1M54A

Cystathionine-beta synthase: reduced vicinal thiols
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
357
structure length
352
Chain Sequence
DAPSRCTWQLGRPASESPHHHTAPAKSPKILPDILKKIGDTPMVRINKIGKKFGLKCELLAKCEFFNAGGSVKDRISLRMIEDAERDGTLKPGDTIIEPTSGNTGIGLALAAAVRGYRCIIVMPEKMSSEKVDVLRALGAEIVRTPTNPESHVGVAWRLKNEIPNSHILDQYRNASNPLAHYDTTADEILQQCDGKLDMLVASVGTGGTITGIARKLKEKCPGCRIIGVDPEGSILAEPEELNQTEQTTYEVEGIGYDFIPTVLDRTVVDKWFKSNDEEAFTFARMLIAQEGLLCGGSAGSTVAVAVKAAQELQEGQRCVVILPDSVRNYMTKFLSDRWMLQKGFLKEEDLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title HUMAN CYSTATHIONINE BETA-SYNTHASE IS A HEME SENSOR PROTEIN. EVIDENCE THAT THE REDOX SENSOR IS HEME AND NOT THE VICINAL CYSTEINES IN THE CXXC MOTIF SEEN IN THE CRYSTAL STRUCTURE OF THE TRUNCATED ENZYME
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
molecule keywords CYSTATHIONINE BETA-SYNTHASE
total genus 91
structure length 352
sequence length 357
chains with identical sequence B, C, D, E, F
ec nomenclature ec 4.2.1.22: Cystathionine beta-synthase.
pdb deposition date 2002-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00291 PALP Pyridoxal-phosphate dependent enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1m54A01
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1m54A02
5I7OA 4LI3X 2C2BA 4D97A 4D9CA 2Q3CA 2WSYB 4OREX 3V7NA 3ZEIA 2C2GA 4D9KA 1TZ2A 4L28A 5B55A 1E5XA 2ISQA 4HPJB 5DBHX 1D6SA 4ZU6X 3X44A 1K8ZB 3SS7X 1KFBB 4COOA 5IWCA 3PC3A 2GN2A 5EY5B 2CLEB 3FGPA 5HBGA 2CLKB 5B53A 4F4FA 4IL5A 2ZPUA 4NEGA 5CGQB 4L27A 1WBJB 3FCAA 1A5SB 1C9DB 3TBHA 4D9NA 5I7RA 4L0DA 1VE5A 3DKIA 4ZU1X 1P5JA 1A50B 3AEYA 5CVCA 1TDJA 1J0CA 4Y6GB 1TTQB 4LMBA 2J9YB 1RQXA 3IQGX 4D9BA 5DBEX 2BHTA 4D99A 5JISA 3IAUA 3R0XA 3SS9X 2V03A 2CLFB 2TYSB 3IQHX 1K7FB 4D8TA 2O2JA 5J5VA 5C3UA 2GN1A 2JC3A 2DH6A 5T6MA 1J0AA 3L6BA 1J0DA 4D8WA 1FUYB 1FCJA 2EGUA 2PQMA 1CX9B 3L6CA 1K8YB 1KFEB 2CLLB 4LMAA 1WTCA 1A5BB 3CEPB 4QYSA 4JBLA 4XUGB 1WKVA 2O2EA 5DVZA 1TTPB 3X43A 1UINA 1KFCB 1Y7LA 1K3UB 3HMKA 5I7AA 4HO1X 3VBEA 1K7XB 1Z7YA 4JBNA 4D8UA 1UBSB 4L3VA 2J9XB 1KFJB 3DWIA 4AECA 4D9EA 5JJCA 2CLOB 1V8ZA 3VSAA 1V7CA 2EFYA 3VC3A 4D9FA 3PC4A 1K8XB 5B3AA 4HT3B 1TYZA 1O58A 2ZSJA 1UIMA 1JBQA 2RHGB 3RR2A 4AIRA 1WDWB 1X1QA 4H27A 1BKSB 4I1YA 3SPXA 5DW3A 2BHSA 2ECOA 2DH5A 2RKBA 2J9ZB 1C29B 1M54A 1J0BA 5D85A 1K7EB 4KKXB 5BW6B 1C8VB 2Q3DA 1PWEA 3VSDA 4PCUA 3AEXA 5B1IA 4D96A 1CW2B 1VB3A 1KFKB 2RH9B 2Q3BA 2TRSB 4D9MA 5KINB 1BEUB 5IW8A 1A5AB 1OASA 5J43A 5B1HA 5D87A 2TSYB 2ECQA 4ZQCB 3L6RA 5D86A 5DW0A 5I7HA 4WX2B 2D1FA 4D9IA 1F2DA 2CLHB 4D9GA 5I6DA 4D92A 3BM5A 1TZJA 3R0ZA 5B36A 1VE1A 1QOQB 2CLMB 1V71A 1TZKA 2CLIB 1TJPB 3IQIX 5I7WA 1PWHA 1QOPB 1Z7WA 4HN4B 3T4PA 2GN0A 2ZR8A 3PR2B 4HPXB 5E0KB 3VSCA 5IXJA 5KZMB 1J0EA 1KL7A 3DWGA 4OFXA 3PC2A 1TZMA 4NU8X 5D84A
chains in the Genus database with same CATH superfamily
4HWGA 1Y9JA 1HNZB 1BMFD 2JGDB 4C7OA 3I2YX 3MJSA 4N3NA 2IZ0A 2K4MA 6REQA 3QKIA 5CT9A 1L5HB 1KMHB 3JYNA 4XWKA 2B7BA 4IF6A 3F7TA 2XE6A 1Q14A 4PFKA 4RELA 4FFDA 2HH9A 3AHGA 5B53A 1ECPA 3DVSX 1M2OA 1Z2PX 3WHPA 4OAOA 1XTKA 5FPYA 2X5XA 4TL7A 4AJNA 2EKQA 5JWOA 4GX0A 3DPSA 4G5HA 1VL0A 1E4VA 1ZOOA 2D13A 4LX0A 4GZ5A 4E6PA 5E6UA 3IJRA 2B21A 3SJAA 5I9MA 4GZ6A 4BZQA 3V9PA 1J0CA 1MX5A 5K0LA 3RG2A 4G2TA 3AW8A 2B4KA 3V4VB 4X64B 1GUZA 2X5NA 2YHIA 1Y6QA 4TV9F 4N41A 2HD4A 1PK9A 3ORFA 5F7OA 4PQRA 1J9ZA 3CKLA 1PL7A 3T7EA 8ADHA 4NFSA 4KJZA 2HPAA 2W6ZA 4GMKA 3WV4A 1WU7A 3HP7A 2YTZA 4DILA 1QYRA 1YC2A 2ORYA 2X9VA 3E81A 3V1LA 1I14A 2F48A 5JWHA 5BN5A 2PMEA 4AL4A 1P4AA 5KQLA 2EW8A 3Q8MA 2HEGA 3D3JA 4FIDA 1TB4A 2A58A 3A6HA 1JZQA 3LO5A 4IJUA 1Q1GA 4MUEA 2MSLA 4I55A 3M4XA 3OX4A 1YO6A 4L9RA 3TCNA 5DWDA 1DJMA 2E89A 3K1YA 2BT4A 3DCJA 3MYYA 1GTMA 2BZ1A 4B8ZA 3L0DA 3P20A 3LC0A 3SX0A 3BIFA 1ENYA 3GNTA 4CUJA 4MITA 4PTYA 3WGJA 2I29A 4LJLA 1QR6A 1DFGA 3MK31 3UJ9A 1PS9A 3H4VA 4EYGA 4XGRA 1FF9A 4RETA 1E9DA 3AY3A 1AM4D 1NRJB 4IMRA 5AW9A 5CIWA 1DCKA 2X7XA 5DEOA 3PFIA 5EMKA 5C5CA 2QHXA 2YXPX 1CZUA 4GX1A 4OHCA 1UMDA 3RYHB 1PR0A 2YJZA 4NCHA 2ZUTA 2BH2A 2NU7A 3JXEA 2WSLA 4MO2A 3AVXA 4BX9A 4HGZA 4AYXA 2PWBA 2OR3A 3UMSA 3ZQ6A 3DUFA 3VPXA 2AOUA 2FLWA 2EF1A 3R6GA 4KRYA 4Q9KA 3ZWKA 2AFIE 3C1UA 3U3DA 2I1VB 3AEUB 2OGUA 1FPMA 1WJGA 3BRQA 3V32A 5JBNA 5ARCA 4HCJA 5JNTA 2JF0A 3AP2A 4W8HA 3A9RA 2XSZD 1RXCA 3UQZA 3UJ7A 2MYUA 2D3WA 3WJ2A 4CQLB 3ZNPA 5FI1B 4DVGA 1ZUHA 1BN6A 2CVPA 4X1KB 4BN0A 3WIDA 3V7WA 4HEA6 4MK4A 5E2IA 3IP9A 1N33B 1T4GA 2WVJA 1RCTE 3KWLA 3A4VA 5LCXA 3T7SA 3L7AA 3W8DA 1TO1E 3DAFA 3KEMA 3QX7A 3T95A 3DM5A 3BMCB 3V1KA 5A4AA 3UWPA 2VHUA 3FDZB 1N9GA 3X1XA 3JR3A 4WZBA 4CF6A 4CMEA 3LG2A 4MS1A 5C8YF 3M9XA 1N0WA 1GNTA 2ZEJA 2HTFA 4YPVA 5HOQA 1RWVA 3LF2A 3GC6A 4RVUA 4B74A 4C4AA 3SJ7A 3DMYA 4EQ6A 2I99A 4JL5A 4UDOA 2WV7A 1GCGA 1D9XA 2PX3A 4N12A 5E1DA 1WS6A 3G9UA 4FFSA 5E2BA 2QG4A 3W77A 5J23A 4W5TA 9LDBA 2GCGA 1EPUA 1S2OA 2Q2NA 3GFSA 1BEZA 5IJ9A 3A1EA 1OXVA 3R3WA 4MMXB 3OPNA 4HVTA 2Y6UA 3JY6A 3MUFA 1XVLA 3RS2A 2A9PA 3CISA 1I80A 2W6QA 3HCDA 4PBTA 3VC7A 5J58A 4BFTA 2PIDA 5BPFA 1VJ1A 2WNSA 4O4HB 5ALEA 3NTQA 3OIWA 3TH5A 3A1TA 1ISGA 2KM1A 3L6OO 3OAAD 4ZHQF 2D1SA 5EUMA 