1M54A

Cystathionine-beta synthase: reduced vicinal thiols
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
357
structure length
352
Chain Sequence
b'DAPSRCTWQLGRPASESPHHHTAPAKSPKILPDILKKIGDTPMVRINKIGKKFGLKCELLAKCEFFNAGGSVKDRISLRMIEDAERDGTLKPGDTIIEPTSGNTGIGLALAAAVRGYRCIIVMPEKMSSEKVDVLRALGAEIVRTPTNPESHVGVAWRLKNEIPNSHILDQYRNASNPLAHYDTTADEILQQCDGKLDMLVASVGTGGTITGIARKLKEKCPGCRIIGVDPEGSILAEPEELNQTEQTTYEVEGIGYDFIPTVLDRTVVDKWFKSNDEEAFTFARMLIAQEGLLCGGSAGSTVAVAVKAAQELQEGQRCVVILPDSVRNYMTKFLSDRWMLQKGFLKEEDLT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYSTATHIONINE BETA-SYNTHASE
publication title HUMAN CYSTATHIONINE BETA-SYNTHASE IS A HEME SENSOR PROTEIN. EVIDENCE THAT THE REDOX SENSOR IS HEME AND NOT THE VICINAL CYSTEINES IN THE CXXC MOTIF SEEN IN THE CRYSTAL STRUCTURE OF THE TRUNCATED ENZYME
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
total genus 91
structure length 352
sequence length 357
chains with identical sequence B, C, D, E, F
ec nomenclature ec 4.2.1.22: Cystathionine beta-synthase.
pdb deposition date 2002-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00291 PALP Pyridoxal-phosphate dependent enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1m54A01
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1m54A02
4KKXB 4WX2B 2DH5A 5CGQB 3DWGA 4H27A 1J0DA 2RKBA 5J43A 3R0ZA 2CLHB 5BW6B 4D92A 1WBJB 5HBGA 4D8TA 3VSDA 5D86A 2PQMA 2CLEB 2TRSB 1PWEA 4D9MA 2CLFB 2C2BA 2EGUA 2ZR8A 4ZQCB 1VE1A 5C3UA 3DWIA 1KL7A 1UBSB 3SS7X 4HO1X 5I7RA 2Q3CA 1TZ2A 4AIRA 1V71A 1K7XB 3L6BA 3SPXA 3ZEIA 2GN0A 2CLMB 1KFBB 3T4PA 2ZSJA 2CLLB 3SS9X 4D9FA 4LI3X 2BHSA 4D9NA 1J0AA 5B36A 1C8VB 5KZMB 2TSYB 2CLKB 5B1IA 5IWCA 3CEPB 4IL5A 1A5SB 3VSAA 2ECOA 1E5XA 1JBQA 2O2EA 2J9YB 1TZJA 3HMKA 4HPXB 2ECQA 2TYSB 4HPJB 1OASA 4NEGA 1J0CA 4D9CA 4D9EA 5D84A 1UIMA 1J0BA 2ZPUA 4HT3B 5CVCA 5J5VA 1TZKA 5B53A 1Z7WA 1TYZA 4D8WA 1CX9B 3BM5A 4HN4B 1K8XB 5I7HA 3DKIA 5D85A 1TJPB 4D99A 1RQXA 3FCAA 5B1HA 4F4FA 1K7FB 4QYSA 3VSCA 3IQGX 5D87A 4L0DA 2GN2A 1A5BB 5DW3A 5I6DA 1M54A 4D9KA 1K3UB 2GN1A 3L6RA 2CLOB 4D97A 3IAUA 4ZU6X 1V8ZA 4OFXA 1P5JA 5KINB 4JBLA 5DBEX 3PR2B 1FCJA 1C29B 1BKSB 5I7AA 1K7EB 5JISA 3X44A 1O58A 2D1FA 1A5AB 1Y7LA 4Y6GB 3V7NA 5DBHX 1VE5A 1K8ZB 1KFCB 1KFKB 2CLIB 1KFJB 3AEXA 5IXJA 1TDJA 2J9ZB 1UINA 2JC3A 1FUYB 3L6CA 5EY5B 1TTQB 1VB3A 2J9XB 5B3AA 2C2GA 1V7CA 3PC3A 4D96A 1A50B 1CW2B 1BEUB 2RHGB 5T6MA 3FGPA 2BHTA 4D8UA 4PCUA 1QOQB 3AEYA 5IW8A 1PWHA 3PC4A 2V03A 5B55A 1K8YB 3TBHA 3VC3A 1X1QA 1WDWB 3IQHX 3RR2A 2ISQA 1C9DB 4NU8X 4ZU1X 4COOA 1F2DA 3R0XA 4LMBA 2EFYA 4XUGB 5I7WA 4L27A 1TTPB 4LMAA 5DW0A 1QOPB 1TZMA 3IQIX 3VBEA 1WTCA 4I1YA 1D6SA 5JJCA 1WKVA 2O2JA 4L3VA 5E0KB 1KFEB 3X43A 4D9IA 4L28A 2DH6A 1Z7YA 4D9GA 2WSYB 4OREX 4AECA 4JBNA 2Q3BA 4D9BA 5DVZA 2Q3DA 5I7OA 2RH9B 3PC2A 1J0EA
chains in the Genus database with same CATH superfamily
5CX1A 5EQJB 1J22A 4W9NA 4EX7A 3ZV6A 3ETJA 1SJ9A 4IWNA 1JEAA 4ALLA 4DQUA 1R88A 3GUUA 4H60A 4BE7B 4DHWA 2VR1A 3DD1A 1ENOA 1F4LA 2CXPA 3FVWA 3C85A 1QS0B 3ZVNA 2F8MA 3CGGA 4EB6B 2KQUA 5FRDA 4QTTB 5BQ3A 1JFLA 1TOAA 3PQ5A 4HMQA 3HFRA 1N32B 3WYDA 2HU8A 3QLVC 3E48A 3O90A 4Y1EA 1YMVA 2VUHB 1ZVVA 3PHJA 2HHAA 1D6MA 5F2KA 4Z1MA 2OGUA 3AR2A 2WI8A 3DA8A 4XEHA 4XUDA 4JITA 3WIVA 1GAJA 1JEYA 1C1HA 2B2XA 1E3DA 1KY3A 4OQXA 3RRYA 2I34A 2D54A 2G5TA 5DEIA 4BZWA 1G38A 4GVPA 2I4OA 4MPPA 1RPNA 3RUHA 4DKJA 5HFJA 4AY3A 5F3RA 3JD2A 3CE6A 3SHTA 5CXQA 3DXXA 3KPUA 1SR8A 3C8ZA 1W59A 1ZCAA 5E6RB 5CVDA 4BU1A 4C6HA 5J63A 1I9GA 4XGNA 2XUDA 3HFGA 5ELLA 1MRZA 1C9MA 1N1DA 1PRYA 3ADCA 5F5LA 2YJGA 1P31A 3QTTA 4ZYTA 3RSLA 4QA9A 1S9DA 2UXDB 3KOYA 2XZPA 1CUIA 1VE6A 4YHHB 3WKAA 5IKOA 3VZRA 4CMEA 3STWA 2H1SA 1G4UR 5AR1A 2XZLA 1ORHA 1WCV1 4A4DA 3E7XA 4K9PA 1XDGA 2QL5A 3KZ1E 5FDFA 1RTTA 3R5XA 5EVCA 1QO9A 4D82A 3EK2A 1AKNA 2LVBA 1TCUA 1E2EA 1RJEA 1D0IA 1CUFA 2H1HA 3CISA 2ARKA 3HN2A 3IT1A 3OPXA 2NZUG 4HTAA 1EJ0A 3TEMA 4BGUA 1NBAA 1JQAA 1SZDA 4F2HA 5DBHX 2IZ7A 4OYHA 1OXKB 5DN9A 5DYTA 4Z9XA 3TLJA 4UMDA 2LGJA 4NCKA 1TTHA 1U9IC 4D46A 5LQAA 1FUYB 1Z26A 4XFJA 1L9KA 4IHAA 1CQZA 2VP6A 4JLDA 4ZOCA 1RTKA 2AQKA 3ETCA 4YP6A 2OFWA 3CUEF 4I50A 1NQUA 4B6OA 5CFZA 8ADHA 5UKDA 5JNLA 3H1BA 1A98A 1JMYA 1ODJA 2ATXA 2H2IA 1NT2A 2WHYA 1I33A 3GAFA 5LOVF 1VLJA 4QGGA 3OP1A 3PHCA 3TPZA 3WGTA 3FNQA 4ZGBA 3NWPA 4OHCA 4RO0A 1M6NA 2AJCA 1JMKC 3PJGA 3R3ZA 3H86A 3JQAD 3AJ9A 4IQFA 4LDPA 4COOA 3N7AA 1C8LA 1OX4A 2F62A 2XCSB 3IXLA 1L7OA 1MX5A 2VEDA 3TW8A 3VR4D 3W0LB 5BT8A 3Q3VA 5JAOA 1SXQA 1B00A 3KS9A 1OW3B 3U3ZA 3CUTA 4L95C 4G9EA 1ZVJA 2I7VA 1K89A 4ZVMA 3VKFA 4YDHB 4URVR 1K9SA 4AROA 3HHEA 4S1PA 4ZCTA 2FK8A 2VHEA 2QBYB 1V26A 1DZ3A 3HEAA 1W8DA 4BL5A 2AJLI 3L8CA 3UWOA 2GPNA 1XJ5A 3GOHA 2W71A 1ZN8A 3EGWA 2R97A 1GLGA 4V0ME 4GS5A 2J0VA 1RQLA 4PAQA 4MS1A 2OP0A 3C3JA 3TI7A 2XT9A 4YT8A 5I45A 1P7PA 1MO4A 1D2MA 2H8GA 3OIVA 3K9CA 3MQ2A 3KEMA 4U6QA 4JVSB 5GM2A 2ERXA 1YOVA 5JJKA 2B9VA 3MHTA 2CF5A 3HR4A 4NZOA 2VZLA 4RK6A 1TF5A 1ONSA 2X1VA 3N8IA 3SX4A 4AD8A 2QPTA 4AU1A 3RAGA 4RKWA 1K75A 2VCEA 1TYCA 3LUAA 2BE9A 1T10A 3R5TA 3M6MD 3NNDA 4DDVA 3QPVA 4MWCA 2E5FA 4HAYA 1PKXA 2UZ1B 2NLOA 3PGKA 1KXZA 2PRYA 2AOUA 