1M54A

Cystathionine-beta synthase: reduced vicinal thiols
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
357
structure length
352
Chain Sequence
DAPSRCTWQLGRPASESPHHHTAPAKSPKILPDILKKIGDTPMVRINKIGKKFGLKCELLAKCEFFNAGGSVKDRISLRMIEDAERDGTLKPGDTIIEPTSGNTGIGLALAAAVRGYRCIIVMPEKMSSEKVDVLRALGAEIVRTPTNPESHVGVAWRLKNEIPNSHILDQYRNASNPLAHYDTTADEILQQCDGKLDMLVASVGTGGTITGIARKLKEKCPGCRIIGVDPEGSILAEPEELNQTEQTTYEVEGIGYDFIPTVLDRTVVDKWFKSNDEEAFTFARMLIAQEGLLCGGSAGSTVAVAVKAAQELQEGQRCVVILPDSVRNYMTKFLSDRWMLQKGFLKEEDLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYSTATHIONINE BETA-SYNTHASE
publication title HUMAN CYSTATHIONINE BETA-SYNTHASE IS A HEME SENSOR PROTEIN. EVIDENCE THAT THE REDOX SENSOR IS HEME AND NOT THE VICINAL CYSTEINES IN THE CXXC MOTIF SEEN IN THE CRYSTAL STRUCTURE OF THE TRUNCATED ENZYME
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
total genus 91
structure length 352
sequence length 357
chains with identical sequence B, C, D, E, F
ec nomenclature ec 4.2.1.22: Cystathionine beta-synthase.
pdb deposition date 2002-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00291 PALP Pyridoxal-phosphate dependent enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1m54A01
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1m54A02
2ZSJA 1WBJB 4HT3B 3X43A 1P5JA 2CLIB 4D9IA 1KFEB 3PC4A 5I7OA 4HPXB 1J0DA 2ZR8A 4F4FA 5B36A 1J0CA 2WSYB 5DBHX 2CLOB 4OFXA 1UBSB 4D9EA 5B53A 4COOA 1TTPB 1TZ2A 2GN1A 2JC3A 1K8XB 1RQXA 1FCJA 4ZQCB 5IW8A 1PWHA 2ISQA 5DW3A 1KFJB 3RR2A 1A50B 3TBHA 1D6SA 1A5AB 4Y6GB 5D85A 4D99A 2GN0A 4IL5A 4PCUA 1Z7WA 5T6MA 1M54A 1KL7A 2Q3BA 4HO1X 5E0KB 1K7XB 3IQIX 4NEGA 2ECOA 5BW6B 4D9NA 5JJCA 3IQGX 2D1FA 4D97A 1E5XA 4D9CA 1BKSB 3HMKA 1C9DB 4I1YA 2O2EA 4D9KA 2DH5A 2ECQA 3SS9X 5JISA 1CW2B 1C29B 2CLLB 2DH6A 4D8UA 2CLMB 4D92A 1Y7LA 5J43A 1Z7YA 2RHGB 5IXJA 3R0XA 4HPJB 4D8WA 1K7FB 1K8ZB 1KFKB 3SS7X 1TZJA 1TTQB 1BEUB 3FCAA 4LI3X 3PC3A 4ZU1X 1X1QA 5I7HA 2CLKB 2BHTA 5DW0A 1J0AA 4QYSA 3L6RA 1J0EA 2O2JA 3DKIA 3L6CA 1C8VB 4L3VA 5I6DA 2ZPUA 4JBNA 3PR2B 5CVCA 4D9BA 3L6BA 1A5SB 2C2GA 5B3AA 3AEYA 1VE5A 3V7NA 5EY5B 2V03A 3T4PA 1WDWB 3VBEA 1KFCB 5I7RA 1KFBB 5D84A 3R0ZA 4D9GA 5I7AA 2TRSB 1QOPB 2J9XB 4HN4B 1A5BB 1K3UB 1JBQA 4LMAA 1UINA 3CEPB 4KKXB 2EGUA 1TJPB 4H27A 1TZMA 5DVZA 5KZMB 1TYZA 2GN2A 4D9MA 1FUYB 4D8TA 5B1HA 3VSDA 1V7CA 3VSAA 5IWCA 2C2BA 3FGPA 1CX9B 1K8YB 2Q3DA 4XUGB 5HBGA 3DWGA 5DBEX 5D86A 4LMBA 4D96A 4AECA 1WKVA 1TZKA 5B55A 2RH9B 5D87A 4JBLA 5B1IA 3IQHX 2Q3CA 2EFYA 1VB3A 4AIRA 4L27A 1OASA 2RKBA 1O58A 1UIMA 2CLHB 1J0BA 2J9YB 2TYSB 3BM5A 4ZU6X 3IAUA 3ZEIA 1PWEA 5KINB 3PC2A 1TDJA 3X44A 5CGQB 1V71A 1K7EB 2PQMA 1F2DA 3VC3A 1VE1A 3AEXA 4D9FA 4L28A 2J9ZB 2CLEB 4WX2B 1V8ZA 4NU8X 5C3UA 1QOQB 4L0DA 2TSYB 2CLFB 2BHSA 5J5VA 3VSCA 5I7WA 3SPXA 1WTCA 3DWIA 4OREX
chains in the Genus database with same CATH superfamily
1T9DA 2ZSJA 3TL2A 1KEVA 4Q9NA 1ECGA 1BCSA 3WISA 1GZSA 2RFLA 2VPTA 1GT6A 2WBLC 1UQUA 4LK2A 3HCBA 1R0LA 1W87A 1WKCA 2X58A 3OZIA 4LVUA 4LXUA 2OFOA 2NLOA 3R6DA 1D9ZA 4PWYA 3UWOA 2PFGA 3NHJA 4K7JA 1WX1A 2ZG6A 3O4RA 1JPJA 5BSRA 1OZGA 4BTEA 1E2GA 1LBSA 4C7OA 4Z9AA 1T6ZA 1K4YA 3TN7A 1SXJD 3HSKA 2TMDA 1WHSB 3VH3A 1WMDA 4L0CA 3V46A 1D0SA 2C9ZA 3CCFA 3LZDA 1PZNA 2IXDA 3FVRA 4KUGA 2R48A 4M9QA 3BFVA 3KSAC 1G7RA 1NVEA 3MTAA 1VECA 2YWEA 5AW0A 2C92A 2FZCA 3E23A 1HE8B 3JATA 4YV0A 1BEZA 2HWYA 5JJBA 3Q8WA 5GINE 2HYIC 1GSHA 4JB8A 4KFRA 1G16A 4OLFA 2V1UA 3RGWS 3SYMA 2GHQA 2H2HA 1H2FA 1FBNA 4HFRA 3PKZA 4IXNA 4IX1A 1OT3A 2NZYA 2PG3A 3HZRA 3PC7A 4LI0A 5F1KA 2I91A 1ZNQO 4H1WA 1FSGA 1GPBA 2B3DA 5AOAA 3A4IA 3SBDA 2FP3A 3A0RB 3WWYA 5A2QA 1U0FA 2XKKA 2NP6A 1YQEA 1H5QA 2TECE 3DEFA 3ABZA 4OHFA 3ME5A 2VDLB 4V3CA 5F5XA 3H5RA 5CFNA 4FS3A 1EKXA 3BTOA 3HGQA 1FB5A 3A1VA 4IW3B 4FNGA 4IIHA 2JRLA 3FSGD 1Y89A 3LGAA 2GARA 1Z3IX 3EXAA 4UC0A 4DNFA 4QVIA 3NWBA 3HXQA 5EKDA 5GZ6A 4DJDC 2GZSA 3F49S 1XEXA 4LHZA 3C5HA 4TRRA 1KPIA 3JZMA 3EWIA 1VHDA 4WNAA 1L5NA 5HKAA 3U7EB 4I7EA 1YNOA 4LOKA 5H16A 3ZU4A 1Y9EA 2I2XB 4F11A 3AEYA 3WIEA 3E3AA 1AK9A 2ATIA 4FT4A 2FZ5A 4G5SA 4JQZA 5CMLA 3COJA 5HF5A 5JR3A 1TF7A 2A0KA 2OK7A 1QRUA 1G20B 2WOOA 2IH2A 1ESZA 4IHJB 1YQDA 2XMGA 1XTJA 1RXEA 1XDWA 2A0WA 3WHLA 2BE7A 3BXGA 4H7HA 4EGQA 6Q21A 1V16A 3HQ4O 2VHCA 4BQRA 5ESWA 5F64A 3HPRA 4F6CA 1MT0A 2CWWA 4JJ4A 1YU6A 5EZQA 4XH9B 1B8VA 5D7BA 4LMBA 4C06A 1X94A 4MW2A 2XCRB 1KK1A 5EJ8A 1XJ0A 1YUNA 5F76A 1ZNXA 1VGQA 4LHYA 3IMGA 4MIEA 4BMNA 5CVTA 2O5EA 2I2BA 2IYYA 4QUAA 2QDXA 3VNVA 3L84A 3EVZA 2YQ4A 2XJ4A 1OAOC 4GX0A 4F3YA 4BFUA 3AIKA 1UXKA 4L8WB 1WU8A 3K0FB 4MQEA 4YTEA 1U3UA 4D0SA 1SVLA 2IGTA 5F33A 2B6NA 4TTJA 4Y2RA 2EZ8A 1G21A 3KYDA 1JHOA 3ZDXB 3KSBC 2AG0A 1OJ7A 2JFFA 3R0JA 2YFKA 3QWFA 2JFWA 5H4HA 1FVXA 4EKNB 5CYPA 3JVEA 4WXMA 3DVQX 1A2OA 1NQUA 1SUPA 1ZGAA 1SXPA 2CY0A 4ZD6A 1ZOOA 4NEHB 1J1ZA 2I99A 1Z5ZA 3DFUA 1X1AA 1QZZA 3C45A 3KT8A 2PKYX 3X43A 2Y9MB 2ODWA 2CWDA 4IDNA 4WVFA 5CVUA 1YR3A 2Z98A 4ACAA 5LUAA 4XWKA 2X4IA 1J9GA 3LFTA 4C21A 4Y6RA 3HLKA 5F7OA 5SZIA 5K8TA 2QKYA 2PH5A 3LIIA 5CXSA 1ECBA 3IE2A 1UPBA 1ZMXA 2DWCA 2D3TA 5DX8A 3ZJ5A 3RQIA 2XYRA 4DWJA 5BRAA 2G09A 5JW6A 2XZOA 1PQ4A 4ZGWA 1KO7A 