5T4BA 4KQCA 3CZMA 2ZUBA 4PCVA 3WWPA 3AF3A 5EXTA 1TLTA 5AM0A 2WNHA 3ZHSA 1ZH2A 3ZHUA 4GC5A 3WA7A 1HDYA 1TO2E 1JG7A 5EN4A 3I9FA 3QKWA 4U7TB 5JCJD 1GCAA 1GO2A 4YPOA 1T9BA 4Y7DA 1T9GR 4GOJA 2DERA 3PDWA 4O8CA 1AD2A 5TQVA 3D3QA 1WD5A 2AN1A 3ASVA 2WEKA 3R40A 2NZYA 1TU4A 2KYRA 5KREA 1OYVA 3DMNA 3M83A 1E4YA 3CV3A 3NI2A 4N5HX 4IS3A 4M1WA 4ZFNA 1E2UA 2P9BA 4ZP1A 5F23A 4RABA 4ZAVA 5KHAA 2ZATA 4CCAA 2D7DA 2AVDA 3A9UA 4DREA 4MYCA 1O03A 3N58A 4S1PA 1FRFS 3F1KA 4KC0A 3HB9A 1JW9B 4OFWA 4PXAA 4OGFA 4ESOA 2VFAA 3TLCA 3NHZA 1FRNA 1KVSA 4Y2JA 3UPDA 1DL5A 4QZVA 1XRQA 3NH9A 2YFYA 4RPHA 2VJNA 4RDIA 5PNTA 4DRZA 3EF0A 1EXNA 4M9XA 2H7XA 4N18A 2GYVA 4QQNA 3JQ9A 4HDNB 4J0JA 4NMLA 3SSAA 4R01A 4LUCA 1Q57A 2VYND 1TM3E 5C4GB 5DX0A 2CUKA 3ZW8A 1O6CA 2XVYA 1EHCA 3H19A 2JIPA 4ALJA 2RAVA 4J4HA 1F4PA 3IB3A 2YV5A 1NVVQ 3L7MA 3PNOA 4JEIA 1DAIA 3RT7A 2KLHA 4ZO7A 3V3KA 4WUVA 3KS9A 4AUMA 5K09A 1XRLA 4WESB 2F9LA 4K87A 1VLQA 1C80A 2Z6VA 5DW0A 3HKBB 5F5LA 3GLFA 4R31A 1I7PA 3F0TA 4MLPA 2E37A 3IEVA 2FQQA 3BWYA 1QHHA 1Z56C 3OTQA 3H87A 3EPPA 4ME6A 1GRRA 3VJRA 4UBOA 1XQ1A 1QAMA 4BU0A 1PK8A 1RW4A 3GVHA 4DYDA 1I1NA 4HAOA 2IRWA 1X15A 2X9NA 1W44A 2QSYA 2C2BA 3UG7A 1U7WA 3GLFB 4J8PA 1C9JA 3SHTA 3HCAA 2JKVA 3DD1A 5B58C 2O05A 2H0QA 4LNHA 3KQHA 5BSWA 1X7ZB 1C0IA 4YT4A 5CA0F 7AT1A 2H0AA 4KN8A 4ZOQI 4UHEA 5TQ2B 4D4KA 5ULLA 3FYHA 4PNPA 3MWJA 3LUFA 3JYPA 1M1YE 1FNDA 4KL8S 4ZWNA 4CCYA 3RKSA 1RKVA 2CNLA 3UMMA 2CHQA 2FPKA 2ZSEA 1JXAA 3KFVA 4M22A 4MV5A 1XE3A 1N4AA 4YV2A 3O74A 4KB5A 2VPZA 3COZA 5C3MA 5JASA 3ZE7A 4X20B 2P8JA 2E2WA 3OZEA 1I51A 1N2CA 2Q2WA 1PUJA 1N1GA 2L42A 4BHTA 5C5EA 2DQKA 3EZ9A 4DRXA 4QWWA 4AK9A 5JISA 4MQEA 4PVCA 9ATCA 3R6LA 3H1AA 1WOMA 4BKRA 4WGGA 1OX6A 1N2ZA 1F2TA 1PF7E 4GSKA 1E2DA 4DLRA 4HNUA 3KZVA 3ZD6A 3EZNA 3GMDA 1CJTC 3WICA 3G1WA 4GYKA 4EMTA 3QU5A 1AKEA 4O2LA 1XZJA 2UZ0A 3KXKA 3HADA 3O3MB 2P9JA 1KZ1A 4PFQA 3U4CA 2V5AA 3GN1A 3WDKA 5FV7A 2MJLA 1EZZA 1CR1A 1YZHA 2PZMA 3KXDA 3OJ0A 4V0ME 4WOPA 1LBQA 1NRWA 1NUTA 1PV2A 1MQAA 3N7AA 4IQ0A 4J1SA 4LXQA 4OM8A 1GGFA 2VPTA 2YOFA 5ER6A 1M3SA 3D54D 4IJWA 4XR9A 3NBXX 5REQA 4MR8B 5TY0A 3S5JA 4HBZA 5FUYA 3NHJA 4M9SA 3L7LA 4POOA 4XD7A 1VPLA 1C9MA 1I3MA 2B78A 5JANA 1DTEA 2I54A 1OPRA 4NY1A 1AS3A 2HCBA 4DLVA 1KYZA 5E4JA 1T5SA 3L1HA 5FUXA 3V55A 2OE2A 1SD2A 1P29A 3D7RA 4HT3B 2E0IA 1LDNA 1B0UA 2Q3MA 2VF7A 2FSHA 1GRCA 1L7EA 4I55F 5C8XA 5A5FA 3E9CA 3VHXB 1N57A 1NT4A 3QE0A 3QKRA 2VRWA 3Q87B 1NPTO 4H27A 4HLDA 3HYNA 3SPXA 5KWSA 3KQQA 3AIMA 1COWA 1ML4A 1LB1B 1DQYA 4O1IA 4QWMA 1BA2A 3D81A 3L9XA 5A3RA 3DEIA 4M49A 3S7TA 4WEOA 2LNDA 1Z82A 4M8IA 4ZQIA 5FIUA 4LJRA 3ZWYA 2OWEA 5FCDA 4DWJA 4YUWA 1P7WA 2NPFA 5AR1A 4BVHA 3UQYS 4E5UA 1W93A 3FBWA 5D8DA 5KDLA 5AKEA 3PIDA 1BS2A 3HVIA 3TMYA 1KAGA 2WSBA 4K28A 3V97A 1L5FA 1LLQA 1DQZA 1VKOA 1ESDA 4G86A 4MIYA 3KBBA 1YQQA 3B48A 4XM0A 2PNJA 3V2IA 2PT7A 3DXZA 4IFTA 5BQPA 1A4IA 3DOJA 1XDSA 1UMKA 4DCUA 1X1RA 1B42A 2PZGA 2ZUDA 3GOQA 4KR6A 4L4RA 3M4ZA 1AQIA 1AHIA 2FHSA 4IHKA 3R5TA 3DT8A 3Q3VA 4LWOA 4TMFA 1PWYE 1JLLB 5D3MA 3QWIA 1BWPA 4KAJA 4QQKA 4RAQA 5DF1A 4B45A 2C57A 2KPOA 4XSVA 3RKUA 1RFLA 5KNCH 4A3SA 3DPUA 1BS1A 4TRMA 4YR7A 2Z2XA 1H8ED 3SGLA 2PL5A 4TRNA 3NXSA 4HFJA 4RS3A 1E3SA 1QANA 1TZMA 1Z47A 1HO3A 1HL3A 2A5JA 3HWSA 1VHDA 3UJNA 2F8LA 1HE1C 3ZEIA 2PXXA 1G64A 4Z53A 4N5NA 3D0QA 4R8LA 1YR6A 2PUTA 5B55A 3F78A 3OFNA 3BSYA 4WLFA 1FSSA 1P7ZA 3AOEA 1JMKC 3FPLA 3LXUX 1RE0A 3OWOA 2WQ6A 5AXCA 3CX4A 3GFGA 1CUSA 2Y2VA 2POQX 4WBSA 1A9SA 4W5HA 5EC8A 3RIXA 3W0LB 5LOVF 1OZAA 1K6EA 1EJBA 3MRSA 4JJ6A 3QMMA 2NU7B 5BW4A 4MWOA 1QHNA 3I3OA 3OO0A 3TLKA 4EPVA 1YB5A 4P8RA 1D4OA 2WIFA 4PPFA 1HKHA 3ZY2A 5BNZA 1L3IA 3M6IA 1WAMA 5KVSA 3SJZA 5JAMA 1P5HA 4DIFA 2JZNA 3A1NA 1GDTA 4GC9A 1G2PA 1YAJA 2J9YB 3KZKA 1YD7A 1XAJA 1JQ5A 2FETA 2NVWA 3UJHA 1E2BA 2BMWA 4N0DA 3JYLA 5MHTA 5I9BA 4HBGA 1ONBA 1ISHA 4MGEA 5ELLA 2JC3A 4ZIRB 5B5SA 3KUUA 5DCWA 2WLSA 1M73E 2P9GA 3BQMB 3UK1A 4R9SA 3S1LA 3GEEA 4DCGA 2FEWB 4ARIA 3BZBA 1R3UA 3M4NA 4JXJA 5CFPA 4J6FA 5JW6A 2Y4OA 1GGMA 1SVWA 3PP8A 4QO7A 1QV7A 2B7LA 5H02A 1UP7A 3BMOA 1WW8A 1J70A 2GJ9A 3L46A 2ZWVA 3O6VA 2YFQA 1QZTA 2IOFA 3GH3A 1MW8X 4MZXA 4R1TA 3G68A 2P3OA 4NARA 5FOQA 4J3NA 2C7BA 1NW7A 1JAHA 4HXFB 5G02A 3RNOA 4BNWA 5C8ZA 3IIEA 3AVPA 4LVNA 4LZPA 2XRZA 1FSZA 1NR7A 3NBQA 4J7AA 1W9MA 1J8FA 1KF0A 3PL5A 2F3UA 1YMUA 5T5QA 1NKVA 4L3OA 1QWSA 2GXAA 5E6UB 3HDJA 1V9CA 2Z1MA 3HYTA 4NYJR 2XKBA 2HRCA 2WD9A 2Y9MB 2AG8A 3A3PA 1NBME 2E1PA 1MB3A 3I4LA 3RVBA 1SU6A 5CG1A 2GDZA 2CW5A 2GBLA 3TZ6A 4BNGA 5LMUB 3QVTA 1ZCAA 2DUMA 1D9ZA 2AJLI 3MLBA 4ZOLB 3AEXA 1JXOA 4Z0NA 2GN9A 3U49A 4BLUA 3H11A 3B7PA 4FEEA 3AF6A 5D5HA 3CW9A 1E1RA 2QRGA 4PC3A 1I4OA 1OF1A 3HZRA 1G20A 1VXOA 3J7TA 1DQNA 4K3UA 2AN3A 4N6OA 3Q7EA 4AVYA 2OV4A 1EFUA 1SOAA 1FVXA 2QRJA 4M2LA 4RGVA 3PXAA 4XVHA 4DR6B 2O50A 5KNCD 4XXHA 4Q5IA 3ITEA 4EMSA 2WJ3A 1OY1A 5CB4B 1FFHA 5FWXB 1G38A 3D4IA 2I8AA 5AI4A 1BE8A 4F5WA 4H17A 4WNCA 2BZ0A 2XGGA 3GUHA 3QEMB 5DLPA 2ZR8A 3OY2A 1P2FA 4RV9A 2ZUFA 4ND5A 4QYXA 5A04A 4AICA 2AFIA 4O4IB 5DNAA 4G9EA 3KTFA 2Q3CA 2HADA 5G3YA 3DFZA 3VMMA 2EL7A 2QL6A 5CW2A 1SKMA 1Q20A 3LDGA 1WEHA 3C4VA 1W85B 1UPXA 1WP4A 3PK0A 1YOVB 1K8ZB 2VNSA 1T6XA 5EZ6B 3DTVD 