1M57C

Structure of cytochrome c oxidase from rhodobacter sphaeroides (eq(i-286) mutant))
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
265
structure length
265
Chain Sequence
b'AHAKNHDYHILPPSIWPFMASVGAFVMLFGAVLWMHGSGPWMGLIGLVVVLYTMFGWWSDVVTESLEGDHTPVVRLGLRWGFILFIMSEVMFFSAWFWSFFKHALYPMGPESPIIDGIFPPEGIITFDPWHLPLINTLILLCSGCAATWAHHALVHENNRRDVAWGLALAIALGALFTVFQAYEYSHAAFGFAGNIYGANFFMATGFHGFHVIVGTIFLLVCLIRVQRGHFTPEKHVGFEAAIWYWHFVDVVWLFLFASIYIWGQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME C OXIDASE
publication title The X-ray crystal structures of wild-type and EQ(I-286) mutant cytochrome c oxidases from Rhodobacter sphaeroides.
pubmed doi rcsb
source organism Rhodobacter sphaeroides
molecule tags Oxidoreductase
total genus 97
structure length 265
sequence length 265
chains with identical sequence I
ec nomenclature
pdb deposition date 2002-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00510 COX3 Cytochrome c oxidase subunit III
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1m57C01
1.20.120.80 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 1m57C02
4QE7A 3RVZA 3R65A 4GX1A 2Q69A 3K0GA 5EBWC 3FB8C 4MW3A 3SPJA 4HZ3A 3F7YC 4LBEC 5EC1C 2NLJC 2X6AA 3VOUA 2R9RB 4PA4A 1OCCC 4QNHB 2WLMA 3ABLC 3EFFK 4LCUC 4OXSA 4MVRA 1V55C 4JTCB 5B1AC 3RW0A 4XDJA 3UKMA 2ZXWC 4X8AA 3K06A 2BOBC 5KUMA 4UUJC 1OCZC 2ITDC 2Q6AA 1G4YB 3SYOA 4MVUA 4P9PA 3IGAC 2AHZA 2Q67A 5J9PC 3SYCA 3FB7C 4HYOA 3LDDA 4MVQA 4DXWA 5CBGA 5CBHA 2BOCC 3BEHA 1XL6A 4CBCA 2OCCC 5EK0A 3GB7C 1R3LC 2WLJA 5B1BC 3IFXA 3K0DA 2EIMC 3LDEA 2X6BA 3OUFA 4PDRA 2WLNA 2QTOA 3LDCA 2WLLB 4PA7A 4RAIA 5EBLC 2WLHA 3OGCC 1ZWIC 4GX0A 2DWDC 1BL8A 4MTGA 4P30A 4I9WA 2EIJC 3SYPA 3RBZA 2P7TC 3WG7C 5CBFA 2Q68A 5EC2C 2DYSC 4KFMA 3OUSA 4QE9A 4MTOA 3RVYA 3SJQC 3SPHA 3ABKC 1V54C 2W0FC 1K4CC 1XL4A 4LP8A 2IH1C 1J95A 3F5WC 3SPCA 2K1EA 1FFTC 2HVKC 2Y69C 3ASOC 3LNMB 4RUEA 4J9YB 3ZRSA 2A79B 4PDVA 4JTAB 4PDLA 3JYCA 1QLEC 4WFGA 1JVMA 2EIKC 1R3KC 3E8GA 3FB6C 4X88A 4R8CA 2WLIB 1R3IC 2WLLA 1ORQC 2HG5C 4PA3A 4EKWA 3AG4C 4MW8A 3KG2A 3SYQA 2HJFC 4P2ZA 2DYRC 4G27B 3OR6C 3SPIA 4PDMA 4ZBMA 2EINC 3SPGA 1S5HC 4WFFA 4WFHA 1K4DC 4XDKA 5IY5C 3E83A 3T1CA 2KB1A 3E8FA 4H37A 4MVSA 4F4LA 5B3SC 3LUTB 2EILC 1M57C 4GX5A 2HFEC 2ITCC 4MS2A 4J9ZB 2ZD9A 4P9OA 4R6ZA 2AHYA 2YEVA 3FB5C 3F7VC 3K04A 1LNQA 4TWKA 3T4DA 3UM7A 1M56C 3ZJZA 4H33A 3PJSK 2WLKA 5E1AC 4RO2A 3SYAA 4RUFA 3STLC 3X2QC 5KUKA 4PA9A 1OCRC 3K03A 4PA6A 2X6CA 4XDLA 4BW5A 3E8BA 4JTDB 4WFEA 3ABMC 2QKSA 4X89A 4R7CA 2DWEC 2HVJC 3K08A 4MSWC 4MTFA 4MVOA 1R3JC 3E8HA 2A9HA 5EBMC 3STZC 4MVZA 2ATKC 4G28B 3AG2C 4GX2A 3E86A 3HPLC 3TCUA 3E89A 3OR7C 4R50A 2H8PC 3AG1C 3T4ZA 3ASNC 2A0LA 3T2MA 3AG3C 4MVMA 2WLIA 2IH3C 2JK5C 1OCOC 3TETA 1KKDA 1P7BA 5BZBA
chains in the Genus database with same CATH superfamily
2EJ7A 4WFBV 1K9MW 1Q3EA 1WN7A 2RQ6A 5L0JA 4NTWA 4P6IC 2JJ1G 2ZR3A 1OCCB 4DJ9A 3JSNA 1K92A 3CAXA 5HV9A 1NZ6A 5B1AC 1OJHA 5IYBO 1YJ9V 1NJIW 3K06A 1JMKC 3UT5B 4PHZA 5IJ0B 2NSFA 3ASOB 5ITZA 4DV5O 2PUSA 4JI2O 1EQ1A 5CBGA 1M1KW 3ZEDA 2W0XA 4JYAB 4X9QA 4NYKA 2R7UA 2WLJA 3K0DA 4O4JA 2ZXPA 3OUFA 4YJ2B 4K0DA 4PA7A 4DO2A 3TJ6A 3OGCC 2R25A 3NMIA 2P7TC 4DBRA 3WG7B 5BY1A 4QI2A 2OT5A 4I55B 1HNWB 1P84F 2DYSB 1V54B 1ZU5A 5JH7B 3LNMB 1NH2D 2Y3DA 3DGEA 3IQCA 4AILC 3G4XA 2HJMA 1K33A 4JYCA 3DWWA 1QHTA 3A8TA 4X65O 3RKOF 5L0DA 3K59A 2UXDO 4CS7A 1VF6A 2Q9CA 4IIJA 3MYIA 2QTVA 2Q7HA 2RN9A 2RDCA 4P2ZA 4PJ0Z 2DGJA 3UMKA 4PJMA 3EHBB 5LGUA 4JI7O 4DUZB 3E2EA 1M9NA 2RJZA 2J9VA 2IXPA 1I08A 2L6FA 3K1IA 1RJ9A 5J2TA 2XLOA 3TGUH 3SJAC 2KG7B 1AILA 2WVOA 1KBHA 4NY3A 2JGUA 4DV0B 2O9XA 1Q82W 2G62A 2LFFA 1KECA 4JC7A 3W7WA 4JI6B 4I9QA 1FPOA 2PTMA 4XDLA 1X59A 1Q90D 4JI3O 2ZDIC 5COGA 1AI5A 1NT2B 1RSOA 4MSWC 3S27A 2NPUA 4GYTA 4LF6O 4LH6A 3OAAG 1RCPA 1OZ0A 4GQHA 1LI7A 2R7RA 2H7OA 4P9TA 2B1GA 1WB7A 2Y4UA 4ZOLA 3ETDA 5JP7A 4DW1A 3K9SA 1SZXA 1OKKA 1A0BA 3RYFB 3NRHA 4U5GA 1S3JA 1MMNA 4U9DA 4MW3A 3S0XA 1K5SA 1WAZA 3ZWIA 1J5EB 3X1OA 3PN1A 3ABLC 3KCYA 5BMVA 2OYQA 1NKDA 1UPGA 3NYJA 5CI8A 4JAAA 3UKMA 4X8AA 1SQVH 2JJ2G 3CCLV 2WZGA 2GTAA 2J45A 3BCCH 2JDIG 1KD1W 5L3EA 1D1CA 3B9QA 1N33B 2E3CA 3F47A 3G4SV 4K8XA 2AGAA 5COFA 1TFOB 1QBZA 4XPWA 3K5MA 5LMNO 2ZCEA 5EIBD 5EYPB 2VB6A 3EQLF 1FD9A 1IBKB 1BZ4A 3PHF2 2P4VA 4DR3B 4WGYA 1IBLB 4DW0A 4X1YA 4JZGA 1NVPB 3O9OA 2Y39A 2CE4A 2A79B 3HNLA 2GA0A 2KSDA 2BSKA 2BC5A 2MW2B 4FLVA 4EB6B 4LFCO 2I8BA 5LA6B 1R3IC 3VRCA 1S5LZ 2Q0AA 4KL1A 2AVKA 2J9WA 4K0KB 3RFRA 2PF4E 1AI6A 3O55A 4GKJO 1Q6HA 1RPRA 1N32O 1RKCA 3ZRXA 2ZXRA 3JD3A 3SPIA 1SQBH 1Z2GA 1E1RG 3E9VA 3E8FA 2A1DD 3HKBA 3B40A 1G1XB 1AB3A 4GX5A 3O65A 1P7GA 3OD4A 1JMWA 4G7HF 1HMDA 3FAPB 4KP4A 5LBQA 2XL8A 2ADQB 3C90A 3JD0A 5E3AA 3X2QB 5KUKA 3C63A 5BQGA 3K03A 1GM9A 1K7DA 1N0NA 3EZHA 1FAFA 4XLPF 4NXNO 3JTLO 4EEQA 3BAAA 1AJNA 4WBNB 1SA0B 2ZXWB 2R7OA 2D5RB 4MVZA 4NTYA 4TV9B 4GX2A 1R1BA 4JGSA 1F1MA 3BY6A 2JPUA 3H1KH 3RGBA 1PNKA 2KGOA 1MZEA 2PGGA 1F23A 1Y6DA 4DV4O 3DKAA 3H65A 4J10A 5BZBA 3JSLA 5L3QA 5L3GA 4JJGA 1JAFA 5EBWC 3B4SA 2CH7A 5L3BA 2M7WA 3H01A 5EC1C 1JOGA 2X6AA 2HJ3A 4YWQA 3RYCA 1S77D 3K5NA 2UXXA 3QF7A 1D5NA 2C03A 3NMKA 1YVWA 3B71A 3S9OA 1OCZC 5CIVA 1L3PA 4CH3A 3M1CB 3IJ4A 5D5PA 2IBZH 4AX2A 3JD2A 2XXAB 2ZIMA 3WODF 2LJ2A 1R5ID 2I15A 3A2FA 2LGQA 4BEJA 4FM0A 1EN6A 3IFXA 3S3WA 5D5QA 3SJCC 5A6BD 5EBLC 2EPNA 4A5UB 1C03A 1MQVA 1JFFA 2H7VC 3W7TA 2UUCO 1XNQB 4WGZA 1GN6A 4NQFA 3G50A 4IHJA 4WBNA 4JYBA 4YT5A 1LPEA 4FLYA 5B5EZ 2AWYA 3ABKC 1Z6AA 4X20A 3CC7V 1GH6A 1AEPA 3K58A 4J42A 1Z63A 5C93A 4DVYP 2UU9B 2YICA 4U5FE 5CA1B 1H9GA 4U5EE 4JI5O 3AQBA 2Q73A 2A3QA 3WB2A 4UVAA 2MK3A 1ORQC 1Q6IA 4U3JA 1S7ZA 1PPJH 4JZAA 4EFEA 4B3TO 1M2OA 3IPMO 4W8KA 3JCUZ 4IAQA 3RYIB 4LDRA 5KHHA 1TUEB 3JALB 2LSEA 2XS8A 1FYJA 1YYXA 4X66O 5L0HA 4OD4A 4ASUG 2P4KA 4WFHA 4YN0B 4EHPA 1MNGA 1H2NA 4B7KA 4DRJB 3CYOA 1YLMA 1Q0KA 4AL0A 3L74H 4K3AA 2XNDG 3W7UA 2XM0A 1P4RA 1Y74A 3DXRB 1LUVA 3I5DA 1ZUQA 1APCA 4QDLA 1OCOB 2QA4V 3IAYA 1NTKH 5E1AC 1FAPB 3Q4HA 2J8WA 3TJTA 4PA6A 2XS1A 4LNUB 3U0CA 1TWGA 2W9YA 3US6A 4X89A 3U0ZA 3U8PA 5IE9A 2MWQA 2B9ZA 1E85A 4DR2B 1PL4A 1GRJA 1AVOB 4J7YA 4OPHA 3ZRWB 4DOZA 3L70H 5KYXA 3E89A 3L9DA 5CA1A 3MLGA 1BR2A 1XNRB 1E84A 4QIWF 3QW1A 2JK5C 4X62B 4GKKB 1CEZA 2DQ0A 2IBFA 3ZVRA 4D6TH 5FLXN 4JZ2A 3F7YC 3APQA 1ZTEA 4DV1O 1BQZA 3B0VC 3EHMA 4RQEA 1VTMP 4QNHB 2VQFB 4DR4O 1YJWV 1Z3IX 4J32B 1OXKA 1RP3B 2YL3A 2PYJA 2G3KA 2FB5A 3UR3C 2KQ9A 5L0GA 3SYOA 1TR2A 3IGAC 4K7BA 2XRHA 4TSFG 3SYCA 2EIKB 5KHGA 2YRFA 3WHNA 3HNKA 3HKCB 4RAIA 2KNHA 3ZIBA 2R02A 3SYPA 4YY3B 1TVKB 4CS3A 3GM2A 3ZRWA 3LNRA 2NG1A 4JKVA 1VQOV 1SQPH 4DR5B 2CDQA 5LGTA 3F5WC 4BEMJ 2FAPB 1U0BB 4FZ0A 4K1OA 2N04A 3C3TA 1FFHA 1PNMA 2W6IG 4HNAA 3IHUA 1IDSA 1R3KC 2J0WA 1WA8B 2W6JG 1O87A 4BW9A 1AROP 1SKVA 3CMEV 3T1HO 3SYQA 1XI1A 3DM5A 1LVKA 1M4UA 3CSKA 1N0JA 4Z2WA 5T3WA 3U8VA 4X1IB 3JARA 4ZBMA 1FFXA 4JV5O 2AWCA 3GWNA 1MA1A 5A6KA 1YJGA 3CCRV 4B3MO 4F4LA 4UB8Z 5IJ9B 2XHBA 4JI8B 3JRTA 3N2KA 5E2QA 5DN6G 2EILB 1H38A 4J9ZB 2ZD9A 3FB5C 1R6KA 2BL2A 3CRAA 4LF7O 3GEEA 3BFRA 4JJFA 5F5HA 2R7VA 3LEVA 3STLC 4YT2A 3CMAV 3VYWA 3C8ZA 1THZA 4BW5A 4LWSB 4B3SO 4PELA 1G5ZA 1E83A 1SQFA 3ABMC 3SJBC 2W4BA 3FAVA 1URFA 2V1DA 4KUMA 4AHCA 3ABTA 1QR8A 3R7CA 1EN5A 1FJGB 1M2VB 2AXTZ 3WB0A 4BPMA 4J7JA 4XPYA 3UQ8A 1O3UA 3DE9A 4F6RA 3KYIA 1EZVH 1H8HG 2CDYA 1IURA 3ZTMA 2LGWA 4MVMA 3WB1A 2JGDB 1IZMA 4IT5A 2VWKA 2EZPA 3GWKC 1N34O 1SMYF 2DJVA 4J11A 2X51A 2F4VB 1K34A 3NYMA 4DV7O 1G6UA 2GSMB 4YK5A 5DM6V 4O4LB 2NLJC 1IW7F 2WZLA 3E22B 1WWPA 3ZC4A 1OCCC 3QO5A 4LDKA 4LCUC 3QVZA 3OW2U 4WABA 4MVRA 5EZYA 3EGXA 3DJUB 1BR1A 2QUPA 1GMGA 4ZHQB 2XL6A 4C3BA 2UXCO 5CBHA 5L3DA 5GONB 5IYDO 2VCCA 4BJ5C 2GHYA 3TOMA 2LW7A 4D7TA 4GCZA 5LP6B 3DAGA 4G7OF 3J7AU 