1IBLB 2F3SA 4U7FA 4XDYA 5JSFA 2VRWA 4ND5A 4U6SA 2IZ0A 2Q5EA 3UA3A 1R5JA 2LDXA 4REOA 3V00A 3WYNA 1KIMA 4MS4B 2A9FA 4NJMA 4BE9A 4L85A 4AWBA 2GYYA 1JU3A 2PWPA 2J0SA 1D4ZA 1MAVA 1Z75A 4LC1A 1Q84A 5KSOA 1JBKA 4H15A 3DE1X 2PX6A 3EGEA 1YMQA 1KAEA 1K0FA 3W5UA 4KQ9A 1P8JA 3NZEA 3DR3A 3W1WA 3C41J 1H4VB 2W6PA 4LBZA 3HB7A 5I7HA 2QQEA 2M2IA 4GR5A 3A10A 4B3GA 1COWD 1XRLA 1XD9A 2GD2A 2I76A 4OAPA 1AHHA 4FHEA 2JLBA 2C5SA 1EVYA 1HZZA 2Y1GA 1J23A 2FF7A 2ZRMA 4EOGA 1QHIA 2ACWA 3WMFA 2PGDA 2FXVA 2IYTA 3AJEA 2P2NA 4E21A 1GFZA 4OA8A 4EUEA 4NYIR 3Q15C 4ARCA 2Z8YM 4OQPA 4FD3A 5DXFA 2X9LA 1QQTA 3G2IA 5TPWB 3VDNB 3QBEA 3R0VA 1UFRA 3A36A 5D3ZA 4A36A 4TQ9A 2BBSA 4G9GA 5GY7A 3UM9A 3OE7A 2PR7A 4K6CA 1JG4A 4C6SA 4FFLA 1V7CA 4AXBA 3B60A 4HYYA 1H2HA 4EHNA 4L4YA 1RPJA 1XMPA 1YZKA 2XBLA 2EW1A 1OKKD 2FP4B 4UREA 3OM1A 5TGDA 2AYZA 4GOOD 1EFLA 3VYSB 1U0FA 4R98A 4Z54A 4EJ2A 3BF8A 2WAYA 3WQSB 3TD2A 2CUKA 1PIWA 1RI3A 2BGJA 1XTJA 4B6RA 2JAXA 3D7SA 3LUJA 1N8TA 1TD9A 4JWKA 1Y6FA 3RIHA 4JQCA 4F7WA 3DF9A 4JBYA 5T3UA 4GECA 4DTIA 3RS2A 2AB0A 4XUGB 3BYZA 3NJRA 4JENA 3OFND 2NO6A 1PHPA 4MZXA 1XQWA 3OLWA 3U61B 2VTBB 2EFDB 4EKNB 4HDCA 3Q9LA 3JVVA 4UNIA 3R9XA 4W63A 1J8QA 3U4IA 3U3KA 4NKRA 3WYCA 4DZZA 3E9EA 4W1QA 4CMAA 4D9IA 4DUPA 3PC8C 2FMHA 4OOEA 4KNWA 3OO1A 4TXMA 3RYIB 1M2HA 2Q0HA 3K73O 5BO5A 1GPWB 1CKEA 3LJKA 1K2WA 4H7JA 4M8SA 1E1CA 3GNQA 3R3WA 3LIPA 4P58A 1NY5A 1XZGA 3MJDA 4IRUB 4GC9A 2YXDA 5JMTA 2BR4A 5F1PA 1WBDA 4XCXA 3NVAA 1FDWA 3STTA 4RKEA 3EPHA 1XCMA 1QRAA 3LQQA 3RU3A 2CUNA 3L5KA 1UR5A 2WUWE 4XJTA 4NH4A 4RPIA 4A8JA 3IIIA 4GR9A 1NVDA 1W5FA 2GERA 1NAHA 1KBOA 1ZGAA 3IQDB 1MOZA 3EA0A 1KO8A 4GXNA 2BM8A 1YK1A 4U7GA 3CXRA 4QUHA 2YHAA 4YJHB 5G4KA 2Q6LA 4MEAA 4TMKA 2GA9A 3V33A 1Y4ZA 5AVXA 2Q07A 2GF9A 4M9UA 1EX6A 1JQLB 1OA1A 2WTAA 1JLLB 3PE3A 3VX3A 2VVTA 4R3WA 3ZHQA 1Q91A 4H3SA 1FTNA 4TTJA 4WT7A 4UUNA 1GKKA 1K27A 2EJCA 1BAPA 5DGIA 2BV3A 3UMYA 4HUQA 4GDMA 1CF4A 1Q17A 1M75A 4FW9A 4RPKA 5IC4A 5EYPB 1YZYA 2FW8A 3BDAA 4BJ3A 2FMKA 1ADJA 2PV7A 4UATA 3DHVA 2YYZA 4UEOA 3OOWA 2ZULA 3NV7A 4E13A 5CA0F 1REQA 5DNWA 3PRJA 3DVLA 1FSFA 1YH3A 4UZFA 4YV2A 4KACA 4YLEA 3K0HA 1FDVA 3NHMA 1WPRA 3FOZA 3W2GA 3GLHE 1XZMA 4UTNA 2SICE 2JLRA 1CPYA 5H9VA 2HSZA 3QKWA 5ECYA 1M2OB 3GPBA 4LXIA 3BKWA 3TLBA 4M8KA 3ESXA 3LY9A 2UUAB 4QGAA 5CAEA 1U0TA 1C1DB 3D4IA 4KPGA 1UKAA 4V1CA 1VKJA 1DC3A 1TJ3A 2AXPA 4MRMA 5E6UA 5U4QA 5JJIA 4DUGA 7ADHA 2Y1CA 2Q2OA 4G0WA 2YMLA 1QV6A 1DKOA 2RB4A 3FYSA 4TS3A 2CCGA 3M3PA 1HRDA 3V32A 1W44A 2GNAA 2AG6A 1E0SA 1ZD4A 2QSZA 2OK8A 1FFDA 2IGTA 3NOXA 4RPLA 4EGCB 4C6RA 3RK0A 2R8PA 2XF8A 3VHXA 1DQSA 1L4FA 3PC3A 3QKTA 4IXNA 4RQTA 3SF8A 3T06B 5IJ0B 2JLVA 4CLEA 2BF7A 2E1RA 4ZTUB 2MINB 2VYVD 2C57A 3R74A 3HKBB 1KEWA 4BN0A 5DHQA 4QE3A 4WEOA 4DCMA 4KO1S 3AVTA 4Z51A 2EL7A 1J5EB 3E61A 5FQOA 3UUFA 5FNZA 3U0BA 3TQSA 2AMVA 5AI8A 3ASYA 4YCJA 5AK5A 1E8DA 1DRJA 4C21A 1I10A 1DRVA 2R11A 1YIDA 3UK6A 4BJ5A 3D2LA 4UMEA 3UMFA 1LRLA 4JI1B 2EFGA 1QB7A 2PX0A 3KUCA 4QOHA 1Q15A 5IAEA 2JGLA 1IZ7A 5JYEA 5FTJA 1OHHD 2POQX 2WZDA 4NMLA 4PFSA 2NT4A 1XKXA 1VHTA 2P1ZA 3IHLA 3SXUA 5FHRA 5ICSA 1GTMA 2PT7A 4OSOA 4PO3X 3NVKI 1PJRA 2ZYIA 4F84A 1J1IA 5KX5A 5DNDA 2VAMA 2VSXA 4JSYA 3C7TA 2BMDA 5C7OO 2HSWA 1AURA 1EPUA 4RETA 3AB8A 5FX2A 1K3TA 2E89A 1O6GA 4WBXC 2QTLA 3NQ41 3HVHA 4G97A 5GQSA 3HYSA 4DVJA 3QEBZ 4D8TA 3NKLA 2CNBA 3FYUB 4QHYA 2XQIA 4C3ZA 2BSXA 3CNNA 3ZE9A 1KO7A 3CZPA 1CUUA 3LA8A 1WSBA 4KWCA 1PV4A 4UUPA 2ORVA 3HU1A 4R2IA 4IJWA 1F6DA 3EIUA 4TMFA 3ZW7A 1KP2A 1MIHA 5T57A 4QU9A 1D07A 3EPPA 3ZI0A 3JTEA 4P3OA 3QPAA 5FLYA 4P38A 2EF1A 1O96A 4BOYA 3PF9A 4BDSA 3X1DA 3QY0A 2WC1A 3MUOA 1F20A 5CM9C 5K9ZA 5KQLA 3PUJA 5EQFA 1SU6A 4GNRA 2WHEA 3DVAA 1GEGA 1T2CA 3CNBA 4IBOA 1YI1A 4P4UA 4RIHA 3THSA 2DTXA 2OCYC 1M66A 2QZSA 2R4UA 3QW4B 1XQ9A 2W37A 4LZAA 2F1IA 3BE5A 4IP0A 4R83A 4YNBA 5AESA 3HO1A 5ED4A 1NQXA 4X93A 3WBBA 3WISA 4ETNA 2J5RA 3WGZA 3RPEA 2QMZA 3TRKA 1SXPA 4JR1A 2A5LA 3GCZA 4HWKA 2WICA 2X9VA 2O23A 2OZVA 2XD4A 4I55F 1RHUA 4IVQA 5CLIA 1IBRA 1QHXA 1RBQA 5IT4A 4K0RA 3RYFA 1XRMA 5JCZA 3FGNA 1Q1BA 4B17A 1Q7EA 2GVZC 5BSMA 4BTVA 5JZSA 1E9CA 2FOLA 1E20A 3LT5A 2XT0A 4YGXB 4O4LB 1X6VA 3PUVA 1XTRA 4BO2A 5IWAB 3UPUA 1JQ3A 2GILA 1RJ9A 3S28A 3GH1A 4YVFA 3W8NA 2HBQA 2WPDA 2OK7A 2OHVA 3VZPA 2P1DA 2FFHA 3ZDRA 3ZV4A 2DGDA 1PDVA 2IYOA 2Q4BA 1ZNWA 4B09A 1U3FA 4RV5A 3UW1A 1XAGA 3AETB 1JZTA 1VHJA 3DLTA 3NONA 2G70A 4WCVA 2YXNA 4WZAA 1GHTA 2W5UA 1N92A 4YIHA 2JGKA 2BEJA 2JEOA 2VP5A 4M37A 4NHEA 4C2BA 1N6IA 3MCWA 1JWLA 3MCZA 2VUTA 4NEQA 2PZFA 4E4YA 1Y7PA 3UQZA 1GU7A 1QR2A 2VNKA 4MPDA 4P35A 3T1VA 3HE3A 4ZQEA 2GK6A 1JKMA 1KEVA 3GGSA 3WLTA 2XWSA 1Y6QA 5EL0A 2VSYA 3UAXA 2CHQA 4F06A 4PLWA 4BJHB 2EFJA 1F7UA 2GD0A 3PC6A 1SBYA 3AYXB 4OUDA 1J4AA 2H31A 1VGVA 4E3ZA 2R25B 4L9AA 3MOIA 4Q7EA 5E9QA 2W6JA 2WYUA 3Q8XB 2ZSAA 4O25A 1C8KA 1FJHA 3N0XA 4R51A 4BP1A 5IANA 4LF9B 3JQ7A 4ED9A 2RGYA 5EUBA 1OAOC 3GGDA 3N8GA 4JYMA 5K20A 4RTMA 3ZD6A 4TXJA 2Y67A 1I5EA 4MPRA 2I22A 5L6LB 2JI7A 2ISSD 3MILA 1Q0LA 5ALNA 5H7XA 2ZROA 1ICEA 3N9IA 2VHXA 4IMJB 4GFDA 1EFDN 4WFJA 4YTEA 3IGFA 2SKDA 2I80A 5F9FA 1WQ1R 2WJHA 4FYHA 4G0QA 3L1IA 1FLAA 4N47A 5ALEA 5CD9A 1DBRA 1A8SA 3DBOB 1JYFA 2OYRA 4JN6B 