3TW4A 2R7AA 5IPFA 1NRXA 1WXHA 1V48A 1RTTA 2FMKA 1Y34E 1ZI9A 2HAEA 3NTUA 3OLYA 3U7QA 4DQUA 1U1GA 1Q17A 4GE0A 1ZJ6A 5DHSA 3QPAA 1OE0A 3DZDA 3TPCA 1TCBA 2BM9A 2P6MA 2GPJA 2WWGA 4I99A 4BWYA 1QTQA 5JC1A 1VG9B 1IXYA 2HA5A 3FBTA 3WAJA 4MW1A 1WVIA 1C30B 1ZUWA 3H13A 4MIKA 4NESA 1SVNA 3O95A 1ZICA 4II7A 1ES9A 3KB2A 2I22A 2IHZA 4LG1A 2PV7A 3CJTA 4KR9A 4LW8A 1VDMA 1XAIA 3IT3A 2JCGA 4EIWA 2ZS7A 1L8XA 4CCWA 2V97A 1OX5A 3PLRA 5BT8A 3PI7A 2D5CA 1ZIPA 2BE9A 2V7PA 4J6EA 1KAHA 4UD2A 3FI9A 1Y82A 1TQ4A 2IPLA 5EFOA 2BKAA 3NV9A 3OPYI 4EW3A 1SQ6A 4G23A 3MTBA 5H1YA 1C30A 5JPIA 3KDPA 1WTAA 3M49A 4RKQA 4YRQA 4DYHA 1P2UA 4N4AA 3QELA 2Z5LA 3KLPX 3MTJA 4EATA 2TECE 2ATVA 2XUGA 4EF5A 1HM5A 4HWOA 4HDRB 2RHBA 4H6WA 2PPLA 1Z18A 4M1TA 4F0JA 1TK2A 2FCRA 4DM3A 2M6KA 3ZE0B 5EWMB 1A0OA 2IKSA 5JZBA 1COWD 4MMYB 4H59A 2Y1EA 1VI2A 3DWIA 2H8GA 4FP9A 4B81A 2ZRQA 3B78A 2EATA 5LLDA 3CEMA 3K4QA 3W1VA 3WQRA 4V1CI 4OLFA 2BMAA 3TG8A 1Y4AE 1KC3A 1WSWA 1X8JA 3W1EA 1XHEA 3NIGB 2R2AA 3L8MA 1RI5A 3H2ZA 4M36A 3H8JA 3KD3A 4Z8YA 3IVXA 3VKVA 3BXPA 5BXYA 4C4XA 4R8SA 2YCBA 4EEZA 4XCXA 5A9SA 4YLYA 5D3QA 4WXHA 1MABB 2DFNA 1MC4A 2XXAA 1H6BA 4CXMA 2MSNA 2WSSA 3FYTA 1EJ2A 1P7VA 4KV7A 1Y7TA 4UC0A 3ZQ4A 2HGSA 1U3UA 2EIXA 2PN1A 5FNZA 5B1DA 5EKTA 4LXXA 4WINA 3GZNB 1NPDA 2J9GA 4EPXA 4IF4A 2A4MA 1MC1A 3U9TA 4R9NA 1QQTA 5ALSA 2UXDB 1CR6A 1WUJS 2ZUCA 3G13A 2I2DA 1E9RA 1H85A 2NUTB 2Y05A 5ILQA 5I6DA 3LQ1A 1USUA 1TJ4A 1IG3A 2WTNA 3OUUA 3CR3C 3GIDA 4XUEA 5HIJA 4EGQA 4CKCB 3RYCA 3R9XB 3DCYA 3T3OA 1VL8A 4R16A 2XMRA 2CLIB 3P4UA 5DTQA 1Z7WA 4WY5A 4GWLA 1E58A 4K9LA 5CX4A 1HX7A 1P1IA 3JZFA 2ZSDA 2H1WA 1E4OA 4KIWA 4GRAA 1FRVA 2IV2X 2NZUG 2GF0A 3DL0A 3PUJA 5AH0A 4D97A 2B5OA 4RMJA 4TMVA 4R71A 3S68A 1UBEA 5H9VA 1FSPA 4GLOA 4GLJA 1R9GA 1SELA 1E9CA 4N1AA 1D6SA 3GRRA 1XTQA 5DNUA 3X2FA 1YQEA 2WM3A 3K31A 2O14A 4RLSA 1KE1A 3U44A 3HJTA 4P6VF 4R3UC 3M8KA 3ENQA 2NPIA 2I8LA 2V6IA 4QGBA 3F6EX 3L1UA 1YB1A 1P4JA 4DCCA 3J81k 3SZRA 1GGEA 2VHVA 3MJCA 3GGDA 3A9VA 2AHRA 2HHAA 5IKOA 1YTLA 4LCEA 2XNDA 4XFJA 1DZIA 4KREA 1QGAA 3LQRA 2AWOA 4KGXA 4Z4HA 1IZYA 1NJ8A 2Z4RA 1PP4A 1DXYA 1RYFA 1VJDA 1F6WA 1ZITA 3RAPR 2C99A 1YIDA 2P77A 2G70A 4CMIA 3FE2A 4YRAA 1DXQA 5LZ4A 3FMFA 1N2OA 1YS6A 3FB4A 1E7WA 3GXBA 2QZPA 3LPAA 3QNWA 2D2IA 2RHHA 2HJSA 2QT0A 4BTLA 1JWLA 5I7EA 3ZCXA 3MMXA 1ORRA 4R5HA 4NFYA 1AUXA 2DCUA 1K8RA 4MJXA 3OQIA 2F62A 4B3MB 3D0KA 3ILHA 3ES9A 1VECA 2F9MA 4P7FA 3ZX5A 4PN3A 1ADGA 1QHIA 3KCQA 1P0IA 2FR8A 2A0FA 4MYTA 4P98A 5H4HA 3FOFC 1KJ8A 1W4BA 2PUGA 3CEAA 3K15A 1MNQA 4OHVA 1DHTA 1NQTA 4Z2AA 1XZ8A 2VDKB 4CM4A 4F5EA 2Q45A 3RGGA 1THZA 3UWKA 3OOHA 3MWLA 2BP7B 3BXHA 3CW2A 2FSGA 4GBED 1P19A 3RBXA 2QN7A 3T9AA 4IZ6A 3K1AB 2PU7A 1UPUA 1ELOA 1QCDA 1BMDA 1D1PA 1ZM9A 4L7QA 1OLSB 2V3VA 4TKUB 4RHEA 4ZOLF 4TKVA 1QHFA 3TVTA 3EVNA 2JRCA 3PHBE 4G0NA 4JI3B 5AW4A 4LQLA 5DYGA 1LSSA 5HZGA 1SC9A 1XV5A 1SKYE 1CJUC 1U8UA 4MRRA 4IDBA 4Q1AA 2FJPA 3UW1A 2GK7A 1U0BB 5FADA 2DXIA 3H18A 3EUAA 4YCLA 1W8DA 2VH1A 3IBGA 2IGBA 3KOZA 4MDYA 1GVNB 4OQLA 4UDNA 3VPGA 1FXWF 1WMEA 2ZT7A 1AJEA 3ROQA 3T52A 3E8MA 4GOMD 4OYRA 4J0EA 1FU8A 4ZTUB 3PDJA 4YP1A 4JBIA 2FLVA 4DXDA 5CCBA 1OGYA 3A9SA 1XCOA 1HZZC 3P26A 1R16A 1W0JA 4FYPA 4C6RA 3BRWA 4R1SA 2AHOA 3KQVA 4QOHA 1G0OA 4IJMA 1T3ZA 2OL4A 1ZGZA 1KZ7B 2E85A 2FSFA 2IE8A 2NX2A 3NATA 5F64A 1JDBC 3KQPA 3KVVA 1RTKA 2ZBGA 4TN1A 1Q3KA 3O2QB 2CSXA 2UXCB 4H7DA 4Y6RA 2JZOA 1EEHA 2XOKA 3MMNA 1P72A 1MIOB 1T24A 1LNQA 1T8TA 3KOWA 4CIBA 1J2YA 5ENVA 4GAEA 3K4HA 1J0EA 1JALA 5A4IS 2FHPA 3LBFA 1N2HA 5HCNA 3DTVB 1RJEA 2X86A 2OLEA 4NLLA 3WA6A 4BO4A 1KU0A 1IUPA 1XEXA 1VI6A 2Y0BA 2D8MA 4QPZA 4YREA 2G71A 3U7QB 3MF4A 4FDTA 3E7WA 4K05A 2RKWA 4M55A 3S29A 4OK3A 2JFOA 5FI0B 1KRXA 5C8VA 4HSEA 1UT5A 4D80A 4LJ8A 1MV5A 1V6CA 2O3RA 3NP7A 1MEEA 3VUFA 1B0ZA 4X7RA 3HN6A 4RZ3A 4KIGA 1K6MA 1OH5A 3K73O 1W0KD 1WQ3A 5HOEA 1WBJB 2NZVG 2XNKA 1Z4OA 3SBEA 1N9GB 3U4GA 5EZYF 2MINB 3NHBA 4WNYA 5ES4B 5HWSA 1T9HA 4I50A 4IXNA 1ZUD1 2WG1A 4NSNA 5K7SA 4C7XA 4N76A 1ZGGA 1A50B 4TXLA 4Y9RA 2H2DA 5ECDA 4CEHB 3JV7A 1CLUA 4NATA 4K2AA 5JI3E 5HP4A 3JVDA 1XZHA 1MEOA 5FFNA 3A1CA 4H1WA 2ID4A 4OFBA 4AW9A 1PNTA 2EZ4A 1IBCA 2NT4A 2V03A 3JQ8B 2ANBA 3PX7A 1Z5UA 3RVPA 3IBYA 1UPBA 2ZJ3A 1N1DA 1J8VA 3FVVA 3TIFA 4CR6A 4FCTA 5AJHA 3BSFA 1E98A 2XYQA 2RH8A 3CUYA 3DS8A 4KQFA 4TTVA 4E12A 1QG4A 5TIIA 1N5IA 3CVVA 3UF0A 1Y9AA 4KDRA 1J2RA 1XMPA 4M3NA 3KUCA 4ZT6A 2AQ8A 1YMQA 1LXCA 3JWIA 4BFCA 1DRWA 1X70A 2FMUA 1X0XA 2G06A 2O4UX 5A6SB 1Z0FA 5BWLA 2VYFA 4ZI3A 1FBTA 4W1PA 4XCVA 1XL1A 2XRFA 1JBEA 4H7KA 4AJHA 5ILOA 3BE6A 1G5HA 1QB7A 4MVJD 2DU8A 4CKEA 2ZYWX 2WJZB 3OU6A 2WZQA 4M1MA 4AJ9A 2GDJA 3UK2A 3MB8A 2FPGB 4LEIA 4KLCA 2CKMA 2ZBPA 4EFDA 1A7AA 1S9DA 2KBFA 3ACDA 8LDHA 1Z88A 3E8XA 3HXTA 4WXPA 1TQHA 2A30A 3D4PA 7GPBA 5BN3B 1Q95A 5IMSA 4I3HA 1K63A 2BFMA 2HNBA 2PZKA 2NZXA 1WSBA 2P2GA 4QXPA 2GTIA 2Q28A 4Q12A 1XZQA 2WFLB 3U0BA 3ZHXA 2RKBA 4ZI2A 3Q7RA 1COZA 2IPOA 1SBQA 4OMCA 4Q9IA 4QKQA 1WIWA 2XCOA 5JNLA 3BXOA 5EZYA 4B3GA 3FVRA 1YJ5A 3UFXB 3ZU2A 3H9QA 2QENA 4DV3B 5M34A 1JFFA 3LLVA 1FP1D 1Z8NA 4MWEA 5E4TA 2QZ4A 1GV1A 3KJIA 5GWXA 3EFEA 3WMEA 4MKRA 3Q7TA 4I9NA 4NJEA 3ZGOA 3I37X 1NKTA 4NAUA 4MRNA 1OFIA 2REQA 2I2BA 2I6SA 