1OVGA 4W6ZA 3QUTA 1YB7A 3UBTA 1U0JA 5AESA 3R8FA 1KDRA 3JSAA 1K86A 3A06A 3P9IA 2Q4EA 3DOFA 3K16A 2CBGA 3V9PA 4J1TC 1ZNYA 1GKLA 4CLXA 3DOEA 4RIGA 3MM4A 3UHPA 3W8NA 3CW8X 5ANRB 4DMRA 3F5FA 2VIIA 4V24A 3ZBTA 2WKPA 3COZA 5I4KA 5JMPA 2NTNA 1ZEJA 1B3BA 1FNNA 4HAVA 5FYDA 1EK6A 1KYVA 4BO4A 4ZKEA 2X4GA 4ZI2A 5K45A 2X0DA 1SG6A 2G4CA 1KZHA 3L06A 4B6FA 4C5AA 1JG7A 3R5XA 4MMZB 3MCUA 1Q50A 3Q9SA 1WXHA 3SLGA 2CXSA 2BMAA 2WYOA 5J4KA 3GG9A 5BQXA 3OZFA 4Q4AB 1N2CE 1NUSA 1RI2A 2WD7B 3PG5A 3MN1A 2ECKA 3QZUA 4N47A 1Z2AA 2P27A 2I6TA 4XDZA 4Z4QA 3AL3A 4NABA 1PG5A 3VKFA 4JBGA 4Q7KA 2PQ6A 1W93A 4MUAA 3TIIA 1QVWA 3NCHA 3K0AB 3ZCPA 4AZVA 5JS1A 3Q41A 1G8SA 2GEUA 2H9YA 4LY0A 5CAEA 2ZSIA 4Z1MA 1DX4A 4F92B 1VE5A 2P30A 4TLLB 4PPNA 1U2GC 3PD1A 3TSCA 2R8BA 1SIUA 3GN2A 4JC8A 4DNOA 1YZ3A 2YYZA 1JR3E 2QD4A 1JJBA 1JBQA 1NLFA 1Q2XA 3H6HA 4KDRA 3PKJA 1ZP6A 4KWIA 4OXRA 5E2IA 1PX0A 2V65A 3EBOA 3JW8A 4NV3A 4PWZA 5DPMA 5GV8A 2QMHA 4D44A 3KXKA 4EX6A 3F78A 1U9YA 1ZUIA 4E5MA 4CPDA 5IUKC 4OOFA 3CNNA 2WUFA 4IHKA 2QI9F 5B6PA 4HAXA 4NOJA 2FJPA 3PYXA 4F91B 1E32A 1TADA 3MWDB 1F8XA 1SU8A 1UKAA 4DQDA 1UBMS 4CG0A 1EEXB 2O9JA 3PA8A 1J5XA 3W2IA 3HY4A 3GOQA 4B4WA 1VHQA 1R10A 1QIJA 1Z83A 2PGIA 3KR0A 3CLSD 3QE2A 1FFBA 3KZVA 2VHVA 3DXZA 3W2TA 1NOJA 1R0SA 2CEAA 3H0CA 4JQYA 3O9ZA 3GLHE 4JYMA 1KYQA 4DDMA 3GEBA 1ENZA 4YONB 3AHDA 1U7ZA 1CUXA 2O0JA 2PMDA 1P6UA 3LI2A 2IYPA 3PQEA 4HL6A 2O5CA 4UUBA 3FHLA 2F8LA 5IKMA 4Q1BA 4D3YA 4BX3A 1M2EA 3PNPA 4I5GA 1G8HA 3ZQ4A 2H4XA 2DXIA 4YCLA 1ZD2P 1KYIA 1GLNA 3ESYA 3LX6A 3P32A 4L0DA 4BNGA 2H1FA 1FTNA 3AUAA 3V1LA 4DNXA 2GHTA 4LXXA 3DE0X 1KQFA 1TJ5A 2KSQA 1K88A 2D4AA 5K0JA 2ZW9A 2F8TA 2ENWA 4YCDA 1XMIA 5T8KC 3UOAB 4E70A 1V6AA 3GLKA 1VLMA 1Y33E 4AJ1A 1QBKC 1JLLB 2VYVA 3CLKA 4PQEA 1JEJA 4EGJA 2W71A 2P6UA 5AI0A 3JYQA 2OO7A 3WKDA 5TQVA 5BOSB 2IDMA 3OKPA 1FBTA 1X7DA 2V7UA 4RA9A 2JEZA 1T8RA 1DIAA 4HADA 2XTJA 1AQ6A 1B8PA 2HPHA 4DREA 1EFPB 4IDCA 2ZREA 1TKAA 4QXRA 3TBFA 1PV4A 2GPWA 1JPNA 4YASA 3P0FA 1P44A 1Q6YA 4KQWA 1Q12A 4RF4A 1P9NA 1J2EA 3EQ8A 4OHXA 4IZOA 3LUDA 1NWHA 4IVRA 1CR2A 3L8CA 1L5HA 5ARCA 1DBPA 4EG8A 4A0GA 4AJ4A 4IH4A 1WB6A 3HKDA 1ZR4A 2FLWA 3TZLA 3TZ6A 5KJ1A 3P4UA 2CL0X 5I9BA 1OPRA 2VJYA 3GXOA 3QKSA 1LSJA 4JP8A 4NL4H 3RIMA 4W5QA 1QHIA 3H6KA 5CNKA 1VBNA 4RTKA 2GYUA 4YVFA 4QEDA 2AUMA 1ADBA 3NM6B 4PXYA 3OQIA 3ZD6A 4NYMR 4QUGA 5FTNA 3WGYA 1MB3A 1S1CA 4FGLA 2CLKB 3CVJA 3ZWPA 3ER8A 4Q3DA 4X41A 5EZYF 3ROQA 3KJFA 3CF4G 3STYA 3SXPA 3MINA 1HSOA 4XRGA 2YMLA 5TARA 1H9AA 1MAUA 4PFKA 1V3VA 2OE2A 3K9HA 3BN3A 4TS1A 2DJIA 4DLRA 4J75A 3IIEA 3KDPA 5CJJA 1A04A 3CRZA 1NVVQ 3HB0A 5CH5A 4YRZA 5LNK6 1UPUA 1U5AA 3I04M 4B2LA 1ZA1A 1HG0A 4QGBA 1ECJA 1YACA 1PBTA 3C6MA 3QWHA 4UDYX 4UAJA 5EIEA 1Y0BA 1C7FA 1J8FA 3FMOB 1YDGA 1HI9A 3Q7IA 2XKAA 1FUYB 5B1HA 1FFGA 1NSYA 2A1TR 4PC6A 3UMVA 2M1XA 5K3EA 3OM0A 3WFIA 4IDAA 2VWGA 2JF0A 4WGGA 2JLWA 5IAGA 4HWKA 1XG5A 4RADA 5PNTA 4I66A 2V4UA 2WDZA 3FWNA 4BECA 3VPCA 1AKVA 1SUDA 2VH1A 3BZBA 3WC4A 4NULA 2FK8A 2OCYC 3SSAA 4BO2A 1SCNE 4FEYA 4HGYA 2R8XA 5A6SB 1TYBE 1UJ2A 4CCWA 4K05A 3DLIA 4I4TF 5F51A 5HVNA 4LV8B 1V3TA 5IAEA 2PT5A 3KWLA 2D0DA 2JGIA 4CM9A 4DBZA 2R4UA 3T7SA 3BREA 1JKJA 3BWBA 1C2TA 3D0RA 2PZLA 2M6LA 1RZRD 2QZPA 3HNPA 4ZHQB 2XBMA 4UM9B 1DARA 1JHUA 1GADO 1ZD8A 4UAVA 2JBWA 3VZSA 4JVNA 5EA2A 1TJYA 2YMMA 4LY6A 1U7OA 3BG5A 2OBNA 4AIIA 1UXHA 4JI0B 1JXAA 2PJDA 1T3LA 2Q2OA 1IN5A 1S3IA 1XA4A 3EC7A 4E22A 4UMEA 4K6KA 2WABA 4ITVA 4TL8A 2QP9X 1KNQA 4AS1A 3DGEC 4NJEB 3QYAA 1E7WA 3BSWA 3G5LA 2RD2A 3NCTA 2AC4A 3OQHA 1OA0A 5I3CA 5DX0A 3GLGB 4LE0A 4F60A 3GEPA 3SZMA 3O4IA 1JPVA 4U0KA 5L45A 2A6PA 5DP1A 3M81A 3T9CA 1PLJA 2YIVX 5FUQA 1K08A 1A9XA 1Y9JA 4Z4GA 1KAQA 1Q1QA 2KE5A 5HMMA 4HSEA 1L1QA 5I51A 1ZD9A 3W4KA 3FJ1A 4QTUB 4URUR 5TV2A 4X91A 2Q0QA 3JQ7B 2RG1A 1E5XA 5H9VA 1CZRA 1ZU5A 4FIZA 1GDHA 1NL3A 3BL8A 3THOA 5C4MA 5HQTA 2BC9A 1RXYA 3NUGA 1B0UA 4LRUA 1NHGA 3C5EA 3VYWA 4B3IA 1T0IA 4E4YA 1Q77A 1TW3A 2I2AA 3BF7A 4JX9A 3ZWAA 1H1LA 1Y8RA 1S7GA 2XTAA 1T34A 1RM4A 3PUHA 1H9BA 4JA0A 4UULA 5T7BA 3D31A 3M8KA 1Q19A 1Q7RA 3COWA 1SM4A 1YB1A 3CY6A 4NYJR 5KBYA 1X7GA 1LY1A 4Q12A 5FTWA 2I4MA 1F8UA 2OBBA 3QF4B 4RZHA 4WMLA 1GPYA 1P2UA 3GYGA 4B4UA 1WXDA 1V8DA 3I9FA 2YRFA 4OM8A 3G6WA 4GS5A 4AUEA 1E3LA 3M3HA 3L5OA 4TXHA 5ALUA 4HDMB 5J2UB 3OOHA 3ZVRA 2NZ8A 3SHTA 3ZK7A 1E3MA 4U9IS 4FINA 4MV5A 5ITSA 3IXLA 1FUKA 4IKPA 2IQIA 3V8RA 5HA5A 1B76A 3UTCA 4KE7A 5F3DA 2B8NA 3C6BA 1HURA 3P0JA 3W06A 4AMZA 1O9GA 2C5GA 3H5IA 3RYCB 3KHKA 3HBLA 1UXIA 1W4BA 1Y1PA 4ZI7B 3M6MD 3QFCA 1C50A 2EP5A 4EYSA 3D8BA 1M1YB 1ZK3A 2QQEA 3CZCA 3HKBA 2PWPA 4OHPA 4P3OA 4NCIA 3VRHA 2VG8A 1ZHOA 3WYNA 4UUOA 1RYMA 4PEVA 2DCUA 3WL5A 4TN5A 2VRCA 2AJ8A 3T94A 3PR3A 5CB4F 4FYXA 5FUWA 2RI6A 4IDFA 3B3QA 4W5WA 3WLNA 4X1KB 5EHXA 4BVEA 5EZYA 3UPDA 4XSVA 4EVIA 5AUOB 4QOIA 1DFGA 1SNYA 1JRLA 3RYIA 2BE9A 1Z0IA 1ZO8A 2HFJA 2VRWA 3U7IA 3LLUA 1FNCA 1D4OA 4KMOA 4B3XA 5HS4A 1ZOLA 3GX1A 1W35A 1YOVA 1AK1A 3ECAA 2XTZA 4ZU6X 4YT5A 3AESA 721PA 2WYUA 4E4RA 1KZ1A 2JIRA 1P5RA 3B3GA 3KB6A 3P1JA 4JLDA 4RY2A 4YYZA 1QH9A 3I61A 3IAEA 3DBLB 3I2IA 3L6UA 3Q3VA 2AOUB 2L69A 2XSZD 1KEPA 3SX2A 5F35A 1L8LA 1PTJC 2Z1DA 1YHYA 1KO5A 1K06A 1W73A 2XNHA 3HH8A 