3SD7A 3R7SA 1K6XA 2V6FA 2EZUA 1ODTC 4FOOA 3OOSA 4JELA 4TV8F 1MX9A 4KYVA 5KYUB 3LDGA 2DFLA 4EECA 2Q99A 4IGAA 4Z7NB 1EDZA 1TLLA 2WV7A 3F5FA 5I48A 2IODA 1WMBA 1Y1SA 3BN3A 1EGMB 5ITVA 4ESVA 4MW7A 1H85A 3LFTA 2H65A 2XQFA 2XXBA 2CW5A 4AY5A 3LFHA 2OHHA 4RGVA 1YCGA 1RXCA 4UCQA 2Z1DA 4LVNA 1OC2A 1L3BA 1QMGA 1ZD3A 2IEDA 3BILA 2R86A 4IG9A 4P4SB 4AZ0A 5K51A 3ECSA 3USZA 2NZJA 4KRGA 1G6OA 3QNUA 3Q8WA 4IV0A 1ACLA 1DTEA 4PRZA 5AJHA 2B5VA 1FZQA 2Y6UA 1KJJA 4IIGA 4Z4EA 3OE1A 2QUHA 5ALLA 5DRYA 1T0UA 1T6XA 4JBXA 2VJNA 2Q45A 3PGA1 2WAOA 5AW6A 5FPYA 3WWDA 1UF9A 1WETA 4BVFA 1IQ0A 4H0FA 3AW8A 1YQXA 1IQRA 1UKVY 1LBIA 3A04A 3N58A 4LVOA 4M9ZA 4PAGA 1EX7A 2KWIA 3ZDFA 3GEGA 3JVUA 2A4MA 4G5FA 3G0OA 2IOYA 1YJQA 1IIBA 3DUWA 3G85A 3GT3A 2B7LA 3HYCA 3HUEA 5DB4A 4RYDA 5FWDA 5J2TB 4KAAA 4TKZA 3ESZA 5SZJA 1NNLA 4MDFA 5CM2Z 2DERA 2CLOB 2HCRA 3NDBB 3DWFA 5B2FA 4QUIA 5HHTA 2WD7A 1SELA 4DG8A 1M10A 2OE2A 2RHMA 3FPFA 1BKDR 1Q21A 2ZTSA 2CD9A 2GJSA 3C4QA 3U39A 4KNVA 1AE1A 3OT1B 4IS3A 4W5QA 3TINA 1WZUA 1NVFA 4FFBB 2HJRA 3P2MA 3UAYA 1WW8A 4YT5A 1O97C 1U6IA 2HXYA 3CMMA 5I8PA 2YQZA 5J4KA 1AH2A 3M9XA 3PT9A 5FBLB 3OPVA 3KK0A 2JC3A 4LJLA 1CJCA 1NFFA 4IDEA 5DM2A 3OWHA 2FSGA 2ZDHA 2ZWOA 3NU1A 1RWQA 2Q8NA 1Q1GA 4MAFA 1P18A 4WZ6A 5IUJC 3EYAA 3F96A 4X95A 3GLIA 1BEUB 3VSEA 4S1TA 1NXWA 1NJFA 5FV4A 5BUSA 5ALMA 1G8FA 1H9AA 5JS2A 5CDSA 3AEYA 3I8OA 2GK3A 2R84A 4L5CA 3T3IA 5KQRA 4KJZA 4RVCA 1WDWB 4CTMA 3HZZA 1U7XA 1TQHA 4CM3A 5JFTA 4D3SA 1T5OA 2YZ7A 3EGDB 6ABPA 4ZYWA 3NBFA 4AZ3A 4B4UA 2FQQA 5JWOA 4ZI2A 4L27A 1P2UA 3B51X 2B8WA 3GXBA 3R6WA 3QX7A 1YHYA 3PEEA 5DIFA 4ZT7A 4RORA 3VPAA 3IEVA 4KXYA 4U1RA 4UTXA 3H99A 1ID1A 1WUTA 2R751 5F3DA 1V5IA 3G0HA 4CF5A 1YVDA 4MQEA 1GV1A 5D6OA 2XXAA 2ZWVA 4JDUA 5ALXA 4CDGA 2R1ZA 4FE7A 3MJEA 3EVCA 3MGKA 1GV0A 4ASUD 3PC2A 1D6JA 2BMWA 1G5PA 1YRLA 3P9YA 4UDNA 2CBGA 5AM0A 1XPUA 1V5FA 1K86A 3MLAA 3SM9A 3WLRA 4CM9D 4EO4A 5FL7D 2NWQA 4EHAA 4TX1A 2ENUA 4XPZA 1U0SY 3W2HA 1W1UA 2V8OA 4KLRA 4XSGA 1KJQA 2X7XA 3AR9A 3GLHB 3KQWA 3T5PA 8AT1A 2HQOA 3ROGA 3BRWA 1YAJA 2EERA 2P0YA 2PXCA 2V6GA 1CB0A 3CBGA 4MR9A 1H2YA 5FLXA 3P0JA 1UKBA 1H0SA 3HABA 3HRKA 3PX3A 2AI3A 1I4DD 3JQAB 3I0ZA 1FNNA 3M4XA 4Z53A 1N75A 1JKJB 3I01M 4XWTA 3C45A 3T95A 2PSEA 4PFKA 3ZEAA 1KQNA 4JA0A 4BC0A 2FZCA 2JIBA 3ZK9A 4QLOA 3O5AA 4MV6A 2I2FA 5I47A 3E70C 3ZE6A 5P21A 3IEPA 5ADVA 1Z2OX 4G1CA 1MH1A 3EVZA 2VBIA 2K6GA 1DBSA 3G5UA 1VYHA 3E2IA 1KXJA 1Z37A 3Q2KA 2PZBA 5C8ZA 3PDIB 3MT0A 1BDMA 3K1TA 1T43A 3KJNA 3VR1A 2F7SA 4V3BA 1DJLA 4JLBA 1R6UA 2X23A 1T2UA 2WUDA 2Y3IA 2DHEA 3PICA 3QFFA 4HY3A 4CLHA 3KFLA 2JK1A 2RHTA 4RJJA 1UPBA 4TYQA 4MB0A 5HIJA 1JH8A 1COZA 3OQOA 2ZIUB 1N5IA 3DTVD 3OQVA 5B1HA 1ZQ1A 4CGYA 4J3NA 3PIIA 4RVOA 4JOCA 4YRCA 5AJVB 5JASA 4EAQA 2J45A 1AUOA 3DHNA 1Y48E 4Z0TA 2BYTA 1OWMA 3DHYA 2V9CA 3THWA 2QXYA 4DIFA 4NNJA 1C5KA 5GVRA 4E12A 4YJ2A 1O5TA 1YBVA 2GLXA 2IY9A 3SYKA 4H6XA 2NXEA 3GJQA 3VAYA 2ZM5A 2VCYA 3VQTA 2V5AA 1BX1A 3KSMA 1U99A 4LGCA 5BNWA 4ARZB 2GCOB 1RYYA 3I4CA 3NHAA 4NBNA 1KDYA 1X1CA 4KFTA 3RANA 3UN1A 2V7WA 3LTEA 2M6LA 1KU6A 1DAEA 1L4HA 3ZOZA 2O5RA 3JZAA 1A88A 2WMOB 2MJLA 1Y4UA 4KMMA 5DCUA 2IKQA 3AV3A 3D2BA 3WHKA 4ZVQA 4JOBA 4YP9A 1L5KA 4MLDA 2N75A 2B37A 2QV0A 2NXWA 2WG2A 2C2GA 3K31A 4WKOA 4DR6B 2RJNA 2AQHA 3O8OA 4O3MA 3E9CA 3KR9A 1YZGA 2FZLA 4YV0A 1FP7A 1TVEA 3QVUA 2W93A 3IUMA 4TT8A 4EW2A 4GKVA 4WKGA 4XJSA 2A67A 2BISA 3GA7A 4FQ5A 1MZVA 8LDHA 3TZKA 3ZQKA 1QG2A 3K1YA 3SU8A 4S12A 3TAUA 4E15A 1TW2A 2FR0A 2BEUA 3NTRA 1SXJD 1TLFA 3GZNB 1HX7A 1ZUWA 2JD0A 1PJLA 1Y89A 3BQMB 4CMEC 1T0PA 1Y8CA 1Z06A 3LLCA 1M5UA 4BNJA 1UJCA 4QYWA 4QLAA 1KBZA 2H1LA 2Q5FA 3BH0A 3MJVA 3G8YA 3TPFA 5DK4A 5J23A 5E0KB 4B3FX 1C30A 4FHCA 4I9FA 1GGEA 4YAKA 5AKJA 4MQLA 5A4FS 1LC0A 3WRYA 1N4DA 1IG0A 2AXQA 4INAA 2XKJE 2V7BA 3AESA 3DTTA 5A2GA 2A7XA 1FTSA 1KK1A 2H85A 2EJBA 2VAXA 4JUDX 4UAUA 2YINC 3HPRA 3OWOA 2DBVO 4M99A 2IEYA 4Q3AA 2GUWA 4MWZA 3ETNA 3ZWMA 5CA1A 1ZHOA 3V4PB 1NW6A 2EG9A 1UMBB 5ALGA 1AKUA 3TQFA 4WK4B 1X94A 3GCXA 3MCTA 1RQ7A 3TIGA 1W5SA 4FMCB 3MWEB 1N2CE 1FNMA 2HO5A 5H9WA 4JLNA 2BN4A 1AXGA 3DOOA 1TZ2A 2OHIA 1M3SA 3L43A 3QVWA 4QWWA 3ZXUB 3IKJA 4LQ4A 4DMUB 4D0SA 2CLMB 1AZSC 2D2EA 2XUQA 4JEUA 4TUYF 3QVKA 2Z9DA 3B12A 4R3NA 1HT3A 4DR5B 3VR6D 4XAQA 4M0DA 4HL6A 2R1UA 1W85A 3DBRA 2RGGA 4C08A 2JFXA 3IP7A 3PGVA 3WLOA 4C0HA 1WX1A 2VT6A 3L3BA 1V11B 1VQ1A 1PWYE 3KKEA 1RXVA 2X86A 4X62B 4CL3A 4H35A 2CB0A 1GUAA 2CUTA 3FH0A 1QFXA 3BUSA 3I8SA 3RD5A 2Q29A 1PJZA 2GVNA 3I1JA 4N18A 3RVMA 3DZFA 4U2BA 2GBFA 4NYMQ 5DI3B 2C1ZA 4HX2A 2C61A 1N2HA 3L7OA 1ZK4A 1J1ZA 2D1TA 3PEVA 2WKRA 3B20A 3WFIA 4W4TA 1EVQA 1NF8A 4BN5A 1GQYA 4L8WB 4ID9A 2WQ6A 3Q7EA 4YB8A 3VR2A 4J8PA 5IJXA 4D26A 1UH5A 3M83A 2RG7A 1DXOA 1Z17A 2DPMA 3C48A 2EKQA 4DZRA 1P1FA 3WMWA 1OC4A 4M6WB 4OB8A 4D0RA 4ENSA 3U4QB 4S05A 2E18A 2NTJA 3I1YA 2PUGA 3A3NA 4F1KA 5JLJA 1DFIA 1NOKA 1XRRA 3M1AA 4JBLA 3WGNA 4R41A 4C76A 3BWYA 3B3FA 4S2EA 1B3BA 2HWKA 1W4RA 4KODA 4CEIB 4I4TB 1SIUA 1XCBA 3M89A 2Q1UA 4AMYA 1OLSB 2YIMA 4N3BA 3K2BA 3M5WA 4EA9A 1SQGA 3MLEA 3PPWA 4KMSA 1K5GA 1KTIA 4AUMA 2GKSA 3EZFA 3SHOA 5IYZA 1VI6A 2PLWA 2XLCA 4FOTA 5EWMA 5C53B 3NOOA 1HYQA 3F74A 4RVGA 1K8RA 2EVWX 1GT91 2FDXA 1EVZA 3SC4A 