5A4KA 1E5DA 2AJ8A 1S7CA 2H11A 3EOZA 3A1DA 3LUDA 4UMDA 5GJWC 1Z4LA 5EIHA 4UDYX 3V9AA 1HSZA 1SHTX 1MV8A 2ID9A 3I6ZA 3OF3A 4GKJB 4GX2A 4G5OA 2IDKA 3HV2A 4RM2A 4FFBA 1QOPB 1SOUA 1RWQA 2UZ3A 3GO4A 3B9BA 4C0QC 3MXOA 5FAXA 2Z6AA 5EYPB 4LCJA 3CLSC 3R1IA 4RSMA 2A9KA 4GNRA 2ZXFA 4BRZA 3ZK7A 2C3UA 3UT6A 4S2EA 4PANA 2OSVA 5FX2A 4WN9B 4QU9A 1AV7A 5JS6A 2ZJ4A 3DLBA 5JFTA 3FHTA 3AUJB 4CVNA 4D3YA 1UJ6A 5E3IA 5IUKC 1U3CA 2WA2A 5I51A 3PEEA 4I8DA 5B30A 2XCUA 5MGNA 2X0RA 3JAKB 3LOQA 3H1PA 2GN2A 5J2UB 3I73A 3MM4A 4WUTA 4F4JA 1EFAA 1NFFA 5AXBA 4XGIA 3UV7A 2ZETA 3B9RA 1CCWA 1JSLA 3P1JA 2QRLA 4YRKA 1CG6A 5BW8A 3K9FC 4BUJA 4HGRA 4GR9A 3ZWDA 2XMGA 1KP2A 1G8HA 5JDCA 4YT8A 2KLBA 4B76A 3KR1A 3AHCA 2DFPA 4PZUA 4GOXA 5HIIA 2A9FA 2ORVA 3LPLA 4MQ5A 3WLFA 3GT7A 3OOYA 4PYNA 5DOZA 1ZLYA 3EQ2A 4RH1A 4I14A 3DBRA 1XVUA 2F3QA 2PH7A 3QXCA 1G66A 5LBIA 3O1JC 1W8IA 5CNKA 1DC5A 2VAVA 3V2HA 4YYEA 1KVUA 4F12A 4YCSA 1FW6A 5TDHA 5CLGA 3VPBA 1UT6A 3QVMA 2GHRA 2ENUA 4QJ4A 1CUEA 1HEYA 2OAQ1 1Z28A 2YXEA 4KP7A 4GOND 1FFDA 3O9VA 3ZQKA 2WZDA 3GHHA 3MBKA 3DUWA 2JGAA 4BCDA 5EIXA 1JQDA 2Z8YM 5EQDA 5LYJA 2ZVQX 4GEGA 2X0JA 5LKRA 4FKMA 1BDJA 4ZOEA 1I5RA 2XGOA 4QASA 3KL4A 1CUCA 1ZGHA 3BRSA 4PYIA 4KSCA 5BSMA 3UAXA 2IXTA 3TD2A 4P3KA 3NWJA 4CR8A 2BYTA 3PJRA 3KTAA 4KFUA 5IVDA 2R4UA 3H0KA 1M6YA 3JTEA 4DJDC 1QRDA 3C2QA 3LCJA 1NQOA 4C3OB 3A2NA 2LCIA 2WIAA 3KUXA 3MC1A 5BSRA 2QRVB 4Y2SA 1CDDA 2VDPB 2XTZA 4TMWA 5AVTA 3KQMA 3TG2A 4IDAA 4RVGA 1NVUQ 2ONKA 4IRMA 5JDCC 2ZJOA 1JIJA 2YXDA 4NG5A 5KPDA 2A9QA 2EFDB 2Z8ZA 3GUVA 4EB8A 1TW3A 3VNUA 2ZFUA 1MOPA 3QXXA 4HF7A 5CNJA 2TMDA 1ACLA 5FOUA 3AP1A 3L6DA 1FP2A 1XDWA 3UXMA 4BLOA 3PNQA 3I5YA 2I3BA 4F6CA 4CGYA 2VSNA 3LHIA 4CZ2A 1U6JA 4LDNA 1WABA 1WULS 1SCKA 1WXIA 3QVJA 4KEAA 4MJ7A 4TUYA 1BCSB 5EKUA 2JFBA 5A9TA 1TCVA 2POCA 1JJFA 3BILA 2Q7OE 3X1JA 1S2NA 4FMPA 3WL3A 3ZDRA 1GUYA 1VGQA 4IBOA 4MVJF 3OCWA 1P0CA 2AQKA 2JFFA 2NNWB 4OHWA 4KYIB 1T2EA 4OOEA 2M1XA 4X95A 4R6XA 3VNQA 2C4MA 4XGNA 3A4MA 4AO8A 5KOYA 1FZQA 1X1TA 2NXWA 1FYWA 2NTEA 4AJ4A 4BO1A 4EVIA 1RPJA 2G8LA 2WAAA 5K3CA 3S1AA 2JA1A 1D1SA 2W2LA 3BD6A 3JU3A 4IILA 3SXPA 4DC0A 3LUAA 1IY8A 1NFRA 3KM0A 2R11A 1QE3A 1FQKA 3GRZA 5IAKA 1Q7CA 2EP8A 2O48X 5IEBA 2E1RA 2G1AA 3R3YA 4PPGA 2C0QA 5LZ8A 1WMSA 1Q91A 3MWGA 4UHFA 5LSAA 3JD1A 4C1BA 4IIFA 3SEFA 2WUGA 1T0IA 1MRSA 1BTOA 2OK7A 2ZZNA 5E1MA 2HQSA 3CCBA 1YH3A 3DXYA 3R2JA 4NPCA 5JCJA 1H23A 2J3LA 1PYOA 4AQYB 1OZGA 3UAVA 2QRVA 2IEBA 3CC8A 2NZ8A 4JP5A 1G8YA 5GJCA 2VJLA 5T4HA 5JZOA 5K8JB 1BHO1 2I1LA 2JFHA 3TW0A 2Q1TA 2FEKA 3K0KA 2ZI5A 4JX9A 2PYZA 1HETA 3WJ7A 3ED5A 5CM2Z 3TSYA 1C0LA 4TKLA 1GL7A 3VOBA 2OD7A 1LS1A 5FTKA 3RYFB 2PU5A 1OZHA 2QX9A 5TMPA 2PBZA 5J5VA 2QRNA 1E6EA 3QKSB 5ALHA 3H17A 2Z83A 1XXHB 2R5WA 4G4SP 4LHZA 1YCHA 5KQSA 1MC8A 3H2GA 5EVJA 4DGSA 2W2TA 4YBZA 1UANA 5JJIA 5BUQA 4FILA 3P9KA 2EBHX 3BJZA 2GAJA 2VP2A 5EAIA 3H99A 1SN7A 4Y2HA 1KE2A 2PVSA 2G25A 4L8FA 4CIYA 5MDHA 1QLJA 5KSYA 3P19A 1NJGA 3FNEA 4D2IA 2FKAA 4HDNA 4XJSA 4B71A 1GU7A 3W2FA 4DW8A 4IYRA 1QONA 3D02A 1E6CA 3DL2A 4F6LA 4D45A 2PWYA 3VR6A 1NNLA 1OWOA 1DT5A 2O2ZA 5SZKB 1WMDA 1KEZA 2PLNA 1U2DA 4H60A 4PHHA 1XLWA 4QO8A 4Q4HB 3C87A 4R1PA 5K6RA 4Z0TA 2NMVA 3VR4D 4FZ3A 4J9UE 3SF8A 1XJ0A 2QG9A 2V6JA 3TLGB 1S9HA 6LDHA 3R0IA 2AUNA 4LA4A 1U90A 5LWQA 1M5TA 1UBOS 1Q0ZA 1E0JA 4TTQA 3IUYA 2ZJ5A 5H3CA 2XWBF 2V58A 1YDWA 5JS1A 3MUOA 3QX9A 1RBQA 1QP7A 4C2UA 2MOKA 2X8JA 3RANA 1CQJB 1C8VB 3FOCA 2KE5A 1F4VA 4B48A 1RQNA 2AEJA 2NU9A 2PA3A 3BN3A 3IVCA 3QX8A 4GMFA 3HKEB 4KN6A 4KQKA 4PZLA 4RL6A 5JLAA 1XI2A 2VJCA 3GAFA 5TF4A 3I2FA 4BLRA 4TSFD 1HTWA 1C81A 3MLAA 5FAKA 3PEVA 3PPWA 2UUCB 5EWJB 1R6TA 2PR2A 3CT4A 3EXFB 2L17A 1XTJA 3JX9A 3RC1A 4DBVO 2D1FA 3CE9A 4PC2A 1JS1X 4I50F 5JATA 1WUHS 1LQUA 1N8KA 4IP0A 1I7DA 4I1RA 2QMUA 2OGZA 3WGOA 3B7WA 3OZFA 4LOLA 2FZWA 3ZZNA 4HNAB 5B2EA 3CM0A 4QTYA 4JMLA 5ICMA 4LC0A 5JO9A 2PJUA 3NGLA 1UR5A 2YWCA 4PLVA 4QFBA 1CS0B 2CC2A 3T3HA 1D09A 4WLVA 1QBKC 5FORA 4FBGA 3E5RA 4AJIA 4DCNA 2YHSA 2CXXA 4D9KA 5C4MA 3RF7A 1YBHA 2EJUA 4XR4A 4Q4DA 1KEVA 3SC2B 1SAYA 3ERCA 2QF7A 2VATA 1LPPA 1MDFA 2XKJE 5GADl 5D7NA 4EHIA 1Z7BA 4FCCA 4GL4A 3VO9A 3EWIA 1JWBB 3I9OA 4IVNA 4DUYB 3NP9A 3VAZA 2QX8A 5CA0B 2XCRB 1ZBQA 2GK3A 1QIKA 1ZINA 2H5EA 4M8SA 1HURA 3UCFA 2O5EA 1EWKA 1CJSA 1H2YA 5KNLA 4MUIA 2ZREA 5KTPA 2ZRBA 2JLCA 1UMBB 2WFLA 3A32A 1JHAA 1UZNA 2IEZA 3HJGA 3FLEA 3LYLA 5LNK1 3K53A 2B1IA 1H4SA 3EVZA 1I24A 1V6AA 5HMMA 3H42B 2Y1GA 3FTFA 3NJRA 2JFUA 2LKDA 1QK4A 2F1KA 5CT6A 3ZVNA 3TDNA 2ZIFA 4YLEA 3UJCA 1JE0A 4FXPA 2G28A 5E0OA 2I4LA 2BEWA 3RSZA 5J4YA 3K2QA 2ZBVA 3FG9A 3NYIA 3RTGA 1UBMS 1ZVJA 1A1VA 1OIVA 4A5OA 3ZVKA 2FR1A 3K1AA 4OMUA 4E31A 4C9BA 1PT5A 3IO3A 2WF9A 1XN1A 4BQPA 2ZYUX 2JIZA 1QQ5A 5EINA 3NBKA 1C8KA 4QRDA 4UHHA 3VBCA 4XUGB 2IL1A 3DGEC 2GSWA 2JJ8A 1L8LA 2UUOA 3N2KB 4NL4H 3TLBA 3ZWVA 3ZVRA 4CDGA 1UXIA 4F9GA 4I4TF 5IBCA 1KI2A 3HMKA 3G82C 2IWHA 2UYOA 3IXQA 4JV5B 2EQ5A 3IA7A 1L4YA 1Q0RA 1T4CA 3H5AA 3ZHTA 4RE5A 3IOMA 3D4BA 1Y1RA 1ADFA 2RH4A 1IRXA 3VC3A 1HYGA 1V41E 1PFVA 2A3NA 2I4RA 5EP1A 3N5KA 1X9GA 1ZG3A 2RHLA 4LYYA 2GM9A 4LWQA 1GZSA 4N0PA 4JI0B 4F2WA 3LKBA 2PKQO 4FR5A 5G0VA 3JD0A 5BQOA 3T99A 4C04A 1QF6A 1SIBE 5DGCA 3NANA 2QB5A 