2G9RA 1H4VB 4BZPA 2JIBA 1ETUA 4KLZA 5E9AA 4ZT5A 1KU6A 3CWQA 5FA8A 3QP9A 1WW8A 3VAYA 5KOHA 2H0RA 2CV0A 4HNAB 1TD1A 1SHTX 1NJFA 3FA2A 1GZ3A 3N76A 4Q00A 1NPYA 2YWRA 4CMAA 4OXXA 4QBHA 2XF2A 5EE0A 4L5AA 2HGZA 3OX3A 4I4TA 4NBVA 4A8JA 2VYND 2PS3A 3VX3A 4JFAA 1RC0A 2PY6A 2IW1A 2ZLBA 2ORVA 1KKLA 2A92A 4OAOA 4MKHA 4JYBA 3UKJA 3UG6A 3QM1A 4E1VA 1S4MA 4KQEA 2OA0A 3WLAA 1F4VA 3IKTA 3WIOA 2MSKA 2AEEA 3F2VA 4XFJA 1J42A 2HSEA 3S1AA 5KX5A 1I4OA 5E6RA 1E94E 1S8NA 1VHWA 4OD0A 1NQOA 2R6FA 2XMSA 4NI5A 5HNKA 4UUPA 1SU6A 2HK9A 2XZPA 3LS2A 4QGHA 5JWHA 1FLAA 1FYWA 1PJZA 2C4UA 4MI9A 2XUKA 4HR7A 2AX4A 2WLTA 3Q0IA 4N18A 4WXPA 2IPAB 2QXYA 3UW3A 1Z0UA 3PITA 4D8WA 3MYRA 1LPSA 5AHWA 3IEPA 4ONEA 2B1RA 1KPGA 2JH9A 3N3BC 1LEHA 2WPNA 1ZZGA 2JAXA 2WAMA 3PFWO 4L22A 3SNKA 1IEWA 1WKBA 2Y2VA 3U56A 1HLFA 4JP1A 3K09A 3ETHA 2V7TA 3PWKA 3OZGA 1XZPA 4G4JA 4K9DA 1G21E 3WGKA 3EN0A 5D01A 3J81k 1KI4A 1QHXA 4RH0A 4YPOA 2P9HA 4HDQB 3RFUA 4B9AA 4DIEA 3OPXA 3B48A 2DY0A 3C85A 2FZEA 3KKLA 2IPXA 1Y48E 4NOLA 1CQJB 1EUDB 3IQXA 2C54A 4LQLA 1A9QA 4A82A 3IMKA 1DJPA 3IP8A 1MQ8B 3DKVA 3TMKA 3D4OA 2JFHA 3ZKWA 4KQHA 5CEJA 1ABFA 5JU6A 3UW1A 3OESA 4BS9A 5MHTA 4EG7A 4D8TA 3NTRA 5A1JA 1IN6A 3TQOA 2JIZA 2WWWA 2C2BA 3WLEA 3DOCA 1LDBA 4YRCA 1KE2A 1P75A 1UDBA 4K9NA 1IU9A 1OBCA 2YZNA 1PT8A 2CK3A 3IURA 4EY4A 2BF7A 3CNQS 3TVYA 2WSSD 1MC8A 5IU6A 1Z2OX 1WPXA 3ZVMA 4HGPA 1GZ5A 1NMQA 3GW8A 4UM9D 2VPWA 4X7BA 1IWBB 3RSLA 1PL8A 4N12A 4TMTA 2NVBA 3UAYA 2QZ4A 1EINA 5ALMA 5KSYA 5HGJA 4C78A 3E2MA 4QYXA 3QEAZ 3O26A 1DIHA 4TOIA 1ZXLA 3ZQJA 5GOTA 2RHJA 3VDXA 5ULLA 2ZIAA 2H5EA 3O2JA 1RU3A 5KYWB 3NASA 2ZBPA 2DTXA 2AJCA 4HAUA 1HK7A 4MULA 4C3UA 4QASA 4ZAGA 3DUFB 1WIWA 1BFDA 2XE6A 3G1UA 2BFNA 4H31A 3HADA 4WHMA 2FCRA 2X7XA 1SUWA 3MAGA 4O59O 5CB4A 2O0MA 1PUJA 3NP7A 1M6YA 2X5JO 1WTCA 3BWEA 4ZZ1A 3K53A 3QTLA 2UXBB 3USZA 1HDYA 1WAMA 2GZ1A 4L0MA 4C03A 5IUNC 3CVYA 3RWBA 2Z95A 3REOA 3WA6A 1T29A 4EI9A 1Z7BA 4H6WA 3OSZA 3L92A 3DL7A 3CHYA 3EC2A 1VLQA 1E1QD 3LHKA 4N8DA 2QJTA 2ZIGA 4KI0A 1BDJA 1D2GA 3H5WA 4MMYB 1WSAA 4MRMB 4QC2A 4YRAA 1R8QA 2Z08A 4M87A 5CFPA 3UA3A 3WAKA 2A7QA 1RJ9B 1K0UA 3GLTA 4GMFA 4NY1A 3UAXA 1TUBA 1QH0A 2WVHA 2ZB4A 3DWEX 1JALA 2GNOA 3D7MA 3L18A 3M6XA 3OJLA 2NUBA 4JP2A 4LCEA 4N39A 4RHUA 5T4BA 4K6OA 3S68A 4AY5A 1J07A 1UFKA 5FLXA 4BN5A 5CW2A 1M0TA 4UJ5A 2GKSA 2NYVA 2ODBA 3L1JA 3VV2A 2RB5A 1F51E 3DKRA 1OXBB 2GNAA 2ZR0A 3QBJA 3PFNA 1NP6A 4EG1A 2F67A 1S3GA 2PL5A 2IUFA 3W3AH 1XX6A 4HFMA 2WWHA 1IM2A 2OO5C 1CLUA 3PKIA 4IWXA 3EMVA 1PGPA 2ECQA 2X9LA 4O3FA 5K4HA 5CVEA 4IWNA 1GN9A 1KJNA 3QU7A 1AIPA 4G0MA 4N3GA 4QQKA 1E7QA 3IDAA 3ZWCA 3REFA 4WZBA 3KEOA 1Z6QA 3VHXA 1Z33A 2HPAA 4FI3F 1QP4A 1WEHA 3U7GA 1VKHA 4NWIA 3FWKA 1BEUB 5DISB 3VR5D 1F0PA 1E7RA 5ALRA 4TXLA 2F1RA 1DAFA 5BYBA 3AP2A 4RF3A 5A5EA 4RMNA 1EVJA 4BZQA 1JJAA 3CEJA 4TXJA 1KKMA 4MI3A 2NO6A 3RBZA 1JYSA 4I55A 2GPTA 3IQWA 4GLLA 3CNBA 2QSUA 4PNEA 4HZIA 4XEUA 3IB6A 1XF9A 3U5TA 2WTUA 2J67A 2WIDA 1I9CA 4QAJA 4NCNA 2BY4A 2JI8A 3FGZA 5TPZD 5UKDA 4HVAA 2IJGX 4H7KA 2CT8A 1KK0A 4OGKA 3RUCA 1I2DA 3M33A 3DXFA 1D2HA 1KQNA 3R41A 2JKVA 2O50A 5FOUA 3GQBB 3WB9A 4DCSA 2QP4A 5DI9A 4ENVA 1TC2A 5I4BA 1QRDA 4KKXB 1SC1A 5A0TA 1MABA 4DCMA 1XA3A 2ZI7A 1DEKA 4LDAA 1R8XA 2C5AA 2X41A 2OCIA 4NENB 5DBEX 4KAFA 3ITKA 3IR5A 3TLEA 1QU3A 1I1OA 3CVWA 5CU7A 4QXOA 5DF1A 2PVSA 4FYWA 1Q1EA 3B9RA 4UTZA 5KIAA 1WVGA 5C7IO 5K0EA 2OFWA 3A1TA 1KJQA 2FWPA 3CF2A 3PEEA 3A2LA 5EWLA 3TS1A 1TVKB 3HJUA 1U6KA 4ZMRA 1VL2A 1E2LA 1DRVA 1OIVA 3V55A 3NBQA 3PTZA 2JRCA 2VAPA 5YASA 2O8BA 1X77A 2DUNA 3DE5X 4PO1A 4EFNA 4KR7A 3KVRA 3OETA 5EUCA 1YKSA 4BZXA 1Z4NA 3HACA 4GECA 4IVQA 3R23A 2J5BA 3KKQA 2WU4A 3LUKA 4BWVA 3HJGA 1C1DA 1X3SA 4J91A 3VDQA 1X1BA 1DIBA 4BJ5A 4DILA 3HUTA 3LD9A 2J08A 4IM7A 3HI4A 4B9EA 5LIPA 2VYQA 4PZ0A 3LLCA 2Q9AA 4NFYA 2UZ1A 4QYIB 2XECA 3CV3A 4NDNE 2IVFA 5LYJB 3GDFA 4RSMA 3RAGA 3LFUA 4IJQA 5BVHA 3K6RA 3EXIA 3P2IA 1T1EA 2V7PA 4LE1A 4Q16A 4UCQA 5CM8B 2H1VA 1E3WB 2YVQA 2H2FA 5KTMA 3W79A 1E9VA 1LX6A 4CMHA 4ZRMA 1U28C 1OZ0A 3OEHD 3RASA 1IIBA 4DWVA 1YUMA 3D54D 1UM9B 2YR0A 1FDTA 3B9BA 5I9IA 1M54A 1YVRA 3IUJA 4QDTA 5BW6B 3OIFA 3OT4A 2QAJA 2BELA 1M1NB 4MDHA 4U2CA 3SXUA 4IDBA 4AAYA 1NFQA 4J2HA 2Q8QA 3C7KA 2J1LA 1PKEA 3KHSA 3NJ4A 4NOMA 5C2JB 1ZM9A 2H1RA 2PXHA 4UTXA 1PRYA 2YZ2A 3B53X 3L6EA 4KN6A 5JUWA 3QENA 4HXEB 1WSWA 1JG6A 4DABA 3HHEA 3MSCA 2E87A 4QDZA 1GAQA 3DXXA 1VXOA 4ND8B 3R09A 3QEMA 3ODPA 4N5HX 1UWLA 3CE9A 4UMDA 3ZXSA 3C7TA 1S9HA 3LFHA 2RHLA 3QKIA 1APBA 5TJ9A 1IK6A 1U63A 2CF5A 2ZBVA 5EN4A 4O5AA 5HTKA 2IYAA 2ZWIA 1I0ZA 2NU6B 5DMHA 4MR9A 4AYTA 3MT9A 3TM5A 3D5QA 5DNAA 5AM0A 1PBNA 1C4WA 3GHYA 3PDIA 4S1VA 5B3AA 1DQPA 5EIFA 3TQRA 2O3JA 2D06A 2F1KA 3OBBA 4IJ6A 4KACA 3PHCA 1JFRA 1V39A 2E4XA 3AFOA 3UQYS 1SQGA 1UJ5A 2VO1A 1WXXA 4LXGA 2ZFUA 1BWSA 2QE6A 2VSYA 2ZUBA 1LA2A 3ZUPA 3Q9NA 3R44A 2XUJA 4IZIA 3Q1KA 2Z5GA 4A10A 2D2XA 2G9ZA 4WZAA 1URPA 3DULA 1DRKA 1ECPA 1F6BA 3G5UA 3OZRA 3DLTA 3QEKA 4FOLA 4YRIA 1FU7A 3SR0A 2ZJBA 4ZTUB 1VM6A 1L8AA 4PICA 1G7CA 1FW8A 1K5GA 1KOFA 2J6BA 3FOWA 4MUNA 2ZYDA 1QKIA 3C98A 1LTQA 4D98A 3K9GA 5B6IA 3FRIA 1Y1TA 1QZUA 2FQYA 1ZYUA 3DUWA 4FOSA 4GOLD 3ZWOA 2YBDA 1U8TA 2YY5A 1QYIA 1NNLA 2ZTUA 3R3VA 