4OX9B 1RKEB 5TISZ 1QKRA 3T9OA 1KU9A 1D2DA 2HMQA 3A9CA 1Y66A 2DYRB 4NVPA 3WG7C 1QR9A 2DYSC 1HR0B 3V7OA 2HZ8A 4U7NA 1V54C 2W0FC 4LP8A 2IH1C 5JCOC 3CEXA 2K1EA 3VAYA 2QLAA 3KL4A 3CSXA 2NUPB 2YUAA 4O4HB 3OM3B 3W2WA 4LLEA 2A0BA 3OGIB 2HG5C 4FLXA 2YL7A 4XEKA 4O6YA 3P32A 4MW8A 3AG4B 4ZI7A 4W4KA 1Q5OA 3WFVA 1DLBA 1LI5A 1O5HA 2A0UA 1KP2A 2ETSA 2PYLA 2FTKA 1B3QA 1K4DC 1HWYA 1VQ5V 3TD7A 5BR8B 2OOCA 2PX0A 2DQ3A 2ZE6A 3BRCA 3K7DA 4RBNA 4Q6GA 3C3SA 1JJOA 4C7OB 3L73H 2J46A 3ZBHA 3GORA 3OTOO 3N2ZB 3C8GB 3HKDA 4H33A 2H3OA 1RKEA 2C04A 2VASA 4AI8A 2YI9A 4OIOF 2P5OA 2GBOA 5DS6A 1M6TA 3ZDLA 3E8BA 1CP9A 3HR0A 4J7KA 1VQ7V 1WPBA 1R6TA 5KYWA 2DWEC 1ST6A 3NYLA 1VQ9V 2HV6A 1R3JC 4TV8A 4FLZA 1N36O 1NLXA 2HSBA 2P06A 4Z1MG 2Q00A 1DTOA 3OMAB 3E70C 2WA3A 3TXSA 1QPUA 5ITZB 2JRIA 3R66A 1AP6A 1NSGB 3ZMTA 2IXOA 3R65A 2Q69A 4IAOA 4HZ3A 1YA9A 4O4JB 5JQGB 1XMQO 1U96A 1IZ3A 1I5XA 2WAMA 2Y0IA 3CJHB 3NKDA 3CCQV 5KHKA 1YXBA 3B8NA 4ZLCA 1PKXA 2JS3A 4NR1A 4JIOA 4CS9C 4DRXA 3CCVV 2Q67A 4NC3A 4MVQA 1QZXA 4U5BE 3FFQA 4JW1A 3GB7C 3CRMA 1R3LC 4J7TA 2JS5A 3SZRA 2HFIA 1AR4A 2X6BA 4FPPA 1E1QG 1ZWIC 4MTGA 1SZTA 4FESA 4YL0A 4IIJB 3K79A 4E18A 2P22C 1JX9A 2VH3A 1A7DA 5DQZA 3KYJA 4O79A 3FXHA 1JOYA 3RFYA 3H1LH 2OWOA 1M57B 2E74B 1SRYA 3FYIB 2ZE8A 3C7JA 1X4TA 2Z5UA 1VMAA 3ZRSA 2OIGA 2YI8A 4JI4B 1QSPA 5JVEA 1RJ9B 5J2TB 3BA8A 1TWCA 4GZRB 4M63A 5IT9N 3W8IA 3AK2A 3FDQA 4LFAB 2XAFA 3E8GA 1Z7Qc 2PBEA 4O2BB 1I94O 1XDCA 4DR6O 4UCOA 1D0XA 1NZEA 2BE3A 5JQGA 4CS8C 3CJHA 5DEDA 3NXSA 4XLNF 3OR6C 1YJNV 1NH2B 1IX9A 4OGQB 4PDMA 3SPGA 1RSOB 4UV8A 2QNLA 4PJNA 4MVSA 1GN2A 2VRZA 2ZINA 4PI0A 4N21A 3LS0A 4H13B 2HFEC 3CP1A 1VYIA 1I7FA 2WZFA 3SEOA 2R7WA 4N4WA 3C18A 4U3FH 3ZN1A 1VQ8V 2YWAA 1AUEA 4ZOLB 1F4MA 2CK3G 1Y67A 3X2QC 5F28E 3DJNB 3SYAA 1RFYA 2Q3TA 1YI2V 2QM4A 1AVMA 3FD9A 1YF2A 3P3NA 2YS8A 3IQTA 2OTJV 1VF5B 3LAYA 3DAFA 1OKKD 2VCBA 2FYUH 5BMVB 2PI5A 3E86A 4DRIB 3K33A 4F6EA 4JI1O 2XLDA 4CJOA 2NUTA 2X7RB 1PD3A 4O2BA 3WU2Z 1K3EA 1VYKA 2Q9AA 2OCCB 1H2LA 1N4CA 1AR5A 1MZFA 3AEIA 1GO3F 5AGFA 3L0IA 4BIUA 2ZM6O 2PP4A 1CPQA 4YT4A 1WATA 4ZLDA 5KA6A 4DV5B 5D92A 4JI2B 3EFFK 4OXSA 1SETA 1DOWA 4ANJA 1VP7A 5CN0A 4CDYA 2E5LO 2QGNA 3N24A 3QTCA 4DR1O 2Y48A 4X1YB 1SF9A 4RQFA 4EBJA 5L3FA 1MMDA 4G7ZF 2AHZA 4A4AA 4UDVA 5JWPA 4DXWA 4Z9IA 1K73W 4CBCA 5KYUA 3EZIA 4TQFA 3CE2A 2D4UA 2BSKB 4HEAJ 1WGWA 3N2GA 3M4BA 1JCHA 1YSCA 4O6MA 1BMFG 4BJ1A 4GX0A 2EIJC 4DV3O 4B08A 4GLXA 4I44A 2QY9A 3M8AA 1SS3A 3QZCA 2CTPA 1VQ4V 1FXKC 4X65B 2PZSA 4UVBA 3V5XA 3QVYA 2UXDB 3H2VA 3VF0A 3UGOA 3HKBB 4RUEA 3M99B 5KHIA 2ILMA 4TUYA 3JCZA 1VEWA 2R7SA 4JI7B 1UFBA 4X88A 3H2UA 1N1CA 2WLLA 2GDCA 3F46A 3AG7A 3VM6A 2YLDA 3ECSA 3O6XA 3F5TA 2AW9A 2P1AA 1YDIA 3PCVA 1AR1B 4Q20A 4LFBO 2ZR2A 3ZHVA 5IY5B 1O9HA 3RYHA 2P67A 4PI2A 4JI3B 2MHRA 1VQ6V 3SXMA 1D0YA 1ZAUA 4LF6B 3EXAA 2CTRA 4JI0O 3UM7A 3BHPA 4JEBA 3H1IH 1FNTc 4DV6O 1EN4A 4YHHO 3LESA 3JCUQ 1BSMA 4C3EA 1BR4A 4WFEA 2QEXV 1SC5B 4I3MA 4FJCC 2CH7B 3QMKA 1L0NH 3RYCB 2FGYA 2XAQA 5EBMC 3STZC 2VWJA 1TUBB 4LH7A 3AG2B 1S76D 5JUAA 3OR7C 3T4ZA 5HFLA 3ASNC 4G2KA 1XQ8A 2ZNJA 1U89A 4XQ1A 4ULWA 2CYDA 4UCVA 2YHSA 2KSFA 1SQQH 4NCQA 3HKEB 4N23A 2XLEA 1XMOO 4LF8O 5FZTA 5H2FZ 3JYYA 3S29A 4IL6Z 5D91A 4AE4A 3Q7GA 1FXHA 5B3IA 4AQYO 4RDAA 4N6CA 4XTKA 5JJJB 4JVSA 1EFRG 1JFFB 5JVDA 4I1OB 1Y4MA 4CS9A 4IHJB 3TXQA 4EBBA 1TA8A 3THOA 2EULA 1JJ2U 1NQTA 2YC0A 5LMNB 2P6JA 4X20B 5L3CA 2WA4A 1AJPA 3QNEA 3EFOA 2A68F 4FFBA 4XBFA 2QWPB 2LFRA 3W4YA 5JSLA 3LDEA 3KH2A 3T6BA 3G80A 1BDJB 4U3JB 2R72A 3BA9A 3ABUA 4LFCB 3OUSA 2NR5A 1TUBA 2UXBO 4CDAA 1KNYA 3A0HZ 3AQCA 5JLIA 3RYLA 4CSAC 3SDLA 4GKJB 1N32B 1QLEC 4BWAA 3IC7A 1BQ0A 3HKEA 4LR3A 1YTFB 2KYHA 3M79A 3SNHA 1Y74B 3NR7A 1MNEA 3AOUA 1OQCA 3SGIA 4CS8A 4KHPO 3RH3A 1L8DA 1JRAA 3Q4HB 2RSEB 2HJFC 2YZSA 2AZ2A 4G27B 3LLIA 3I5QA 1ZL8A 4X64O 1YTFD 1GN4A 2EINC 3H1JH 4JYYA 2J0XA 3E83A 4HFKB 3D3IA 5TJ5E 2EILC 5A69A 2IU0A 3RT3C 3I56V 2CGEA 1YZBA 1OW6A 1SESA 1YEWA 3ZMUA 3S3XA 5KYXB 3N27A 4NXNB 2PNOA 5CA0A 3GWOA 1M56B 2YDEA 4LF9O 4OIPF 5IWAO 4TOIA 3CRRA 1Q81W 1GS9A 2X6CA 1L1FA 2WVQA 2QDOA 1CXZB 4GT1A 2MYSA 1HNXO 2AU5A 1FS0G 3GM1A 3ZHTA 3JASA 3O39A 3ABLB 5CMUA 4DV4B 3ZCCA 4ZKIA 2ARHA 2WPDG 1OHHG 2L9JA 2A9HA 4DR7O 4PD4F 3O10A 1NU7D 4H44B 5FNVA 4OPAA 1C02A 4I7ZB 1ORSC 3AG3C 4FZ1A 1US6A 3G6BA 2QE7G 1VLTA 4P9OA 4CBEA 5LGNA 4UFZA 4AK9A 2ZDIA 3W7SA 4U5CE 4DUYO 3S28A 4JAVA 3VOUA 5KLVH 2R9RB 4UVCA 4DRHB 2ZXOA 2YXLA 3JAKA 3RW0A 4NXMO 3KPHA 4LF5O 2HHHO 5EGYA 4E2LA 2YSUB 3K6BA 4I0XA 1H7IA 3EJNA 5J2UA 2P90A 2UUCB 2E75B 1MMMA 5JJEB 2FFHA 5J9PC 1EI7A 4LACB 2BOCC 3M7MX 4N6HA 2R9AA 3A0RA 5LP6C 2Q7GA 4HNAB 5B1BC 1IXMA 2JVDA 3CEIA 2UXNA 2JEXA 2VQEO 1ZW2A 1TKNA 3J06A 1BS3A 4P30A 2R05A 2O57A 3RBZA 3EG9B 1PV3A 3D36C 4JI5B 2UUHA 4EUKB 4PACA 2Q4FA 4KFMA 1KTMA 4I4TA 1QU7A 3JARB 4FLWA 1FFXB 1A7VA 3U10A 4B3TB 4QJFB 1KB9F 1DF5A 3SPCA 2Y69C 3N2KB 3FOOA 3MAQA 5KAIZ 2IJJA 4JTAB 2CTQA 4X66B 4FM2A 3PMRA 2BTQA 2M6YA 3BPZA 3U11A 2WVNA 3JRMO 4KNVA 4BJ6C 1LR1A 3TK1A 3AG4C 4MT8A 4FVMA 3RN4A 1H9TA 3K9AA 2ADPA 1YVIA 3T6GB 3V5YA 3DZAA 3V5ZA 1CPRA 4I5SA 1VMGA 3FAVB 3T1CA 2KB1A 2ZKOA 5B3SB 4P9FA 4PJLA 2HKOA 2F93B 4AL1A 1TGOA 2Y0PA 1EA8A 1M93A 2ZQMA 1B68A 2R7XA 2L6GA 5FPOA 4F6RB 2KKWA 1G8MA 4J30B 1MOFA 4TT3G 3CCEV 3UNGC 1SR2A 2Q8VA 3EG9A 4WJ0A 3K08A 5DLJA 3E8HA 1COWG 4DV2O 2YLGA 2G3VA 1VF7A 4JF3A 5LHIA 4JPRA 2DOSA 4NTAA 2Y4TA 3HPLC 1Q0DA 2Q9LA 5EZYB 2H8PC 4DV1B 3EGXB 3MBGA 3Q6NA 1KQSU 4DR4B 2EZOA 1GM8A 4HAMA 4QE7A 3K0GA 3NG1A 1LUWA 4G78A 1Q0GA 2HUJA 2NN4A 1T5EA 4IYIA 4HFFB 2LP7A 2X0CA 1H2SB 2Y3BA 2HLDG 4DYLA 4IGGA 2Q6AA 3ZHSA 4CDVA 3NDBB 5BQIA 1LKXA 5LMUO 2IW5A 1ZLZA 2C2AA 4K8ZA 5IDJA 1XL6A 4UXNA 1HMOA 5EK0A 2G38A 4WCEV 1T01A 3A0BZ 2VS0A 4FK5C 4UV9A 3JD4A 1VF6C 3ATPA 2VCAA 3OMNB 4I9WA 4MQ9F 4ZI7B 4DK0A 5LXTA 4KI2A 3MHSC 2UUAO 4QE9A 1UJWB 2K9PA 3JAWA 2D2CB 4IRUA 1Y76B 1I4ZA 3T1HB 1AI7A 4UCUA 1QVGU 2Q9BA 3K1IC 3ASOC 1FFTB 5CB4A 2UUBO 1JVMA 4JV5B 2Z15A 3FX7A 1HY5A 4JURI 4B3MB 1WB8A 1YA7O 1CPYA 3HKDB 4O2AA 3T1YO 3DM9B 2RMKB 1H2MA 5COMA 2QSAA 2XUMA 4LF7B 3ZX6A 5KYWB 4I50A 4WFFA 3TOLA 3ZMZA 1GQAA 2B0HA 4H37A 4TV8B 2HP8A 4B3SB 1W59A 3EHNA 2FKXA 1QQCA 4MS2A 1F51A 3POVA 1AI4A 4BJTA 3F7VC 2ZPAA 4LF4O 4YJWA 2WSSG 3PJSK 1SQGA 5L0FA 1HP8A 1B6QA 1B06A 3CHXA 1SYQA 4L87A 3CWBH 2OEVA 1WPXA 5KX5A 1NFNA 3DMDA 3LEOA 1XOUA 1WNSA 1N34B 1LE4A 1C17M 1Y76A 2ATKC 4CH5A 5A2QN 4DV7B 2LD6A 1ZYRF 1VOMA 3Q7LA 3Q6MA 1CGME 1EBOA 3KKBA 3ZHUA 1DGSA 3AG1B 5LOVA 1IBMO 4B3RO 5DS5A 2YVKA 3ZMVA 4DRXB 5JRAA 1E79G 3TETA 1RMVA 2XAJA 3APOA 3LSQA 3H9VA 1HNZO 1RXQA 3UMHA 2JIZG 2OU6A 5LL6Y 1PV0A 4LBEC 3BVOA 1K40A 2YIAA 1ORJA 2UXCB 1WP8A 1RM1B 4E0IA 3CXHF 4CC5A 1WOLA 5KMGB 3EH2A 1SZIA 1V4AA 1R73A 4UUJC 1ZHZA 4U5HA 2GAQA 5K1PA 4MVUA 4U9EA 2YXHA 2B5UA 1TAEA 1W0KG 3OWTA 1N8RW 4DK1A 3CCJV 2XT9A 2QKCA 5E3CA 1M5IA 2QKAA 4PDRA 3M4CA 3B0UX 4XPXA 2EIMB 2DW4A 2QTOA 4IJJA 1Z5WA 2YIBD 2KC3A 2M4EA 3W2VA 2YQYA 3OEHG 1SF8A 3DE8A 2P6VA 3JD1A 5EC2C 4JYAO 2HV7A 1XZPA 3GWLA 3GM3A 4IB4A 3EGDA 5KYNA 3K5OA 2XSEA 3MDSA 1P7BA 3RQEA 5EIBC 3ML0A 3U3BA 2HSQA 1HNWO 4Q5SF 1HW7A 1R6NA 3DD7A 3DC6A 3ZHQA 2CNWA 3ABMB 3OT7A 5KYYB 1SQXH 3VBBA 1KC8W 3HKKA 1S5HC 1DF4A 5GTIZ 5KMGA 3OTOB 5IY5C 1VQLV 4O6NA 3L75H 4LDQA 3LUTB 1XZQA 2CTWA 3OEOA 3MD0A 2YIBA 3FMSA 3S84A 2YL1A 2YEVA 3ZS8C 4OD5A 1LNQA 2FMLA 3GEIA 2LCHA 1N36B 4DUZO 2WLKA 2JD3A 2NUTB 2H7BA 4RUFA 3CXCU 2QM7A 4Z1VA 3T4RA 1B04A 2P0NA 1VK5A 1OCRB 3TULA 3K5LA 1VLSA 1XHZA 2QKSA 3IC9A 2FL4A 5BXZA 3CRQA 4BIOA 2GWWA 2GUZB 2N74A 4DV0O 3B8MA 4XEVA 2OCHA 4YXWG 3OA1A 3QO7A 3AG2C 4JI6O 1NI8A 4NB5A 4TQDA 4YJ3A 2OJQA 2R7QA 5C8YA 3NKEA 1NBMG 1XMQB 2XASA 1XUQA 3ZTZA 1QNMA 4DVZA 3KZIZ 1KKDA 1LIHA 3FYEB 3RVZA 1XHXA 2F1MA 5KYUB 3K1HA 3HB3B 1QVXA 2LFDA 2XLHA 4PFOA 5AC4A 1A32A 2R9IA 5KYYA 