2O2DA 5EWMA 1MN6A 1Y5LA 1ZAKA 2QTCA 3V46A 3A4LA 3F71A 1YR1A 2CXTA 3CZRA 2ZI9A 2C03A 4FCWA 4I50B 4OYLA 5BYBA 4HN2A 1TVMA 4KPGA 2VYNA 5IH7A 3TIIA 1KPGA 2B83A 5K6TA 1TYCA 3RNLA 4IDEA 1MCZA 5BVGB 1CIPA 3MSXA 1U0OC 2XUKA 4GFDA 4JJIA 4RYDA 4EJSC 3R6TA 6GPBA 5DNYB 4QGFA 1IN8A 1JVBA 1T1SA 2HDWA 4OQYA 4E1AA 1IQ0A 5EJ9A 4OXIA 2G76A 4WFJA 3CMCO 2K7FA 1BXGA 1IJBA 1PJQA 3O3OB 4UMVA 2NU6B 1XQ6A 4ZQCB 2DP4E 4KXYA 2GASA 1T29A 1P9NA 1V11A 4I4IA 5C5DA 1BWSA 1OD6A 2D54A 1XVAA 3IUQA 4XIFA 2JAUA 2BBTA 1LPMA 2JGJA 5B4UA 1RXUA 3CPJB 3SEAA 5K01A 5FBLB 2JGRA 2R3SA 2R87A 1KQ3A 3NM6B 3VXKA 2HT1A 3OQNA 1D2HA 4MQLA 3GR6A 3I04M 1MO3A 3IOEA 1M34A 4DZRA 1B8PA 3DEZA 2HN9A 4OXKA 4WEQA 3QXJA 2R1VA 1P6QA 2AF4C 3UWMA 3EA0A 2Q5FA 4CM7A 1S3FA 3SIPA 2QJRA 1MO4A 1CQWA 4LDPA 4RPJA 2C8VA 4PZ0A 3RC8A 2NO4A 1EP2B 5ARDA 1XVTA 4XSGA 1XKQA 2OXTA 2E48A 2ZR9A 3PCTA 2FCAA 1ZKDA 4EY6A 3KKPA 4UVEA 2UUAB 1PG2A 3K9CA 4X3CA 1D6JA 3K0AA 4GUDA 4Q3EA 1V95A 4TM7A 4MS1B 3ASZA 1YB2A 3Q8WA 4IIGA 4OGKA 5C8YB 2I67A 3NUQA 1IEVA 1CK4A 1I2MA 1JDUA 2IDMA 2UZIR 1H5UA 4FGLA 3E1SA 4JBGA 4KGDA 1WXXA 5JYDA 4PICA 3TIGA 1TPYA 1NBAA 2PAAA 1RAHA 4R1OA 5EXEA 3ZV7A 1NUQA 5L3SB 1NF3A 3MEQA 1NI5A 1YCFA 3IKVA 4CKBB 2I8CA 2O54A 2CL5A 5FYDA 1I4DD 3HYRA 3W4JA 1CBUA 1VP9A 2O5RA 3OCVA 7MDHA 5EHZA 4YP9A 2HRRA 4Z6KA 1GQFA 1L5YA 5CD9A 1T9AA 2O8DA 1YE8A 4KU4A 2B4AA 1WSAA 1BRTA 2WM8A 4MB6A 3ZC3A 3ZXUB 4A2CA 2YIMA 2HSGA 4TYPA 1P7CA 2RGNC 3OJWA 1EK0A 3D2BA 3FR7A 5C1DA 2AZXA 5DMHA 1EXMA 3G8BA 1EUCA 3U3KA 2HW8A 1IY9A 2HBQA 5T64A 1NT2A 4M1ZA 5AI8A 2M2IA 4AXXA 1NVWQ 4L15A 1KI8A 4HQLA 3CBQA 2ZYAA 4M8NE 4ZRDA 4FE7A 1FU7A 4EVQA 3BGDA 5FLKA 4HFNA 4NPHA 3DHYA 4Q9AA 4X92A 2PKWA 1C5KA 1EWYA 3RQIA 5AM3A 1KVQA 1G4AE 3I6MA 4D4IA 1JQBA 2IUTA 1IWOA 1UBFA 4ZVKA 1FUIA 1K8XB 1WMFA 3WFIA 4KVFA 3ZDQA 5LQNA 1BHQ1 4OXNA 3N8IA 2BLNA 3OZAA 5FPHA 2CCGA 3P96A 3RK1A 2JFGA 4RTRA 3CLUD 1O95C 4AIRA 5CT8A 4RIFA 1OXUA 1JXQA 2OPBA 1ZI6A 1SUSA 1RWNA 4FB4A 3ZS8A 2O3TA 1EZ4A 1CULC 3IALA 4F4UA 1WXEA 4Q9DA 4WLUA 1GLNA 1WB9A 3VHQA 3GK3A 4KMMA 1J5XA 3TIXB 5B7GA 5CIYA 1NY5A 1LKZA 3MS4A 1BJKA 1LJUA 2WWRA 1TXGA 2EEZA 3N59A 5DBGA 4MI9A 1ZHOA 2VWPA 1U8TA 5FWAA 3UC5A 1E2LA 4LZLA 3EVAA 1OASA 1VJGA 3HACA 2IU4A 4LF5B 1VSUA 2LUOA 5B6JA 3AB7A 5B7PA 2Z8YA 1A9XB 5K1ZA 4PGMA 1NQWA 2P5YA 4GXRA 4J0HA 4FZ5A 4H2DA 2XEXA 2V45A 1HFJA 3F67A 4L95C 5D86A 4DSNA 3WL5A 2HZ7A 4CIXA 4LY3A 2HA6A 2VNHA 1O97C 1SQFA 2CT8A 4UUQA 5E6RA 2Q4TA 2HT6A 4AF7A 5B3LA 1H4TA 4GGPA 5AVVA 4M1YA 1TA0A 4PYKA 3WLJA 3H8VA 4G1EB 3DR3A 1M10A 4J03A 2P4QA 2XTNA 5E0KB 1U7UA 3N28A 1WRBA 2IZ6A 3CZ9A 3Q85A 2KMLA 5EJMA 3SSOA 1XJ5A 1F0PA 1LY1A 3P9CA 4H1HA 3S2GA 1XMSA 3OOEA 2Q8NA 1IN6A 4XIIA 3WG9A 1E1MA 3AF0A 5LUBA 3SXUA 4R8MA 2F1HA 1EP9A 1RYBA 3TEFA 3UHFA 1Q19A 3PNYA 4FE4A 1CT9A 1U99A 1ZK4A 2XQVA 4JLAA 4KO1S 4F3RA 3TMKA 4BVFA 3D0OA 1TZ2A 4UQLA 5T7BA 16PKA 4CLRA 1ZEJA 1R4ZA 5A3JA 1MH9A 1F8UA 2BGUA 1BHJA 4G4JA 4COOA 4LRTB 2R60A 1FP4B 4X1OA 1KRWA 1X13A 4GP6A 3R3HA 4UM8B 1GU1A 2PGAA 3PTZA 1EWVA 3HZZA 1RM3A 4OQ4A 1PT9A 1Z2CA 1SCIA 4Y6PA 2R0QC 2QD4A 2C31A 2GYWA 2BFDB 4QT4A 1ISMA 1EE1A 3P9PA 2EW1A 4NF2A 2ECPA 3PPYA 3C3CA 3W7BA 3AEYA 1F60A 1U3VA 1EINA 4G24A 4UUBA 2DUWA 4Y6GB 4EYEA 1A3CA 4OI2A 2Q1WA 3AF4A 4N6NA 4JP2A 4JI5B 1XVVA 3WV5A 3ZNNA 2O2JA 2ZDGA 5E1BA 1P2SA 1W9HA 1ZQ1A 2E6KA 2H59A 4HEHA 5TEVA 1FE8A 2YYYA 3TNYA 3UMGA 2EGUA 3TGWA 3JD2A 1YVUA 3L6CA 3RRMA 1ZH0A 5TV2A 4Z8XA 3HDGA 3TI9A 1PD0A 2A59A 1C0PA 1OH6A 2XBUA 4WXMA 1Z4KA 3RIGA 4IGKA 3RVDA 1ZVQA 3DLTA 2JS7A 4EGAA 3P97A 3I76A 4EGJA 4F8YA 4O4HA 2I7DA 2CLSA 2R7NA 5KB3A 5MF6A 4D3ZA 2CD7A 2WWTA 3EH2A 3IXMA 4JBNA 2YWEA 5KCMA 3RRNA 3ZXXA 4BJ6A 4GS5A 1SC1A 5K3FA 2V5VA 3N53A 2AXPA 2VAWA 4XOIA 3C1AA 5JAHA 2HIGA 2VAXA 4ZZ2A 5LQRA 4BP9A 5C52B 4BNVA 4ENTA 1C1XA 3CNOA 2IF0A 2OESA 2UXBB 1PJRA 3ZUPA 3EQ7A 4DL9A 4PLPA 4JB2A 3IMEA 4RTNA 4LZOA 3USZA 4US2R 3EEQA 3G2PA 4MQBA 3O8OA 1I33A 3K0FB 4R2WA 2FPLA 1RMYA 3G2NA 1HEUA 2J9ZB 3FZNA 1QFXA 4L75A 5FT9A 2FUEA 2BKUA 3VDQA 2F6RA 4HVCA 2ZUSA 3L4EA 1EM8A 5FBRB 4KQXA 2YY7A 1E9FA 4P22A 5GJVC 4RFLA 5LB2A 3ZN2A 4LMRA 5HR5A 1HQKA 1SU4A 3P2IA 5F2NA 4JBWA 4D79A 4PCUA 1YAHA 4XX0A 4YDRA 4RFVA 3SFVA 3T7IA 3DOEA 2HU7A 2P6PA 2VT6A 4BKQA 5DNWA 3ANTA 2VSQA 1Y5IA 1GNLA 2ZDHA 4HAIA 4I8IA 2GFIA 3HB1A 4NE2A 5C80A 4JWKA 1NN1A 4C4OA 5FA6A 4C0AC 1HOTA 2HF8A 3G79A 4IH1A 3KTDA 3QVXA 4QHTA 4MPDA 1H8HD 3BMXA 2R8BA 3HLTA 3CUEF 4IEFB 4OD0A 1G21B 4I7EA 4O6VA 2X3FA 4ZVLA 1N8NA 4ND3A 3OOSA 3OICA 2WU1A 1PNVA 1G21A 4HHEA 3CRRA 4D6XA 1IJEA 1HT3A 1JXMA 1ZR4A 1E64A 1ZOLA 3CKMA 1Y42X 2WWIA 3H86A 1G7CA 4V2UA 3D3KA 3PHHA 1WUKS 1Q7EA 4RF2A 3PUXA 5BNIA 2IELA 3EZXA 4ZAGA 4EP1A 5KC9A 1Y3AA 3UYLA 3HI6A 1W0CA 2BFBB 2FMFA 1U2SA 3A4YA 3ESDA 3GT0A 4MYRA 3R9IA 3TVDA 4AS2A 2Y99A 5KQGA 3H2KA 1R0CA 4EA9A 1NVFA 3D6AA 5KVQA 3PA8A 2CZGA 2HI0A 4RF5A 4EA6A 1K0FA 2O7SA 5ALOA 3UENA 3IBFA 1C8LA 2HMYB 2R79A 1LC3A 3KB6A 2VP5A 3RG8A 3SHFA 4CHTA 2VG8A 2GCOB 1NP3A 4ZYTA 2HREA 2Z5GA 4HEA1 4II3A 2X4GA 3KPUA 3R23A 1RYHA 1L2TA 2GEJA 2H00A 3DP9A 4MZDA 2GPAA 3JQCA 3EJ6A 4PQEA 2NU8B 4ASUD 4WHMA 3HBNA 4BGEA 2O23A 2WFAA 1LPOA 1QVWA 1TUGA 2CLFB 2QVCA 3FTNA 3O94A 1DAEA 4MP6A 2Y1LA 4O4IF 5M04A 1HEIA 3G0GA 