2J9XB 2VP9A 5EE9A 3BMXA 3DD5A 2MR6A 4TYNA 2W6ZA 1KZGB 4G37A 4RQUA 3ESBA 5FWXA 5B1SA 3ICEA 4OFBA 1UZUA 3C3BA 5AKEA 2FSFA 3AIKA 2QRPA 2XWJI 4AKTA 2HX1A 1EB8A 4HR7A 4D9JA 1Q83A 5B55A 1HEIA 1UPCA 3AMVA 5FYQA 1FFSA 5KTOA 4Q6WA 1RYHA 3BD7A 3C8HA 3HR7A 4IDCA 4CLOB 4DLBA 1VBFA 1L5GB 3DH0A 3U09A 2RGCA 1KC1A 2DBZA 4BLPA 3I2IA 4PWZA 1X7YB 3E7PA 1HZZC 1OQAA 2FF5A 3IQIX 1D0VA 4G1UC 4OHRA 4MK4A 5AI0A 1EB9A 2PUDA 4YJ3B 3RSSA 4JHXA 3ZTTA 3X43A 4CM7A 1TM5E 1EP2B 2V65A 5B2EA 3C0KA 1N1MA 1YS6A 2BJVA 2XMSA 4KQFA 4MVYA 4PIPA 4RVFA 1DB3A 2ZSHA 2ZWPA 1W19A 4DIEA 4Y9DA 1G20E 1G16A 3IEIA 1DC4A 4GUAA 5DTEA 3IMKA 3GRPA 3INNA 5KOJA 1I7SB 1U1EA 1ZBDA 5KIAA 5KJFA 3IIKA 2DTDA 4M38A 1MAWA 1YT5A 3EXIB 4YACA 3C5CA 2C78A 1XJCA 3EW7A 2O8EA 4U3JA 4OY3A 1E2JA 4PR0A 4GPEA 5JDCC 4JIGA 2GHTA 5CB6A 1NP3A 3BVPA 2FG6C 5DLDA 1GDDA 1O8CA 4CXMA 2PUTA 1SBCA 2W6OA 3LZDA 2F43B 1M1YA 2QNRA 3H13A 3FRHA 5BN3A 1SCIA 1TAQA 4UJ5A 2DECA 2EDAA 3E22B 1S01A 1T6ZA 4XVHA 2ONJA 5J2UB 4ILKA 5EI5A 3TXAA 2FWPA 2FQ1A 2J3EA 3FDZB 3ED5A 1OF1A 2QG9A 1DCMA 2GKOA 3CW9A 4IS2A 5HQJA 4EHHA 2IDKA 4G5RA 1CZLA 2JFYA 1QPGA 3K5PA 1YB6A 3HUTA 4JKYA 4A2QA 1EZZA 1OA0A 3H04A 2VJOA 3I37X 3U7FB 1QDLB 3VH1A 1ECGA 2P5TB 1JECA 3R0QA 1Z0AA 4BLOA 4U7PB 4B47A 4CM8A 1OIWA 3HCRA 4EX6A 1UEIA 5GONF 1Z9BA 1U94A 4HAZA 4Z9FA 3EG9B 2QUBA 2IDMA 4EEKA 1C3JA 1K0UA 2CMFA 2HWXA 4PYQA 1A4XA 4PGFA 2F55A 4GEKA 4B43A 3I62A 4D25A 1W2GA 1BXRA 4PXYA 4KRFA 3SKXA 1B8PA 1W73A 2HADA 3E3OA 3JQFA 4N3CA 4PU0A 1IB6A 4V0OA 3AF4A 2PT6A 2LIVA 3N75A 2CNNA 1ZN9A 2YW2A 3I2FA 5HP4A 4ZK6A 3E81A 2YZKA 2RHHA 2WF6A 4L1KA 1ECJA 3RC9A 3TIVA 3ZHUA 4IKEA 4FFDA 2CFOA 3EW9A 3SJBA 1XX6A 3O8LA 2V7QD 2DVMA 3ABRB 3FI9A 3A3PA 5CLHA 5BR8B 3PYXA 1RYMA 2FG7C 1U0LA 2OBNA 1T5BA 4PLFA 3D8BA 1UWCA 4PNZA 4QHSA 2VHVA 3N2KA 1WY5A 4ZVVA 5JDIA 3R0IA 2PL3A 1GPYA 4UNRA 3S81A 1KYYA 3JQEA 4PHHA 1KEZA 1Z8DA 4WD3A 3M3DA 1OZFA 3MAAC 4AUKA 1FA9A 4ZRNA 4DS3A 1H9CA 4DV3B 2RGWA 4F4HA 2DXIA 2GWRA 3B5IA 4LDNA 2APJA 2ZUTA 4ER0A 1K63A 4KQEA 2XBUA 1SCNE 3I4FA 2AH5A 3HKDB 2GAFA 2FH5B 2NNLD 3H11B 3KPVA 3OLCX 4Q1VA 1FJXA 3DBLA 1E7WA 1V2GA 1MBZA 3IJEB 3PFBA 4DANA 4TQGA 5IW8A 1QVWA 3GRFA 2O3JA 2FDCA 4R1OA 1IN6A 2YBDA 3TB4A 4HI0E 1E63A 2OG2A 1Y3BE 1IEXA 1FXWF 4IYJA 1JSXA 4ZU1X 4M3NA 1IDN1 1UBLS 4MUBA 3CNEA 4PRKA 2SKCA 2I2AA 4FKMA 4IFEA 5E95A 4A1OA 4B31A 3FNFA 2YV3A 4RK7A 5JCXA 3SVTA 3AUUA 4N0PA 2PR2A 4I08A 4IQ4A 3KAQA 4NENB 4AYXA 1PR5A 3IVCA 1YVPA 5IJWA 1Z07A 4FBLA 1C50A 2DY0A 3B8EA 4QYIA 2QVLA 4EKYA 5JADA 3HDQA 3G7NA 1G9XA 3IXMA 3RYHB 4L28A 1ZNYA 2TMDA 1ZCZA 3P5SA 1HMYA 1GTSA 3K0KA 4CKCB 4X9XA 4K6KA 3RYCA 2VPQA 4MJLA 3WL6A 5IKMA 2AFIE 3KQYA 4M0FA 2OAQ1 3IUPA 1OE0A 4HH0A 1A8PA 2E48A 2YV1A 4OV6B 5IAAA 2CD7A 3OZAA 3LVRE 1EWYA 1ZSVA 2P9GA 2VDWA 3VSDA 4WIAA 1XR3A 1KZ4A 4ZCPA 3T7EA 4CQMA 1B1CA 1ORDA 3GP3A 4JL5A 4NTZA 5KOHB 2Q2WA 1VIAA 2B36A 4F12A 5EJIA 1F8UA 3M4JA 1BS1A 1DTWB 2DQ4A 4JJ8A 3FVRA 4MEJA 3U7QB 1K68A 1EE2A 1E0DA 1CS0A 1GYRA 2F9FA 2I6SA 4RL6A 4EUFA 2UZ4A 3ESRA 5IMBA 3KT6A 4DJFC 4K9SA 5FIUA 3SGLA 1E1NA 2X8WA 4IL5A 3V8PA 2H1RA 2WJIA 3WGUA 3C97A 5A5EA 1ECCA 4HPXB 2ZKIA 1BFUA 1EFVB 1FFAA 1RLJA 2YQ4A 2YXEA 3BTVA 4MO9A 4MVJH 4GLBA 1BCSB 4O02B 4RLQA 1U98A 3CEJA 3SEFA 3HK2A 4ZHQB 4AQYB 4ITVA 4OQQA 3C4JA 4Z49A 1F0NA 1WSAA 3L4EA 3FMGA 4H7EA 4XX0B 1MR3F 3L4BA 3RTDA 4MQ5A 3OLXA 1KARA 4QTUB 1M73E 5ICCA 3R4CA 3Q98A 2QRLA 4JKIA 5EUCA 2ZRGA 5KDLA 4BFTA 3NRJA 4E5KA 2ZK7A 1WU8A 1JIIA 4XWYA 3TNYA 3QH4A 4LOKA 3H42B 4P5DA 1A9RA 2PWYA 1R10A 1SKYE 1WHSB 2O0MA 4QC2A 2JCSA 4K6GA 1ATZA 2FE4A 2JZCA 4MOWA 1Y8RA 4MSUA 4TMXA 4B0OA 3RFTA 3S6JA 4B75A 5G2OA 4GOXA 4HDSB 3AUKA 3PR1A 5JY6A 2IBTA 1Y3IA 3AWDA 4YRNA 2OOSA 1W4LA 1TMOA 4CV3A 1WNFA 2NM0A 4M8LA 1KZ7B 1N0HA 4OAOA 1T8YA 3EJWA 2GSWA 1AN9A 3U7HB 5K3OA 4ENRA 4KVGA 1A3CA 1VMKA 2MOKA 2OZPA 4YRFA 3URMA 5FWYA 4L57A 1PV1A 3W9UA 3TLZA 4RTOA 1C7QA 2XCRB 2BKAA 4CCYA 3NWJA 1IVNA 2VBCA 2XKKA 4GRAA 1N2CB 1AV7A 2F90A 4BMZA 1WMFA 4H18A 5CW1A 3FPJA 3ND9A 4AT1A 2QN7A 4BKPA 621PA 2X8JB 2NPFA 1M2KA 1G8JA 1EJ6A 1B15A 3KJFA 2I6XA 3JASB 2C9OA 4QTXA 3T52A 1N5KA 3ET4A 3JXEA 2Q1WA 5H81A 5BSGA 1HYGA 1QQBA 4UBOA 2OENG 3NFYA 3Q41A 3VH3A 5AT1A 2R5FA 2GN8A 4RDCA 4GL2A 2IEAA 1DIBA 1CBUA 5DX8A 1TPZA 3C15C 4CHTA 5C7LO 2IHJA 2WZQA 4RSRA 4DV4B 1IVSA 3TQQA 2H7CA 1UDWA 2PT9A 3KDPA 4P22A 5A4DA 2CNOA 4LYDA 1OOEA 1UC4B 3CG4A 6LDHA 2R1TA 2RHWA 4CKWA 4CEJB 1CNEA 3CLSD 5JCJA 4Q3LA 1II8A 1UOEA 3DONA 3RADC 1JEQA 4E7OA 2RH9B 3IMGA 5AW8A 2NMVA 3HCWA 1R0RE 2CXHA 5TDHA 3GWGA 2ZSEA 4H27A 4EW6A 2R8RA 1Z15A 5EXSA 3TZBA 4PQEA 1KETA 4PO8A 3P9IA 3OIUA 4AQ7A 2EIXA 4BQNA 5THKA 4GU5A 3TOSA 2WINI 4L5BA 4ZEWA 4D0NA 1E1LA 2CJWB 5FNVF 5IVKA 2C0PA 2JANA 1L5HA 2C2BA 3FMFA 1W88A 5GGXA 3UT0A 4H0CA 4LDJA 3PGMA 3FTNA 4FT2A 5LU8A 1E1RA 2P8JA 2VI5A 3W9BA 3EEOA 1XDBA 4JSRA 1WU7A 2CJFA 4NH0A 1FVFA 2DQSA 3G6KA 4E51A 4IG4A 1IH8A 2H2DA 1ZMXA 1S8AA 2WYOA 1Z39A 1EHCA 4H6PA 1O6BA 1JQEA 3ENZA 3LLMA 4OJMX 3FZYA 2NUTB 3IP6A 2I55A 1NLZA 4PO9A 1K66A 4LCJA 1SH7A 1RHMA 2H4HA 2IVFA 3PFGA 1MC4A 3FTPA 5JHHB 3KQUA 4CNBA 1KI6B 8GPBA 2AFVA 1S3GA 3AEKA 3Q7RA 2VAWA 3LF2A 1XB2A 2H4JA 4OHBA 4Q3BA 3HR8A 1UT6A 3C5VA 3JWEA 3B89A 1NMQA 1N2XA 1VA4A 3CY6A 