2XLCA 2IUEA 1T8WA 5CFZA 2CD7A 2R9VA 2NZVG 1Y5IA 3O4FA 4C0XA 1MJHA 3JASA 1I3KA 2ABWA 2R6AA 4TLAA 3TLZA 1KXJA 1WEKA 2A94A 1P8JA 2OILA 2X40A 4OM7A 5HFJA 4F7DA 3S5JA 3STWA 4WX2B 3H04A 1PFYA 2Q0SA 3HVJA 1S9DA 1P61B 1LF0A 1HY3A 1ELOA 1WUKS 5CG2A 2ZROA 4P5DA 1SVKA 5J5VA 1DB3A 5IABA 3EZ7A 3C8MA 1D1QA 3I6BA 3UB3A 2BEVA 5JMTA 3PC4A 4UVEA 2PKRA 3BXHA 3QIAA 3A8TA 1N3LA 4ZRDA 2D5IA 3E7WA 3HVUA 3QEOA 4XR4A 4JEMA 3P2MA 4HTFB 5G1NA 1SCJA 3E3MA 3M7IA 4NHOA 3JQ9A 4OL0A 5L3SB 1XPOA 2GBGA 4NEQA 1TCVA 5EUBA 4N82A 1H42A 1KBZA 4LXIA 2FSHA 3GFFA 1VTKA 4AULA 4WY2A 5AICA 5SZKB 3BX1A 4YJ2F 4YMTA 3CZ4A 3FY4A 1L6RA 1NBIA 4GP6A 5ES3A 5EI5A 4RJTA 1ZN8A 2ZIXB 4Y67A 1P9WA 2XE7A 3FFTA 3WG9A 3CEMA 1V43A 4R1OA 5SZJA 3NX4A 4XJTA 5TVKA 3IT2A 3E82A 4Q05A 3EF1A 2UUPA 5AVQA 4LAFA 2HGSA 3WKEA 1S2LA 3ICQB 3PXCX 4EJMA 2C96A 4I4CA 3ZKAA 3PV0A 3Q12A 5E1BA 3ROXA 4BX2A 4YV2A 2OXTA 1XD9A 1U6JA 4I1UA 1J56A 5CA1F 4FC7A 1ULBA 4W4TA 1LQUA 4B7XA 2Y66A 5FLKA 2GLXA 3GFQA 4RPKA 1M5RA 1I01A 3KV1A 4N5IX 4DA8A 3AEUA 3RKUA 2R00C 2OKCA 4RLFA 4OHWA 1QQ6A 2Z57A 2HLPA 1H2YA 1KZ7B 1CFJA 1P7CA 3OH8A 2Z5FA 1DKOA 1NN1A 4FGZA 3T1NA 4TQGA 2NTEA 3M70A 2P4QA 4Q3EA 3HN6A 5CB8A 2JGDA 1GEEA 2IPMA 3H05A 4GBJA 5M04A 1T4DA 4DARA 4E6PA 4P36A 1GTZA 1CDOA 2PS1A 3ORRA 2AWNA 3TTXA 5BPHA 2FUCA 2B5OA 2FFRA 2GKGA 3A25A 3O3CA 3PTLA 4HLDA 5HE9A 2NVUA 4P5EA 4POOA 1VHTA 4AWXA 2JAWA 5IYZA 2I34A 3PB3A 3F6PA 1W0CA 5KNBD 5L6MB 2CCJA 1KRHA 1HH4A 4NP6A 4RMHA 2NW6A 5I5EA 2PXAA 1C3OA 3A1DA 1KJIA 4LV6A 1NUTA 3IBCA 1F0YA 4ZVTA 4IR7A 4TRMA 3GBVA 5JI2E 2R6ZA 3FF1A 3NUQA 3S2GA 2R47A 4L72A 4Z9XA 4ER5A 4MITA 2PUVA 2YVUA 1UXJA 4MRNA 1Z74A 1UOEA 3N70A 4UZFA 1WB5A 3EYWA 3KEFA 5AKKA 3VR6A 4CXMA 4TVOA 3PX7A 1MAAA 2Q28A 1L3CA 3CPHA 4RGBA 3W2FA 4D9HA 3E84A 4KOEC 4UE2A 3AOEA 1IEXA 4N4AA 3FGOA 4BRWA 3MGBA 2EGGA 1H6AA 2FQQA 1PFVA 3QPUA 4QGGA 2EDCA 3CR7A 5DCUA 2CCKA 3QBDA 2PYZA 4U2DA 2XW6A 3FWYA 3RV3A 4J0FA 2I0FA 1EFKA 1WR8A 1E66A 2LUOA 3AETA 2XT0A 3RFVA 1R18A 4Q3KA 2ZIWB 4HLNA 5TX7A 3WVNA 1LLCA 1ONSA 3EC1A 2P41A 1FK8A 3MERA 1FTYA 2ZRAA 3BHIA 3VZCA 4KIGA 4DIMA 3TR6A 3ZWVA 5EHZA 1OTYA 1MIOB 3ZDDA 2CN1A 1C80A 4DKXA 1F38A 1GPMA 1X7XB 3CPSA 3QXJA 4IIJF 3THSA 2X13A 2BKVA 3HC7A 1W85B 4QM7A 3PA6A 3IT1A 4ZZ0A 2VLBA 3G9UA 5IP5A 3PJRA 4O02B 1QO0A 1UMBA 2IK8A 1X1SA 5IBCA 1ODTC 3OPMA 1KDTA 2Q07A 3GYBA 3MLBA 2VJMA 2CYAA 4WKGA 2JIQA 4F5ZA 1RPAA 3PUIA 2FSSA 3FRJA 3CRW1 2I6UA 1MO3A 2DU8A 2FN3A 1EFRD 1V45E 3PUVA 3F7MA 5HIMA 3MHPA 1DU4A 4BUZA 4CHTA 7YASA 2D5LA 3WNQA 1T3GA 2AA3A 2CJYA 4XUDA 4HMOA 5JH7A 5IJ9A 1V48A 3BWCA 2Q2VA 1CUGA 4RWZA 5H9WA 4Q1DA 3NATA 4R1SA 4FNOA 1YS2X 4JY7A 5FF9A 3ANSA 4NFSA 2UU9B 2C5FA 3MTQA 4IUBS 4M2LA 2LXNA 1JR3D 1TYDE 3VDMA 1HQDA 3ZV5A 1CD5A 2XGGA 2FMKA 3RC3A 5FA6A 1SBQA 1EVQA 1WXGA 4XIIA 5DGTA 1Y5RA 2P6MA 4P4UA 5JI3E 4DRYA 3LA8A 5JYCA 5DM4A 3FXAA 3RF6A 3SZUA 4EYEA 1XRPA 2I4NA 2QHXA 2QR2A 2FF7A 3AUYA 4AJ2A 1PNTA 3FPFA 3GNQA 3I2YX 3HLTA 4J0GA 3K1YA 5CJ2A 1C7IA 1J0XO 4YJ2A 4PZZA 1W4CA 3AKYA 5E4TA 2EF1A 2OCBA 2YOFA 2ES4A 1Z38A 2QORA 3ASUA 4AJOA 1TM5E 3I9KA 3OA2A 4LX8A 4BMPB 1ZOIA 3H4TA 4FKBA 3RTAA 3S55A 2BKXA 2P6PA 5J2TA 4E7OA 4KMRA 1ZSVA 4GEGA 1ZVKA 5FV7A 2NO9A 4AZSA 1YULA 4BVAA 1VPVA 3QLEA 4L8GA 1CC1S 1EDOA 1XMPA 2HSDA 1PGNA 1SCBA 2P4EA 4QIHA 4GMXA 3M1AA 3TQHA 5CA1A 4CF7A 4ETIA 1F17A 2R6HA 4LG1A 1O8CA 5TGDA 3FUVA 4P4TA 2DECA 4ZOCA 1RLTA 3AKZA 1SIBE 1XKQA 1Z5NA 1L7OA 1SBNE 2IPNA 4MPJA 5E0OA 3ANYB 4ME6A 1XQWA 3STTA 1RC8A 1XT6A 1FY2A 2WU1A 2P2LA 2AOVA 3HDTA 1VZ3A 3IA2A 3IFSA 4H1UA 4MPRA 5DLYA 4W8GA 1Y37A 1QPBA 3KQKA 4K6MA 1P45A 4S1PA 5B57C 5KJ6A 2UXCB 2VPYA 1E2IA 3ZE9A 5HOQA 4YPVA 1X2EA 1XDGA 3OKAA 3RFTA 3GVXA 3RUEA 5CFOA 2V54A 3LDHA 3OKFA 1TAGA 2I7VA 1TE2A 3C8DA 1I2BA 2H29A 4JJGA 2VT2A 4FMPA 4MHSA 4Z0TA 2ZVDA 3ZH2A 1SU7A 2AN9A 3RV4A 3UMMA 2PUGA 1K6XA 3MCAA 5BV7A 4QXAA 1YK0A 1SK9A 3UOWA 1GITA 3KXPA 4B3HA 4QFBA 3M83A 3LZ6A 4L3OA 4LZLA 2ZRJA 1X1CA 4OP2A 2LZ0A 1EU1A 4I8XA 3IXQA 5EC8A 5EP1A 4GZMA 8ABPA 1JFFB 4DLAA 1J33A 1NGSA 4BMYA 4E5NA 4II3A 4ND2A 4WZBE 4ZPXA 2O5RA 2BMJA 2FY8A 2PRIA 3TQFA 1A9RA 4IILA 5FL7A 4QXMA 1C7RA 1RYHA 1MB9A 5HHTA 3ZY3A 3U4QA 1XWWA 1M74A 1VLLA 4LGCA 3R3SA 4OLHA 4EF4A 4I3FA 1YI1A 1N5MA 1I9GA 1R0YA 2J5RA 4HWOA 2HXGA 2JJYA 4PQGA 3VQTA 1I94B 3Q3JB 221PA 3QVUA 1KFEB 4RVSA 3P9RA 3SDSA 2J6CA 4PZUA 1E6MA 1TMKA 3EG9A 3WYGA 1UT6A 3PICA 1VYUA 4YJ3A 3W4IA 1FXUA 2MYPA 4MA4A 4KX5A 2EQAA 2YQ5A 5K3DA 2X0EA 3VYUB 1UJNA 2G0TA 2QN3A 1YZLA 2CXHA 2J4CA 2JVIA 4S1NA 1I3LA 3BFXA 3H7IA 5LC1A 1KZYC 1RAEA 4PRYA 4G5GA 1G19A 1N2GA 2G76A 1MVLA 5KHLB 4ALNA 2IITA 3GP8A 3FPHA 3PGLA 1W25A 4M0MA 1T24A 1K0FA 3OT5A 5HRUA 4IIJA 2ZJ5A 4Y6OA 2ZRBA 2WTNA 5BORA 3LO5A 1DAGA 1G2QA 5FV4A 1OGYA 3KD2A 3IR7A 3LECA 4D4KA 3N28A 2QPLA 4LNUB 2ZETA 3S28A 4EHIA 4EMSA 3MEQA 1RMQA 3QBEA 4E32A 3L0DA 1VPDA 5HZMA 2C2OA 1E4EB 5C5EA 2PKQP 3OQPA 1C29B 4FW8A 2Z09A 5ED0A 1O5IA 2X14A 1B15A 2WJWA 1WB4A 2R97A 4UHCA 2NPFA 2NZWA 3RAFC 5CXQA 2WM9B 3BMOB 4EZBA 3LT1A 4BFCA 2XIQA 4XM0A 5AM5A 1CVRA 1AKWA 1EDZA 3V48A 1XTBA 3V4FA 3MGCA 4B85A 2J9GA 1BU5A 3O3OB 2ATXA 2R8EA 4RE6A 4EEKA 4QA9A 3IP3A 5F3RA 1G5TA 2FDXA 3JXEA 1R3DA 2HJGA 4OHRA 1WZNA 3C6ZA 4D4JA 3KPVA 5C5IA 1GZDA 3OICA 