5AXAA 3HY3A 3W5IA 1N7HA 2HIMA 3LP6A 4A2PA 5FA5A 5BMOA 2C7OA 1FUYB 1ILWA 1RLUA 4JBYA 3OZVA 3WB2A 4DAOA 2QTVA 3RB8A 3TNDA 1UBGA 3RUHA 2O2GA 2PKXA 1W5TA 2QQGA 1R12A 2JGMA 1RI3A 4H16A 3AGPA 4JR0A 1R0SA 1ULAA 1YDMA 1CP3A 4PRKA 4U2GA 5EE0A 1ZFNA 5ELMA 5BN4B 2MDTA 5EIFA 1UAYA 1ZCJA 2PVCA 1I6WA 1FX0B 5K2MA 3TZQA 4JOBA 1FX1A 4OBWA 2FPWA 4E5DA 3WL8A 3F4KA 3RFVA 1FLDA 1QIDA 4EPYA 2C1XA 1AZLA 2GK4A 1NZDA 4YDQA 1RC8A 3T3NA 4GPEA 3U09A 3Q12A 2QPTA 4QBTA 1M2OB 4YX9A 1QO0A 2GPBA 4QNNA 5BV1A 1NW9B 1PIWA 1YB6A 1JMYA 3OCYA 3GZNA 2O2XA 4LZAA 5D7BA 2BCJQ 1VRWA 1KWGA 4A8JB 2FPXA 1CUWA 2HMVA 2QD3A 3P9RA 4FK8A 2Z30A 2V1XA 5F1KA 4RDHA 1CYEA 2Q5OA 1C0KA 2PWPA 5ALDA 5DTJA 2WWVD 1OCEA 1CVLA 3OP1A 2EP5A 1FUEA 1XB2A 4WKCA 4EF6A 5CFOA 4DIKA 5FPTA 5A9SB 4ZYVA 4D96A 1N5JA 1T8UA 3P2EA 1X39A 1DI0A 1M9NA 3WNDA 4AN1A 4P3OA 2H4YA 2L19A 4OHUA 1RWOA 3B12A 3WYAA 2X9GA 4RTQA 3O83A 4CV0A 1VPWA 1VLHA 1U8FO 2W71A 3HBMA 1L5QA 1X1AA 2ECQA 2LIVA 3LWZA 3M1LA 1M6VA 4P7JA 4JI6B 3BJMA 4XQEA 3VH4A 1MO6A 4X1YA 1ZLXA 4FN5A 3BS4A 4F93B 4ZYLA 3CZ4A 3EXIB 3UC9A 4NDNE 2R86A 3SQOA 3BUSA 2H1HA 2Z43A 3TD6A 4LJ5A 1Z62A 2OXIA 3CCFA 5KYYA 1ND5A 3E4DA 3OF2A 5HE9A 1Z83A 1HRDA 5THXA 1DB3A 1NVDA 2PA0A 3O3NB 1TJ5A 3O4JA 4YGYA 3TQTA 4AN0A 1MT3A 1XEFA 4H0FA 1O95D 4DMMA 4KR3A 3PC8C 2ZJ0A 4MW5A 4LOHA 4RDCA 5DHQA 1JQKA 3DNFA 2V65A 1H93A 1JPUA 2GOYA 2V7UA 3GHYA 4PZEA 3U3MA 3C16C 1VG1A 1T2CA 2UDPA 2D7JA 2QLNA 5HM8A 2G40A 4JVMA 4ZVPA 2C3YA 4RMIA 5LA6B 4C20A 4YS6A 2ZYRA 1ZONA 1I3OA 5D00A 3WC4A 4MGKR 3GCDA 2BTQB 3QH4A 2WHYA 3N2LA 3WIVA 4X60A 5TLSA 3C5HA 4MI1A 1EFTA 1ZY2A 3FYSA 4IHAA 5CDSA 2NVOA 1A9TA 4UOZA 4P7KA 3K6SA 5B7QA 4DQ0A 5JRJA 2XZPA 3DTTA 1BH6A 1C9DB 2UVPB 3Q9UA 1EIZA 3ESXA 3D7MA 2OQVA 5JJBA 5FOSA 5SZIA 4B4VA 3P9XA 1YZTA 2RHJA 3ONVA 3QHQA 4UZSA 5JMOA 5F78A 4MICA 4E2FA 3KZCA 4WOJA 3QHAA 4OF4A 5HJ7A 1M7BA 1P9WA 3IKMB 5DHAA 1FVHA 4PSCA 3GLIE 1P91A 3WRXA 2O57A 4NBVA 1MQSA 5IYZF 1R9MA 4C6TA 1VDZA 4ACBA 2DC1A 4ZEOA 3BSWA 3LYAA 3Q98A 5KYUB 1XBTA 3H6KA 4K6GA 1SRRA 2XGSA 4AP5A 3JASB 3IAS1 1UKCA 5EP3A 1RAAA 1RM4A 3GLUA 1XL0A 1JSZA 3PC8A 4V3CA 4UW9A 4UVIA 2BJHA 4MAMA 4XQ0A 3WGKA 3VR6D 3MINA 4QHSA 2BJWA 3EVEA 1G8AA 1R6VA 2VBCA 2NXNA 3BQNB 2QE7D 5J3JA 3QFRA 1DBVO 1NVKA 5CLFA 5J2TB 1LTHR 3DVRX 2Q0SA 5CX1A 1BXRB 2DVMA 2FX3A 2PMKA 2PLAA 3BWVA 1QDLB 3ENNA 4G4GA 1SWVA 2RGNA 5F4ZA 2OCGA 2OZPA 3K5PA 4WNAA 3U39A 3THXB 1B3RA 4LQDA 5JARA 1M6NA 3KB1A 1U2RA 2HDHA 2IEAA 3N3AC 3N2NA 3EGCA 4JT9A 4NK5A 3TXYA 1SU7A 4MRMA 2O19A 4ABYA 3F5DA 5HUHA 3COPA 2XEDA 4Q39A 4FCVA 4KZPA 4FR0A 1IY1A 1AB5A 3ND6A 1XZGA 4J2HA 4MJ3A 4ZGWA 1S3GA 5ESRA 2R8EA 1S0UA 4N5MA 3B38A 5FI5A 5IYZA 3ZZ1A 4O5AA 2Q3DA 1PQPA 3HA7A 2IDZA 1M2FA 3E9NA 4UAGA 2VRCA 2Z1NA 2GKSA 3I05A 3V8QA 2ZQYA 2L0XA 4WTOA 1Y3BE 5J43A 3ZGNA 2AUMA 2PQ6A 4YASA 5TF0A 4EAQA 4Q4JB 4KNYA 2VOJA 1Y1QA 1H2RS 2WYUA 3T9BA 5C9ZA 3E58A 2NOAA 1T3GA 2Z58A 1Y3FE 2HA0A 3NNDA 1NUUA 3FCXA 1LBIA 3S40A 1FS5A 4L50A 4Q4JA 2DWCA 4MW7A 4E5MA 1VE1A 2MR6A 1Y4SA 1O0SA 3LP5A 4K6OA 4MROA 1I1HA 2IBTA 2FWRA 4WBXC 4X65B 3NOQA 3RASA 1X2BA 2R2GA 5AMXA 5AWFC 4KDFA 3RJ5A 3F1LA 1FFSA 2ZTVA 3FROA 3LGXA 2ZBUA 3DWGA 5KX5B 4LF7B 4DV2B 2ODTX 4MO9A 3G49A 5IAAA 3LCUA 5U4XA 4Z1OA 2JARA 1SOVA 4JCOA 2C9OA 2Y77A 4K5QA 5NLLA 3NHKA 5C34B 3WGQA 3M2TA 2LD4A 1XMJA 4IZIA 5BSEA 4ISCA 4CMAA 1FJXA 2QR2A 3E8SA 2XB4A 5ALYA 4R6WA 4WKOA 1HR0B 3D7LA 5DO9A 3W9BA 5L40A 4I1PA 1F7VA 3ET4A 3BQ9A 4H31A 3DC2A 5JXWA 3T3PB 2XBMA 4LF4B 1H65A 3OU7A 5I45A 5LA6F 4LF9B 5JD5A 2BR5A 2BRUA 1Q7TA 1MXFA 2PBLA 3AWIA 2F55A 1CP2A 3ICWA 2IH4A 2QUKA 2CJXA 2EP7A 3O4RA 5MN4A 3QE9Y 1UZUA 1X7WB 3MD9A 4NV1A 2JJ1A 5DIZA 5CD1A 1B2RA 2Q6OA 3UMVA 4BMSA 4Y1FA 1D6MA 1E0KA 1NNUA 5E4FA 4ARCA 3D2AA 1YV9A 2CVZA 4Y8VA 2MMCA 4FQ7A 5CCDA 3DONA 4PEVA 4ER7A 5IBPA 3MELA 5HTKA 4PW0A 4QU0A 3RTAA 1M2EA 3EQ6A 2AN4A 3WMWA 5ICGA 1LD3A 4Q18A 5F7ZA 3F8SA 1WBBA 4E51A 4Z7QB 2ZKIA 3C5CA 1LRJA 4GOKA 2WTAA 3DWEX 3F6SA 4BMPB 4X8OA 3JAWB 4EHHA 5BPHA 4LWZA 4D8WA 1RZRA 5JYBA 1IYZA 3MCZA 1CE8A 1PR3A 1K8YB 5JAQA 4BVBA 1DLJA 2YRXA 5EJGA 4D41A 3L0CA 1MZPA 4DCVA 3BGSA 1O6GA 1Q0LA 2AFIB 3G5TA 1Q0TA 2HIHA 1BGXT 2IZ7A 4OK5A 4EMUA 2GN8A 4K2HA 2CDNA 3E0XA 3QEMA 2WOJA 2QMOA 3FKJA 2C0CA 4CQJA 2RC6A 1G41A 2OCBA 2V1UA 3DMHA 2DPXA 4G5XA 2WI8A 1WOYA 3GGOA 3VKGA 4MVJA 1DAOA 4QICA 5J5CA 5EJ7A 3JWHA 1P2DA 2J41A 2VCEA 4M6WA 5B3AA 4A8JA 3EGXA 5B7NA 2XF8A 4B80A 3BCHA 2BBSA 3CN9A 4B6QA 3REQA 4O5OA 4I3FA 5DM60 4EFKA 4TXJA 3USCS 1M1UA 4I1OA 1K3FA 2J3IA 3IO5A 4Q1CA 4JT2A 5EA2A 4NABA 2H18A 4INAA 2J32A 2YVKA 4RUKA 2PXCA 3G2HA 4ZOLA 1MMFB 4K7JA 1ZOIA 4OEHA 2OA0A 1F9AA 4KN5A 1E8NA 4QJBA 4D57A 5GZ6A 1OU0A 4QSMA 2PSFA 4CTKA 3MNFA 1XZNA 3CX8A 2HGZA 4CM8B 1VLJA 3AOGA 4ICIA 4LX8A 5BOSA 2EQAA 1FFCA 3DHEA 5HS6A 3NTXA 1S02A 1U2EA 2GLTA 2QUZA 3ORQA 1EXDA 2QD1A 3EGEA 3VV3A 2JVKA 3DOUA 4A8JC 4RQTA 5JNSA 5JQWA 2B1RA 2BHLA 3AFOA 1L7NA 1W87A 1Y6ZA 3QU9A 3FCEA 2VA9A 4PN7A 4BRUA 3G8YA 1BXKA 1UBRS 3VZDA 5B36A 2FH5B 5KWEA 1RABA 2QG6A 2EGGA 4F7WA 5CCXA 2I4OA 4TSFA 4E0BA 4P5EA 4HUTA 3M5DA 2P79A 3MZ0A 1FYVA 4ZALA 3VC1A 2BGJA 2ZULA 1JDVA 3AJ8A 3QTLA 4CEJB 4RVNA 3K5HA 3CH6A 1ZP6A 4V1CB 1A9QA 1KJYA 2WHQA 4LK3A 3PQCA 4YRLA 1QS0A 2FN3A 3I9JA 