBA3 4K40A 4YVSC 4FTSA 1VBE2 2VULA 4LO6B 3H1MA 3AMMA 4P9WA 5FFOC 3MIEA 3USSA 3E5XA 3I8TA 5LRSA 4KGQA 1FNYA 1NLRA 4N43C 4XQWA 3MIGA 2IXLA 5FTTC 1QY4A 3TN92 5DUXA 1J3PA 2VOWA 2D44A 2CWMA 4HFSA 1Q43A 4LLOA 4PBPA 3RYRA 2AUYA 4HVQA 1LHNA 1RUG1 2K9ZA 2D43A 1IS3A 5KXBA 4YW3A 4LE3A 2XWJB 2XJQA 1PVC1 2XKPA 3VBHC 1YFYA 4QPGB 4DRVA 1NXMA 1S0FA 4PLOA 4UW4A 1AR92 4A7YA 4XBLA 3KT4A 2DVBA 1NQDA 2WNVB 1APNA 3JB8A 2RR13 1XE8A 1S0JA 3LA3A 5K9YA 1Q8VA 5F6KA 3E6CC 3VDDC 2A6XA 3VZNA 3L2YA 4MV2A 1LHUA 4FO9A 3POWA 1MQTC 1PVC2 1WW4A 3FFQA 4PIZA 4Y1XA 1WMEA 2QQPA 4H7LA 5HI0A 3IDEA 4GB33 5ACA1 2KXLA 2OUHA 3AMPA 2DVAA 2XLFA 3PMSA 3WINE 5DG2A 2MHFA 3JBG1 4JTNA 2HKXA 2ZKLA 1NE4A 4JV4A 4Y1UA 3ZFEB 1V9U3 1LHVA 4RFT0 2WLQA 1WD4A 2X5IC 5CFDB 2WA4A 4H3WA 4X6QB 2E7TA 4BMEA 5L7OC 2HWE1 2AENA 2QDNA 1H1AA 4IV3C 5JWPA 3E5QA 4JGZB 1PO11 4LHLA 4HL0A 1IS5A 3DPRA 3AP5A 2W08A 5JOWA 5H9SA 2Y38A 1SEFA 2WZR2 1D0HA 4Y26A 3WV6A 4AVVA 4ISQA 4FCAA 4DXZA 4CEYC 1R1A1 4SBVA 3ZFGB 4XF1A 4XBQA 1AR72 1Z7S1 1JUHA 1SLLA 4IERA 1LHOA 3ZXLA 1NCQA 3SISA 3M3QA 3HQXA 5FMOL 3G7DA 2IXJA 1FXZA 3QOPA 4DRRA 1H8VA 2R6QA 1TMF2 4AEJA 1R082 4D69A 2WNVA 5BYNA 4I3PA 3MLKA 2BW8A 1YFUA 3FHIB 2K2SA 4FPLA 4XFIA 2SLIA 2CL2A 3MLLA 3NV2A 5GLWA 3ZX7A 1U12A 4AI2A 4LLFA 2VVEA 5C8WA 4AFCA 1PHMA 2C0ZA 2BVBA 3OF1A 3WUCA 1AR61 3NV1A 4DMIA 4F8AA 2BBVA 1FMD2 1GBGA 5D1IA 1G9AA 1PGL1 1CAVA 4EN0A 3RMYA 2CYFA 3UV9A 1O5LA 4PJYA 1YNAA 2KA3A 2R072 5JVVA 2ZX3A 3CO2A 2GNMA 2YUEA 5LRRA 3ZPYA 4AXOA 1YXWA 4IEPA 1X33A 4YGDA 1VLNA 3MIBA 4LUMA 5CFDA 2A6VA 2XJPA 4Q4V1 1LTEA 1XRUA 2XKOA 2R0FA 5IK8A