1BGYH 4FLUA 3N2GB 3UO2A 2NSGA 1KMIZ 5JT4A 2NNUA 3U9JA 2ZXWC 1V55B 3DSQA 4L8JA 4IWBA 1NTMH 2IM8A 2WL8A 4H54A 1J5EO 3FOPA 2QM8A 1I5NA 2P61A 2IJKA 3BEHA 4QPJA 2Q0OC 4TUYB 3SP1A 2R70A 1I4YA 4J7ZA 4OIQF 256BA 3QG5A 3LLKA 1ORYA 2R03A 2WLLB 2GUZA 2WLHA 3RIPA 1Q7YW 2H8AA 1N33O 3UT5A 1GM5A 3SJQC 5IJ0A 1I94B 1H6GA 2Q5ZA 3ZMSA 4DR6B 1MMAA 1K4CC 1W2BU 2UUIA 1XL4A 2OIEA 3FVYA 1JPXA 1D5AA 2CUGA 3RYHB 5DECA 4PDVA 1ZHYA 4JCZA 1IBKO 4BJ5A 2EPLX 3FB6C 4DR3O 3BRJA 4YJ2A 5KA5A 2WLIB 5H6QA 1IBLO 2M64A 5FCLA 2KW3C 4PA3A 2F66C 3B29A 1YAUO 2IOQA 3FAJA 3RQFA 1DOVA 3R2PA 1ENVA 1YITV 2DB4A 1MSDA 3FHDA 4I55A 3CC4V 5DVWA 3JZ0A 3U3FA 3BABA 2WB7A 1JA8A 5JH7A 2A69F 5F2VO 5JCOA 2Z3YA 3GVMA 4NTFA 4Z9JA 1V9PA 2ITCC 4K0KO 2HS5A 1MNDA 4R6ZA 2CGOA 4TWKA 3K66A 1M56C 5JJNB 2LQTA 3ZJZA 1LS4A 2YKZA 4GEHA 2EJRA 1WJZA 2Q7EA 1LM3B 2XLMA 4YT8A 4JI1B 2XOKG 4CIPA 1K97A 1WN0A 5L0CA 4MVOA 4AE4B 2E76B 5LYJB 3IQ5A 2LIGA 2KG7A 4FX5A 5JVDB 1T5OA 2PFDA 2ZM6B 2KK1A 2A0LA 5FL7G 3K57A 1ZZPA 2WLIA 1BCCH 1OCOC 3EFOB 2E5LB 1GTOA 4FFBB 1MSWD 2A6HF 1FKAO 1EM1A 3GANA 4DR1B 2Z0AA 3MX3A 3HJCA 5A6AA 4W8PA 2WLMA 1ZVZA 2L81A 1E86A 1OV9A 1K8AW 5L3VA 3LSSA 4IARA 1BE3H 2IJHA 5B1AB 2XM4A 1HW2A 1T6QA 5KHJA 3J80N 3CPWU 2ITDC 2RCVA 3VQVA 1OW7A 2JEUA 3RYFA 1H2GA 1H2KA 4DV3B 3LDDA 5AC5A 2IXNA 3CS5A 3GODA 1NVPD 3MHHC 1EKYA 4PV1B 1PNLA 4IYHA 3RQGA 2LFSA 5B1NA 4BR6A 1Q0FA 3TQOA 3M15A 2DWDC 4MTXA 4H0LB 5LYJA 4GUNA 1PD0A 1PD1A 1U97A 2Q68A 2XAGA 3SXZA 1ZL8B 5LHGA 4PJJA 2X0LA 1FXVA 2GDSA 1Q43A 4LC1A 2BCCH 1XNQO 4ULVA 3JYCA 2OQMA 3LJBA 3W7XA 2EIKC 1MMGA 2LW1A 3OMIB 4LFBB 1A41A 2ZNIA 3CD6V 2B1IA 1YHQV 2XLVA 4KNWA 5L0IA 1PP9H 5CA0B 4N06A 3UMIA 4BAYA 5EYPA 1JR8A 3KG2A 2UU9O 4RWUA 2ODMA 1ZHXA 4L6RA 1KYOF 1T6IA 2IU3A 4JI0B 2IM9A 3LSUA 4XDKA 1SERA 4DV6B 1VIBA 3JASB 5B3SC 2IXMA 4YHHB 2F23A 4X0RA 1YIJV 3JSEO 3J81N 4KC9A 3MYFA 1KU2A 4EB6A 3W8HA 5FNVB 2XTAA 3K04A 5LA6A 1WP7A 4FWVA 1KKCA 2L6HA 4QI0A 4R32A 4J41A 4E0HA 4F4BA 3HLZA 2BTOA 1H8EG 3I4UA 4D4XA 1NTZH 1O9GA 2V4DA 1J8YF 4EWCA 2YL0A 4C7UA 2HJDA 4JRZA 4KBLA 2ICWG 4BIZA 2F22A 1JR9A 3AK1A 4MTFA 3QO8A 2QWQB 4WF9V 3HNJA 3PDMP 5JS5A 4EIYA 4W4LA 1T6UA 4C3DA 1R4TA 1XMOB 4LF8B 3L1MA 1J8MF 3SYNA 3JAKB 5A9GA 1EZJA 4R50A 3ZQYA 1IXBA 1XBLA 1NBBA 4AQYB 4DR2O 1S5JA 4I0XB 5J2UB 1CGOA 2IH3C 1ZHTA 4HE8D 3D8CA 1YYJA 2VC9A 4NTXA 3DI5A 4GX1A 1VQMV 4ZIBA 3FB8C 4UCSA 2AZ0A 3CX5F 3G6EV 1OR2A 3UO3A 1Y4CA 1XNRO 2EIJB 2ZE7A 1SA0A 5K0IA 1VARA 5H6RA 3EH1A 4GKKO 4TV9A 4X62O 4JTCB 4XDJA 3JATB 1FXKB 1ZU4A 2BOBC 4J80A 3EPVA 2V3CC 5KUMA 2OTLV 5KAFZ 4I4TB 1ZHWA 2EPOA 2J9UA 2YLIA 3CRCA 1OXBA 3FB7C 4HYOA 2VQFO 3ZHRA 1YZCA 1GKFA 1Q6UA 2PY5A 3NMJA 5DQTA 1NR7A 4UCRA 2V26A 2OJED 2UXBB 3I55V 2BTQB 3ZIAG 1U6HA 1BT8A 3CZ6A 1BBHA 1Y6XA 3E35A 2R7TA 5CA3A 2GV9A 3ETEA 1G4US 2B0JA 5CBFA 1WTYA 1GN3A 1XWJA 3B77A 3SPHA 3H1HH 3ZN0A 5A6BA 4KHPB 4LERA 4MNDA 4FIPC 3L34A 5B1OA 1J95A 1FFTC 2XXAA 1JPJA 3CB2A 4PDLA 4WFGA 4YY3O 3CCUV 4X64B 1LE2A 4E7SA 3RWRD 2Y3HA 4R8CA 1E2XA 5T3TA 3QTHA 4DR5O 3IEEA 3JT1A 1FR0A 1S05A 3CCMV 2DYRC 3JATA 4CH4A 1FXKA 2E87A 3JSZA 1MG1A 4LF9B 3VQYA 5IWAB 3FKSG 5H5NA 1VQKV 1QVFU 5H9CA 4NTBA 4PK4A 1I5YA 4EFBA 2EX3A 2DMXA 3A11A 3WAQA 1VQPV 1HNXB 3ASNB 2AHYA 2ZT9B 3T4DA 4QPKA 1XILA 1MABG 3GEHA 2H94A 2L35A 4BG0A 4RO2A 4PR9A 1YZAA 2QR4A 3RYIA 4D7SA 4DR7B 4JI8O 1FMWA 1YARO 3K3WA 4Q4ZF 4UCTA 3JALA 3HNIA 4R7CA 1IVSA 2HVJC 4FMTA 4U7OA 3OE7G 4JAUA 3G4ZA 3P3PA 1F4NA 1Q0MA 2LQGA 4Z9HA 1PL0A 4G28B 1XEQA 1W0JG 2W4MA 5T1DB 1NR1A 3DXRA 3AG1C 4DUYB 3AGTA 4ONSA 3ETQA 1D1BA 2AP3A 1D0ZA 1OW8A 1V74B 4CX9A 4FM1A 1G8XA 4LNUA 4NXMB 1FJGO 4LF5B 2HHHB 1TFKB 3S90A 2GTSA 3P30A 4CS4A 3SPJA 3QVNA 3I5PA 3OTFA 1G4WR 4HBNA 3B2EE 1M90W 1NFOA 1ROPA 1TWHA 1RM1C 3B0PA 4LLCA 4D4NA 1CGNA 4YL1A 5K1XA 1Q86W 2HEPA 3JYHA 4K35A 5LXTB 2F4VO 3L8IA 2A6EF 2ZIOA 5EHHA 2VQEB 1NG1A 2YXYA 1OCZB 3JAWB 1QLEB 1PM9A 3VQXA 2ZE5A 5CB4B 2J9BA 1NU9C 2EIMC 3KCXA 4CS2A 1S72V 2WLNA 4JE9A 4E4EA 3LDCA 3RF3A 1BL8A 4O2AB 3G71V 2PX3A 1F7YA 2EINB 3MFNA 1YDXA 4MTOA 4I50B 2P7VA 3ABKB 4OIRF 2RNBA 4OX9O 1ZW3A 1Z23A 1WLEA 3L8JA 3ICXA 2F43G 2OG2A 1PCXA 2QE9A 3N0TA 1QQ3A 1HR0O 5F5FA 4O4IB 3DXJF 2L6LA 3HKCA 4EKWA 2XAHA 3CQZA 3ZRVA 1TVKA 1UG7A 1AJQA 2HKVA 5KX5B 3T6JA 2BE5F 1FMVA 3IQ6A 4PFPA 3U2LA 3L72H 4CJGA 2DN9A 1KUQA 2CW0F 1M57C 1XREA 4XEFA 4CSAA 3U5SA 3B09A 4G0HA 2TMVP 3QW0A 1QLNA 1WA8A 2QJ1A 3AG3B 5E33A 1AP5A 3KMIA 2KQXA 4DV2B 1ZX3A 5LOVB 1LS1A 1D1AA 4YIOA 2W45A 2J7PD 4PA9A 1VB5A 1OCRC 4A2NB 4WFAV 5BR8O 3CC2V 5HSWA 2F95B 1HDJA 4JTDB 4X1IA 3AK3A 4Q7CA 3ZG1A 5IJ9A 3SR2C 1GK9A 2PI4A 4YIPA 2LK4A 3KKYA 5HFMA 1JQ0A 1K04A 1WASA 2CCYA 2OEXA 4E7ZA 2QWOB 3LNNA 1KP3A 4JASA 1Z5ZA 3TK0A 3ETGA 1W2WA 4O4IA 3CCSV 4LWSA 5B1BB 1K5QA 1QCEA 3OFNG 1A7EA 5BUOA 3ITFA 5LMUB 4PA4A 1BHAA 1M2VA 1YCIA 2EPMX 2J7PA 1V55C 3U9MA 5E79Z 2GFHA 5IYCO 1HW1A 1UFIA 2QWNB 5LHHA 1G4YB 4CZZA 2JGDA 2Y69B 4P9PA 5GPGB 3AGUA 4I1MA 3EGDB 4YL3A 5GW7A 2D3OW 2Y3GA 2IYLD 2OCCC 2UUAB 5AG2A 3DC5A 3VQWA 2V7QG 5CI9A 2CAZC 4O4LA 4RD9A 5FPRA 2DE0X 3E22A 4GYCB 4ABMA 2RD9A 2KJGA 2A7WA 1S0VA 2YIDA 1GM7A 1Q8IA 1BZKA 4FLTA 4X1KB 1OR3A 2HR3A 2UUBB 5IYZB 3EVKA 4O7GA 5B66Z 4OINF 3RVYA 1BHBA 2JX0A 4ER9A 5BQHA 1HE9A 4ZHQA 5DS4A 1RPOA 1L7CA 3T1YB 4DBQA 5GONA 2LO1A 2HVKC 2HMZA 4FFKA 2QTSA 3U2MA 2CNWD 2DI3A 2L7AA 2CGNA 5LP6A 2YEVB 3SXKA 2A06H 4EBKA 4B7EA 3D3QA 4U5DE 1L0LH 3G67A 2WWWA 1DK1A 1NU1H 4JI4O 3DTUB 3D36A 3ZSUA 2Q7RA 1K05A 3C8GD 4LFAO 4JCHA 4LF4B 1JPNA 4ICGA 3TJ5A 3C62A 4KXRA 1TQGA 1GGQA 2NUPA 4O4HA 4YJ3B 1P49A 2ETNA 3UCSC 2LP4A 2N05A 1I0HA 5C8YB 3UGPA 4BJ6A 4UB6Z 1NS1A 1TWAA 2XLWA 1ZSPA 2EBOA 3L71H 3ZQVA 4X1KA 1VQNV 2EPKX 4XWJA 3AJMA 5IYZA 3HTKC 3SXYA 4B3RB 2IJIA 1IBMB 2ASRA 5GTHZ 4CH6A 1T9KA 4B6IA 5A6JA 2QWRB 1HNZB 4JEAA 4E17A 4FAPB 3OEEG 4CIHA 4C7OA 3TCUA 1FTSA 4QGPA 4CC6A 3C8GA 4NKGB 3T2MA 4H4KC 2OKUA 1GAXA 3LS1A 3JAMN 2Q4PA 4J9YB 2XL4A 1Z5VA 1HE1A
chains in the Genus database with same CATH topology
4WFBV 1K9MW 4P6IC 2JJ1G 2ZR3A 1OCCB 1K92A 5B1AC 5IYBO 1YJ9V 1NJIW 3K06A 3ASOB 5CBGA 1M1KW 2R7UA 2WLJA 3K0DA 2ZXPA 3OUFA 4K0DA 4PA7A 4DO2A 3OGCC 2P7TC 4DBRA 3WG7B 4QI2A 2OT5A 2DYSB 1V54B 1ZU5A 3LNMB 1NH2D 2Y3DA 3DGEA 1K33A 4JYCA 3RKOF 4CS7A 2Q9CA 2QTVA 4P2ZA 2DGJA 3UMKA 4PJMA 3EHBB 5LGUA 3E2EA 1M9NA 2J9VA 2IXPA 1RJ9A 2WVOA 4NY3A 2O9XA 1Q82W 2G62A 1KECA 3W7WA 4XDLA 2ZDIC 1AI5A 4MSWC 3S27A 4GYTA 3OAAG 1OZ0A 2R7RA 2H7OA 2B1GA 3ETDA 1OKKA 3NRHA 4U5GA 1S3JA 1MMNA 4MW3A 3S0XA 1K5SA 3X1OA 3ABLC 1NKDA 3NYJA 5CI8A 3UKMA 4X8AA 2JJ2G 3CCLV 2WZGA 2J45A 2JDIG 1KD1W 5L3EA 1D1CA 3B9QA 3F47A 3G4SV 1QBZA 2VB6A 3EQLF 3PHF2 1NVPB 2Y39A 2A79B 2I8BA 1R3IC 2J9WA 2PF4E 1AI6A 1RPRA 3ZRXA 2ZXRA 3JD3A 3SPIA 1E1RG 3E9VA 3E8FA 2A1DD 4GX5A 4G7HF 4KP4A 5LBQA 3JD0A 5E3AA 3X2QB 5KUKA 3K03A 1GM9A 1K7DA 3EZHA 4XLPF 1AJNA 2ZXWB 2R7OA 2D5RB 4MVZA 4GX2A 4JGSA 3BY6A 1PNKA 2KGOA 1F23A 3H65A 5BZBA 5L3QA 5L3GA 4JJGA 5EBWC 5L3BA 2M7WA 3H01A 5EC1C 2X6AA 4YWQA 1S77D 2UXXA 2C03A 1OCZC 3M1CB 4AX2A 3JD2A 2XXAB 3WODF 4BEJA 3IFXA 5EBLC 2H7VC 3W7TA 4JYBA 4YT5A 3ABKC 1Z6AA 3CC7V 1Z63A 5C93A 4DVYP 4U5FE 4U5EE 3AQBA 4UVAA 2MK3A 1ORQC 1S7ZA 4JZAA 1M2OA 4W8KA 1TUEB 2LSEA 4OD4A 4ASUG 4WFHA 4YN0B 3CYOA 3W7UA 2XNDG 1P4RA 4QDLA 1OCOB 2QA4V 5E1AC 4PA6A 1TWGA 2W9YA 4X89A 2MWQA 3ZRWB 4DOZA 5KYXA 3E89A 3MLGA 1BR2A 4QIWF 2JK5C 1CEZA 2DQ0A 3ZVRA 3F7YC 3B0VC 3EHMA 4RQEA 4QNHB 1Z3IX 1YJWV 4J32B 2G3KA 3UR3C 2KQ9A 3SYOA 1TR2A 3IGAC 4K7BA 2XRHA 4TSFG 3SYCA 2EIKB 4RAIA 2KNHA 3ZIBA 3SYPA 3ZRWA 3LNRA 2NG1A 1VQOV 2CDQA 5LGTA 3F5WC 1FFHA 1PNMA 2W6IG 1R3KC 2J0WA 2W6JG 1O87A 1AROP 3CMEV 3SYQA 3DM5A 1LVKA 3CSKA 5T3WA 4ZBMA 3CCRV 4F4LA 3JRTA 5E2QA 5DN6G 2EILB 1H38A 4J9ZB 2ZD9A 3FB5C 1R6KA 2R7VA 4JJFA 5F5HA 3LEVA 3STLC 4YT2A 3CMAV 3VYWA 1THZA 4BW5A 4PELA 3ABMC 2W4BA 2V1DA 4KUMA 