4FYHA 3FOZA 1YFJA 1D04A 3I0ZA 1JDJA 1CZHA 3CRQA 1IK6A 1P61B 4K9MA 4BMXA 1JU4A 4P38A 3KL2A 1MAUA 1J49A 1NATA 2ROQA 1XZKA 1BEEA 3EDOA 4RJIA 1PI3A 3A7DA 4MQEB 3T3IA 5LDDC 2PYIA 1B93A 1G3IA 1K97A 1YRYE 3IVMA 3K0CA 1D0SA 3IIMA 1BKDR 2F1OA 2F9FA 3OSUA 4WCVA 2HMTA 5CB0A 3SC6A 3A70A 2YW2A 4F5YA 4HNSA 1AUQA 5JECA 3TBHA 4ITUA 3W5BA 1EVKA 1H2FA 1PFWA 5JSZB 1C3OB 3K94A 1YS9A 3LQFA 3GDFA 4U8HA 4IH9A 4V39A 3OG9A 2YXLA 1G8KA 1JSXA 2P2CA 1ATIA 2IYYA 3ZW9A 2RMKA 1XDDA 2DKFA 3G9ZA 1DXOA 5C18A 1TQ2A 5FHQA 2VP9A 1W73A 4Q4AB 4IKOA 3LX5A 3BTUA 4Q4HA 2YZGA 3L6UA 4U2FA 1I01A 5KYNA 1YK1A 1RJ9A 4L8YA 4GWKA 4GYWA 5HF6A 4DJFC 4PX9A 2BZGA 4B4OA 4BQNA 4TQUS 1W76A 1VCMA 1DQPA 2AJCA 3OPYB 4JLNA 5KYVA 3UB2A 2JBHA 3R5SA 4MV9A 1J00A 2NO7A 3PBKA 4TLDA 4UOQA 2VZ9A 3AVWA 1TUBB 2EG9A 2XB6A 2OTCA 5I9NA 5JH7B 3EODA 5L8VA 1POXA 3V8NA 3N07A 2OBBA 3JYOA 5JADA 4IVQA 1KBOA 4LJKA 1YBFA 1PBTA 1OXBB 1BC5A 4EJ0A 1MAAA 3D6NB 1IAQA 1YQXA 2FK8A 3NKVA 4BX2A 4DPKA 1ZRNA 2J5KA 1MIHA 5LD2C 1JKJA 1RVV1 1MQ9A 5EFZA 2AUTA 2HJRA 1QIIA 3BWBA 5LLTA 2YHIB 5HX7A 3EOAI 2ZRPA 5EMJA 4YXFA 3ZCVA 3PQDA 5FA8A 1XLTC 4OHKA 1CERA 2C5BA 2P91A 3N74A 5A71A 4J7CA 5CNIA 4BUZA 5BUSA 1UODA 1V3QE 3NT5A 1OLOA 4X54A 5FP0A 2AIRA 4DADA 3LFHA 1XCMA 5ED4A 4K6KA 1J99A 1SVUA 2NV2B 4KGZA 4DEVA 2JLZA 4AMUA 1F9EA 1EU1A 2VNAA 2P0EA 2EHDA 2B98A 4KV9A 4LE1A 3BF8A 1QO7A 1UFRA 3HVKA 1V5IA 4XJVA 5LM3A 5IW8A 3R44A 1CQPA 4ECEA 2R1TB 2YQ4A 1KOGA 1GPBA 3WWDA 2AI3A 3IHLA 4JYCA 2FN9A 1YKGA 3ENWA 4L9AA 4AUKA 5A4DA 4LFAB 1PVVA 4L9SA 4NCAA 1P0PA 5TSDA 1E1QD 1V37A 3HR8A 1AUVA 1V16B 2OLKA 2W2XA 1D7AA 2BZSA 4TS4A 3EXFA 5HKAA 1PJBA 3EMDA 4MVYA 2WE7A 3LPMA 3NC0C 4OU4A 4B6RA 4EKNB 4YV7A 5KYTA 2WQ7A 1V9SA 2EFHB 3CUVA 2QL5A 3MGKA 1QO9A 4W63A 3L7DA 1KORA 2G5TA 1ADJA 3SLGA 3RS4A 1M72A 2IYUA 3AIIA 4TV8B 3QK7A 5A4JA 4OREX 3V7NA 2I78A 3QBJA 2D5LA 3PQ8A 5KTYA 1TVKA 5F1YA 3CF4G 3WYEA 1QGYA 4LHVA 4N7BA 4BP8A 1SY7A 3MERA 1RXVA 4MP8A 1KZYC 3ETGA 1F2TB 3SOPA 4CHGA 2YIVX 2O3UA 2PG3A 4AT1A 3VDMA 1E2EA 5SYMA 3FNRA 3FWYA 2XOXA 1F5SA 1KWKA 1STOA 2FSIA 3IEXA 2MTBA 4HN9A 3R6DA 4KYUA 1RRGA 1CUHA 1NVBA 1ZDMA 5L95A 4QVGA 5LP1A 3DBIA 1NULA 1XWIA 4CLHA 3UPTA 3K8QA 5SY4A 3EQ9A 1FDVA 3WYBA 1SBYA 1ZCFA 2FZGA 2QLLA 4MVJH 2Y0EA 1NQAO 4LTNA 5DI9A 4K9RA 4HAVA 1E66A 1JZTA 2RAUA 2CNNA 4I66A 4QXAA 4F1KA 2R47A 3NALA 3SMQA 4RFSA 2QUIA 3ZBQA 2CFOA 4ZVQA 4BO7A 1U0EA 2ZKLA 3R7DA 3VZSA 3X2EA 2PEYA 2DPYA 2R6GA 3UUGA 1UDCA 3X2SA 2NUAA 3BMNB 3QVGA 4AG5A 2ZBRA 2ZR0A 3OZIA 3ODGA 3ILVA 2NSLA 3INNA 5GQSA 3FTCA 5A3VA 2CMDA 2Z3WA 1NI3A 1XEWY 2ATCA 8ABPA 2VF8A 1K9VF 4HH0A 3QNMA 2OLJA 3QEBZ 1I30A 3KQSA 3DFIA 3M4YA 1Z0KA 2QKYA 2FGKA 3GGCA 3KR2A 1REQA 2HRBA 3BMQB 1YR8A 1GITA 3QPVA 1CRLA 1KSHA 1WF6A 2FWAA 3DBHA 1HYHA 1GGVA 2C0PA 2E49A 2O8EA 2ASEA 2QA5A 1XLVA 3KKMA 3RSFA 4GI3A 3GH1A 4GP7A 3HB0A 4J2OA 4V0NA 3JVEA 3SVZA 4OI4A 2X0NA 3CX6A 1V8ZA 4U9IS 3SBXA 3TTTA 1AN0A 5BMVA 3NVKI 3D5TA 1GWNA 4ARBA 3WGHA 2JKZA 4BDTA 2IQ5A 3IGFA 4DOMA 2J87A 4BIIA 2IP1A 1UIMA 2XE7A 4X00A 1UC9A 3BREA 5MGBA 2GJKA 3FNGA 3RTEA 1U81A 4UNRA 1HQCA 3KPJA 1BE6A 4BGVA 4BU1A 2ZK7A 2P30A 1EE9A 1ZRSA 4LVOA 1KDVA 1KJJA 5EG5A 2QYOA 4M0PA 2AKAB 5HKLA 2JFVA 3M6VA 2OZKA 1CY0A 4FUQA 3SP1A 1E89A 5K5EA 3GFOA 3AL0C 3ZWWA 1ZUNB 2HJVA 4DABA 3GLQA 2VDLB 3AZQA 1LLUA 3S1SA 3R8FA 4D46A 1B76A 4RD3A 3PEYA 5AVOA 2VXBA 2TSYB 4MARA 3U37A 6AT1A 4PTZA 1AK2A 4MS3A 1JIUA 3HWWA 1EQUA 1NXWA 3VYTB 5BXQC 3WWEA 1JV2B 2N75A 2OZVA 4JJ7A 4MW4A 3RM3A 3U5TA 3U56A 2OORC 2XNJA 3HVHA 1VKRA 1X9IA 4CTNA 4BVGA 1L3CA 2GBGA 4HLCA 2HZBA 1CUGA 1EA5A 2XVZA 4JLPA 5LC1A 1KI1A 2AR9A 2VJPA 4C4YA 3CZ5A 3K72B 2ZE8A 1GPYA 3VU9B 5IXJA 1MG5A 1VB5A 2XOKD 4AWAA 2GVZC 2GPNA 2PKEA 3L8HA 4GM0A 5KPJA 1EFKA 3M1AA 1GU0A 1MPTA 1MC5A 2B5WA 2ZSFA 3LK6A 4PLZA 1MP0A 3GNSA 3L4BA 3B82A 4U7HA 3WHLA 5HK8A 4EO4A 4BB0A 1EJ0A 3NUZA 4CWAA 3LLMA 2FWJA 2VHYA 3II6X 3KU1A 2GUGA 4KQWA 3S7ZA 4U0KA 3T54A 4D4MA 3P9QA 4MA4A 3BCRA 3PGVA 4PX2A 5CYOA 1IAVA 3W3AD 3AYXB 4DMKA 3BD7A 1OIWA 4WDQA 3REFA 1RC0A 2P4UA 1KQGA 3TE7A 4D02A 2BMFA 4NHEA 821PA 2QM8A 4M76B 1P7YA 5CU7A 4RVSA 1IWPB 2XZDA 3VDXA 1K27A 3U3JA 4CTMA 1XZEA 1Z73A 1MGOA 2A8YA 4GPTA 4WXYB 1NHWA 4PSDA 1W88B 4FT2A 1T2VA 2XUOA 3I28A 2NN3C 3KSDO 3SDSA 4AF8A 2AMYA 2CMKA 3ODPA 4KIJA 3H3JA 4FR2A 4BO5A 2RI1A 5IN5A 1AQLA 3BHIA 3OAAA 5BQ3A 5IKMA 4B3JA 1W49A 2PCJA 3H4TA 3LTNC 3MIZA 3L49A 4B83A 5IULC 4YECA 1PNRA 1LSUA 1XXHE 3K16A 1U11A 2QIPA 3EAFA 4IUYA 4C08A 2I2CA 3F4LA 3QLUC 3NO4A 1CR4A 2FG5A 4HTFA 1DPGA 1TMKA 2M6RA 1DUVG 4KYVA 3IE2A 2HK8A 1MPXA 1LJLA 3PB3A 3KT6A 3K09C 4LDQA 4PWYA 1JR3E 3SOZA 4A8PA 1L7BA 2KB0A 4GMDA 1EIWA 3CUUA 3AR3A 3LC1O 1RRKA 3G0OA 2ZP1A 3MCVA 1MA3A 4JLSA 4JXKA 4Z0PA 1IHDA 1KYIA 4PRYA 4LPSA 5AO9A 3TFQA 2PTGA 2GCEA 1J5EB 1SH7A 1IBSA 2C29D 4CPDA 2Y9PB 1CQZA 1P1HA 2XUAA 1P1CA 2CXSA 4DLWA 2C8JA 1P3JA 2G09A 2AKEA 3Q5GA 4JYZA 2G08A 2Q8PA 1H3EA 1GRNA 2HK6A 3FJYA 3DZJA 4I4TA 2FRVA 4Z0HO 2W90A 5CYFA 4ZEXA 3H05A 4TWIA 2Y6VA 3L8GA 3RR2A 5HUJA 1BIFA 4E46A 4DA4A 3IBSA 1IPHA 2Z5VA 3AHIA 1GZ4A 4M4SA 4P4UA 4C88A 4HXYA 3GP3A 1JMVA 4P4LA 1RRFA 3ROXA 2IW3A 1OX4B 3E3NA 4Q7JB 2P90A 3ZOZA 4DIUA 2V0CA 1IU9A 1G9TA 3IQFA 2J5BA 4LRQA 4NOLA 4XPIB 1GGJA 1KH1A 