4Q9IA 4RS3A 1QIMA 5DULA 1QK3A 3REQB 4A0GA 3E6AA 3AG6A 2YWGA 1F48A 2I1LA 5HOEA 2C0CA 2ZE5A 4Q48A 4NMMA 1JFFA 4TVSA 3SR0A 4N0QA 1Q3TA 4KQ2A 2B25A 3OM8A 2VT3A 2YUIA 3PNLA 1JG2A 2PZAA 1IRIA 4FDVA 5EJAA 1ULHA 4DAOA 3G9XA 3NDJA 1OYVA 4P80A 1GVNB 4QOSA 3RAFC 3G5TA 5I51A 1GY8A 1R3UA 1I7NA 3R8CA 3CBQA 3W9YA 1EEXB 4C4OA 5JECA 1NPYA 1R8SA 3P1JA 3R0JA 3AZQA 3HLKA 3AI7A 1XYGA 2XDAA 4P9NA 4RPJA 4IJMA 4BKQA 2XBMA 3TJMA 1FFXA 2GZDA 1I51A 2OC4A 2NU7B 2NW6A 2PZJA 3FZGA 4U63A 1DKRA 2GEUA 3HLYA 2XE8A 2D8MA 4PTLA 2LV8A 4TSFA 5G3YA 5F2EA 1SY7A 4ER3A 1OT5A 4LHSA 1N78A 1YUMA 4C7MA 3ZIAA 1DVRA 3JR7A 2QN8A 2DAPA 2WTMA 5DFAA 3W78A 2XNDD 1UDCA 3Q5EA 5HRAA 2ACKA 3Q6MA 1IIRA 3UG7A 4BB0A 1G59A 2PKEA 3AGQA 4PPFA 1YHNA 2AWOA 3DTVB 1DTSA 4Q21A 4BIIA 3BSWA 2G4LA 2AOVA 5EJFA 3ZWOA 5ILOA 3ZZ0A 3M34A 3NB0A 1T0HB 1TTPB 1U3TA 1GQQA 2VT2A 2RG1A 1GPBA 3PIDA 1T9ZA 2VJAA 5BN5A 4B4OA 1GILA 4H3KB 4GIBA 1SA0A 1KORA 3G0GA 4O2AA 4R01A 1Y5NA 3FDFA 3RT9A 4BBPA 4E2WA 4EPXA 1DDIA 2FPOA 3IP9A 2D00A 5E4JA 2H4XA 2OFXA 3FRJA 4ALJA 5M3BA 1YJ8A 4NOMA 2R5NA 1J0EA 1WR8A 3SQOA 3C5WP 4F56A 2NP6A 1QGZA 4X1IB 4BWGA 3MTIA 5AJXA 3HCPA 4NZZA 4PSVA 2VNSA 3KJHA 4H3HB 4CEHB 5KYWA 1E3MA 2JLXA 4DRXB 1L8OA 5BOSB 3QOXA 3NOVA 3Q11A 1SZCA 2I3AA 2QLJA 2BW0A 1CUVA 1UPAA 4ZQCB 3H2KA 4FGKA 4HO1X 1SRQA 3ER6A 4AIRA 3MJFA 5E1MA 3T4XA 3L05A 2QTNA 1EQUA 1Q6ZA 5IVIA 1T5SA 2HQRA 2ZZMA 3AVXA 1Z2NX 4G4GA 3OLQA 3T7SA 2HDNB 2A78A 1E2DA 1HE8B 1M7HA 1OLOA 4Q15A 1E2LA 3U4MA 4K9DA 1X19A 2YJTD 4DDHA 1HZJA 1SXJB 3OOYA 2BFMA 2ZBFA 1OGJA 2ONZA 4M98A 5F1OA 5DNCA 4HNTA 4JV5B 2C1XA 2WT8A 3ISVA 4ZO9A 3FTFA 1SOUA 3CLKA 3U6KA 2ZXFA 4KU4A 5B3JA 4B8ZA 4MTLA 4FC7A 2DWCA 5L4NA 1E1QA 2XA9A 521PA 3UPDA 3WAGA 3R7AA 3X1WA 4CU5A 3OZBA 3AHCA 3IXQA 4FLEA 5KNBA 5DPMA 4B2LA 5KWSA 2HRRA 3AL0C 3C74A 1QK4A 1L4YA 2JAPA 3TRDA 1R6TA 4A6EA 4ND1A 1S3FA 2LNDA 2AOWA 2PGIA 4QDJA 4ARBA 3TXXA 4YCMA 1QO7A 3D0QA 3T34A 1U2GC 1TU0A 2AR9A 2DUWA 4JP8A 2G5GX 3QOWA 2HFKA 3E7WA 1V5WA 3KOUA 4UVIA 4IIVA 3RRBA 2VF7A 4B46A 5ALOA 1KHTA 2W2LD 3GGCA 4CIYA 1U7DA 1Y33E 2GO1A 1VIVA 2D7CA 2PWZA 2YFHA 3CW2A 2A86A 3I9JA 4NMWA 4TPKA 1QH1A 3L6RA 1P44A 3SSNA 4QULA 3OLZA 1NRXA 1EDBA 5FL3A 4IDDA 2YVUA 1VPTA 3FF4A 2Z8ZA 2XYHA 3AVOA 3QMVA 4Y0NA 1Y3CE 4KQ1A 3F5DA 1ORVA 2P78A 2B1GA 3C87A 3KSDO 3RHTA 3KVYA 5LR6A 3DQPA 1N9KA 2QDXA 4HDQB 4PPGA 4X24A 2PU7A 4FU0A 3EEBA 2R7MA 4JQOA 3RHFA 4NCIA 1TB4A 4MDHA 6NULA 3VR5D 2BIFA 2ZETA 5C31A 2PSDA 2YRXA 1XNQB 1ZU4A 2IH4A 2C8JA 1QXSA 4IHJF 2HRQA 4O4IF 1QC5A 2BUCA 4JGIA 1CEXA 1CE8A 4DMRA 2I03A 3A6KA 5C1OA 3WGKA 4L72A 5CNJA 2HRDA 3B13B 3KZXA 3UJBA 1XCOA 4ZOLF 1JXAA 3N0TA 3BK1A 5JNVA 4BJ6A 1G98A 2P9TA 4D4MA 3KEFA 4AZVA 3IEUA 4FUQA 1Q7TA 4BO5A 4G0VA 1MABB 3EOZA 3KYDA 1ZH8A 3L0SA 3I5YA 2JBAA 4MVCA 1YZVA 2QORA 3PNBA 4KQKA 4TTTS 1SXHA 5F78A 1MW8X 3B1VA 4R71A 3R0XA 2ZU0C 3GNLA 4D8XA 1G3UA 5ARDA 2PAFA 3N6XA 4EUSA 5DW0A 3W5CA 3KNZA 2OPHA 1PJ8A 3TOCA 2D0PB 1USVA 1V25A 3D3EA 3SQXA 2JGEA 3DDCA 3DXZA 1KYQA 4MITA 2A1UB 1UANA 4G89A 1I0LA 1VHDA 1QQ7A 1JAHA 4LHWA 4NYJR 2UZ0A 4LTDA 2X4LA 4PHCA 3ROTA 1J06A 4QEDA 4TRRA 3GPIA 1UC5B 1VL5A 1Z8HA 2G1JA 4D5GA 4IJ6A 4HG2A 3EXHB 3PRHA 4K40A 4AJKA 2RK4A 3L07A 3DFIA 3T9BA 1QFSA 4QO7A 4XW2A 5FFNA 1H2XA 4G8DA 3LVQE 3GBVA 4MV5A 4YXWA 1T24A 4GXRA 1T9DA 3EQZA 4Q3OA 3MC1A 2BZGA 4D98A 2CXRA 2GPWA 5K2OA 1M7BA 3LW8A 2WP0A 4P3YA 1SKYB 3PTAA 3PL5A 5ANRB 3JZIA 4EELA 4KN6A 5LZ2A 3FAZA 4U39A 3AZPA 3JYQA 1HH4A 3ZWDA 1QONA 1ODSA 2XQKA 3BWVA 4WXMA 1W581 2PZKA 3U4DA 2X5OA 1MJFA 1EFPA 3TZEA 1NURA 1OXVA 4BNVA 4WDRA 3JRWA 3UANA 4NP6A 3VNBA 2FN3A 2MSWA 1WRBA 5AOBA 3HDJA 4MKZA 5K3FB 3UJ6A 1GM5A 3MINA 3NUZA 1JPNA 4C0WA 4XR4A 1MJHA 4MGEA 3T1YB 3ZDCA 2A9PA 4MYTA 2BEKA 5LQUA 1Z6GA 2NO5A 2A3RA 4XWOA 1KZ1A 1L7XA 1W48A 1J0CA 4LZWA 1XELA 3H2YA 4QXOA 4BQSA 2PKQO 1F0PA 5F76A 3DB2A 3V1KA 4CM6A 5JH7F 2FMUA 2V6BA 5CVCA 5C1DA 2Q4OA 1K7SN 3IVAA 3S2FA 4NDNE 5KMGA 1NBHA 1TYZA 2ZB8A 4QUAA 1NSFA 1E98A 2OG1A 3L7LA 4IRMA 5J4VA 4BHTA 5F4ZA 1HTTA 2AK2A 3KWJA 2C5GA 1DG9A 1X7WA 4OJNA 4OLJA 4G1VA 4A6DA 2IDJA 2WTBA 3IKMB 5B58C 3G49A 4WESB 1BVRA 1LNSA 1UCFA 3T54A 4EMTA 5B6IA 2JH9A 1YO6A 2NUAB 1N36B 3EVBA 5EXEA 1H1LA 2R00C 3PB3A 1PW5A 3DFFA 5AOVA 2XHEA 1DV2A 3V8RA 3TW6A 3JALB 3K72B 1EZ4A 3EMVA 3A0RB 4PV7A 3KJQA 2QLFA 5CDFE 1Q1NA 2RHDA 3DEAA 2ET6A 2ECKA 3NHYA 5LJLA 1GR0A 4J0CA 1Q6YA 3R9KA 3QBJA 3N28A 1SC9A 3RT7A 1UMCB 4BVLA 3SDBA 2J0QA 1U3WA 2X76A 4Y6OA 2QRVB 3A1WA 2J85A 4UU8A 3JRNA 4H6WA 3R8FA 1BKYA 4RV4A 5KVQA 3UCFA 4CQJA 2BFFB 4BASA 1JDVA 2R87A 1S3SA 4FYWA 2J67A 2REXB 4HTFA 2EWVA 3FSGA 4M0PA 3PE6A 4LZZA 4OBEA 4QDZA 5CPBA 3U4AA 4OMDA 4Q4CA 2OY0A 1UBTS 1FUKA 5FHQA 4HLUA 2J5XA 3TLGB 1PS0A 4IR7A 1SD5A 4DEYA 4B6QA 5FUYA 2VDRB 2GNOA 3EVAA 3DCYA 1Y4DE 1H0HA 1P9OA 1T2FA 3EXG1 4JJIA 2FSSA 1N5MA 2VDNB 3L82B 3K1AB 3ICQB 1TEXA 1IHOA 1OLUB 4AX8A 2VJPA 4MO2A 4XM2A 4E46A 3UWPA 2B82A 3IOBA 1JDNA 4KCGA 1T9BA 1DQYA 2I29A 3ASZA 3CXUA 5GZ1A 3WZMA 3AYZB 4XRGA 4QQ8A 3GT0A 1I0ZA 4F9FA 3EEFA 4DA7A 5JNWA 1MC1A 4HAOA 4Z4FA 2O2SA 5DGDA 2OV1A 3QUBA 4NZMA 2WSIA 2EV9A 2QRNA 3OSZA 3UHJA 3DWGA 4EFKA 1ZI9A 2ODNA 3CVJA 4LJYA 2LCIA 1QK5A 3G2NA 4NVRA 4R9RA 3EZXA 5JWHA 1ZLYA 5JE8A 4E22A 1QNFA 4LCEA 