2HHCA 4Q9HA 5KU7A 1CNEA 3DFFA 1HPLA 1K92A 1ZIPA 5F73A 1XXHE 2QW1A 3JQ8B 2V6JA 3QPDA 1BRMA 5ALXA 1LSSA 5ICEA 5KTYA 2ZCJA 5CNMA 1M2VB 4OF4A 4LJSA 1Z0DA 1NFFA 1WJGA 4QPNA 3I6YA 4PLVA 1W47A 4XUEA 4YH1A 4HSGA 4CDGA 4P0TA 4GDMA 4RGVA 4ZT6A 4HQ6A 3ETCA 1MLDA 2GA8A 7MDHA 4CQMB 1XAGA 1UFVA 4MR7B 3IKVA 3ZLVA 1K8YB 1YIAA 1IK4A 2FPXA 5CCEA 1KC1A 2HLHA 4UXHA 3PUXA 1NW6A 1CIPA 2HXSA 1E4YA 2GPBA 1GCUA 4A8JC 3DHEA 4GDFA 3VUEA 2YJTD 1MJFA 1Y8ZA 1J2JA 3JZDA 2GJ8A 4OB6A 4EDHA 4J76A 1E2BA 3B85A 1XZBA 1Q1BA 4QE3A 3AVPA 4B3SB 4IV5A 4MVWA 2H4ZA 3VMFA 4B3BA 1BDHA 4PIVA 3BZUA 3AUJB 2IY9A 2MSEB 3DMHA 3N75A 2J4DA 4TLEA 4DA6A 3LUAA 2PX5A 4ZQEA 5AO9A 4DUZB 5DEOA 1BH2A 1M83A 1OGIA 4P4SB 2C57A 3TE7A 4EKGA 1DPFA 3Q72A 1Q1GA 2OEPA 4Q6WA 4OX9Y 4JOBA 4Z8YA 4QJ3A 1V8ZA 1CCWA 3MF4A 5CUQA 3LQFA 3OP4A 3O91A 5T57A 3GVPA 3VYRB 4M7WA 4PHTA 2Y4NA 5AKIA 1QRSA 2YWJA 2B5VA 3AF5A 3KIPA 1F20A 3ULKA 1MJGM 1JEAA 4JLWA 4KQIA 5LDHA 1QK4A 2RAPA 5HZGA 4EI7A 1KY4A 4MPTA 4WNIA 3ND5A 2DBYA 1J49A 3KT0A 3KZNA 4OQ4A 1KJ8A 4UOZA 4X0EA 2JARA 1TGYA 3PXAA 4OUDB 3DTVB 3OCXA 4NNOA 3T15A 1J06A 3ZS9A 4QX6A 1JB1A 2P9QA 1O89A 4BMZA 3Q7QA 1T25A 2A5JA 4Z3KA 3MRSA 2V4MA 3VNUA 2D1RA 2YCLA 1YZHA 1RPTA 4FSHA 1RS0A 3F3KA 3NVMB 4G26A 4J3FA 4N54A 3ZWQA 4AC9A 4L5JA 4EBFA 3T1HB 2CNWD 4R2JA 5L4SA 3GJSA 4ZQFA 3JYNA 3RYFB 2WIBA 4WZAE 1DZIA 1QZTA 2OD2A 3FETA 3TRJA 3X2SA 1OI7A 1ZW6A 4N0DA 4YMWA 4OPMA 2B8EA 1CY7A 2WF7A 3WV4A 1OWOA 2W0MA 3BFKA 5BV8A 1DV1A 2JCXA 3C5WP 4ISCA 4WFKA 4UVGA 5FR1A 1K6EA 2APJA 2H11A 1BNCA 1F0KA 3AR4A 4QD3A 3R8CA 4EFMA 1A4RA 1LJUA 1O97C 1U11A 4X20A 5CRIA 4YLGA 5FPTA 4CTOA 1H94A 1R5NA 1XNGA 1D09A 4JKYA 1CQZA 2OP0A 1Q7TA 3QBVA 1M2KA 1YF3A 3NDBB 4GIBA 4O4LF 4AROA 4ND7A 1U5BA 2QN8A 1Z35A 3IKJA 1ZLXA 1LW7A 5A3SA 5L3QB 1I1HA 1ZH0A 2JG3A 1GSAA 1I4EB 1CEQA 3C6KA 4JZYA 3ZWBA 2XXAA 3B6EA 4RVGA 4XJSA 3PENA 4EECA 3ZIDA 3IUSA 4ZAZA 4UNRA 4C88A 2RJ3A 2VBCA 1RZVA 1YJCA 3DJFA 4YALA 5JAHA 1UH5A 1XTIA 3FFXA 3DLPX 3PNMA 4CKCB 1SXQA 4M8LA 4LWQA 4RTPA 2FPRA 3A3NA 4R8VA 3QYPA 1A7AA 3NHFA 1IQ0A 3GD7A 2V3WA 5ITZB 2C42A 1UMCA 1II8A 1TO2E 3DAPA 3KQOA 4UEQA 5DVZA 3QX3A 3QKWA 3ZW9A 4E2ZA 3T9EA 4FB4A 3ED1A 3IPCA 3VH2A 1JEOA 2BGWA 1QWOA 2XUDA 4GOMD 1IWOA 1OE0A 3HRIA 3IEXA 1WMEA 3SHOA 3CN9A 1EGMB 4TL9A 2E1RA 3AVWA 2GXUA 1N77A 1QZ3A 2O6LA 1B4DA 3PQCA 4UD6A 3I1YA 4LWPA 4TVKA 1ABBA 1IHDA 5JD3A 3W5JA 4L7QA 1MF7A 2VSOA 3A6DA 2ZCUA 3NHKA 4ITRC 4JOSA 3K05A 1P9LA 2Q62A 1UC9A 3RRZA 4HKTA 2RKBA 4RPCA 3NH9A 1NF2A 3GCXA 1KP9A 3LT0A 2WF8A 2XKJE 4DZZA 2Q5CA 3ZEIA 4R5MA 1HV8A 1C3VA 3N3AC 4UTOA 2CVZA 4ANFA 1SHJA 2W6ZA 4DCCA 3SJCA 5HZKA 4UUQA 3KEQA 4UTRA 4XGNA 5CBKA 5KNLA 5IVHA 1QP0A 1WMSA 2C8KA 2WKWA 4JI4B 2H06A 3AIIA 3NEJA 1NRIA 4CE6A 4O4HB 4YACA 1ODKA 1S96A 2P79A 4OOEA 2WQZA 1POWA 4BX0A 2D5BA 2PFSA 1L7DA 3CPEA 3KPUA 4H77A 3A28A 5AW9A 3WWCA 1ECLA 5BT9A 4TPKA 2DPMA 2JJ2A 2NXNA 3HKCA 5IDQA 2XNDA 2GD1O 5TEWA 1NAIA 5JCJD 2J48A 2MSCB 1UL1X 1U4NA 1VZ2A 4YRDA 1Z34A 3EMBA 1NV9A 3A3OA 4ZV4A 3Q3GE 3BJIC 4ZT2A 2NSJA 3F5DA 5LQAA 2PO7A 1GKKA 1SULA 1KZ6A 2YHAA 1UOPA 3E1SA 3WGGA 4BMDA 4Z51A 1L4BA 4Z8XA 2VF4X 2BGLA 2QJWA 4GHWA 3H4MA 2ISQA 3ENKA 1ENPA 1MRZA 3RR2A 4ESHA 4INJA 3AM3A 4PHFA 5T6MA 1G6OA 2HDHA 2Z5LA 3NIWA 4EJFA 4LSGA 1Q14A 2A33A 1E20A 1CJSA 3UG7A 3GIWA 4Y2GA 1P1JA 4M60A 4D9CA 4ARCA 5F5LA 1UWCA 2BGIA 5FFMA 3Q8MA 3Q11A 2VKTA 5K3FA 2IHNA 5AW1A 1GHTA 1IG3A 2JGMA 3FMFA 4N0PA 2GSWA 4RIFA 1ZJWA 2EL7A 1CKEA 5B7GA 2J0VA 4UQOA 2W4MA 1DBQA 2Q6TA 3MPOA 1G18A 3EPHA 3AVYA 2Q3LA 3DBRB 1T1SA 2XVYA 1LPPA 3MS2A 3W78A 5JSKA 1DEHA 2E37A 3AVUA 4IF6A 1R4ZA 2AJLI 1RWPA 1SHZA 4PGHA 1RQGA 4HP8A 1YKFA 3WADA 4FCCA 1ZCAA 2PH3A 3KOZA 4C0JA 1TKRA 2FZWA 2XQVA 2QYTA 3L93A 3PT9A 4YGXB 2C7OA 2NACA 3SYRA 1WHTB 1RBZA 5EESA 3UV6A 4JBNA 3A58B 1XJ5A 2R1VA 3Q3CA 5CG1A 5HK9A 2PUDA 4NCHA 4CQMD 2O8DA 2QAGA 1VCMA 4NU6A 4W5NA 4R51A 5C1PA 1PF7E 4Z9YA 1ORWA 3CMMA 3VNQA 2GT1A 2JJ1A 2OCXA 5G02A 3IAM6 3OHSX 4JA2A 2GH1A 4HN9A 2VK1A 2XCQA 1OX6A 1KI7A 5U1PA 4C6HA 2WYVA 3WLTA 3OCJA 4D56A 3O2SB 1I2MA 4TMWA 2AL7A 2HJVA 2PNFA 2NQ8A 1ILEA 4HF7A 9MHTA 5C31A 3L1HA 3UMCA 3VYSB 4O4LA 1WCIB 1TNDA 1HQYE 2AJBA 3U3KA 4ECEA 3GC6A 2IYEA 1L1RA 2YVLA 4DQXA 4OMUA 4B6QA 3OEYA 4FONA 1XD8A 2P0EA 3STVA 3WS7A 1RHJA 4IZHA 2AMYA 4XDYA 3B7GA 5CK5A 1ONPA 2OOSA 1ORIA 3VBCA 4CUZA 5ICCA 1QQAA 4R0NA 3STHA 5T5QA 3T5DA 4HVLA 1VGVA 4OQXA 1NUUA 3KR9A 4I5IA 4I4LA 3R7DA 3U7RA 5LLSA 2EEZA 4GR9A 3TTWA 3YASA 2V6FA 4TRNA 1K7EB 2DFNA 3OP1A 4F71A 3IBTA 3E4CA 2K2QB 4O1HA 4DHWA 5HOEA 5H3HA 3I5XA 4LDNA 1IVNA 5K6TA 4QBTA 5JBIA 3EXHB 3M4NA 2XUHA 1T9BA 4ROSA 3DTVD 2RGXA 4MHOA 1R6XA 3SHVA 4QO8A 2YCBA 1G0NA 3MYYA 5DASA 5H5JA 1KI6B 5A4IS 4W63A 4QUHA 5HCUA 3KWJA 5E7JA 1H6DA 1C9NA 1NY6A 5DHFA 2F4VB 3U61B 2WRZA 1JE1A 2BFDA 1N9ZA 3OWHA 3TLJA 3SE0A 3TW8B 4LCBA 4LYGA 3U60B 1PGJA 3T0IA 3LKDA 1R00A 2GYVA 2BM1A 1DQYA 3CO0S 3WMGA 2QN6A 3BJEA 3TPFA 1YCFA 5EPEA 2RBKA 1QIKA 2O52A 4ZVLA 4DV3B 4L50A 4EGSA 2YDXA 4K9LA 4X93A 4HUQA 5I9MA 4F4DA 4AWBA 3K0KA 4Z7JA 2IXTA 5JXJA 3PHGA 3O5AA 2GMWA 1EGQA 1XBTA 3AM1A 1A9OA 4R8RA 1WW2A 4ED9A 1SIWA 2WKRA 4X71A 2XB2A 2BKLA 3NWEA 3IQGX 5FFNA 5LP6C 1V1MA 4YJFA 2IZ7A 1ADJA 2AK2A 1JXMA 1HYEA 2VYVD 3IUBA 5DRYA 