3ABTA 1QR8A 1M2VB 1H8HG 4MVMA 1IZMA 2EZPA 1SMYF 2X51A 1K34A 3NYMA 2GSMB 5DM6V 2NLJC 1IW7F 2WZLA 3ZC4A 1OCCC 3QO5A 4LCUC 3OW2U 4MVRA 3EGXA 3DJUB 1BR1A 1GMGA 4C3BA 5CBHA 5L3DA 5IYDO 4BJ5C 2GHYA 4GCZA 3DAGA 4G7OF 1Y66A 2DYRB 3WG7C 1QR9A 2DYSC 3V7OA 4U7NA 1V54C 2W0FC 4LP8A 2IH1C 2K1EA 3VAYA 3KL4A 2NUPB 3OM3B 3W2WA 4LLEA 2HG5C 4O6YA 3P32A 4MW8A 3AG4B 3WFVA 1DLBA 1O5HA 1KP2A 2FTKA 1K4DC 1HWYA 1VQ5V 3TD7A 2PX0A 2DQ3A 3K7DA 4RBNA 4C7OB 2J46A 3N2ZB 4H33A 2C04A 2VASA 4OIOF 5DS6A 3E8BA 1CP9A 1VQ7V 5KYWA 2DWEC 1ST6A 3NYLA 1VQ9V 2HV6A 1R3JC 4Z1MG 1DTOA 3OMAB 3E70C 3ZMTA 2IXOA 3R65A 2Q69A 4IAOA 4HZ3A 1I5XA 2WAMA 3NKDA 3CCQV 3B8NA 4ZLCA 1PKXA 4CS9C 3CCVV 2Q67A 4MVQA 1QZXA 4U5BE 4JW1A 3GB7C 1R3LC 3SZRA 2X6BA 4FPPA 1E1QG 1ZWIC 4MTGA 1SZTA 4FESA 3K79A 1JX9A 2VH3A 5DQZA 4O79A 1JOYA 3RFYA 1M57B 1SRYA 3FYIB 2Z5UA 1VMAA 3ZRSA 1RJ9B 1TWCA 4M63A 3FDQA 3W8IA 2XAFA 3E8GA 1D0XA 1NZEA 4CS8C 3NXSA 4XLNF 3OR6C 1YJNV 1NH2B 4PDMA 3SPGA 4UV8A 4PJNA 4MVSA 3LS0A 4N21A 2HFEC 3CP1A 1VYIA 2WZFA 3SEOA 2R7WA 3ZN1A 1VQ8V 1F4MA 2CK3G 3X2QC 3DJNB 3SYAA 2Q3TA 1YI2V 2OTJV 3LAYA 3DAFA 1OKKD 2PI5A 3E86A 3K33A 2NUTA 2X7RB 1PD3A 2Q9AA 1K3EA 1VYKA 2OCCB 3AEIA 1GO3F 3L0IA 4BIUA 2PP4A 4YT4A 4ZLDA 5KA6A 5D92A 3EFFK 4OXSA 1SETA 4ANJA 5CN0A 3N24A 2Y48A 4RQFA 5L3FA 1MMDA 4G7ZF 2AHZA 4DXWA 1K73W 4CBCA 5KYUA 3EZIA 4HEAJ 1WGWA 1JCHA 1YSCA 4O6MA 1BMFG 4BJ1A 4GX0A 2EIJC 4I44A 2QY9A 3QZCA 1VQ4V 1FXKC 4UVBA 3UGOA 4RUEA 3M99B 3JCZA 2R7SA 4X88A 1N1CA 2WLLA 3F46A 3ECSA 3O6XA 1AR1B 4Q20A 2ZR2A 5IY5B 2P67A 1VQ6V 1D0YA 3UM7A 3LESA 3JCUQ 4C3EA 1BR4A 4WFEA 2QEXV 4I3MA 4FJCC 3QMKA 2FGYA 2XAQA 5EBMC 3STZC 3AG2B 1S76D 3OR7C 3T4ZA 5HFLA 3ASNC 4G2KA 4ULWA 2YHSA 4N23A 3S29A 5D91A 4AE4A 3Q7GA 1FXHA 4RDAA 4XTKA 4JVSA 1EFRG 4I1OB 1Y4MA 4CS9A 4EBBA 1JJ2U 1NQTA 2P6JA 5L3CA 1AJPA 3QNEA 3EFOA 2A68F 4XBFA 2LFRA 3LDEA 3KH2A 3T6BA 3ABUA 3OUSA 3AQCA 3RYLA 4CSAC 1QLEC 3IC7A 1YTFB 3SNHA 1MNEA 4CS8A 3RH3A 2HJFC 2YZSA 3LLIA 4G27B 3I5QA 1YTFD 2EINC 2J0XA 3E83A 4HFKB 3D3IA 2EILC 2IU0A 3I56V 2CGEA 1SESA 3ZMUA 5KYXB 3GWOA 1M56B 4OIPF 1Q81W 2X6CA 1L1FA 2WVQA 4GT1A 2MYSA 1FS0G 3O39A 3ABLB 5CMUA 3ZCCA 4ZKIA 2WPDG 1OHHG 2L9JA 2A9HA 1NU7D 3AG3C 2QE7G 4P9OA 4CBEA 5LGNA 4AK9A 2ZDIA 3W7SA 4U5CE 3S28A 4JAVA 3VOUA 2R9RB 4UVCA 2ZXOA 3RW0A 5EGYA 4E2LA 2YSUB 3K6BA 3EJNA 2P90A 4LACB 2FFHA 5J9PC 2BOCC 5B1BC 3A0RA 1IXMA 2UXNA 2JEXA 1TKNA 4P30A 3RBZA 3EG9B 4KFMA 4QJFB 1DF5A 3SPCA 2Y69C 2IJJA 4JTAB 3PMRA 2WVNA 4KNVA 4BJ6C 3TK1A 3AG4C 4MT8A 3K9AA 3DZAA 4I5SA 3T1CA 2KB1A 5B3SB 4PJLA 2HKOA 2ZQMA 2R7XA 1G8MA 4J30B 1MOFA 4TT3G 3CCEV 3UNGC 3EG9A 4WJ0A 3K08A 5DLJA 3E8HA 1COWG 2G3VA 4JF3A 5LHIA 4JPRA 3HPLC 2H8PC 3EGXB 3Q6NA 1KQSU 2EZOA 1GM8A 4HAMA 4QE7A 3K0GA 3NG1A 4HFFB 2LP7A 2Y3BA 2HLDG 2Q6AA 3NDBB 1LKXA 2IW5A 2C2AA 5IDJA 1XL6A 4UXNA 5EK0A 4WCEV 4FK5C 4UV9A 3JD4A 3OMNB 4I9WA 4MQ9F 4KI2A 3MHSC 4QE9A 1UJWB 4IRUA 1AI7A 1QVGU 2Q9BA 3K1IC 3ASOC 1FFTB 1JVMA 2Z15A 4JURI 1CPYA 3DM9B 5KYWB 4WFFA 3ZMZA 4H37A 3EHNA 4MS2A 1F51A 3POVA 1AI4A 4BJTA 3F7VC 2ZPAA 4YJWA 2WSSG 3PJSK 1B6QA 4L87A 1WPXA 3DMDA 2ATKC 1ZYRF 1VOMA 3Q7LA 3Q6MA 1EBOA 3KKBA 3AG1B 5DS5A 3ZMVA 1E79G 3TETA 2XAJA 3LSQA 3UMHA 2JIZG 4LBEC 1RM1B 3EH2A 1SZIA 1R73A 4UUJC 1ZHZA 4U5HA 4MVUA 2B5UA 1W0KG 3OWTA 1N8RW 3CCJV 5E3CA 4PDRA 3B0UX 2EIMB 2DW4A 2QTOA 4IJJA 2M4EA 3W2VA 3OEHG 1SF8A 2P6VA 3JD1A 5EC2C 2HV7A 3EGDA 5KYNA 2XSEA 1P7BA 3ML0A 4Q5SF 1R6NA 3DD7A 2CNWA 3ABMB 5KYYB 3VBBA 1KC8W 1S5HC 1DF4A 5IY5C 1VQLV 4O6NA 3LUTB 3OEOA 3MD0A 2YEVA 4OD5A 1LNQA 2WLKA 2JD3A 2NUTB 2H7BA 4RUFA 3CXCU 2QM7A 3T4RA 1VK5A 1OCRB 2QKSA 3B8MA 4YXWG 3OA1A 3QO7A 3AG2C 2R7QA 3NKEA 1NBMG 2XASA 4DVZA 1KKDA 3FYEB 3RVZA 5KYUB 3K1HA 3HB3B 4PFOA 2R9IA 5KYYA 2NNUA 2ZXWC 1V55B 4IWBA 2WL8A 2QM8A 2IJKA 3BEHA 4QPJA 3SP1A 4OIQF 3LLKA 2WLLB 2WLHA 3RIPA 1Q7YW 3SJQC 1MMAA 3ZMSA 1K4CC 1W2BU 1XL4A 3FVYA 1JPXA 4PDVA 1ZHYA 4BJ5A 3FB6C 5KA5A 2WLIB 5H6QA 5FCLA 2KW3C 4PA3A 2IOQA 3FAJA 1ENVA 1YITV 3FHDA 3CC4V 5DVWA 2WB7A 2A69F 2Z3YA 2ITCC 1MNDA 4R6ZA 4TWKA 3K66A 1M56C 3ZJZA 4GEHA 2EJRA 4YT8A 2XOKG 1K97A 4MVOA 4AE4B 4FX5A 2PFDA 2A0LA 5FL7G 2WLIA 1OCOC 3EFOB 1GTOA 2A6HF 1MSWD 3GANA 3MX3A 3HJCA 2WLMA 2L81A 1K8AW 5L3VA 3LSSA 2IJHA 5B1AB 3CPWU 2ITDC 2JEUA 1H2GA 3LDDA 2IXNA 3GODA 1NVPD 3MHHC 1PNLA 2LFSA 5B1NA 2DWDC 4MTXA 1PD0A 1PD1A 2Q68A 2XAGA 5LHGA 4PJJA 2X0LA 1FXVA 4LC1A 3JYCA 3LJBA 3W7XA 2EIKC 1MMGA 3OMIB 3CD6V 2B1IA 1YHQV 4KNWA 4N06A 3UMIA 4BAYA 3KG2A 1ZHXA 2IU3A 4XDKA 1SERA 5B3SC 2IXMA 4X0RA 1YIJV 4KC9A 1KU2A 3W8HA 3K04A 4QI0A 4FWVA 4F4BA 3HLZA 1H8EG 3I4UA 4EWCA 1J8YF 4KBLA 4BIZA 4MTFA 3QO8A 4WF9V 4C3DA 1J8MF 3SYNA 1EZJA 4R50A 1ZHTA 2IH3C 4HE8D 4GX1A 1VQMV 3FB8C 3G6EV 2EIJB 5H6RA 3EH1A 4JTCB 4XDJA 1FXKB 1ZU4A 2BOBC 3EPVA 2V3CC 5KUMA 2OTLV 1ZHWA 2J9UA 3FB7C 4HYOA 1GKFA 5DQTA 1NR7A 2V26A 3I55V 3ZIAG 3CZ6A 3E35A 2R7TA 5CA3A 3ETEA 2B0JA 5CBFA 3B77A 3SPHA 3ZN0A 4LERA 4MNDA 4FIPC 3L34A 5B1OA 1J95A 1FFTC 2XXAA 1JPJA 4PDLA 4WFGA 3CCUV 4E7SA 2Y3HA 4R8CA 5T3TA 3IEEA 3JT1A 3CCMV 2DYRC 1FXKA 2E87A 3JSZA 1MG1A 3FKSG 1VQKV 1QVFU 5H9CA 4PK4A 1I5YA 1VQPV 3ASNB 2AHYA 3T4DA 4QPKA 1MABG 2H94A 4BG0A 4RO2A 1FMWA 4Q4ZF 3K3WA 4R7CA 2HVJC 4FMTA 4U7OA 3OE7G 4JAUA 1F4NA 1PL0A 4G28B 1W0JG 2W4MA 5T1DB 1NR1A 3AG1C 1D1BA 1D0ZA 1G8XA 3P30A 3SPJA 3I5PA 1M90W 4LLCA 1ROPA 1TWHA 1RM1C 3B0PA 1Q86W 3JYHA 2A6EF 5EHHA 1NG1A 1OCZB 1QLEB 1NU9C 2EIMC 1S72V 2WLNA 3LDCA 1BL8A 3G71V 2PX3A 2EINB 4MTOA 2P7VA 3ABKB 4OIRF 1Z23A 1WLEA 2F43G 2OG2A 1PCXA 3N0TA 5F5FA 3DXJF 4EKWA 2XAHA 3CQZA 3ZRVA 1AJQA 3T6JA 2BE5F 1FMVA 4PFPA 2CW0F 1M57C 4CSAA 4G0HA 1QLNA 3AG3B 5E33A 3KMIA 1LS1A 2W45A 1D1AA 2J7PD 4PA9A 1OCRC 4A2NB 4WFAV 3CC2V 5HSWA 4JTDB 4Q7CA 3ZG1A 1GK9A 2PI4A 5HFMA 1JQ0A 4E7ZA 1KP3A 4JASA 1Z5ZA 3ETGA 1W2WA 3CCSV 5B1BB 1K5QA 1QCEA 3OFNG 5BUOA 3ITFA 4PA4A 1BHAA 1M2VA 2J7PA 1V55C 2GFHA 5IYCO 5LHHA 1G4YB 4CZZA 4P9PA 2Y69B 4I1MA 3EGDB 5GW7A 2D3OW 2Y3GA 2IYLD 2OCCC 2V7QG 5CI9A 4RD9A 2KJGA 1S0VA 1GM7A 2HR3A 4O7GA 4OINF 3RVYA 1BHBA 5DS4A 1RPOA 4DBQA 2HVKC 2CNWD 2YEVB 4U5DE 2WWWA 3DTUB 3D36A 3ZSUA 4JCHA 1JPNA 2NUPA 3UGPA 4BJ6A 1TWAA 2EBOA 1VQNV 4XWJA 3HTKC 2IJIA 4B6IA 3OEEG 4CIHA 4C7OA 3TCUA 1FTSA 3T2MA 4H4KC 3LS1A 4J9YB 2XL4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QE7 A;  3RVZ A;  3R65 A;  4GX1 A;  2Q69 A;  3K0G A;  5EBW C;  3FB8 C;  4MW3 A;  3SPJ A;  4HZ3 A;  3F7Y C;  4LBE C;  5EC1 C;  2NLJ C;  2X6A A;  3VOU A;  2R9R B;  4PA4 A;  1OCC C;  4QNH B;  2WLM A;  3ABL C;  3EFF K;  4LCU C;  4OXS A;  4MVR A;  1V55 C;  4JTC B;  5B1A C;  3RW0 A;  4XDJ A;  3UKM A;  2ZXW C;  4X8A A;  3K06 A;  2BOB C;  5KUM A;  4UUJ C;  1OCZ C;  2ITD C;  2Q6A A;  1G4Y B;  3SYO A;  4MVU A;  4P9P A;  3IGA C;  2AHZ A;  2Q67 A;  5J9P C;  3SYC A;  3FB7 C;  4HYO A;  3LDD A;  4MVQ A;  4DXW A;  5CBG A;  5CBH A;  2BOC C;  3BEH A;  1XL6 A;  4CBC A;  2OCC C;  5EK0 A;  3GB7 C;  1R3L C;  2WLJ A;  5B1B C;  3IFX A;  3K0D A;  2EIM C;  3LDE A;  2X6B A;  3OUF A;  4PDR A;  2WLN A;  2QTO A;  3LDC A;  2WLL B;  4PA7 A;  4RAI A;  5EBL C;  2WLH A;  3OGC C;  1ZWI C;  4GX0 A;  2DWD C;  1BL8 A;  4MTG A;  4P30 A;  4I9W A;  2EIJ C;  3SYP A;  3RBZ A;  2P7T C;  3WG7 C;  5CBF A;  2Q68 A;  5EC2 C;  2DYS C;  4KFM A;  3OUS A;  4QE9 A;  4MTO A;  3RVY A;  3SJQ C;  3SPH A;  3ABK C;  1V54 C;  2W0F C;  1K4C C;  1XL4 A;  4LP8 A;  2IH1 C;  1J95 A;  3F5W C;  3SPC A;  2K1E A;  1FFT C;  2HVK C;  2Y69 C;  3ASO C;  3LNM B;  4RUE A;  4J9Y B;  3ZRS A;  2A79 B;  4PDV A;  4JTA B;  4PDL A;  3JYC A;  1QLE C;  4WFG A;  1JVM A;  2EIK C;  1R3K C;  3E8G A;  3FB6 C;  4X88 A;  4R8C A;  2WLI B;  1R3I C;  2WLL A;  1ORQ C;  2HG5 C;  4PA3 A;  4EKW A;  3AG4 C;  4MW8 A;  3KG2 A;  3SYQ A;  2HJF C;  4P2Z A;  2DYR C;  4G27 B;  3OR6 C;  3SPI A;  4PDM A;  4ZBM A;  2EIN C;  3SPG A;  1S5H C;  4WFF A;  4WFH A;  1K4D C;  4XDK A;  5IY5 C;  3E83 A;  3T1C A;  2KB1 A;  3E8F A;  4H37 A;  4MVS A;  4F4L A;  5B3S C;  3LUT B;  2EIL C;  1M57 C;  4GX5 A;  2HFE C;  2ITC C;  4MS2 A;  4J9Z B;  2ZD9 A;  4P9O A;  4R6Z A;  2AHY A;  2YEV A;  3FB5 C;  3F7V C;  3K04 A;  1LNQ A;  4TWK A;  3T4D A;  3UM7 A;  1M56 C;  3ZJZ A;  4H33 A;  3PJS K;  2WLK A;  5E1A C;  4RO2 A;  3SYA A;  4RUF A;  3STL C;  3X2Q C;  5KUK A;  4PA9 A;  1OCR C;  3K03 A;  4PA6 A;  2X6C A;  4XDL A;  4BW5 A;  3E8B A;  4JTD B;  4WFE A;  3ABM C;  2QKS A;  4X89 A;  4R7C A;  2DWE C;  2HVJ C;  3K08 A;  4MSW C;  4MTF A;  4MVO A;  1R3J C;  3E8H A;  2A9H A;  5EBM C;  3STZ C;  4MVZ A;  2ATK C;  4G28 B;  3AG2 C;  4GX2 A;  3E86 A;  3HPL C;  3TCU A;  3E89 A;  3OR7 C;  4R50 A;  2H8P C;  3AG1 C;  3T4Z A;  3ASN C;  2A0L A;  3T2M A;  3AG3 C;  4MVM A;  2WLI A;  2IH3 C;  2JK5 C;  1OCO C;  3TET A;  1KKD A;  1P7B A;  5BZB A; 