3OPVA 4JJ8A 4UNIA 4ADSG 3UJAA 2QW0X 4CKYA 4GW3A 1HL7A 4R9UC 3AEKB 3EZYA 3H97A 2C5SA 2QRQA 1WDTA 5K0SA 5LZ9A 1EHIA 2FXVA 2CYBA 4KBGA 2WKQA 3PF9A 2FAXA 5HW0A 1J5PA 1N2XA 2QQEA 3B9QA 1BX3A 4I6EA 4EW2A 1LDYA 4MUKA 1FMCA 3CNBA 3DE4X 3OJXA 1VIVA 2HQOA 1ZIYA 4K1XA 4REOA 4LGVA 4B6FA 3NEPX 2HLPA 5EZSA 4LJYA 1FMLA 2YICA 1OB2A 1R00A 2FEOA 1HQDA 2XMPA 3C5EA 1PDVA 3FETA 2DR0A 3KAJA 3OPYA 4YFYA 5D51S 1WWKA 1ZISA 1G5PA 2H1IA 4X7BA 5BYJA 4EUHA 5C4IA 1XNQB 5I7OA 4ZDWA 3PHJA 1JI3A 3VRHA 1GPWB 4Y2GA 1T1GA 3LZDA 3PD7A 3OTOB 2G3YA 4URZR 3WL4A 1BYIA 2WVAA 3DMDA 1J8DA 1DO0A 1RLTA 4JLBA 5JPCA 2GHQA 4OATA 2JIMA 2BPOA 4Y2RA 5JRZA 1JG3A 1GUFA 1Y3HA 2COEA 3P2JA 3TCXB 1E3DA 3WOVA 1ANKA 4JNCA 3RTDA 5FFMA 5JDIC 1EUYA 2Q2OA 2M9MA 5FOVA 1HE4A 3S1AB 3PWSA 4ER6A 1NXOA 3HY4A 2A5DA 5AVYA 3CVJA 2YDYA 3SIWA 5AVZA 1L4EA 1WCIB 2HRZA 4GH5A 5FUMA 1I7NA 3WO0A 2AOVA 3U4AA 2XZLA 4JKIA 3OIDA 1LK5A 1LLFA 2FR0A 3LY9A 4U7GA 1T3HA 1T3SA 1DARA 3EYWA 3QF4B 3UKJA 5T8KC 1S89A 2IDJA 5AK0A 2BHTA 4MSUA 3FPHA 3KX2A 5A7HA 1L9KA 1U4NA 3HU2A 4P53A 2QRHA 1CEYA 5ESDA 4D8TA 3ICCA 1C9EA 1Z9BA 1NP6A 2BKEA 2HRDA 2VTEA 1WXGA 3OOWA 3P9SA 2ZITA 3T3GA 2ZB8A 3MUEA 4LRXA 1KAOA 3L7BA 3A27A 4OP2A 3EE6A 4P5PA 3T0IA 4GIBA 3KCNA 5ADWA 1ZGCA 2NAPA 3I34X 1UKEA 4E07A 4EI9A 1OFGA 3DZ8A 3ICOA 4GDFA 1YZFA 4CM1A 3T3MB 4B6OA 1TTPB 1N2IA 1U5CA 1I0ZA 1WETA 1UPTA 1GL9B 3CF2A 3OE5A 3RAGA 5DISB 1YJQA 3WX0A 1F14A 1PUXA 2AMJA 2FRDA 4JQYA 2FR8C 3SK0A 2ZB3A 2EFYA 1VMDA 2XB8A 3P4YA 2XQGA 1P0QA 1ZUIA 2WHEA 5EXDA 1ZW1A 3ANYB 4TKMA 1V4VA 4F45A 1WR8A 4TV9A 4A2WA 2PGLA 3L1KA 3EPKA 4LPKA 3LUCA 1QR2A 2WYOA 2C3MA 1FYDA 1U8ZA 5EZ5A 3PFNA 4Y2TA 2V4ZA 5HJEA 2WT4A 4R8KA 5JD6A 3VUEA 1S3SA 3JQPA 3GDOA 3QMVA 1Z45A 1N5DA 4I6JA 5KCZA 1KZ6A 4EY5A 2W2QA 3S2FA 1TIBA 3W2IA 6YASA 1W36C 1GADO 1SZJG 5D1HA 5B1IA 3KUKA 5GONB 3BRWD 5F2OA 3BWEA 9LDTA 2VIIA 4IO0A 1KQPA 3RFUA 2GZDA 3PE3A 3OM9A 2WWWA 4M6WB 4YTEA 2AMFA 5DTRA 4BAZA 5KDOA 1FC0A 1D0VA 4NQZA 1XTRA 1NYQA 4UHJA 4FKBA 2F2TA 2GK6A 5IC5A 2O2HA 4CCSA 5F33A 3ZNQA 4DIEA 3KVNA 4P36A 5KSOA 3ZJUA 3JQRA 4ARZB 4MKXA 5FJIA 2GRJA 4N3CA 5JZ9A 3QKSA 4NCIA 2E5WA 5IF3A 1V1JA 2WILA 1XP8A 3DJYA 3KHSA 3HKCA 3JQ7B 4AWXA 1Z75A 1SPXA 1DZ3A 3TX2A 3GLIB 1FLAA 2P9QA 3WGIA 3VU0A 2QWXA 1OWPA 1Z5VA 1V5FA 2KSQA 3PNKA 1QCZA 3QTBA 3LWDA 3NFRA 2YZKA 4I5GA 4Y9UA 2O2SA 3N8HA 4DDKA 4F97A 4DMLA 1U8AA 4UD6A 5HRCA 2FSUA 5A5GA 4OUKX 3UXEA 1TEHA 4ASUA 3F5QA 3DYIA 1BOOA 4ZI7F 4HQOA 3SJCA 5JMPA 4QODA 1WLSA 3UJBA 5KOJA 1IOWA 1TK9A 1YRAA 2FWIA 1YACA 2Z56A 3SS7X 3UK7A 4Y0AA 1N5LA 4BOYA 3GEGA 1XC7A 3OF5A 1B6TA 2ZUUA 3GUZA 3RPEA 3BA1A 3TLMA 2OGSA 3THYA 1FFBA 3STYA 4I9FA 2Y1OA 3F4BA 1CEXA 1RWBA 4G0VA 2UZ4A 2O5VA 2FWNA 2XYPA 2VPXA 4NDAA 5YASA 4DNPA 2IHNA 1WO8A 1E6UA 2YY5A 3UO8B 4JVLA 1U28A 4JJ4A 3H5WA 3W06A 2PZLA 4ZU3A 5GIPE 4EY4A 2Z2IA 3LY7A 5TMBA 3LOUA 4EHAA 3S70A 2RB4A 1NTOA 1FFGA 4NAVA 3A1WA 1CF2O 3HA3A 4U6QA 5CA1F 3NU1A 1ONSA 1PFKA 5EL0A 1KBQA 1D1QA 5FWYB 2X9LA 1GTL1 5LOVA 3TIVA 2VLIA 4HB2A 4ZA2A 3MT8A 4NXNB 4C4ZA 1IL0A 1KEWA 1JKJB 2AA3A 1C3JA 3CVOA 4AN4A 2YY6A 3KZOA 3QHPA 1EUDB 2JJMA 1ETHA 1KFEB 5DSXA 4PO9A 3FLMA 1BDIA 4BJ3A 1R0WA 1E7SA 2C92A 3I9LA 3NBUA 5CRIA 1KO7A 3CNLA 3WMXA 4YAUA 1Z3IX 1UINA 2H48A 4OKSA 4DCTA 4C3VA 3ANXA 1NQVA 4CMCA 1F2UB 2IPNA 4R54A 1O6BA 2IGTA 3IUBA 4D0SA 4QDJA 4RA6B 1PVOA 2VHXA 3WLIA 5LIPA 2IKQA 4ZMSA 5FD8A 3PHLA 5DRTA 3MSCA 1VE9A 2VNJA 4PX3A 1V7CA 2HV8A 3D1JA 3HGTA 5DTEA 2C4WA 4UE2A 2GEVA 5CYPA 1NF2A 1XDZA 2EXXA 5CXXA 3FTPA 3AYZB 3OM0A 4F2GA 1LUAA 3B9PA 2FPMA 3JPWA 1WW3A 2K2QB 4RM3A 1QGDA 4M1OA 4CODB 1IEWA 1JG6A 3DVAA 3OCZA 4MUGA 1DDIA 3GZJA 4CQMA 3BL6A 1EGAA 1CEQA 5CH5A 5IFKA 1BWQA 3MJRA 4IG4A 4R1QA 4EJSA 3Q7PA 7MHTA 1SHUX 3L43A 2PT5A 1IEXA 2YXNA 2VHZA 2GQ0A 2I9PA 2IITA 3U40A 3VSDA 3W8FA 1JT2A 1Z0IA 2PWAA 1TF5A 2ZRAA 4ZCRA 3IPYA 1Y98A 2B92A 2ZJ6A 1OX4A 4LBZA 4M0UA 4UBJA 4H7HA 1KH2A 2H16A 1D03A 1JBKA 1EG2A 1LW6E 1Q3HA 4MEAA 4BVAA 4CBVA 3OHSX 3GFFA 2DFKB 1WXDA 1R2QA 1XF1A 2OHHA 1D3AA 2ZYVX 1S4MA 1AURA 1KDTA 2H1SA 3EY4A 3OP4A 5I9SA 3CVXA 4YJ3A 1Q7GA 1IJKA 4BCCA 1X9HA 1NP7A 3PUIA 2EBWA 4RKRA 3TF5A 1DEAA 3OEEA 4GOOD 3QLEA 4ZVNA 1YDGA 1ECLA 1U1EA 1RWXA 1RHUA 4YGXB 3NEJA 2XIQA 4QDOA 1UBNA 4O4IA 4X3PA 3E3AA 3U80A 1WY5A 4C5AA 4CYMA 1CJMA 1HWYA 3G1UA 2ZI3A 4WCFA 1N5OX 3UHOA 1JEYA 3PEUA 3N2GB 1YZLA 2X2FA 4L7VA 1PR1A 2I7CA 1Z06A 2ZE6A 4QBHA 1VIYA 5IJ0A 3U3ZA 4QDKA 1E4EA 1XCLA 3HP4A 5CIQA 1ODTC 5EJ5A 2XXAB 2ZRHA 4JMPA 4L28A 3E48A 4U1RA 5BSVA 2E82A 4Q66C 4FPXA 4KO8A 5CPBA 1JB1A 2WWXA 4QRHA 4BBZA 3OZWA 4ZMBA 1AB6A 4KQIA 2IYFA 2VPPA 4DDMA 1J2EA 4CTOA 4JBXA 1GSHA 3CG0A 4FC7A 4KQMA 4M9QA 1FDOA 2WLTA 4Y6QA 4YO8A 3WL7A 4ALIA 1V45E 1UWVA 4IHJF 4HYQA 2IHYA 2K87A 5K20A 1Y7HA 3AV3A 3MLEA 4E08A 3BGIA 1MH1A 1TA4A 1PQUA 2AOTB 2VCHA 4CFZA 3PUWA 3ST7A 2HQRA 4OBXA 1F6DA 2OKCA 3N0TA 1TQ6A 3DEYX 3KO8A 3NYQA 2ZSHA 1UPAA 4TTRA 2XIJA 1DINA 1SVOA 3QYFA 3TZHA 1A5ZA 3AETB 2QV0A 3I52A 3IV9A 3IP3A 4A8TA 3U3RA 5GVSA 1CRWG 1Z5WA 3V3TA 2Y68A 5TGZA 1UJ4A 5FYQA 1N6HA 3IQHX 5AT1A 1BMQA 3VVCA 3OI7A 4M0LA 4NYJQ 5IDWA 1Z6GA 2FZLA 1JQLB 1D8AA 4H15A 5ECWA 3HPQA 1V8PA 3VR4H 2DWQA 5DT2A 3P8ZA 1EWTA 4GLLA 4IS2A 3ZXYA 4PV7A 4KO3S 3ZDFA 2OB2A 4NMXB 2RC5