1MVOA 2C4VA 2EP8A 3MUFA 2BHRA 4TTQA 1PV2A 5HIIA 1LX7A 5H59A 2RH4A 3ASUA 3CZRA 2FXIA 2BP7B 3EXFB 4MUMA 5JXWA 4UUMA 2JIZA 3C3KA 4GKKB 5HTKA 2H59A 3N86A 3IAEA 4X41A 4QGBA 1G8YA 3KT8A 1DDOA 3WXMA 1OI7A 3U3MA 1DMSA 3CH5A 4FFVA 4QGHA 3M8KA 5COQA 1IMJA 1YR6A 1XL1A 3I0MA 3WNQA 4B6SA 5ER9A 3MRXA 4XYLA 3BMCB 3T5DA 1Z83A 1QLWA 1YI0A 2YOFA 2E6KA 2BFNA 1E79A 5BP7A 5AW4A 5DEOA 1U31A 3QY9A 2GRAA 5L40A 5L3ZA 1OB2A 1CS4C 5IPFA 4ETIA 1CUBA 4P7FA 4NC9A 1SPBS 3VO9A 2GNPA 2XVZA 2VZ8A 4TLLB 4UMFA 2HCBA 5CM8B 3DMGA 5EZYB 4Z3OA 2BKUA 1P1HA 4XZ3A 4X1KA 3WRVA 1KEKA 1P8AA 3FYCA 3O0TA 4NRDA 3P0FA 3MTGA 3WWEA 1HDOA 1S2OA 2QX9A 5KKCA 3PEFA 2AE2A 1AM4D 3PLNA 3ZE0B 1PSWA 1ACMA 1G5RA 1T9HA 2W6QA 3IUQA 3JQ8A 3SZRA 4ARSA 5KTRA 2BR5A 3UC5A 1IC6A 5D87A 3DM9B 1ZC3A 4YMVA 5K3EA 1PUJA 1I4OA 2UV8A 3FHLA 1SU8A 2PSSA 4QD3A 5KEIA 1L7EA 3DZJA 1TTTA 1LPMA 5TS2A 4ZZ3A 2AA3A 1LVHA 1QBGA 4LSMA 4M1YA 5DX0A 3P9RA 3I9V1 4XUCA 2IHVA 2ZUDA 1A72A 1DC5A 1LXCA 4X92A 2XIJA 3COZA 5JRZA 4Y2QA 1JDBB 1PJ3A 4J91A 5KYKA 1U9ZA 1B0ZA 2VH5R 2V7GA 3OPQA 3OQPA 3P2IA 1A4UA 3TBKA 3N8HA 2C7OA 4IZOA 2B83A 2QTBA 2WKSA 2XYQA 2GYUA 1EBUA 1L7BA 3IOCA 3RQIA 4N01A 1XMSA 4MR7A 1ISHA 3AJRA 4CQLA 5C35A 1E0KA 3ISJA 1KQOA 4MRAA 1YWGO 1UAAA 2A14A 3KQSA 5ARCA 1XVTA 5AIAA 4P32A 3SI7A 3VVMA 4BZZA 3KQMA 2VLIA 4P7JA 2QS9A 2UYGA 4XRRA 2GF0A 3SZGA 3TQCA 5NULA 2ZWIA 4RCZA 2VIIA 3V48A 5K7SA 2QD5A 4RM3A 821PA 3V8MA 4ND7A 5AOAA 3D02A 1GFWA 1GTZA 1JYSA 1IPEA 3LDHA 1G5FA 1G8MA 2QQ0A 1DNPA 3N8KA 3O8QA 1BX3A 4QRDA 1N6PA 2AD5A 2CNDA 3I45A 3A9WA 4LMBA 4K1XA 1PQPA 1HORA 4PBSA 2ZAIA 4WZBA 4CFYA 4PSDA 4MV4A 2ID7A 1FC0A 1KSHA 2YQ5A 1GYPA 4MIEA 4TVOA 5G0UA 3FHJA 3Q3JB 1VBKA 2XUZA 3GY0A 5KVVA 1PFKA 4I1YA 4NE9A 4ZYZA 3DOIA 4IQ8A 1A8QA 2YL2A 5IAOA 1B74A 2Q1XA 7REQA 2X2OA 1JH9A 1Y1RA 2C58A 2PBRA 1QTNA 4B82A 4B84A 1XNGA 1YDHA 4I3HA 2GZ3A 2XUAA 4KN5A 1DT5A 4UVHA 5JDIC 1CJSA 1YQ9A 2AK3A 2NZYA 3ANNA 5EJ4A 2X40A 2F1RA 3NH9A 4Z0HO 2VYFA 4CMHA 5D5PA 3ND8A 5DBFA 1SVIA 2X3FA 3WGMA 3PQ7A 4UAJA 1MVNA 3L7BA 1VSQA 3LW7A 3DL0A 5A0VA 2RGXA 1YC2A 3FNRA 3H1GA 1RZRD 2WHPA 3JW8A 2IPOA 4UM8B 5KHAA 3PQEA 2WNIA 3T1NA 3K0FB 3NXSA 3P27A 2DLNA 3QTLA 1ESNA 1PP4A 1JHOA 1DX4A 2NNWB 3H18A 1GQRA 3IAHA 2V54A 3H6GA 1XMJA 1Z47A 4S1WA 5FJIA 4E09A 1QIGA 3LY7A 4HQ0A 1H2AS 3UGKA 1CY4A 4GBGA 3FA2A 2XMBA 2ATVA 4D5EA 2P11A 4LN1A 1H5QA 3HWWA 2RK3A 4RKRA 3GMIA 1AA9A 2AC4A 1L9XA 3KZNA 4MZDA 2VOEA 3T0GA 3VKVA 4MKFA 1IWBB 1H5UA 1PFUA 3S55A 3NT5A 2A59A 6AT1A 2OD9A 5BRAA 2X0FA 3GRAA 1SBIA 1FE8A 4MGYR 3RBZA 5A7HA 1VL0A 4HZGA 2WFMA 4IIYA 5F21A 2PLNA 2DB3A 2R79A 2CDRA 1ORIA 3A9RA 2BFEA 3NHKA 4LSWA 5TJHA 1O87A 2IE0A 4ZQIA 2J7PD 4ER6A 5T67A 1JJAA 1EJBA 4BNFA 1CEYA 4DV2B 3PFFA 1AXRA 3HDHA 2BGNA 1GG8A 3G0DA 1PFGA 4HNSA 1XRPA 1BA3A 1J2TA 3KOZA 4MIOA 4BWVA 1GRRA 1V4VA 3JQPA 4F6RB 4JI0B 1NIJA 1X9HA 2XQGA 3CZMA 2X8AA 5GPBA 2WJ4A 4D3DA 3G9QA 1OIVA 3LC1O 5H1YA 6REQA 5LMUB 2DJ5A 2V8BA 1DXQA 5BORA 2R68A 5D01A 2IGBA 4ZT2A 1TUBB 2I6QA 3KQTA 4NJEA 2PKWA 2WFLA 4IICA 4IOKA 2C59A 1XD2B 5TMBA 4IXDA 1WSDA 2UDPA 4PIVA 1G4HA 2VRCA 2FP4A 3EGVA 4QPZA 3W1VA 3FVQA 3Q3HA 1RMQA 2WMDA 1ZH0A 1RR6A 2GKGA 1JHZA 2QZJA 2XTMA 3B7WA 3GARA 3JAKB 2FWRA 3HN6A 3QEJA 4O59O 4R1NA 4TYMA 5DMXA 3RVOA 4YRZA 4RS4A 5TNXA 1JHUA 3HBMA 1ZG3A 2JIQA 3BMQA 3NI2A 5FUWA 3HVRA 1SG6A 1TQ8A 2XKAA 3T0FA 1DCFA 3TXYA 3S2IA 2A8YA 2H1FA 1NI4A 3L4BC 5A5FA 2HHLA 5LYJF 1A4RA 1D5WA 3EY9A 3GDOA 4N54A 4XB2A 2QVYX 2VTBA 4D4KA 1B6RA 4R7GA 1NUAA 3BQ9A 4G63A 3PHHA 3L02A 4O2BA 2XNHA 3NHWA 1N3IA 3LBNA 4MPJA 1RM0A 3MQ4A 2V98A 1XFAA 4KIFA 3S27A 1VXOA 4FNMA 4R8MA 1HLPA 3G1WA 1X7ZB 3OUUA 4F96A 5C0OE 4NBRA 4KDEA 4NFHA 1PZFA 5ULLA 4ZOQI 1UDAA 1TIKA 2QQFA 2G04A 2WYWA 3CHYA 2WWTA 1CY2A 1NP7A 2IW3A 4OKSA 1UK6A 4UUOA 1KFEB 3AR7A 3CPEA 4R2KA 4WRRA 3WE7A 2HK6A 3LBHA 2OHJA 3QENA 2PIAA 1VJGA 3ILVA 1CERA 1GNTA 1NVVR 2VK4A 1Y4AE 2X5KO 1ZWLA 4PZAA 2AOTB 1DI0A 1M8FA 5BSHA 1XTPA 1GRQA 2A94A 2ALJA 3TG2A 1Z5WA 1F60A 3LUFA 4YQZA 1H4SA 2J6BA 3ECAA 3HA3A 3ODPA 1BEEA 2CLEB 4HAVA 2H7YA 2EZ8A 4PZLA 4Z8XA 5JI3E 1IBKB 1P7CA 2Y71A 4L07A 4Q3CA 1NQTA 4JP5A 2C9BA 3RTAA 1Z45A 1M2JA 4F3NA 2IH5A 4HQFA 5JXGA 1Q1AA 4JB2A 3TN7A 5J5AA 3IOEA 3LDUA 2O07A 4Q4HB 1ZR2A 4IIFA 1JLLA 4RA6B 1E9FA 1T1IA 4L8YA 3EBLA 4WJKB 1DOHA 3LPDA 3QWAA 1C9NA 2KLHA 4NV3A 5AKZA 4LHVA 5K0NA 1P1IA 5C4GB 1JTFA 1RWVA 1U8YA 2IHZA 1ZI6A 1V43A 4V2IA 3RJ9A 3TSAA 2RIPA 3Q88A 4FW8A 4GE0A 4A27A 1NNUA 1O95A 1IY0A 1U1DA 3F6RA 1MZPA 5EJ6A 1ENPA 1X1DA 1MGOA 2G1KA 1SZJG 1YAHA 2RFLA 4XGRA 3TSOA 5LQNA 4Q66C 4O4HA 4Z2YA 1X9GA 3D2CA 5BWNA 4IX1A 4QQFA 1HYBA 3VO8A 3GIDA 3LC2O 1R6VA 3H97A 2C07A 1VRCA 3B6ZA 2QR2A 4WQMA 4KL8S 1QIIA 2CV2A 1RE1A 3I72A 3TKAA 2PZMA 2HK8A 5CLLA 1M34E 1UADA 3EISA 2PJZA 2ATEA 1NR5A 3SQMA 5LIPA 2OESA 1IZYA 2OHOA 3STUA 3WADA 1FXUA 3NS7A 2K87A 1LPAB 4RVDA 4BBZA 4YGYA 2FUCA 4M7RA 2WJ3A 2WWIA 5AHKA 5LBTA 5LPNA 4LG1A 4AKGA 5HCNA 4WXYB 2BBOA 1WIWA 1M0WA 2QX6A 3IAM1 4UNNA 4DMMA 4EDFA 4WADA 1K97A 3VVLA 2A1IA 1ORTA 3DP7A 5JXHA 1LTQA 1UBFA 3PQ4A 1BS2A 3O8DA 1YONA 3RTEA 3ADDA 3SLGA 1O2DA 1XP5A 2HA6A 3CONA 5HKKD 5IXJA 3W6OA 4YMLA 5FEMA 3AVQA 4H0NA 4DCJA 3EVFA 2UUCB 2Q0XA 2RH8A 3HKBA 1KA9H 3FUVA 4M2LA 4FSDA 4NZ9A 5K3SA 