1UFRA 2DFKB 5A5FA 3GPCA 4DV0B 2A4KA 2JLBA 2L82A 4OQEA 1OLXA 5E95A 2PMEA 2PGXA 1IBCA 1Z7YA 2JD1A 2GJSA 4Q21A 5DHTA 4IIVA 4FWIB 1EWYA 3UFXA 2GPNA 2A9PA 4WDQA 5AIAA 4YRQA 2PYDA 3CRRA 3REQB 2Z6QA 2VUUA 4TTAA 1OXUA 4MLCA 3NPMA 1PD1A 4ENSA 4TS3A 1KI2A 2FUG1 4BBAA 1X7WA 3MQ4A 5BV0A 3CSDA 4YREA 2NSHA 2IU0A 4ARVA 4M9ZA 1KYZA 1PLKA 1X92A 2AC7A 4IICA 5IASA 4YUXA 2ONYA 1COWD 3PJDA 4HLQB 1LFDB 3MS7A 3IOEA 1ID1A 4GM0A 2WKQA 3FYDA 4CFYA 3VKHA 4GM4A 3UKDA 3MELA 3GHHA 3LVRE 3QPAA 1B7GO 2IS4A 2HT6A 4BDSA 4BOYA 2XVZA 4ZYXA 3FBWA 4BRZA 1KQPA 2Q5HA 2FN9A 2XD9A 3CZMA 4FZJA 2C00A 4JVSB 2GK7A 4X7PA 4D6YA 5K3OA 4WTOA 3BXPA 4PSKA 3OLCX 3D4NA 2FH5B 1YVEI 1TEZA 5TQ2A 1JQLB 1U0EA 2H5IA 3UHOA 2IBTA 3V7YA 1FTSA 2QB5A 3LVBA 1FSPA 1UZAA 1SEVA 3KC2A 4U0JA 3VO1A 3WGQA 4F72A 1TRKA 4Y0VA 4IJVA 1KNXA 4RY0A 4TLMB 3R0QA 4IMIB 4TT3A 1SBZA 5DNVA 2GXAA 5CTJA 1ZGJA 2HK8A 4Y2SA 1TKCA 3KBBA 2FLKA 2P3LA 3IKMB 4MI6A 5HS6A 4TZ6A 3NR2A 1EFVB 2I4RA 1JQ5A 2QOEA 4YJHA 5EFOA 3HUFA 3DEAA 1HE4A 4HOYA 5KJEA 3NV7A 4MQMA 3ZG6A 3D59A 3OIWA 5KNDH 1LGYA 1L7XA 3H75A 5AM1A 2P6NA 3U4GA 2C94A 4YMGA 3WB2A 4MVJH 4FDAA 1ZMRA 2BEWB 2HMUA 1GVNB 5A03A 3ZZ0A 5B58C 2XUQA 1E9SA 3LOUA 1GPH1 1E6UA 1MOPA 2FQWA 1JILA 1LLFA 4GZ3A 1DKUA 4Q3BA 3H8JA 2B25A 1V6CA 4DOMA 1ORDA 3GRZA 1NMZA 4CLOB 5AJXA 2SKCA 5KYUB 2OLEA 2IYSA 1EZ1A 3MPUA 1CUZA 3UJ7A 5FUVA 2X8AA 3QW2A 1RR6A 2WG2A 3K2IA 4RGYA 4WBNB 1N0UA 2ZT7A 1MUUA 3K9CA 3TR5A 2B82A 4OQPA 5E38A 3QOYA 1JZQA 4N6NA 3FSJX 3RHTA 3BXEA 5BSMA 1YD7A 2H51A 1YQWA 1ND6A 4EAQA 1RXUA 4PCUA 3FOZA 2K4MA 2QGZA 2IS6A 1BN7A 1YQQA 3F6CA 3HJHA 2WUDA 2B2CA 2EYQA 3F73A 2VP4A 2G4LA 1O95A 1A95A 1JU3A 4PZAA 4JI1B 1RKBA 4UFPA 1JVSA 1NNEA 3IELA 5CLLA 4OLBA 3ZD9A 1PFKA 2GK6A 2HAEA 3OCWA 3QUSA 3FB1A 2LWIA 2FSIA 1K8QA 3RTGA 4ZYTA 4C6SA 4R41A 2RHBA 3THYA 4KDEA 1GL9B 4PPYA 3RARA 1X1TA 2H92A 3OU2A 4HX9A 3R76A 4D3ZA 4BV2A 5BW4A 5KTPA 4YCSA 3P5BA 2UAGA 1QNLA 4MUKA 5KOHB 2BP7B 4BFZA 1O57A 5JMWA 3ZE6A 2AH5A 3JZAA 3VPDA 2PHZA 2WINI 2C8LA 3VH1A 3R7BA 1ZNZA 1GU1A 2JBAA 2G7ZA 5AKYA 5AM2A 1IG0A 1DE0A 4HFNA 5CDGA 3NHRA 4TTPA 5A7GA 2GZRA 4UXJA 1MORA 3NVAA 3FPGA 1YB6A 1NJ5A 3C5VA 1SUSA 2HNBA 4U9HS 2DLDA 4HH1A 1OREA 1USWA 5EXEA 4MS3B 1G8JA 3IO3A 3JALB 3H11A 1UXGA 2NG1A 3T4UA 1ULAA 2VUHB 2VRBA 5B37A 1ISPA 3FSRA 4IMRA 4K0RA 2YXPX 4KYTA 4DWOA 5AI8A 1E9CA 2FPIA 1W76A 1FRFS 2HJHA 5LA6F 3C16C 4KOAA 1EWRA 5ECGC 4AS3A 3HA7A 5LD2B 3NVKI 4ARSA 3SHWA 3I2JA 3U0VA 4B3MB 2A9QA 4R31A 3PQ4A 3SD7A 3WKAA 2Z4SA 2OO3A 2QX9A 1ZDMA 4F5DA 5KCZA 4W5OA 4KREA 5HZHA 1G64A 1KQ3A 4DDUA 3Q5GA 2XA9A 2BFCB 3DB2A 3MGKA 2V7EA 1N2XA 3AI7A 2YFHA 3PDUA 2VP3A 3QI2A 1PZEA 1SA0A 4JXJA 3AEKA 1W46A 4K28A 3C5CA 2REXB 3AHJA 2FG7C 2C7PA 1DIGA 1KYYA 3ET5A 2G5PA 2PM8A 4EGAA 1QYRA 4AQYB 2VRCD 4RY8A 3LKVA 2VAXA 1CDZA 3CISA 4KAAA 5JTTA 2IS1A 1NQWA 1JSRA 3CCCA 2YJNA 2NO0A 2GO1A 2CUNA 3HUUA 4Y2TA 1GGEA 5C3UA 1H1TA 2Y77A 5FOSA 1UBCA 4TMYA 2B3TA 2XHZA 2WWIA 5E6SA 1IC6A 2EW8A 1LQ2A 2MT9A 3DCYA 1MABB 4D7AA 5KKAA 4RQBA 2WWTA 4AK9A 1I3MA 4HI0E 4Z2YA 5LXTF 1P2GA 1P80A 2J32A 3L7NA 5K09A 1YBFA 5KAMA 3U44B 1L5MA 3HXTA 5D3MA 1TT5A 4DA0A 3DT9A 1W1IA 2Q41A 3DE4X 4UDXX 1DOZA 1EUQA 1YA6A 3TSWA 1OR8A 3VMMA 4A4DA 1IN7A 1NN5A 5C1OA 1CJKC 1XZQA 4DPMA 5AVVA 3UBMA 3VYVA 2H4FA 2Y3IA 1NNUA 4RK0A 4AKGA 2E85A 4BVJA 2W6JA 3WGLA 1EHYA 3WYAA 5KS2A 4IIFA 2W2PA 4NEGA 3RK0A 1XAIA 5ILGA 3KYCA 3DVSX 3ZCUA 2P9CA 4YP9A 4UVHA 4KWHA 4TZKA 4CL0A 5DI3A 3DFKA 2MHCA 3V4ZA 1E1RA 2HWUA 2WFAA 3DBVO 1LC3A 1YAHA 3K20A 3L7LA 3TI7A 1YB2A 2O23A 4MXDA 1OH6A 5DEIA 1S8OA 4E0BA 3Q1LA 2Z2JA 4H7JA 4X6YA 2YRWA 3V2HA 3GA0A 3RUDA 2N1BA 9ATCA 1QLJA 1EBUA 1XXHB 4LVNA 1Z68A 2ZJOA 2XUPA 1MA0A 2G3YA 5CFQA 1W5AA 3I01M 3GRCA 2B4RO 4PZCA 4EW2A 1OLOA 1WUTA 5LYYA 1HX7A 4EY8A 4CF5A 3DKPA 3GCDA 1GQFA 2BR5A 3S7TA 1V96A 3BCHA 2DFTA 3PGJA 5DGIA 2IFTA 2QLNA 3FCOA 3LC2O 4O1IA 3AWIA 3SKXA 3ECCA 4ARBA 3F67A 4KRGA 1SCDA 3GI1A 3K9NA 3I2KA 3P27A 4W5HA 5JNWA 1S2GA 4DIDA 5L4NA 4YCBA 4ZOEA 2PX6A 1ILWA 4DVJA 1W0JA 3EVAA 3DZBA 1G0OA 1GVHA 1R74A 4PTZA 4KKVA 1W30A 4R98A 4UNNA 4CEHB 4DSNA 3C4QA 5I3ZA 1VPWA 4D81A 5COQA 3AC0A 3F8WA 4MV7A 2PRSA 3NV9A 1DBWA 3EQ6A 4TV9A 1TZMA 5AOCA 4WOBA 2C58A 4UHJA 3JCZA 2AG5A 3KKNA 1NVKA 2YKGA 1ZUWA 4FDLA 4G24A 2A5GA 1FP2A 3G8DA 4Q3LA 3FYUC 3G2IA 5E1DA 1AKEA 4U7FA 1KXZA 2Q3DA 3IPAA 5E8RA 4ILEA 2E18A 2IE0A 3ESQA 1G98A 4HQ0A 3QY9A 4FFVA 3T9BA 4BNDA 2YV1A 4AO6A 1LRJA 4PC7A 2AMLA 4UBNA 2NUAB 5IWAB 3BBLA 2GBLC 1QX3A 1ZVMA 3BEDA 3LHIA 4CDNA 1ZJJA 5DN6A 3WQSB 1FNMA 4IUDS 2XE8A 2MU1A 1Z6TA 4RTSA 3O8RA 2Q8PA 4RZ2A 4KH1A 3DAFA 3QY0A 4E2YA 2B7CA 3ANXA 3FDFA 4IHQA 2F4NA 2VKQA 1GFSA 1O97D 1T1GA 4PNHA 5DTJA 5EWMB 5AT1A 3RSGA 1WV1A 2QM3A 5C32A 4LPKA 3T4EA 7AT1A 2FVXA 1Y5MA 2IEAA 3OM1A 2JIZD 4BQSA 1QYVA 4IPTA 1K2WA 2BMVA 3HY3A 5C52B 5LP6B 4GI7A 3FROA 2AN4A 3KOWA 5FNZA 5IUJC 5LA6A 3IT3A 4KXMA 4WECA 5G0VA 3RVOA 4OQFA 3SICE 4AKTA 4BLTA 3EPKA 1CZOA 1J25A 5JXHA 2AK3A 2XLBA 1O6GA 1RJFA 3EWNA 4MDYA 1LZKA 2ZWAA 2JH8A 1IULA 4GXQA 5CT4A 2IWHA 2YHSA 3IILA 3TMYA 3WQBA 2OYCA 2IYQA 2IYWA 4NCJA 4YK7A 2OYSA 4E5SA 3H2KA 3NS7A 3MVEA 4QYWA 4YAKA 3WB0A 2FETA 3DMTC 3VI4B 1HT0A 3K3PA 4GBED 2AVDA 1R0CA 1NATA 3PS9A 3GFPA 4B43A 2R1TB 1OXVA 