#chains in the Genus database with same CATH topology
 2EJ7 A;  4WFB V;  1K9M W;  1Q3E A;  1WN7 A;  2RQ6 A;  5L0J A;  4NTW A;  4P6I C;  2JJ1 G;  2ZR3 A;  1OCC B;  4DJ9 A;  3JSN A;  1K92 A;  3CAX A;  5HV9 A;  1NZ6 A;  5B1A C;  1OJH A;  5IYB O;  1YJ9 V;  1NJI W;  3K06 A;  1JMK C;  3UT5 B;  4PHZ A;  5IJ0 B;  2NSF A;  3ASO B;  5ITZ A;  4DV5 O;  2PUS A;  4JI2 O;  1EQ1 A;  5CBG A;  1M1K W;  3ZED A;  2W0X A;  4JYA B;  4X9Q A;  4NYK A;  2R7U A;  2WLJ A;  3K0D A;  4O4J A;  2ZXP A;  3OUF A;  4YJ2 B;  4K0D A;  4PA7 A;  4DO2 A;  3TJ6 A;  3OGC C;  2R25 A;  3NMI A;  2P7T C;  4DBR A;  3WG7 B;  5BY1 A;  4QI2 A;  2OT5 A;  4I55 B;  1HNW B;  1P84 F;  2DYS B;  1V54 B;  1ZU5 A;  5JH7 B;  3LNM B;  1NH2 D;  2Y3D A;  3DGE A;  3IQC A;  4AIL C;  3G4X A;  2HJM A;  1K33 A;  4JYC A;  3DWW A;  1QHT A;  3A8T A;  4X65 O;  3RKO F;  5L0D A;  3K59 A;  2UXD O;  4CS7 A;  1VF6 A;  2Q9C A;  4IIJ A;  3MYI A;  2QTV A;  2Q7H A;  2RN9 A;  2RDC A;  4P2Z A;  4PJ0 Z;  2DGJ A;  3UMK A;  4PJM A;  3EHB B;  5LGU A;  4JI7 O;  4DUZ B;  3E2E A;  1M9N A;  2RJZ A;  2J9V A;  2IXP A;  1I08 A;  2L6F A;  3K1I A;  1RJ9 A;  5J2T A;  2XLO A;  3TGU H;  3SJA C;  2KG7 B;  1AIL A;  2WVO A;  1KBH A;  4NY3 A;  2JGU A;  4DV0 B;  2O9X A;  1Q82 W;  2G62 A;  2LFF A;  1KEC A;  4JC7 A;  3W7W A;  4JI6 B;  4I9Q A;  1FPO A;  2PTM A;  4XDL A;  1X59 A;  1Q90 D;  4JI3 O;  2ZDI C;  5COG A;  1AI5 A;  1NT2 B;  1RSO A;  4MSW C;  3S27 A;  2NPU A;  4GYT A;  4LF6 O;  4LH6 A;  3OAA G;  1RCP A;  1OZ0 A;  4GQH A;  1LI7 A;  2R7R A;  2H7O A;  4P9T A;  2B1G A;  1WB7 A;  2Y4U A;  4ZOL A;  3ETD A;  5JP7 A;  4DW1 A;  3K9S A;  1SZX A;  1OKK A;  1A0B A;  3RYF B;  3NRH A;  4U5G A;  1S3J A;  1MMN A;  4U9D A;  4MW3 A;  3S0X A;  1K5S A;  1WAZ A;  3ZWI A;  1J5E B;  3X1O A;  3PN1 A;  3ABL C;  3KCY A;  5BMV A;  2OYQ A;  1NKD A;  1UPG A;  3NYJ A;  5CI8 A;  4JAA A;  3UKM A;  4X8A A;  1SQV H;  2JJ2 G;  3CCL V;  2WZG A;  2GTA A;  2J45 A;  3BCC H;  2JDI G;  1KD1 W;  5L3E A;  1D1C A;  3B9Q A;  1N33 B;  2E3C A;  3F47 A;  3G4S V;  4K8X A;  2AGA A;  5COF A;  1TFO B;  1QBZ A;  4XPW A;  3K5M A;  5LMN O;  2ZCE A;  5EIB D;  5EYP B;  2VB6 A;  3EQL F;  1FD9 A;  1IBK B;  1BZ4 A;  3PHF 2;  2P4V A;  4DR3 B;  4WGY A;  1IBL B;  4DW0 A;  4X1Y A;  4JZG A;  1NVP B;  3O9O A;  2Y39 A;  2CE4 A;  2A79 B;  3HNL A;  2GA0 A;  2KSD A;  2BSK A;  2BC5 A;  2MW2 B;  4FLV A;  4EB6 B;  4LFC O;  2I8B A;  5LA6 B;  1R3I C;  3VRC A;  1S5L Z;  2Q0A A;  4KL1 A;  2AVK A;  2J9W A;  4K0K B;  3RFR A;  2PF4 E;  1AI6 A;  3O55 A;  4GKJ O;  1Q6H A;  1RPR A;  1N32 O;  1RKC A;  3ZRX A;  2ZXR A;  3JD3 A;  3SPI A;  1SQB H;  1Z2G A;  1E1R G;  3E9V A;  3E8F A;  2A1D D;  3HKB A;  3B40 A;  1G1X B;  1AB3 A;  4GX5 A;  3O65 A;  1P7G A;  3OD4 A;  1JMW A;  4G7H F;  1HMD A;  3FAP B;  4KP4 A;  5LBQ A;  2XL8 A;  2ADQ B;  3C90 A;  3JD0 A;  5E3A A;  3X2Q B;  5KUK A;  3C63 A;  5BQG A;  3K03 A;  1GM9 A;  1K7D A;  1N0N A;  3EZH A;  1FAF A;  4XLP F;  4NXN O;  3JTL O;  4EEQ A;  3BAA A;  1AJN A;  4WBN B;  1SA0 B;  2ZXW B;  2R7O A;  2D5R B;  4MVZ A;  4NTY A;  4TV9 B;  4GX2 A;  1R1B A;  4JGS A;  1F1M A;  3BY6 A;  2JPU A;  3H1K H;  3RGB A;  1PNK A;  2KGO A;  1MZE A;  2PGG A;  1F23 A;  1Y6D A;  4DV4 O;  3DKA A;  3H65 A;  4J10 A;  5BZB A;  3JSL A;  5L3Q A;  5L3G A;  4JJG A;  1JAF A;  5EBW C;  3B4S A;  2CH7 A;  5L3B A;  2M7W A;  3H01 A;  5EC1 C;  1JOG A;  2X6A A;  2HJ3 A;  4YWQ A;  3RYC A;  1S77 D;  3K5N A;  2UXX A;  3QF7 A;  1D5N A;  2C03 A;  3NMK A;  1YVW A;  3B71 A;  3S9O A;  1OCZ C;  5CIV A;  1L3P A;  4CH3 A;  3M1C B;  3IJ4 A;  5D5P A;  2IBZ H;  4AX2 A;  3JD2 A;  2XXA B;  2ZIM A;  3WOD F;  2LJ2 A;  1R5I D;  2I15 A;  3A2F A;  2LGQ A;  4BEJ A;  4FM0 A;  1EN6 A;  3IFX A;  3S3W A;  5D5Q A;  3SJC C;  5A6B D;  5EBL C;  2EPN A;  4A5U B;  1C03 A;  1MQV A;  1JFF A;  2H7V C;  3W7T A;  2UUC O;  1XNQ B;  4WGZ A;  1GN6 A;  4NQF A;  3G50 A;  4IHJ A;  4WBN A;  4JYB A;  4YT5 A;  1LPE A;  4FLY A;  5B5E Z;  2AWY A;  3ABK C;  1Z6A A;  4X20 A;  3CC7 V;  1GH6 A;  1AEP A;  3K58 A;  4J42 A;  1Z63 A;  5C93 A;  4DVY P;  2UU9 B;  2YIC A;  4U5F E;  5CA1 B;  1H9G A;  4U5E E;  4JI5 O;  3AQB A;  2Q73 A;  2A3Q A;  3WB2 A;  4UVA A;  2MK3 A;  1ORQ C;  1Q6I A;  4U3J A;  1S7Z A;  1PPJ H;  4JZA A;  4EFE A;  4B3T O;  1M2O A;  3IPM O;  4W8K A;  3JCU Z;  4IAQ A;  3RYI B;  4LDR A;  5KHH A;  1TUE B;  3JAL B;  2LSE A;  2XS8 A;  1FYJ A;  1YYX A;  4X66 O;  5L0H A;  4OD4 A;  4ASU G;  2P4K A;  4WFH A;  4YN0 B;  4EHP A;  1MNG A;  1H2N A;  4B7K A;  4DRJ B;  3CYO A;  1YLM A;  1Q0K A;  4AL0 A;  3L74 H;  4K3A A;  2XND G;  3W7U A;  2XM0 A;  1P4R A;  1Y74 A;  3DXR B;  1LUV A;  3I5D A;  1ZUQ A;  1APC A;  4QDL A;  1OCO B;  2QA4 V;  3IAY A;  1NTK H;  5E1A C;  1FAP B;  3Q4H A;  2J8W A;  3TJT A;  4PA6 A;  2XS1 A;  4LNU B;  3U0C A;  1TWG A;  2W9Y A;  3US6 A;  4X89 A;  3U0Z A;  3U8P A;  5IE9 A;  2MWQ A;  2B9Z A;  1E85 A;  4DR2 B;  1PL4 A;  1GRJ A;  1AVO B;  4J7Y A;  4OPH A;  3ZRW B;  4DOZ A;  3L70 H;  5KYX A;  3E89 A;  3L9D A;  5CA1 A;  3MLG A;  1BR2 A;  1XNR B;  1E84 A;  4QIW F;  3QW1 A;  2JK5 C;  4X62 B;  4GKK B;  1CEZ A;  2DQ0 A;  2IBF A;  3ZVR A;  4D6T H;  5FLX N;  4JZ2 A;  3F7Y C;  3APQ A;  1ZTE A;  4DV1 O;  1BQZ A;  3B0V C;  3EHM A;  4RQE A;  1VTM P;  4QNH B;  2VQF B;  4DR4 O;  1YJW V;  1Z3I X;  4J32 B;  1OXK A;  1RP3 B;  2YL3 A;  2PYJ A;  2G3K A;  2FB5 A;  3UR3 C;  2KQ9 A;  5L0G A;  3SYO A;  1TR2 A;  3IGA C;  4K7B A;  2XRH A;  4TSF G;  3SYC A;  2EIK B;  5KHG A;  2YRF A;  3WHN A;  3HNK A;  3HKC B;  4RAI A;  2KNH A;  3ZIB A;  2R02 A;  3SYP A;  4YY3 B;  1TVK B;  4CS3 A;  3GM2 A;  3ZRW A;  3LNR A;  2NG1 A;  4JKV A;  1VQO V;  1SQP H;  4DR5 B;  2CDQ A;  5LGT A;  3F5W C;  4BEM J;  2FAP B;  1U0B B;  4FZ0 A;  4K1O A;  2N04 A;  3C3T A;  1FFH A;  1PNM A;  2W6I G;  4HNA A;  3IHU A;  1IDS A;  1R3K C;  2J0W A;  1WA8 B;  2W6J G;  1O87 A;  4BW9 A;  1ARO P;  1SKV A;  3CME V;  3T1H O;  3SYQ A;  1XI1 A;  3DM5 A;  1LVK A;  1M4U A;  3CSK A;  1N0J A;  4Z2W A;  5T3W A;  3U8V A;  4X1I B;  3JAR A;  4ZBM A;  1FFX A;  4JV5 O;  2AWC A;  3GWN A;  1MA1 A;  5A6K A;  1YJG A;  3CCR V;  4B3M O;  4F4L A;  4UB8 Z;  5IJ9 B;  2XHB A;  4JI8 B;  3JRT A;  3N2K A;  5E2Q A;  5DN6 G;  2EIL B;  1H38 A;  4J9Z B;  2ZD9 A;  3FB5 C;  1R6K A;  2BL2 A;  3CRA A;  4LF7 O;  3GEE A;  3BFR A;  4JJF A;  5F5H A;  2R7V A;  3LEV A;  3STL C;  4YT2 A;  3CMA V;  3VYW A;  3C8Z A;  1THZ A;  4BW5 A;  4LWS B;  4B3S O;  4PEL A;  1G5Z A;  1E83 A;  1SQF A;  3ABM C;  3SJB C;  2W4B A;  3FAV A;  1URF A;  2V1D A;  4KUM A;  4AHC A;  3ABT A;  1QR8 A;  3R7C A;  1EN5 A;  1FJG B;  1M2V B;  2AXT Z;  3WB0 A;  4BPM A;  4J7J A;  4XPY A;  3UQ8 A;  1O3U A;  3DE9 A;  4F6R A;  3KYI A;  1EZV H;  1H8H G;  2CDY A;  1IUR A;  