1HQDA 3O4GA 3WB1A 2CFSA 4DEXA 2C2WA 2HJGA 3I61A 4MCHA 4MRPA 3FKQA 2NU9B 5CR9A 4YRRA 4FWBA 5KX5F 3EVTA 4ZMRA 4LF5B 3JR3A 2OV4A 4C0KA 1OFUA 4Q6BA 3AFMA 4DW8A 3NP7A 3D4LA 3TNLA 1F06A 4X7RA 4H77A 2A7QA 3RIMA 1WCXA 3SZ3A 4EYQA 2IYAA 1LPNA 3STVA 3DJYA 1W1WA 2JZNA 4TMZA 1EAYA 1P80A 1W0CA 1ZMRA 4H9GA 1ZH6A 1IOWA 2OQRA 3AUTA 1U0JA 2IYQA 3B6KA 3K6KA 4ZAFA 3COJA 4MVJP 3ZC3A 2AXEA 3H8JA 5F9MA 2JKZA 2CXSA 4LWOA 4BQQA 1YFZA 1CUDA 1NVEA 1HL7A 2QY9A 4UCXA 4JI4B 2OEPA 3TKYA 2OWDA 2I67A 1YV9A 2EEPA 3D59A 4EUNA 2FY8A 4PGHA 3SKVA 5LMZA 4GO1A 1ZIYA 4E1AA 4ZVKA 1K3FA 3CO0S 3EA5A 3ZVMA 2DFPA 3CRMA 2OCDA 3T3HA 3AILA 4R2HA 3ANXA 1WWKA 5IFLA 1I94B 4IFBA 1LLDA 3NATA 1JLMA 3GU3A 2VKQA 4Y1FA 5HW0A 2J6CA 4Q9HA 5I7RA 1RYNA 3ZXIA 1YFKA 2G5CA 2Y05A 2BTQA 4G0ZA 2Q8PA 1WHTA 2GF2A 1PQ4A 1NAIA 4RW0A 4HNGA 3TYXA 5TMDA 1OCEA 3E8SA 1MAHA 3KR1A 3M1YA 4A0RA 4DADA 4YRTA 3MT7A 3V8EA 2OAGA 1KJ9A 2PS9A 1W9MA 2GBLA 5AK6A 4LK2A 4U0KA 3WTCA 4CT4B 5I7FA 3UWMA 2EF0A 5JC1A 2CNWD 3ZH2A 3L1UA 4AK9A 1TL7C 5ED0A 5IF9A 2QN2A 4RACA 3LOPA 1QZXA 3TD9A 3PFNA 2PZLA 2RC6A 3RSZA 2C88A 5JSQA 3OPYA 4AY6A 4G8JA 3OM9A 2O05A 4DIOA 1X86B 2H92A 2KMLA 2WJ6A 3NYQA 1VIYA 1S2MA 2P2LA 1Y63A 5KYGA 3LGXA 1GRVA 4I1OA 5CW2A 1HUQA 1NYRA 2FA9A 4RE5A 1USKA 3E84A 3Q85A 3FOFC 2PUFA 5AXAA 3LWNA 4BMNA 4V0MA 2H06A 4C4AA 3CVOA 4WV3A 2REQB 5HX7A 2I3GA 3IUJA 3NHFA 4UOQA 2V0NA 3EZ7A 1PNQA 2QVZX 4KQXA 4V03A 5EMKA 2BGUA 2OB2A 2D06A 2KBFA 5I01A 3A7DA 4GGPA 1YL6A 2J1LA 4JQZA 1YR9A 2YS6A 1XZKA 1EMDA 4Z9AA 4I1VA 4D80A 2UYHA 2OGWA 3IMFA 4AICA 7MDHA 1KY2A 1U9YA 4BEVA 4DDUA 1U3UA 2ADFA 2EJWA 2R85A 3KTAB 4DIKA 4JLPA 3HRIA 3SSOA 5BMVA 4R1QA 2FEPA 1KZ9A 1YTLA 2YIJA 3LZCA 3PFWO 4K5QA 2AW3A 1FVOA 4OOFA 1TGYA 3M2TA 3W9SA 3GLGE 5CXUA 1TCVA 4AZTA 1PEYA 4RF3A 1JHXA 4C4XA 1XXHE 5I9LA 3CX6A 3WDKA 1X1TA 4LZJA 1RQGA 2IHBA 4CPDA 2EL9A 3A1VA 3H3XA 1W0JD 4QFBA 5DI9A 2Q7OE 3LKDA 3CZ4A 4M76B 4B44A 1E2FA 1F1BA 3NC0C 5ERXA 3D5QA 2X1HA 4DLUA 1ZPDA 3RVRA 4HAXA 3WNVA 1QX3A 1RWWA 1YIAA 3EULA 1D09A 2CVHA 1GZ3A 2HLDA 3KHUA 3TBFA 4URXR 5A9SB 3FNEA 2VXYA 3THXB 1CR0A 4MI6A 3L0CA 3EDYA 3OX2A 1NPDA 3VAZA 5LU9A 3KETA 3ZDBA 2PO5A 3ZUPA 5AUNB 4YS6A 2W6ID 3MMZA 3ZCPA 5BSKA 2D7JA 2ZJYA 2ZPTX 4YRQA 1H6AA 4KHPB 8ABPA 4UMVA 3ORSA 3EF3A 3R7WA 16PKA 5CA0B 1AK2A 2AX3A 1NUQA 3WO0A 3H0KA 4QJ5A 1KAQA 2XOKA 2ZRHA 4BIMA 1Q0HA 3TVDA 2OHFA 1HR0B 2CK3D 1J90A 4YA6A 5ICGA 4LRQA 4L4UA 4HVLA 2QRKA 3AM1A 1CR2A 2CJYA 3OE4A 4FYKA 4OLBA 1IJBA 4MVWA 4FLFA 1CTQA 1PG2A 2G1UA 2Q62A 2XGOA 2AYYA 4F6LA 5BVGB 3OT4A 1P77A 5KB3A 3GLFE 5A3QA 1OH6A 1KDOA 1OX6A 3S8MA 2XR1A 1TM4E 2GTPA 3I6ZA 1PS8A 3KCNA 1HLDA 4MA5A 3AI3A 4PG7A 4BVJA 3KTDA 4DYHA 3FB4A 4MGIR 1C7RA 1AGXA 1GKUB 1U11A 1O57A 2X3UA 2Q7DA 5FA5A 4KH0A 5CMLA 5CT9A 3VXKA 3WP1B 1L4KA 2H2AA 1ZK0A 2VK8A 3GG9A 2VZ0A 1TZJA 2ZBPA 2Q6OA 1UZNA 4YJKA 3S2YA 3OLVA 3BF7A 5BSRA 5CBPA 5LNK1 1Y5MA 4RWZA 1E18A 3EAQA 5BQPA 4WOJA 1CRLA 3CH7A 3LD9A 3TO5A 2OXCA 3I58A 5FUMA 1BNCA 5D51S 2F64A 5EIAA 5SY6A 3CJQA 2UYQA 4IMRA 4EHFA 2X19A 3DPUA 2X9NA 4UARA 2DETA 1E4EA 1PSZA 1SKUA 2Q2VA 2ZJ4A 2BEVB 2MWMA 3GEHA 3MOGA 5JD6A 1H4QA 3D7MA 3O74A 4TMVA 3UAWA 1PJCA 4E70A 1T6NA 4X91A 2ODTX 1NQVA 2AF4C 2Z2IA 5AJZA 1L0BA 2A5DA 1E7YA 2WJPA 1Z36A 1ZZGA 3N5CA 2H2HA 4UHFA 5EZSA 4AMUA 4W5OA 1FP4A 4QDUA 4ACBA 1ECPA 1V8OA 3GQBB 1NASA 5AW9A 1QGUA 2XYPA 1QM5A 2Z3VA 2OKGA 3I34X 4Y2UA 3IMCA 3HFJA 3GXOA 1VXRA 3V1MA 4U7TB 3AUXA 4QDOA 2BGLA 4BQRA 2EYQA 4C5AA 3PQ6A 1BOFA 3B1YA 1YDWA 3NDPA 4HZIA 1U6JA 4TS1A 4P0PB 3MUEA 3LY8A 3LXUX 2VP2A 3MMNA 1QZTA 5EPUA 4NPCA 5H0IA 2JK0A 3A2KA 4R1MA 3B38A 3REOA 1ADCA 1VG8A 3MG9A 2H17A 5AJWA 1BGWA 1E2PA 4O4LF 1AQ6A 4TL6A 4JI3B 3S29A 5KNCA 3OJFA 3L9XA 1QDUA 4YJFA 4X1OA 5EE3A 1HDGO 4M1WA 3ZWNA 1L8LA 2EKDA 2DHCA 2FJ0A 3T5TA 2EX4A 4YV7A 5JTTA 3B7PA 4O6VA 4UNPA 3U5ZB 1P2BA 2WK1A 4NFYA 3VUEA 2HF7A 5GJCA 2UVPA 1XQYA 3IHWA 1KERA 1Q74A 2PPVA 3KUDA 1T1JA 1KDTA 2N9UA 3G5LA 4OGLA 1X7DA 4FR0A 1DKQA 1OB5A 1ZYUA 3QKUA 1QHYA 3U16A 1M5TA 3WS7A 2IUYA 2VPYA 4L73A 1NF9A 5AI4A 4HEQA 4TS9A 4BO9A 2HEIA 3CVVA 4Q9LA 1S89A 5IF3A 5TGTA 1KYXA 4E4RA 5C81A 4RAOA 1WZCA 1IXRC 2AZTA 4RHXA 3EAGA 1YQEA 1RPTA 5E9AA 4X00A 1NW4A 1YL5A 1G9TA 1T9GS 1Y37A 3K6RA 1PGOA 4A16A 5CCEA 2AZ4A 1RI4A 5T64A 1P75A 2OV6A 4M0KA 1M34B 4CL8A 4HZUB 3QU4A 2IYLD 3LQ1A 1C7EA 2BCJQ 4M7WA 1CFJA 1O0CA 1L5WA 5M7EA 1R15A 2CHUA 3QJYA 1T13A 1Z4QA 2QZ9A 2Q0QA 1E5QA 3C16C 5DP2A 3AJAA 1I4TD 2RCYA 2BOVA 3S2ZA 1PK9A 4G4IA 4HEJA 4O33A 2Z2XA 3AR3A 1K5DA 3IIJA 3R76A 2AKYA 4NU0A 4HKTA 4DC9A 5EGNA 4CGZA 2F17A 2GM4A 2FB9A 4HLUC 2WNHA 3MFQA 3D3WA 4OI2A 3HUFA 1O94A 1Q0QA 2XKBA 3AR6A 4JUIA 2YMPA 2HNBA 3FOEC 3GJTA 3K09A 1E9SA 1MO6A 2NU8A 2J9FA 4QZVA 1XMXA 2FMFA 4HX9A 3SNHA 3LMKA 4N6NA 3KD2A 3QVGB 3PWZA 1PTJA 4REMA 2HZ7A 3TL6A 4INPA 4B9EA 1MD9A 4CMJA 4D2IA 4BYMA 2J6HA 4PSCA 4BP8A 2IYFA 2Y9MB 4L6CA 1P62B 3Q0EA 1X8LA 2AHRA 4I1SA 3SIWA 1JEEA 4U9UA 4F5WA 2HT1A 3NG1A 1PD0A 2A30A 3EUWA 3UT5B 2C4MA 5FCDA 2J41A 1UIMA 4CN9A 1MQAA 4HQLA 4KTTE 2WW8A 1KPHA 3D1JA 2X22A 3NWOA 1NVGA 2VP0A 3JAWB 2VDVE 3JQ9C 4K86A 5J5VA 2MCFA 1PZHA 2BTEA 4KLCA 4MV9A 3O8CA 1NVWQ 2DTEA 1S1MA 2JHCA 1IHDA 4JEMA 2AE1A 2WAAA 3IURA 2JGJA 4IEIA 3PUWA 4MWOA 4C01A 4EL0A 