3MWFA 2GN1A 4PLFA 2XWQA 1TZCA 2Z3ZA 1XRMA 3AF2A 4IRMA 3SU8A 4PYJA 1ZN2A 2Y9PB 3HABA 4UNPA 5HKLA 1R4MB 1T2FA 2I29A 4GF5A 4REMA 3V32A 4NZ9A 1VYTA 3UGTA 3V4OA 2QTGA 1CQIB 4D99A 5H4GA 4AUKA 1E0DA 1FFWA 2FSVA 3UK2A 2I8LA 1KL7A 5JMOA 1WETA 4ZC8A 2AEFA 2QRMA 1JR2A 1OILA 3ZBUA 3ZUGA 2IS2A 3UAVA 4Z53A 3TSZA 3WIVA 3CLUC 1XQ9A 1EP9A 1XHLA 1T10A 3P2JA 4PNPA 2X15A 2ZYWX 3KT6A 4RJKA 4G67A 1RBMA 1QRTA 2C2ZA 2FWBA 4ZCRA 3KKPA 1VHLA 2FYTA 2Y67A 3O75A 4WGFA 2CFIA 2PD3A 4FQ5A 4B47A 3JQRA 4ZOLB 2FW7A 3EJWA 2AE2A 2CJWB 1RT9A 3JVIA 3MWLA 4LDPA 2VHQA 4AJIA 5D00A 3O4HA 2ZRNA 3UHAA 1Z25A 3BAZA 4HQLA 4BVBA 1JHDA 4LI3X 1CB0A 1DO0A 4GOKA 4BBJA 5K0GA 4ZKDA 4IJUA 1QV9A 3NT4A 4PCAA 3VR3D 4AG6A 1V3QE 4B75A 3ROPA 4TWJA 3RS7A 4MA5A 2POQX 5H68A 1V1JA 2DG2A 4WK4B 3FFAA 1QBGA 3H5TA 4WESA 3WK6A 1ZJYA 5HE8A 5LBIA 4CNQA 2KX7A 3BIXA 4FLEA 4M21A 3TNJA 4CLDA 3KQUA 2VP2A 4ZJUA 2GWRA 2XQIA 3RROA 3OX4A 1BWPA 1T4GA 1Z5VA 1ZOPA 2AN3A 2Z4RA 3AONB 3BMCB 3G6KA 3KVYA 1N25A 4H4DA 5A4JA 3CBGA 1TGVA 4JVLA 1NXQA 2JZNA 2I62A 4TTQA 1BW9A 1CS4C 5HGXA 4O2AF 4ZEOA 3DA8A 3PYLA 3LY8A 5MGNA 1Y1KE 2EHJA 4EJ2A 2OCLA 1WL8A 5K8JB 2JKYA 2X2OA 2F90A 1PQYA 2F64A 3FG9A 4RPGA 1YZNA 2HRBA 2J4FA 4FQ8A 3LKBA 3LBNA 4IAOA 1T0HB 1IHXA 2OL4A 2H3HA 2VJOA 3EIXA 3I45A 4H7PA 3AEZA 4GXTA 1TLTA 4RZSA 3S2UA 3WLIA 4RXMA 1S2IA 2FB9A 2Q21A 3PX2A 1L8QA 5JC8A 3IMCA 2Q3HA 1YNSA 1XALA 1ULUA 4FX2A 3K0CA 3S8MA 4C6TA 5AI6A 4DXHA 2OV6A 3B6ZA 4LGYA 4Z2AA 1UJ4A 3E15A 4XTRA 2GCPA 2FQXA 3GLFA 1GGHA 2DHCA 4JASB 5WRFA 3E9YA 4NHEA 3ONEA 2QBYA 5EUQB 1M5UA 2QF7A 4KBGA 1EX1A 3MMSA 4BY9E 4FFDA 1U65A 4EHHA 2FPLA 3CGWA 3IPYA 3L01A 3MRVA 4KGXA 1JAIA 5JO0A 4KQKA 5HTOA 1MO4A 3LW7A 1SOWA 4TWAA 3TPZA 5BR8B 3GAMA 3TCXB 3VO9A 4UEKA 5CJPA 4MYHA 1I2CA 5TR9A 1IZ9A 4GM1A 2NSDA 3O82A 1W94A 4C0QC 1P91A 2BEJA 2VNAA 3EXG1 3VJKA 2V7GA 2Q5IA 4UNSA 1VLJA 4YLEA 3WYFA 4FN4A 4A3SA 1R27A 1CVLA 2QTFA 3GPBA 2HV9A 3RRNA 3OZCA 1AQIA 4IIDA 1FFEA 2PGDA 2FWIA 3IUMA 4E46A 5ICGA 5IKOA 2VDPB 2HOQA 1QFZA 3H9QA 1TF5A 1M1UA 4R3WA 1HNXB 3QG5A 1PEKE 3HWWA 2ZRKA 4IXMA 1XZIA 1KVRA 2DWPA 5DTEA 3FCYA 5FCDA 3CB4A 4BNNA 5HKOA 2D7JA 2O2HA 1BXRB 3OLYA 3R24A 4TX1A 5CM2Z 3WFZA 2F00A 1VP9A 1MG5A 1ZH8A 2AJDA 3ESRA 3OE7D 4EFDA 1AZSC 1XEWY 3CVXA 2FX5A 5L7YA 2QTBA 1XLUA 3G2HA 1NVTA 3OY2A 5D5PA 3S27A 1RRVA 5J43A 3WSVA 1K4KA 1YTUA 3ZU6A 5B7QA 2Y0BA 2YYSA 5MFZA 2IW3A 3BIOA 2OV4A 3OPNA 1Y3FE 4HPJB 2BD0A 5I48A 2FWMX 2SNIE 3LQKA 5KMGA 1RWBA 4AZ3A 3SVLA 4DBVO 1QR2A 4TN1A 3MGAA 2O3UA 2PK3A 4RL6A 3ZCSA 4KN8A 4UXIA 4CI9A 3KETA 1G2IA 1XR3A 1Z2CA 4K81B 4Y9SA 5E3IA 3ABQB 1SXHA 1FDSA 5JHHB 2F1HA 2FRXA 2VTEA 1NYRA 4YUVA 4BO7A 4XRRA 2UYOA 3L1KA 4BE4A 3GJ5A 4JX8A 3QXHA 1B8UA 1MNAA 1U8XX 3AFMA 3O3NB 4EQ6A 1QX4A 3ZV7A 3SF8B 1XZJA 1Q74A 4O4IB 1VBMA 3S0JA 5I9SA 2QUAA 2VWQA 2OXCA 1U9IA 2CFSA 1OTHA 1E60A 5EY5B 1ONNA 2BH9A 1AN0A 3CB2A 3JPWA 4IS3A 4UCWA 4XAQA 4DGQA 8ATCA 5IXYA 4BV9A 5JD4A 1ZW1A 3NT2A 2G9UA 1FYFA 4P2GA 4WZZA 1O0SA 3CEPB 1F1JA 2GK3A 2R7AA 2RB4A 3KLMX 3OLZA 5LMNB 3UIEA 5C8YF 5IVPA 4I50B 3DZCA 5KWJA 2PH1A 2R86A 2OQ2A 3EDRA 4ZDWA 3ZDQA 1NJ1A 3LUCA 2IHVA 3NXSA 4GGPA 1X7ZA 4MEBA 5AUNB 3HCDA 1EI9A 2HHAA 2NV6A 2Q50A 3EUAA 3G5MA 4YR9A 1TPZA 3C1OA 2Y6VA 3A9TA 3LAWA 5HMLA 1YL5A 4R7GA 3N5CA 1EG7A 3PNSA 4WCFB 1HDGO 3TDNA 3W9UA 3GFVA 1PZHA 4P8RA 3SZLA 5CFMA 3EDCA 4O2BB 5SY6A 3CX4A 1P0QA 3UF0A 5KNBH 5KYYB 4DCVA 1N2EA 3P0EA 1Z18A 2RC6A 3HV2A 3BL6A 4CFZA 3PGKA 4L9SA 5BN5A 1MB0A 2J3EA 2PX0A 4L28A 2C8VA 2DQ4A 5ER9A 1DXOA 1MAVA 4O2AA 3LQ1A 1M6VB 2PS9A 4REQA 2RKWA 2JLZA 1DGQA 4TMFA 3UWDA 3KJXA 1CV2A 4FZRA 2XE4A 4H7IA 3I4LA 4CM7A 2ON6A 3LHDA 3OOSA 4TLDA 1CE8B 1UZMA 4WLOA 4PYMA 3PI7A 1XHFA 1N0IA 5JVDB 2JI4A 1SOVA 2IXFA 4OHCA 2X0RA 1CBUA 1CQPA 3OKCA 5K6RA 1MIHA 1SVMA 1YASA 3A6HA 3QWBA 2R3SA 3NBZC 5C4IA 4ZEVA 3V42A 2VHEA 5KKNB 1QYWA 2P40A 3JTMA 5CD9A 5LZ2A 1HL3A 4I5EA 3TIGA 4TKVB 8ADHA 2VEOA 1T0UA 5HKBA 5ENDA 3MXOA 3IJEB 1TJNA 4DR7B 4F3RA 3SZRA 421PA 1KFJB 2HF2A 5JNLA 3R7WB 2J0QA 1FW6A 5TSDA 2W6CX 3AUUA 4HLCA 5AUQA 2ZUWA 5KOJB 4U5XA 4XIJA 3FUCA 4PYLA 1WS6A 3THWA 3IBSA 2OSBA 3I23A 4RIHA 4B83A 4F4IA 3ELUA 1GQ2A 1II0A 3NI2A 1TA4A 1PNOA 1C1XA 1VI6A 2AW3A 2QTVA 2VF7A 2XOEA 3HNOA 4UZSA 2WMYA 4R1PA 1USUA 4CMCA 4DT1B 1IBLB 4NJOA 1A8IA 2G25A 2CFRA 3V1UA 1JFSA 4GRDA 4ZDJA 5E7MA 3ESAA 3FYUB 1SKBA 5K0BA 2K7FA 3UJBA 3M5DA 2C9CA 2FG5A 1G8MA 5BNZA 1TVEA 3RYHA 3H0EA 1PZXA 5JZSA 1GGMA 2QS9A 4DMCA 2I2CA 2Z43A 3W0LB 4CVNA 1NWCA 2FPMA 3HCNA 3LXMA 4R0VA 5K0ZA 1GXSA 5AJZA 2ZM6B 4F21A 4OGLA 3P9SA 4V0NA 3AL2A 1FA9A 4E3ZA 4F8EA 2IP4A 3LCMA 3AUSA 3O1LA 5EMJA 4JI3B 3WLQA 4OBEA 1PFUA 4S2UA 1CTQA 3RVBA 4CIBA 5ITWA 2OK8A 4ZDIA 1U0HC 2P67A 3KXIA 3OZVA 3VR4D 3KZ1E 2O8EA 2PZBA 4C4XA 2NV2B 1N5OX 4WLVA 4CMIA 1GPNA 4F06A 2OQVA 3BMXA 2W2LA 4YCAA 4G4IA 3GA7A 4A6EA 4EHKA 1JLHA 2XOKD 5HPYB 2B92A 4AQDA 1F48A 3MB8A 4WK0B 1BCRA 2AV6A 1YHNA 4FKZA 3WMEA 1U2DA 3HB1A 4DV6B 2W2KA 3SR3A 4X8LA 2TMGA 5K0NA 1AQLA 3CNLA 1SELA 3RIYA 2QYOA 5B1EA 3Q7RA 2QMZA 1M67A 1TA9A 2PA3A 1OROA 1AV7A 2YXBA 3T7CA 3W6ZA 4KN5A 3M6LA 1Z22A 4XKJA 4GI1A 3EFOA 1FX0A 2EQ5A 4ZEWA 4ZK2A 3ZIAD 3AW9A 9ABPA 3OCYA 2ZZKA 1Z7EA 1DL5A 2XODA 3JQEA 3ZWNA 1YGYA 4WBSA 2PX3A 2I9KA 1EE2A 4D9FA 