3ZTM A;  2LGW A;  4MVM A;  3WB1 A;  2JGD B;  1IZM A;  4IT5 A;  2VWK A;  2EZP A;  3GWK C;  1N34 O;  1SMY F;  2DJV A;  4J11 A;  2X51 A;  2F4V B;  1K34 A;  3NYM A;  4DV7 O;  1G6U A;  2GSM B;  4YK5 A;  5DM6 V;  4O4L B;  2NLJ C;  1IW7 F;  2WZL A;  3E22 B;  1WWP A;  3ZC4 A;  1OCC C;  3QO5 A;  4LDK A;  4LCU C;  3QVZ A;  3OW2 U;  4WAB A;  4MVR A;  5EZY A;  3EGX A;  3DJU B;  1BR1 A;  2QUP A;  1GMG A;  4ZHQ B;  2XL6 A;  4C3B A;  2UXC O;  5CBH A;  5L3D A;  5GON B;  5IYD O;  2VCC A;  4BJ5 C;  2GHY A;  3TOM A;  2LW7 A;  4D7T A;  4GCZ A;  5LP6 B;  3DAG A;  4G7O F;  3J7A U;  4OX9 B;  1RKE B;  5TIS Z;  1QKR A;  3T9O A;  1KU9 A;  1D2D A;  2HMQ A;  3A9C A;  1Y66 A;  2DYR B;  4NVP A;  3WG7 C;  1QR9 A;  2DYS C;  1HR0 B;  3V7O A;  2HZ8 A;  4U7N A;  1V54 C;  2W0F C;  4LP8 A;  2IH1 C;  5JCO C;  3CEX A;  2K1E A;  3VAY A;  2QLA A;  3KL4 A;  3CSX A;  2NUP B;  2YUA A;  4O4H B;  3OM3 B;  3W2W A;  4LLE A;  2A0B A;  3OGI B;  2HG5 C;  4FLX A;  2YL7 A;  4XEK A;  4O6Y A;  3P32 A;  4MW8 A;  3AG4 B;  4ZI7 A;  4W4K A;  1Q5O A;  3WFV A;  1DLB A;  1LI5 A;  1O5H A;  2A0U A;  1KP2 A;  2ETS A;  2PYL A;  2FTK A;  1B3Q A;  1K4D C;  1HWY A;  1VQ5 V;  3TD7 A;  5BR8 B;  2OOC A;  2PX0 A;  2DQ3 A;  2ZE6 A;  3BRC A;  3K7D A;  4RBN A;  4Q6G A;  3C3S A;  1JJO A;  4C7O B;  3L73 H;  2J46 A;  3ZBH A;  3GOR A;  3OTO O;  3N2Z B;  3C8G B;  3HKD A;  4H33 A;  2H3O A;  1RKE A;  2C04 A;  2VAS A;  4AI8 A;  2YI9 A;  4OIO F;  2P5O A;  2GBO A;  5DS6 A;  1M6T A;  3ZDL A;  3E8B A;  1CP9 A;  3HR0 A;  4J7K A;  1VQ7 V;  1WPB A;  1R6T A;  5KYW A;  2DWE C;  1ST6 A;  3NYL A;  1VQ9 V;  2HV6 A;  1R3J C;  4TV8 A;  4FLZ A;  1N36 O;  1NLX A;  2HSB A;  2P06 A;  4Z1M G;  2Q00 A;  1DTO A;  3OMA B;  3E70 C;  2WA3 A;  3TXS A;  1QPU A;  5ITZ B;  2JRI A;  3R66 A;  1AP6 A;  1NSG B;  3ZMT A;  2IXO A;  3R65 A;  2Q69 A;  4IAO A;  4HZ3 A;  1YA9 A;  4O4J B;  5JQG B;  1XMQ O;  1U96 A;  1IZ3 A;  1I5X A;  2WAM A;  2Y0I A;  3CJH B;  3NKD A;  3CCQ V;  5KHK A;  1YXB A;  3B8N A;  4ZLC A;  1PKX A;  2JS3 A;  4NR1 A;  4JIO A;  4CS9 C;  4DRX A;  3CCV V;  2Q67 A;  4NC3 A;  4MVQ A;  1QZX A;  4U5B E;  3FFQ A;  4JW1 A;  3GB7 C;  3CRM A;  1R3L C;  4J7T A;  2JS5 A;  3SZR A;  2HFI A;  1AR4 A;  2X6B A;  4FPP A;  1E1Q G;  1ZWI C;  4MTG A;  1SZT A;  4FES A;  4YL0 A;  4IIJ B;  3K79 A;  4E18 A;  2P22 C;  1JX9 A;  2VH3 A;  1A7D A;  5DQZ A;  3KYJ A;  4O79 A;  3FXH A;  1JOY A;  3RFY A;  3H1L H;  2OWO A;  1M57 B;  2E74 B;  1SRY A;  3FYI B;  2ZE8 A;  3C7J A;  1X4T A;  2Z5U A;  1VMA A;  3ZRS A;  2OIG A;  2YI8 A;  4JI4 B;  1QSP A;  5JVE A;  1RJ9 B;  5J2T B;  3BA8 A;  1TWC A;  4GZR B;  4M63 A;  5IT9 N;  3W8I A;  3AK2 A;  3FDQ A;  4LFA B;  2XAF A;  3E8G A;  1Z7Q c;  2PBE A;  4O2B B;  1I94 O;  1XDC A;  4DR6 O;  4UCO A;  1D0X A;  1NZE A;  2BE3 A;  5JQG A;  4CS8 C;  3CJH A;  5DED A;  3NXS A;  4XLN F;  3OR6 C;  1YJN V;  1NH2 B;  1IX9 A;  4OGQ B;  4PDM A;  3SPG A;  1RSO B;  4UV8 A;  2QNL A;  4PJN A;  4MVS A;  1GN2 A;  2VRZ A;  2ZIN A;  4PI0 A;  4N21 A;  3LS0 A;  4H13 B;  2HFE C;  3CP1 A;  1VYI A;  1I7F A;  2WZF A;  3SEO A;  2R7W A;  4N4W A;  3C18 A;  4U3F H;  3ZN1 A;  1VQ8 V;  2YWA A;  1AUE A;  4ZOL B;  1F4M A;  2CK3 G;  1Y67 A;  3X2Q C;  5F28 E;  3DJN B;  3SYA A;  1RFY A;  2Q3T A;  1YI2 V;  2QM4 A;  1AVM A;  3FD9 A;  1YF2 A;  3P3N A;  2YS8 A;  3IQT A;  2OTJ V;  1VF5 B;  3LAY A;  3DAF A;  1OKK D;  2VCB A;  2FYU H;  5BMV B;  2PI5 A;  3E86 A;  4DRI B;  3K33 A;  4F6E A;  4JI1 O;  2XLD A;  4CJO A;  2NUT A;  2X7R B;  1PD3 A;  4O2B A;  3WU2 Z;  1K3E A;  1VYK A;  2Q9A A;  2OCC B;  1H2L A;  1N4C A;  1AR5 A;  1MZF A;  3AEI A;  1GO3 F;  5AGF A;  3L0I A;  4BIU A;  2ZM6 O;  2PP4 A;  1CPQ A;  4YT4 A;  1WAT A;  4ZLD A;  5KA6 A;  4DV5 B;  5D92 A;  4JI2 B;  3EFF K;  4OXS A;  1SET A;  1DOW A;  4ANJ A;  1VP7 A;  5CN0 A;  4CDY A;  2E5L O;  2QGN A;  3N24 A;  3QTC A;  4DR1 O;  2Y48 A;  4X1Y B;  1SF9 A;  4RQF A;  4EBJ A;  5L3F A;  1MMD A;  4G7Z F;  2AHZ A;  4A4A A;  4UDV A;  5JWP A;  4DXW A;  4Z9I A;  1K73 W;  4CBC A;  5KYU A;  3EZI A;  4TQF A;  3CE2 A;  2D4U A;  2BSK B;  4HEA J;  1WGW A;  3N2G A;  3M4B A;  1JCH A;  1YSC A;  4O6M A;  1BMF G;  4BJ1 A;  4GX0 A;  2EIJ C;  4DV3 O;  4B08 A;  4GLX A;  4I44 A;  2QY9 A;  3M8A A;  1SS3 A;  3QZC A;  2CTP A;  1VQ4 V;  1FXK C;  4X65 B;  2PZS A;  4UVB A;  3V5X A;  3QVY A;  2UXD B;  3H2V A;  3VF0 A;  3UGO A;  3HKB B;  4RUE A;  3M99 B;  5KHI A;  2ILM A;  4TUY A;  3JCZ A;  1VEW A;  2R7S A;  4JI7 B;  1UFB A;  4X88 A;  3H2U A;  1N1C A;  2WLL A;  2GDC A;  3F46 A;  3AG7 A;  3VM6 A;  2YLD A;  3ECS A;  3O6X A;  3F5T A;  2AW9 A;  2P1A A;  1YDI A;  3PCV A;  1AR1 B;  4Q20 A;  4LFB O;  2ZR2 A;  3ZHV A;  5IY5 B;  1O9H A;  3RYH A;  2P67 A;  4PI2 A;  4JI3 B;  2MHR A;  1VQ6 V;  3SXM A;  1D0Y A;  1ZAU A;  4LF6 B;  3EXA A;  2CTR A;  4JI0 O;  3UM7 A;  3BHP A;  4JEB A;  3H1I H;  1FNT c;  4DV6 O;  1EN4 A;  4YHH O;  3LES A;  3JCU Q;  1BSM A;  4C3E A;  1BR4 A;  4WFE A;  2QEX V;  1SC5 B;  4I3M A;  4FJC C;  2CH7 B;  3QMK A;  1L0N H;  3RYC B;  2FGY A;  2XAQ A;  5EBM C;  3STZ C;  2VWJ A;  1TUB B;  4LH7 A;  3AG2 B;  1S76 D;  5JUA A;  3OR7 C;  3T4Z A;  5HFL A;  3ASN C;  4G2K A;  1XQ8 A;  2ZNJ A;  1U89 A;  4XQ1 A;  4ULW A;  2CYD A;  4UCV A;  2YHS A;  2KSF A;  1SQQ H;  4NCQ A;  3HKE B;  4N23 A;  2XLE A;  1XMO O;  4LF8 O;  5FZT A;  5H2F Z;  3JYY A;  3S29 A;  4IL6 Z;  5D91 A;  4AE4 A;  3Q7G A;  1FXH A;  5B3I A;  4AQY O;  4RDA A;  4N6C A;  4XTK A;  5JJJ B;  4JVS A;  1EFR G;  1JFF B;  5JVD A;  4I1O B;  1Y4M A;  4CS9 A;  4IHJ B;  3TXQ A;  4EBB A;  1TA8 A;  3THO A;  2EUL A;  1JJ2 U;  1NQT A;  2YC0 A;  5LMN B;  2P6J A;  4X20 B;  5L3C A;  2WA4 A;  1AJP A;  3QNE A;  3EFO A;  2A68 F;  4FFB A;  4XBF A;  2QWP B;  2LFR A;  3W4Y A;  5JSL A;  3LDE A;  3KH2 A;  3T6B A;  3G80 A;  1BDJ B;  4U3J B;  2R72 A;  3BA9 A;  3ABU A;  4LFC B;  3OUS A;  2NR5 A;  1TUB A;  2UXB O;  4CDA A;  1KNY A;  3A0H Z;  3AQC A;  5JLI A;  3RYL A;  4CSA C;  3SDL A;  4GKJ B;  1N32 B;  1QLE C;  4BWA A;  3IC7 A;  1BQ0 A;  3HKE A;  4LR3 A;  1YTF B;  2KYH A;  3M79 A;  3SNH A;  1Y74 B;  3NR7 A;  1MNE A;  3AOU A;  1OQC A;  3SGI A;  4CS8 A;  4KHP O;  3RH3 A;  1L8D A;  1JRA A;  3Q4H B;  2RSE B;  2HJF C;  2YZS A;  2AZ2 A;  4G27 B;  3LLI A;  3I5Q A;  1ZL8 A;  4X64 O;  1YTF D;  1GN4 A;  2EIN C;  3H1J H;  4JYY A;  2J0X A;  3E83 A;  4HFK B;  3D3I A;  5TJ5 E;  2EIL C;  5A69 A;  2IU0 A;  3RT3 C;  3I56 V;  2CGE A;  1YZB A;  1OW6 A;  1SES A;  1YEW A;  3ZMU A;  3S3X A;  5KYX B;  3N27 A;  4NXN B;  2PNO A;  5CA0 A;  3GWO A;  1M56 B;  2YDE A;  4LF9 O;  4OIP F;  5IWA O;  4TOI A;  3CRR A;  1Q81 W;  1GS9 A;  2X6C A;  1L1F A;  2WVQ A;  2QDO A;  1CXZ B;  4GT1 A;  2MYS A;  1HNX O;  2AU5 A;  1FS0 G;  3GM1 A;  3ZHT A;  3JAS A;  3O39 A;  3ABL B;  5CMU A;  4DV4 B;  3ZCC A;  4ZKI A;  2ARH A;  2WPD G;  1OHH G;  2L9J A;  2A9H A;  4DR7 O;  4PD4 F;  3O10 A;  1NU7 D;  4H44 B;  5FNV A;  4OPA A;  1C02 A;  4I7Z B;  1ORS C;  3AG3 C;  4FZ1 A;  1US6 A;  3G6B A;  2QE7 G;  1VLT A;  4P9O A;  4CBE A;  5LGN A;  4UFZ A;  4AK9 A;  2ZDI A;  3W7S A;  4U5C E;  4DUY O;  3S28 A;  4JAV A;  3VOU A;  5KLV H;  2R9R B;  4UVC A;  4DRH B;  2ZXO A;  2YXL A;  3JAK A;  3RW0 A;  4NXM O;  3KPH A;  4LF5 O;  2HHH O;  5EGY A;  4E2L A;  2YSU B;  3K6B A;  4I0X A;  1H7I A;  3EJN A;  5J2U A;  2P90 A;  2UUC B;  2E75 B;  1MMM A;  5JJE B;  2FFH A;  5J9P C;  1EI7 A;  4LAC B;  2BOC C;  3M7M X;  4N6H A;  2R9A A;  3A0R A;  5LP6 C;  2Q7G A;  4HNA B;  5B1B C;  1IXM A;  2JVD A;  3CEI A;  2UXN A;  2JEX A;  2VQE O;  1ZW2 A;  1TKN A;  3J06 A;  1BS3 A;  4P30 A;  2R05 A;  2O57 A;  3RBZ A;  3EG9 B;  1PV3 A;  3D36 C;  4JI5 B;  2UUH A;  4EUK B;  4PAC A;  2Q4F A;  4KFM