1T25A 3OJWA 3WIBA 4L78A 3O94A 1GL6A 1DJPA 5LZ9A 3H19A 1QRSA 1EH5A 3GFQA 3O4FA 2FSUA 4IOLA 4W5JA 4Q03A 2GB4A 4YCDA 3M1IA 5EHIA 2IV7A 4EF4A 3DR5A 4TT3D 4KR6A 1NDHA 4URUR 1Z62A 2XVXA 2FPWA 1JGTA 3EN0A 5BURA 1VL8A 3BCHA 1MQSA 1X14A 2C3MA 2DP4E 4KX5A 4IOMA 1J21A 3QK7A 2DMRA 4ETMA 5J2TF 1NNSA 5EJMA 2NADA 2MT9A 4RXUA 3KLNA 2R6AA 4FPXA 4FCTA 2BWJA 3PU6A 4KXNA 4TV8B 5LA6A 2VATA 2PUEA 1ZITA 1OYWA 4AWAA 4LPSA 4QVIA 3NXKA 3X2FA 2OYSA 3FI0A 2GAIA 3DKVA 4RSGA 3SEZA 1JNYA 3F5QA 5F9HA 2HCTA 4YYEA 2G9VA 4WDQA 5DRTA 2GHQA 1Q1QA 2C94A 2JLCA 2O1SA 2VTVA 2Y6VA 3A27A 2PQ2A 5AHWA 2X2PA 4C78A 4HLDA 4DLAA 3GZNA 4N5MA 1ZKMA 4DBLE 4QTYA 1XMVA 2ACEA 3DKPA 3WL8A 4X71A 1B26A 1MF7A 1R4NA 4FLMA 4FC6A 5F51A 3IE0A 3FTCA 1HNXB 3T15A 1FUUA 2ISCA 4HDAA 4WFQA 3TL2A 1XNJA 3HSYA 4N7JA 1J2YA 4P2BA 3EWSA 2X0KA 2FWJA 3EPKA 4LMAA 4BXOA 1HL3A 2ENWA 3ILHA 2FOXA 3EDCA 3MD0A 1OAKA 4YJGA 4EHJA 4ZA2A 1PL6A 2N42A 2CDCA 2GZHA 2ZAGA 4QO8A 4LKRA 3GL9A 4Q34A 3T1QA 5HWSA 1C9KA 2VQDA 4BNMA 2ETXA 4ENPA 5K99A 2WSYB 3PXDA 5AKYA 1AMUA 2HY7A 5DN6A 4RADA 2Q3DA 4CR8A 4MP6A 4S1VA 5DTJA 1KEPA 4MAMA 4WTOA 2WIJA 3M6LA 1J6UA 3L04A 4JC5A 5U4XA 1NZFA 3B7GA 3KOOA 3R2JA 5JYBA 3KU1A 1EDOA 1G19A 2ODWA 3KHTA 2EJUA 3NBQA 1NTOA 4LK3A 1B6TA 1RIIA 2VQ3A 4J4HA 1Z0SA 4F6CA 3SXPA 1JLRA 1SUAA 1LUAA 3DV0B 1DX6A 2CLCX 1K6JA 4Y2RA 1U4NA 4HUTA 4N8DA 4E6PA 1RM3A 2VSNA 3ML1A 3DLIA 5JEDA 5K0SA 2QN1A 3OZTA 3NV9A 2WJAA 3H2ZA 4J1NA 3SPXA 3ROFA 1N9ZA 4GI2A 2PD4A 1QQ5A 2HAEA 2QQGA 2OLJA 4G4SP 1T1RA 3OTOB 1FYFA 2WF8A 2XEXA 1KBQA 5ETJA 1W52X 5HGJA 1LKZA 3ZYCA 2P68A 3ND6A 5C51B 3CQ9A 1V39A 3JD3A 3IV7A 1M0SA 1G3QA 3I04A 4US2R 2P7HA 3OJXA 2PX4A 4HWTA 3VNQA 4A91A 4EA7A 4BAUA 4HATA 2EJVA 1DIOB 3P9KA 3GLGB 2I9KA 2IP1A 3I6MA 3GFGA 4FBGA 5D84A 1U5BB 4WUTA 4OLAA 3WI7A 4ZEVA 1UJ5A 4HFNA 2J3KA 4QL3A 4J3JA 2MSLA 3M6AA 2ZRNA 4BPBA 1ZY2A 2WWXA 3IAM6 5CIWA 1CZRA 2FGKA 4GZ5A 4HS9A 2DSTA 2DULA 4M6WA 1P0MA 2F3TA 4LXXA 1PZNA 1D9XA 3P2KA 2EP7A 4O4JA 5BWBA 1QTRA 2NSJA 3DXFA 4ZJYA 2ZJ6A 4Q7KA 1HLGA 3OFSA 1G2QA 1QLJA 2K5UA 2ZITA 1KNXA 3KQNA 4CEIA 4B33A 3RBVA 1J7KA 4AJ4A 1LA2A 3DP9A 5HKBA 4W1PA 3C39A 1O03A 1ODCA 2H5IA 1KMQA 4IFIA 4F72A 1Q14A 1FJGB 5BQFA 5ADHA 3NTLA 1GGHA 4MQ6A 2AEFA 3DBHB 1CUYA 4CI0B 1QO0D 1I1HA 2HW8A 4XYBA 4GL4A 4PNPA 2YZNA 3V7NA 3OC0A 4DE5A 3DVSX 1FMCA 2QJWA 4R9VA 1EVEA 1EFHA 3LCVB 4GM1A 5F73A 5ENDA 1V45E 3IPRA 4PRYA 5DDIP 1DINA 3UH1A 2ETVA 3OSUA 3GFOA 4TLMB 5TT1A 3P7MA 4BQPA 1PFVA 3LUKA 3NTVA 4I99A 3TUZC 1H4TA 2FPRA 4NSNA 4BMVA 4GD3Q 1E96A 3E8MA 3UMSA 1DGQA 1J49A 2FWAA 1U02A 3VNVA 4INJA 1MQ9A 5ILQA 2NPOA 3W8RA 3KPWA 2CV0A 3QQ5A 1P72A 3F0TA 1Z3IX 2RGRA 3C2QA 3IDQA 4YJ3A 4BQEA 1Q2UA 3CCBA 4B83A 4Y6SA 1SO8A 1Y7TA 5HRCA 2ZBQA 1KVUA 4KGDA 1OXBB 3SJUA 2HQBA 4LZOA 4GOND 2B20A 2IKSA 3NUQA 4LJSA 1F2UB 5IKEA 1D6SA 4KR7A 2WWVD 2ZCUA 3DF7A 4XI9A 5HSGA 5G0TA 4JYAB 3MXTA 4C29A 1NYQA 1KO5A 3C4VA 4XM1A 1PLLA 3A05A 4XGQA 2HNKA 4B40A 2XY4A 3F6PA 5FA8A 2Y0CA 4EA8A 1THZA 2WB2A 5KSPA 4EG1A 3QF4B 1VBMA 1GCOA 4LZNA 5ALSA 5FAXA 3RVJA 3SHQA 3WXBA 2O8BA 3PUHA 1RLIA 4XCQA 5EN4A 4BGVA 2ORWA 2J9RA 1YF3A 3UJDA 1JLKA 2IYRA 3K9LA 4RVHA 4HRVA 3JWHA 3QFHA 3PZRA 5EJ9A 4DA8A 2IK8A 4WKNA 4JYBA 4E5UA 5AVJA 3TW4A 3FDZA 3KUXA 5DXAA 4P4GA 4QPNA 4W6ZA 2WSSD 5DYWA 1L5RA 5HF8A 4FNOA 2XMRA 5K4HA 2OFOA 1EWTA 3OCYA 4M1MA 1HDYA 4YHBA 3CLUD 3GLRA 2PD6A 3I09A 4G0YA 3VTAA 3UMMA 2E87A 2CXQA 4RAQA 4YAFA 1IM2A 2P27A 3AZOA 5CT6A 3JAMA 3BQNB 3MIIA 4WMLA 4ZO8A 1QP7A 5JQGA 4ITRC 3ZH9B 2Q9UA 1MEOA 2YASA 4HADA 4FFRA 3LXRA 4TL9A 3IQFA 2FZEA 1E5XA 3COWA 4FI3C 1YRWA 3WKDA 4C4YA 4YRBA 2FLWA 1LBEA 2L18A 5AM3A 2JFZA 1OD6A 3TUJC 3F7NA 1R0KA 2EFHB 4HQ6A 4TQAA 3L6UA 1GZSA 3G2OA 3ED1A 3OAAA 4YPFA 2ZJBA 5K6TA 5L7WA 3JPYA 2FKAA 5IXSA 1P74A 3GG2A 1TZKA 2SCUB 1Z5UA 3U49A 3I2GA 5C52B 4I9GA 1NC1A 5J4YA 1R2QA 4YRSA 1PK8A 1F2VA 2FI1A 2P9HA 3Q5GA 3AG5A 4IIEA 1T1SA 3BKXA 4ZT4A 4NAHA 2V7PA 1FY2A 1KPIA 2BFBA 2H7VA 3II6X 1K3UB 3IT0A 3TD6A 3KJXA 1I7DA 5D5QA 3VDMA 5B7QA 2NYAA 1ZNQO 4X6XA 1FOEB 4ZT5A 1XNRB 4DPKA 4HNAB 4ABTA 1UBKS 1ZVQA 5DGXA 5E7IA 1EXNA 4NMHA 3IULA 4DG5A 4WOPA 4BBJA 2PKCA 3SR3A 4BTLA 4QYTA 3ZGYA 1XN1A 4NBUA 3TOVA 3UHOA 1SVLA 4AG5A 2H5JA 1XP8A 2BMAA 3HJAA 3KCQA 4Q9JA 2A4KA 3I9KA 2FZKA 2GAJA 3KP1A 1GNRA 2ZATA 2B8TA 4NBSA 2FQXA 2JATA 2XITA 4RMIA 4C2TA 5K3AA 4FFNA 1HEUA 1JSCA 1HURA 3HCCA 4FOSA 4IAOA 4TKUB 4DQDA 4EIWA 2RHGB 2X5JO 1UDXA 2OMKA 3PBKA 2BHTA 4HNRA 5FOWA 2LD4A 5L7TA 4W8OA 3DE6X 1FFCA 4DCUA 4TV9A 1RYBA 2H3EA 4JX9A 2YXBA 5BW8A 4QIHA 3FCYA 2BSQA 5TEWA 4A26A 3IP1A 1R9MA 3FD8A 2NVOA 3H5RA 5ALJA 4F21A 5LP6A 3K1JA 3PCRB 2IPAB 3M4YA 5BW4A 1HC7A 5JG7A 2M1ZA 3N39C 2HMUA 2F4NA 2XRMA 5DHTA 5GGYA 4P3XA 1W9HA 1TMGE 2VSFA 3AJDA 4MV7A 4PLZA 1N57A 1QOPB 2PVCA 2G8LA 1O9HA 2AHOA 3R3YA 3PLAE 3CG0A 2WUEA 1DARA 1WMSA 3OF3A 3LDFA 5ESDA 3PJFA 4ZEOA 4A6PA 3H8WA 2XOXA 2ZJ0A 3TLAA 3GUVA 1KKMA 3RUFA 3FFXA 4EKDA 5BUCA 3SY8A 4XH9B 5BSVA 1GNPA 1QRDA 2HSJA 2XDQA 3DMHA 4FWTA 3R5FA 4U7HA 2AUTA 2DH5A 4BCCA 2EU8A 3NETA 1NJGA 1IXKA 5KOHA 3KSUA 4Y7CA 1PUIA 2RJ3A 4K9LA 4LRYA 2EZTA 5E0OA 4ENTA 1EBBA 2NP7A 3OPNA 1MV8A 5BN4B 5FYDA 4B34A 2JD2A 2WM3A 1KVRA 3B6JA 1E2KA 2L0XA 2WUGA 1I8TA 4HQRA 1ZEJA 5CP8A 5BXQC 5JT1A