4HYYA 4M1KA 4KYVA 1U8EA 5C8YA 3OF3A 1Q6ZA 4ZDKA 3IV6A 2ZKLA 1ZL2A 4J0CA 2QNIA 4QOGA 4RKFA 1YS1X 3I2GA 4RFSB 1PJ3A 3MD0A 4G37A 4BFTA 2ZM5A 2VHJA 3E05A 3PEWA 1T6NA 5JBQA 4HDAA 3JAWA 4HQRA 1NURA 4N7BA 2NM0A 3WK8A 1TXGA 2VTKA 3IOMA 4XPZA 1ISMA 1Y1LA 2XQGA 2NU9B 1EESA 1DC5A 1SUFA 3E3OA 1PR3A 3PCTA 3S3TA 4EABA 1HZZA 2DHRA 1UADA 4UREA 1HO3A 2R8ZA 3IAFA 3BQ9A 2EJCA 4X24A 4AG5A 4E33A 5C7LO 2DRIA 5JSZA 4CIXA 4K6GA 5B6JA 2Q9CA 4Y1RA 5ERGB 1YRQA 1DZ3A 2PTHA 3NGLA 3V8EA 4ASUA 4DB4A 1O77A 1GNVA 3KSMA 2WI8A 4Q4JB 5FI1B 4PVCA 2B8TA 4WFJA 2ZYGA 2GQ0A 3VHRA 1QO0D 3VYTB 1W44A 3ZLTA 4GLOA 3W5BA 1N8NA 1NT4A 4PO9A 5AVXA 2P77A 4AL4A 5MGBA 2BMFA 4QJIA 2MSDB 1L5KA 4L08A 1ST2A 2EFHB 2PQ0A 4WN3A 5ALEA 4B79A 1NIPA 5IBRA 3VGJA 5KPJA 1H69A 3QOWA 2LIPA 3D8NA 4EY6A 4FUTA 4HB0A 2DAPA 1F2TA 2J30A 1I32A 4L2IB 4DCUA 4HXGA 2RGRA 2CLMB 4D02A 1EM8B 1S0UA 3NHLA 2W2OA 4U2KA 3OO1A 3WI7A 1RJWA 2C97A 4A15A 1HF3A 1ZK0A 4C6RA 5JALA 2JKZA 10MHA 4Q7QA 1YFJA 4NZOA 2FJ0A 5TF0A 3S8YA 1NOKA 1UK9A 1WSBA 4HEA1 2XB4A 3ON5A 4BNLA 3DO6A 2R84A 2CXQA 5KUTA 2FDCA 4DB2A 4DV7B 1W581 4JODA 3UV7A 4IFBA 2BFFB 3PL1A 5FULA 4Q4CA 1VRWA 2PCJA 4CM8B 2YX1A 3WBJA 2XGSA 3K30A 4ARZB 1L7EA 4ZAVA 4D3DA 2QD2A 4RQUA 4GR5A 3D8SA 1P7VA 2GPSA 3MFQA 1TKBA 2NXCA 1WHSA 2EXXA 1ZI8A 3MTJA 4NX2A 4EMTA 1W2WB 3ZGLA 3T7RA 4ER0A 3HDHA 3R9KA 4G1MB 2X0KA 3U1BA 1MW9X 1TJPB 5JQGF 4RK5A 1WCXA 1VRCA 3M6WA 4KVAA 4RAQA 4ATNA 5KQLA 4OXQA 2CDNA 3L79A 1DCMA 3UMSA 1K6MA 2MINB 3QVVA 1P60A 2QX8A 2P8JA 1C30B 2ZUTA 4MA0A 3MTBA 1Q21A 2G9NA 4G0VA 5EMLA 2G9VA 1I5EA 3KKEA 3ZDFA 4OFZA 1YZFA 2D5CA 4V0RA 1XRSB 2Y1EA 3TZCA 2AMVA 3K94A 3E81A 1C4OA 3R3ZA 4NQRA 3FH0A 5EIXA 3B6JA 1KOLA 5AR1A 2XX3A 1O03A 3IIMA 2C1EA 1BWQA 4HATA 2B99A 1N1EA 4OTZA 3HO6A 4L02A 3Q7TA 4QQFA 2VQSA 1D2MA 4HMPA 1A71A 2CSUA 2VNIA 5AOBA 4UMFA 1NNSA 4DJTA 4DLTA 3AZQA 3S6JA 4QEZA 2H9IA 2IEDA 2VAVA 3SY8A 4PLHA 3OTQA 5IDVA 4FFPA 2FEKA 1YS7A 1FSSA 4BYGA 1ZAKA 4B3DA 1G20A 1V9LA 2XADA 4IHJA 2HWWA 1IY2A 2FRVA 3U16A 1VDMA 3IBGA 1R50A 3OQ1A 5DTMA 4F7WA 4OQNA 3L0IB 3AUXA 4CEIB 4NKRA 3ECSA 5AW6A 4B76A 1WV0A 1YJ8A 4PRLA 4HBGA 4E12A 2W43A 4KU4A 5A4MS 2C4VA 1K8XB 4YMVA 1YR7A 3I1JA 4R9RA 4BFSA 2FEMA 3OM8A 3GDOA 2GFHA 2XZLA 2CNDA 2ZJ7A 1VJ5A 1Z06A 2B8WA 3OIDA 4PZLA 3RTCA 1R0BA 3K9WA 5FA5A 4KP7A 4RNDB 1N4AA 1SH7A 3VNAA 3LPNA 4XARA 1Z2EA 2OC9A 3EXFA 1XDZA 4NBRA 3K0FA 1OXKB 4H17A 2VJKA 3K92A 5LWHA 1W88B 4JGBA 1DHRA 2WAXA 4B73A 4JEIA 3SYTA 3VVLA 4IEFB 4OQYA 2GETA 4L4RA 3OOEA 1CS0B 4PZ9A 3ZI4A 2R6DA 3RABA 1MW8X 2JHPA 5B1YA 3EZ9A 1XVIA 1AV6A 2OHFA 2ZI6A 2KJQA 3E7DA 3HP7A 4K6CA 5F1PA 4KBYA 2QU8A 4IV8A 2VP6A 5D3KA 3AVVA 3GLFE 3T8YA 1EJ0A 3A4MA 2GZ3A 2CXUA 3F4KA 3D7NA 3R3UA 4L6CA 2ZAYA 3ZC3A 1UKYA 4P34A 4F2WA 1PT9A 2R68A 4DYDA 2A0YA 2XWSA 4FJ2A 1UPTA 5EIOA 1AA9A 3VR2A 1H0SA 4JCOA 2P1ZA 1YRBA 3EUWA 4C7VA 1EIWA 1GYPA 3DMPA 3H5NA 4EPYA 4DCTA 2IHKA 2O4CA 3MZ0A 1Q16A 3DV9A 4G0UA 1LDGA 2IEYA 3COVA 1R66A 1LLQA 2QM8A 4JLMA 2J8ZA 3X0DA 4CMEC 3IHKA 4LOIA 2IODA 3L0OA 1X3LA 1J21A 4RKQA 4Z7NB 1AQYA 1U9ZA 3F97A 1XOIA 3NKLA 4O8CA 1F6WA 1J1UA 3CRVA 1PR2A 1CWUA 3G68A 3LWBA 5E2AA 3K1AB 4H1HA 4DTCA 1Z8DA 2DKFA 2YS6A 4H27A 4JYZA 2PKCA 3DEZA 3KPJA 4D9MA 2Q27A 2AOTB 4RK4A 3U3JA 4DLWA 4YDQA 1T0BA 2QTHA 3OWOA 2DP4E 4KLCA 1FE8A 3LCUA 5CEEA 4JIGA 4TGLA 4N48A 4AZ0B 3HN2A 3RODA 3K70B 3BGIA 2XVAA 3CKMA 1KF0A 3I05A 4KPUB 3HDQA 3ICVA 1CF4A 4B2IA 2UZ4A 4DY6A 2O0HA 4L57A 2IP1A 2W2VA 3BMQB 1FYVA 4Q4AA 4X7MA 2WD7A 3NBMA 2AWOA 1V5IA 1XTSA 3CLUD 1AT1A 2ACKA 5IH7A 4MQBA 1YONA 4UU0A 1PQWA 1NJSA 5GWXA 3EGWA 3NFYA 1BKYA 3EMKA 3FKSD 4TMVA 3NHMA 3FCCA 4PG5A 5BMVB 2PJRA 3K0AA 2BGNA 4M8NE 3MC1A 2PRZA 1OUMA 1MT3A 4OYLA 3AY6A 4J0KA 1ZMTA 1I2AA 4F6RB 1EVKA 4JYPA 4NPAA 3W90A 1S2DA 5GONB 2PKXA 4Z9BA 5TGZA 2WU3A 4HB2A 4LWOA 3TLMA 1OSNA 1CJUC 2JGEA 3CZ9A 1OZHA 1IPEA 4ZHQF 1I1QB 1FNDA 4GLFA 2QJOA 1E5TA 1TTHA 4R2HA 2OUKA 1BX0A 1GPKA 3M0EA 3QKRB 1J09A 4QTXA 5FEUA 3TFWA 2A30A 5LQUA 1YO6A 1PG0A 3EGVA 4GPD1 3NEYA 1PT5A 3SNHA 2XT6A 3MWDA 1DV2A 3S1SA 1RQXA 2UZ3A 1DC8A 2VYCA 3V3KA 5JCOA 3MLAA 5BNIA 4DR6B 3D6HA 4ZVPA 2CMDA 3ZNPA 4AU1A 4LJ8A 2HJ9A 2VPIA 3IA7A 1XA0A 5D85A 5NULA 3EPLA 1F2VA 2DY1A 2YUTA 3PPIA 5ALQA 4MV1A 1P4AA 5IBPA 2RGUA 2ID7A 2X8WA 2VPQA 4C0SA 3LOPA 1W4RA 2IZOA 2X4LA 4Q66C 2MMCA 4MYSA 4IGEA 4B8YA 5JARA 2QR3A 1UT5A 4KWEA 2XRZA 1NX9A 1I14A 5G4KB 3KYBA 3LPAA 3TJZA 4BZWA 5JNSA 5HQJA 1CT9A 3DOJA 3B2QA 2PFKA 4G4SO 1JFTA 1EDEA 2C9BA 2RHGB 4TXNA 2R8RA 3LG2A 3M5WA 4BBPA 1EMDA 4PC1A 4RYDA 2G70A 2LKDA 1JA0A 4NIMA 3IIIA 2X5KO 2P8SA 2VQDA 4NCKA 4AZWA 1FU8A 2JCSA 3X2FA 2FW6A 1JFVA 4X8OA 1JLLA 2ZI9A 5DGCA 1DT5A 2HI0A 1Q7EA 2WUGA 1J0EA 2IOFA 1SCAA 5BOSA 1WMFA 5IDWA 1NR7A 2OVBA 2WTXA 3RUHA 4CKEB 4XWWA 1XO1A 1ST3A 2QRVB 1QFXA 1JAHA 1EFPA 3ERCA 1X0XA 1N6OA 3AV0B 3I92A 2H2WA 2WK1A 5CIYA 4Q9AA 3JWEA 1T1JA 1JIXA 2B5WA 2PUHA 4DPLA 1FZQA 5FNVB 4J2OA 5DWDA 2DZDA 1ULHA 1OFGA 2KBEA 3GEGA 3L4BC 1MEEA 1CVIA 3SSMA 1GWNA 3K6SB 2IEBA 2VYNA 1GUZA 1EP2B 4YJKA 1SU4A 1UKVY 3K5PA 4EUEA 1ADYA 3GRKA 1RI3A 2GFQA 1Q84A 3GJ0A 3GDHA 2BAGA 3AP1A 3BMNB 1CR1A 4H3VA 5I9NA 2QVYX 1JTEA 2COEA 4JLVA 4QGAA 4R71A 6REQB 3EQZA 2QRGA 3TNDA 2OHHA 3RUAA 3PNQA 2C4NA 4JB3A 5AW8A 5BN4B