A;  1KTM A;  4I4T A;  1QU7 A;  3JAR B;  4FLW A;  1FFX B;  1A7V A;  3U10 A;  4B3T B;  4QJF B;  1KB9 F;  1DF5 A;  3SPC A;  2Y69 C;  3N2K B;  3FOO A;  3MAQ A;  5KAI Z;  2IJJ A;  4JTA B;  2CTQ A;  4X66 B;  4FM2 A;  3PMR A;  2BTQ A;  2M6Y A;  3BPZ A;  3U11 A;  2WVN A;  3JRM O;  4KNV A;  4BJ6 C;  1LR1 A;  3TK1 A;  3AG4 C;  4MT8 A;  4FVM A;  3RN4 A;  1H9T A;  3K9A A;  2ADP A;  1YVI A;  3T6G B;  3V5Y A;  3DZA A;  3V5Z A;  1CPR A;  4I5S A;  1VMG A;  3FAV B;  3T1C A;  2KB1 A;  2ZKO A;  5B3S B;  4P9F A;  4PJL A;  2HKO A;  2F93 B;  4AL1 A;  1TGO A;  2Y0P A;  1EA8 A;  1M93 A;  2ZQM A;  1B68 A;  2R7X A;  2L6G A;  5FPO A;  4F6R B;  2KKW A;  1G8M A;  4J30 B;  1MOF A;  4TT3 G;  3CCE V;  3UNG C;  1SR2 A;  2Q8V A;  3EG9 A;  4WJ0 A;  3K08 A;  5DLJ A;  3E8H A;  1COW G;  4DV2 O;  2YLG A;  2G3V A;  1VF7 A;  4JF3 A;  5LHI A;  4JPR A;  2DOS A;  4NTA A;  2Y4T A;  3HPL C;  1Q0D A;  2Q9L A;  5EZY B;  2H8P C;  4DV1 B;  3EGX B;  3MBG A;  3Q6N A;  1KQS U;  4DR4 B;  2EZO A;  1GM8 A;  4HAM A;  4QE7 A;  3K0G A;  3NG1 A;  1LUW A;  4G78 A;  1Q0G A;  2HUJ A;  2NN4 A;  1T5E A;  4IYI A;  4HFF B;  2LP7 A;  2X0C A;  1H2S B;  2Y3B A;  2HLD G;  4DYL A;  4IGG A;  2Q6A A;  3ZHS A;  4CDV A;  3NDB B;  5BQI A;  1LKX A;  5LMU O;  2IW5 A;  1ZLZ A;  2C2A A;  4K8Z A;  5IDJ A;  1XL6 A;  4UXN A;  1HMO A;  5EK0 A;  2G38 A;  4WCE V;  1T01 A;  3A0B Z;  2VS0 A;  4FK5 C;  4UV9 A;  3JD4 A;  1VF6 C;  3ATP A;  2VCA A;  3OMN B;  4I9W A;  4MQ9 F;  4ZI7 B;  4DK0 A;  5LXT A;  4KI2 A;  3MHS C;  2UUA O;  4QE9 A;  1UJW B;  2K9P A;  3JAW A;  2D2C B;  4IRU A;  1Y76 B;  1I4Z A;  3T1H B;  1AI7 A;  4UCU A;  1QVG U;  2Q9B A;  3K1I C;  3ASO C;  1FFT B;  5CB4 A;  2UUB O;  1JVM A;  4JV5 B;  2Z15 A;  3FX7 A;  1HY5 A;  4JUR I;  4B3M B;  1WB8 A;  1YA7 O;  1CPY A;  3HKD B;  4O2A A;  3T1Y O;  3DM9 B;  2RMK B;  1H2M A;  5COM A;  2QSA A;  2XUM A;  4LF7 B;  3ZX6 A;  5KYW B;  4I50 A;  4WFF A;  3TOL A;  3ZMZ A;  1GQA A;  2B0H A;  4H37 A;  4TV8 B;  2HP8 A;  4B3S B;  1W59 A;  3EHN A;  2FKX A;  1QQC A;  4MS2 A;  1F51 A;  3POV A;  1AI4 A;  4BJT A;  3F7V C;  2ZPA A;  4LF4 O;  4YJW A;  2WSS G;  3PJS K;  1SQG A;  5L0F A;  1HP8 A;  1B6Q A;  1B06 A;  3CHX A;  1SYQ A;  4L87 A;  3CWB H;  2OEV A;  1WPX A;  5KX5 A;  1NFN A;  3DMD A;  3LEO A;  1XOU A;  1WNS A;  1N34 B;  1LE4 A;  1C17 M;  1Y76 A;  2ATK C;  4CH5 A;  5A2Q N;  4DV7 B;  2LD6 A;  1ZYR F;  1VOM A;  3Q7L A;  3Q6M A;  1CGM E;  1EBO A;  3KKB A;  3ZHU A;  1DGS A;  3AG1 B;  5LOV A;  1IBM O;  4B3R O;  5DS5 A;  2YVK A;  3ZMV A;  4DRX B;  5JRA A;  1E79 G;  3TET A;  1RMV A;  2XAJ A;  3APO A;  3LSQ A;  3H9V A;  1HNZ O;  1RXQ A;  3UMH A;  2JIZ G;  2OU6 A;  5LL6 Y;  1PV0 A;  4LBE C;  3BVO A;  1K40 A;  2YIA A;  1ORJ A;  2UXC B;  1WP8 A;  1RM1 B;  4E0I A;  3CXH F;  4CC5 A;  1WOL A;  5KMG B;  3EH2 A;  1SZI A;  1V4A A;  1R73 A;  4UUJ C;  1ZHZ A;  4U5H A;  2GAQ A;  5K1P A;  4MVU A;  4U9E A;  2YXH A;  2B5U A;  1TAE A;  1W0K G;  3OWT A;  1N8R W;  4DK1 A;  3CCJ V;  2XT9 A;  2QKC A;  5E3C A;  1M5I A;  2QKA A;  4PDR A;  3M4C A;  3B0U X;  4XPX A;  2EIM B;  2DW4 A;  2QTO A;  4IJJ A;  1Z5W A;  2YIB D;  2KC3 A;  2M4E A;  3W2V A;  2YQY A;  3OEH G;  1SF8 A;  3DE8 A;  2P6V A;  3JD1 A;  5EC2 C;  4JYA O;  2HV7 A;  1XZP A;  3GWL A;  3GM3 A;  4IB4 A;  3EGD A;  5KYN A;  3K5O A;  2XSE A;  3MDS A;  1P7B A;  3RQE A;  5EIB C;  3ML0 A;  3U3B A;  2HSQ A;  1HNW O;  4Q5S F;  1HW7 A;  1R6N A;  3DD7 A;  3DC6 A;  3ZHQ A;  2CNW A;  3ABM B;  3OT7 A;  5KYY B;  1SQX H;  3VBB A;  1KC8 W;  3HKK A;  1S5H C;  1DF4 A;  5GTI Z;  5KMG A;  3OTO B;  5IY5 C;  1VQL V;  4O6N A;  3L75 H;  4LDQ A;  3LUT B;  1XZQ A;  2CTW A;  3OEO A;  3MD0 A;  2YIB A;  3FMS A;  3S84 A;  2YL1 A;  2YEV A;  3ZS8 C;  4OD5 A;  1LNQ A;  2FML A;  3GEI A;  2LCH A;  1N36 B;  4DUZ O;  2WLK A;  2JD3 A;  2NUT B;  2H7B A;  4RUF A;  3CXC U;  2QM7 A;  4Z1V A;  3T4R A;  1B04 A;  2P0N A;  1VK5 A;  1OCR B;  3TUL A;  3K5L A;  1VLS A;  1XHZ A;  2QKS A;  3IC9 A;  2FL4 A;  5BXZ A;  3CRQ A;  4BIO A;  2GWW A;  2GUZ B;  2N74 A;  4DV0 O;  3B8M A;  4XEV A;  2OCH A;  4YXW G;  3OA1 A;  3QO7 A;  3AG2 C;  4JI6 O;  1NI8 A;  4NB5 A;  4TQD A;  4YJ3 A;  2OJQ A;  2R7Q A;  5C8Y A;  3NKE A;  1NBM G;  1XMQ B;  2XAS A;  1XUQ A;  3ZTZ A;  1QNM A;  4DVZ A;  3KZI Z;  1KKD A;  1LIH A;  3FYE B;  3RVZ A;  1XHX A;  2F1M A;  5KYU B;  3K1H A;  3HB3 B;  1QVX A;  2LFD A;  2XLH A;  4PFO A;  5AC4 A;  1A32 A;  2R9I A;  5KYY A;  1BGY H;  4FLU A;  3N2G B;  3UO2 A;  2NSG A;  1KMI Z;  5JT4 A;  2NNU A;  3U9J A;  2ZXW C;  1V55 B;  3DSQ A;  4L8J A;  4IWB A;  1NTM H;  2IM8 A;  2WL8 A;  4H54 A;  1J5E O;  3FOP A;  2QM8 A;  1I5N A;  2P61 A;  2IJK A;  3BEH A;  4QPJ A;  2Q0O C;  4TUY B;  3SP1 A;  2R70 A;  1I4Y A;  4J7Z A;  4OIQ F;  256B A;  3QG5 A;  3LLK A;  1ORY A;  2R03 A;  2WLL B;  2GUZ A;  2WLH A;  3RIP A;  1Q7Y W;  2H8A A;  1N33 O;  3UT5 A;  1GM5 A;  3SJQ C;  5IJ0 A;  1I94 B;  1H6G A;  2Q5Z A;  3ZMS A;  4DR6 B;  1MMA A;  1K4C C;  1W2B U;  2UUI A;  1XL4 A;  2OIE A;  3FVY A;  1JPX A;  1D5A A;  2CUG A;  3RYH B;  5DEC A;  4PDV A;  1ZHY A;  4JCZ A;  1IBK O;  4BJ5 A;  2EPL X;  3FB6 C;  4DR3 O;  3BRJ A;  4YJ2 A;  5KA5 A;  2WLI B;  5H6Q A;  1IBL O;  2M64 A;  5FCL A;  2KW3 C;  4PA3 A;  2F66 C;  3B29 A;  1YAU O;  2IOQ A;  3FAJ A;  3RQF A;  1DOV A;  3R2P A;  1ENV A;  1YIT V;  2DB4 A;  1MSD A;  3FHD A;  4I55 A;  3CC4 V;  5DVW A;  3JZ0 A;  3U3F A;  3BAB A;  2WB7 A;  1JA8 A;  5JH7 A;  2A69 F;  5F2V O;  5JCO A;  2Z3Y A;  3GVM A;  4NTF A;  4Z9J A;  1V9P A;  2ITC C;  4K0K O;  2HS5 A;  1MND A;  4R6Z A;  2CGO A;  4TWK A;  3K66 A;  1M56 C;  5JJN B;  2LQT A;  3ZJZ A;  1LS4 A;  2YKZ A;  4GEH A;  2EJR A;  1WJZ A;  2Q7E A;  1LM3 B;  2XLM A;  4YT8 A;  4JI1 B;  2XOK G;  4CIP A;  1K97 A;  1WN0 A;  5L0C A;  4MVO A;  4AE4 B;  2E76 B;  5LYJ B;  3IQ5 A;  2LIG A;  2KG7 A;  4FX5 A;  5JVD B;  1T5O A;  2PFD A;  2ZM6 B;  2KK1 A;  2A0L A;  5FL7 G;  3K57 A;  1ZZP A;  2WLI A;  1BCC H;  1OCO C;  3EFO B;  2E5L B;  1GTO A;  4FFB B;  1MSW D;  2A6H F;  1FKA O;  1EM1 A;  3GAN A;  4DR1 B;  2Z0A A;  3MX3 A;  3HJC A;  5A6A A;  4W8P A;  2WLM A;  1ZVZ A;  2L81 A;  1E86 A;  1OV9 A;  1K8A W;  5L3V A;  3LSS A;  4IAR A;  1BE3 H;  2IJH A;  5B1A B;  2XM4 A;  1HW2 A;  1T6Q A;  5KHJ A;  3J80 N;  3CPW U;  2ITD C;  2RCV A;  3VQV A;  1OW7 A;  2JEU A;  3RYF A;  1H2G A;  1H2K A;  4DV3 B;  3LDD A;  5AC5 A;  2IXN A;  3CS5 A;  3GOD A;  1NVP D;  3MHH C;  1EKY A;  4PV1 B;  1PNL A;  4IYH A;  3RQG A;  2LFS A;  5B1N A;  4BR6 A;  1Q0F A;  3TQO A;  3M15 A;  2DWD C;  4MTX A;  4H0L B;  5LYJ A;  4GUN A;  1PD0 A;  1PD1 A;  1U97 A;  2Q68 A;  2XAG A;  3SXZ A;  1ZL8 B;  5LHG A;  4PJJ A;  2X0L A;  1FXV A;  2GDS A;  1Q43 A;  4LC1 A;  2BCC H;  1XNQ O;  4ULV A;  3JYC A;  2OQM A;  3LJB A;  3W7X A;  2EIK C;  1MMG A;  2LW1 A;  3OMI B;  4LFB B;  1A41 A;  2ZNI A;  3CD6 V;  2B1I A;  1YHQ V;  2XLV A;  4KNW A;  5L0I A;  1PP9 H;  5CA0 B;  4N06 A;  3UMI A;  4BAY A;  5EYP A;  1JR8 A;  3KG2 A;  2UU9 O;  4RWU A;  2ODM A;  1ZHX A;  4L6R A;  1KYO F;  1T6I A;  2IU3 A;  4JI0 B;  2IM9 A;  3LSU A;  4XDK A;  1SER A;  4DV6 B;  1VIB A;  3JAS B;  5B3S C;  2IXM A;  4YHH B;  2F23 A;  4X0R A;  1YIJ V;  3JSE O;  3J81 N;  4KC9 A;  3MYF A;  1KU2 A;  4EB6 A;  3W8H A;  5FNV B;  2XTA A;  3K04 A;  5LA6 A;  1WP7 A;  4FWV A;  1KKC A;  2L6H A;  4QI0 A;  4R32 A;  4J41 A;  4E0H A;  4F4B A;  3HLZ A;  2BTO A;  1H8E G;  3I4U A;  4D4X A;  1NTZ H;  1O9G A;  2V4D A;  1J8Y F;  4EWC A;  2YL0 A;  4C7U A;  2HJD A;  4JRZ A;  4KBL A;  2ICW G;  4BIZ A;  2F22 A;  1JR9 A;  3AK1 A;  4MTF A;  3QO8 A;  2QWQ B;  4WF9 V;  3HNJ A;  3PDM P;  5JS5 A;  4EIY A;  4W4L A;  1T6U A;  4C3D A;  1R4T A;  1XMO B;  4LF8 B;  3L1M A;  1J8M F;  3SYN A;  3JAK B;  5A9G A;  1EZJ A;  4R50 A;  3ZQY A;  1IXB A;  1XBL A;  1NBB A;  4AQY B;  4DR2 O;  1S5J A;  4I0X B;  5J2U B;  1CGO A;  2IH3 C;  1ZHT A;  4HE8 D;  3D8C A;  1YYJ A;  2VC9 A;  4NTX A;  3DI5 A;  4GX1 A;  1VQM V;  4ZIB A;  3FB8 C;  4UCS A;  2AZ0 A;  3CX5 F;  3G6E V;  1OR2 A;  3UO3 A;  1Y4C A;  1XNR O;  2EIJ B;  2ZE7 A;  1SA0 A;  5K0I A;  1VAR A;  5H6R A;  3EH1 A;  4GKK O;  4TV9 A;  4X62 O;  4JTC B;  4XDJ A;  3JAT B;  1FXK B;  1ZU4 A;  2BOB C;  4J80 A;  3EPV A;  2V3C C;  5KUM A;  2OTL V;  5KAF Z;  4I4T B;  1ZHW A;  2EPO A;  2J9U A;  2YLI A;  3CRC A;  1OXB A;  3FB7 C;  4HYO A;  2VQF O;  3ZHR A;  1YZC A;  1GKF A;  1Q6U A;  2PY5 A;  3NMJ A;  5DQT A;  1NR7 A;  4UCR A;  2V26 A;  2OJE D;  2UXB B;  3I55 V;  2BTQ B;  3ZIA G;  1U6H A;  1BT8 A;  3CZ6 A;  1BBH A;  1Y6X A;  3E35 A;  2R7T A;  5CA3 A;  2GV9 A;  3ETE A;  1G4U S;  2B0J A;  5CBF A;  1WTY A;  1GN3 A;  1XWJ A;  3B77 A;  3SPH A;  3H1H H;  3ZN0 A;  5A6B A;  4KHP B;  4LER A;  4MND A;  4FIP C;  3L34 A;  5B1O A;  1J95 A;  1FFT C;  2XXA A;  1JPJ A;  3CB2 A;  4PDL A;  4WFG A;  4YY3 O;  3CCU V;  4X64 B;  1LE2 A;  4E7S A;  3RWR D;  2Y3H A;  4R8C A;  1E2X A;  5T3T A;  3QTH A;  4DR5 O;  3IEE A;  3JT1 A;  1FR0 A;  1S05 A;  3CCM V;  2DYR C;  3JAT A;  4CH4 A;  1FXK A;  2E87 A;  3JSZ A;  1MG1 A;  4LF9 B;  3VQY A;  5IWA B;  3FKS G;  5H5N A;  1VQK V;  1QVF U;  5H9C A;  4NTB A;  4PK4 A;  1I5Y A;  4EFB A;  2EX3 A;  2DMX A;  3A11 A;  3WAQ A;  1VQP V;  1HNX B;  3ASN B;  2AHY A;  2ZT9 B;  3T4D A;  4QPK A;  1XIL A;  1MAB G;  3GEH A;  2H94 A;  2L35 A;  4BG0 A;  4RO2 A;  4PR9 A;  1YZA A;  2QR4 A;  3RYI A;  4D7S A;  4DR7 B;  4JI8 O;  1FMW A;  1YAR O;  3K3W A;  4Q4Z F;  4UCT A;  3JAL A;  3HNI A;  4R7C A;  1IVS A;  2HVJ C;  4FMT A;  4U7O A;  3OE7 G;  4JAU A;  3G4Z A;  3P3P A;  1F4N A;  1Q0M A;  2LQG A;  4Z9H A;  1PL0 A;  4G28 B;  1XEQ A;  1W0J G;  2W4M A;  5T1D B;  1NR1 A;  3DXR A;  3AG1 C;  4DUY B;  3AGT A;  4ONS A;  3ETQ A;  1D1B A;  2AP3 A;  1D0Z A;  1OW8 A;  1V74 B;  4CX9 A;  4FM1 A;  1G8X A;  4LNU A;  4NXM B;  1FJG O;  4LF5 B;  2HHH B;  1TFK B;  3S90 A;  2GTS A;  3P30 A;  4CS4 A;  3SPJ A;  3QVN A;  3I5P A;  3OTF A;  1G4W R;  4HBN A;  3B2E E;  1M90 W;  1NFO A;  1ROP A;  1TWH A;  1RM1 C;  3B0P A;  4LLC A;  4D4N A;  1CGN A;  4YL1 A;  5K1X A;  1Q86 W;  2HEP A;  3JYH A;  4K35 A;  5LXT B;  2F4V O;  3L8I A;  2A6E F;  2ZIO A;  5EHH A;  2VQE B;  1NG1 A;  2YXY A;  1OCZ B;  3JAW B;  1QLE B;  1PM9 A;  3VQX A;  2ZE5 A;  5CB4 B;  2J9B A;  1NU9 C;  2EIM C;  3KCX A;  4CS2 A;  1S72 V;  2WLN A;  4JE9 A;  4E4E A;  3LDC A;  3RF3 A;  1BL8 A;  4O2A B;  3G71 V;  2PX3 A;  1F7Y A;  2EIN B;  3MFN A;  1YDX A;  4MTO A;  4I50 B;  2P7V A;  3ABK B;  4OIR F;  2RNB A;  4OX9 O;  1ZW3 A;  1Z23 A;  1WLE A;  3L8J A;  3ICX A;  2F43 G;  2OG2 A;  1PCX A;  2QE9 A;  3N0T A;  1QQ3 A;  1HR0 O;  5F5F A;  4O4I B;  3DXJ F;  2L6L A;  3HKC A;  4EKW A;  2XAH A;  3CQZ A;  3ZRV A;  1TVK A;  1UG7 A;  1AJQ A;  2HKV A;  5KX5 B;  3T6J A;  2BE5 F;  1FMV A;  3IQ6 A;  4PFP A;  3U2L A;  3L72 H;  4CJG A;  2DN9 A;  1KUQ A;  2CW0 F;  1M57 C;  1XRE A;  4XEF A;  4CSA A;  3U5S A;  3B09 A;  4G0H A;  2TMV P;  3QW0 A;  1QLN A;  1WA8 A;  2QJ1 A;  3AG3 B;  5E33 A;  1AP5 A;  3KMI A;  2KQX A;  4DV2 B;  1ZX3 A;  5LOV B;  1LS1 A;  1D1A A;  4YIO A;  2W45 A;  2J7P D;  4PA9 A;  1VB5 A;  1OCR C;  4A2N B;  4WFA V;  5BR8 O;  3CC2 V;  5HSW A;  2F95 B;  1HDJ A;  4JTD B;  4X1I A;  3AK3 A;  4Q7C A;  3ZG1 A;  5IJ9 A;  3SR2 C;  1GK9 A;  2PI4 A;  4YIP A;  2LK4 A;  3KKY A;  5HFM A;  1JQ0 A;  1K04 A;  1WAS A;  2CCY A;  2OEX A;  4E7Z A;  2QWO B;  3LNN A;  1KP3 A;  4JAS A;  1Z5Z A;  3TK0 A;  3ETG A;  1W2W A;  4O4I A;  3CCS V;  4LWS A;  5B1B B;  1K5Q A;  1QCE A;  3OFN G;  1A7E A;  5BUO A;  3ITF A;  5LMU B;  4PA4 A;  1BHA A;  1M2V A;  1YCI A;  2EPM X;  2J7P A;  1V55 C;  3U9M A;  5E79 Z;  2GFH A;  5IYC O;  1HW1 A;  1UFI A;  2QWN B;  5LHH A;  1G4Y B;  4CZZ A;  2JGD A;  2Y69 B;  4P9P A;  5GPG B;  3AGU A;  4I1M A;  3EGD B;  4YL3 A;  5GW7 A;  2D3O W;  2Y3G A;  2IYL D;  2OCC C;  2UUA B;  5AG2 A;  3DC5 A;  3VQW A;  2V7Q G;  5CI9 A;  2CAZ C;  4O4L A;  4RD9 A;  5FPR A;  2DE0 X;  3E22 A;  4GYC B;  4ABM A;  2RD9 A;  2KJG A;  2A7W A;  1S0V A;  2YID A;  1GM7 A;  1Q8I A;  1BZK A;  4FLT A;  4X1K B;  1OR3 A;  2HR3 A;  2UUB B;  5IYZ B;  3EVK A;  4O7G A;  5B66 Z;  4OIN F;  3RVY A;  1BHB A;  2JX0 A;  4ER9 A;  5BQH A;  1HE9 A;  4ZHQ A;  5DS4 A;  1RPO A;  1L7C A;  3T1Y B;  4DBQ A;  5GON A;  2LO1 A;  2HVK C;  2HMZ A;  4FFK A;  2QTS A;  3U2M A;  2CNW D;  2DI3 A;  2L7A A;  2CGN A;  5LP6 A;  2YEV B;  3SXK A;  2A06 H;  4EBK A;  4B7E A;  3D3Q A;  4U5D E;  1L0L H;  3G67 A;  2WWW A;  1DK1 A;  1NU1 H;  4JI4 O;  3DTU B;  3D36 A;  3ZSU A;  2Q7R A;  1K05 A;  3C8G D;  4LFA O;  4JCH A;  4LF4 B;  1JPN A;  4ICG A;  3TJ5 A;  3C62 A;  4KXR A;  1TQG A;  1GGQ A;  2NUP A;  4O4H A;  4YJ3 B;  1P49 A;  2ETN A;  3UCS C;  2LP4 A;  2N05 A;  1I0H A;  5C8Y B;  3UGP A;  4BJ6 A;  4UB6 Z;  1NS1 A;  1TWA A;  2XLW A;  1ZSP A;  2EBO A;  3L71 H;  3ZQV A;  4X1K A;  1VQN V;  2EPK X;  4XWJ A;  3AJM A;  5IYZ A;  3HTK C;  3SXY A;  4B3R B;  2IJI A;  1IBM B;  2ASR A;  5GTH Z;  4CH6 A;  1T9K A;  4B6I A;  5A6J A;  2QWR B;  1HNZ B;  4JEA A;  4E17 A;  4FAP B;  3OEE G;  4CIH A;  4C7O A;  3TCU A;  1FTS A;  4QGP A;  4CC6 A;  3C8G A;  4NKG B;  3T2M A;  4H4K C;  2OKU A;  1GAX A;  3LS1 A;  3JAM N;  2Q4P A;  4J9Y B;  2XL4 A;  1Z5V A;  1HE1 A; 
#chains in the Genus database with same CATH homology
 4WFB V;  1K9M W;  4P6I C;  2JJ1 G;  2ZR3 A;  1OCC B;  1K92 A;  5B1A C;  5IYB O;  1YJ9 V;  1NJI W;  3K06 A;  3ASO B;  5CBG A;  1M1K W;  2R7U A;  2WLJ A;  3K0D A;  2ZXP A;  3OUF A;  4K0D A;  4PA7 A;  4DO2 A;  3OGC C;  2P7T C;  4DBR A;  3WG7 B;  4QI2 A;  2OT5 A;  2DYS B;  1V54 B;  1ZU5 A;  3LNM B;  1NH2 D;  2Y3D A;  3DGE A;  1K33 A;  4JYC A;  3RKO F;  4CS7 A;  2Q9C A;  2QTV A;  4P2Z A;  2DGJ A;  3UMK A;  4PJM A;  3EHB B;  5LGU A;  3E2E A;  1M9N A;  2J9V A;  2IXP A;  1RJ9 A;  2WVO A;  4NY3 A;  2O9X A;  1Q82 W;  2G62 A;  1KEC A;  3W7W A;  4XDL A;  2ZDI C;  1AI5 A;  4MSW C;  3S27 A;  4GYT A;  3OAA G;  1OZ0 A;  2R7R A;  2H7O A;  2B1G A;  3ETD A;  1OKK A;  3NRH A;  4U5G A;  1S3J A;  1MMN A;  4MW3 A;  3S0X A;  1K5S A;  3X1O A;  3ABL C;  1NKD A;  3NYJ A;  5CI8 A;  3UKM A;  4X8A A;  2JJ2 G;  3CCL V;  2WZG A;  2J45 A;  2JDI G;  1KD1 W;  5L3E A;  1D1C A;  3B9Q A;  3F47 A;  3G4S V;  1QBZ A;  2VB6 A;  3EQL F;  3PHF 2;  1NVP B;  2Y39 A;  2A79 B;  2I8B A;  1R3I C;  2J9W A;  2PF4 E;  1AI6 A;  1RPR A;  3ZRX A;  2ZXR A;  3JD3 A;  3SPI A;  1E1R G;  3E9V A;  3E8F A;  2A1D D;  4GX5 A;  4G7H F;  4KP4 A;  5LBQ A;  3JD0 A;  5E3A A;  3X2Q B;  5KUK A;  3K03 A;  1GM9 A;  1K7D A;  3EZH A;  4XLP F;  1AJN A;  2ZXW B;  2R7O A;  2D5R B;  4MVZ A;  4GX2 A;  4JGS A;  3BY6 A;  1PNK A;  2KGO A;  1F23 A;  3H65 A;  5BZB A;  5L3Q A;  5L3G A;  4JJG A;  5EBW C;  5L3B A;  2M7W A;  3H01 A;  5EC1 C;  2X6A A;  4YWQ A;  1S77 D;  2UXX A;  2C03 A;  1OCZ C;  3M1C B;  4AX2 A;  3JD2 A;  2XXA B;  3WOD F;  4BEJ A;  3IFX A;  5EBL C;  2H7V C;  3W7T A;  4JYB A;  4YT5 A;  3ABK C;  1Z6A A;  3CC7 V;  1Z63 A;  5C93 A;  4DVY P;  4U5F E;  4U5E E;  3AQB A;  4UVA A;  2MK3 A;  1ORQ C;  1S7Z A;  4JZA A;  1M2O A;  4W8K A;  1TUE B;  2LSE A;  4OD4 A;  4ASU G;  4WFH A;  4YN0 B;  3CYO A;  3W7U A;  2XND G;  1P4R A;  4QDL A;  1OCO B;  2QA4 V;  5E1A C;  4PA6 A;  1TWG A;  2W9Y A;  4X89 A;  2MWQ A;  3ZRW B;  4DOZ A;  5KYX A;  3E89 A;  3MLG A;  1BR2 A;  4QIW F;  2JK5 C;  1CEZ A;  2DQ0 A;  3ZVR A;  3F7Y C;  3B0V C;  3EHM A;  4RQE A;  4QNH B;  1Z3I X;  1YJW V;  4J32 B;  2G3K A;  3UR3 C;  2KQ9 A;  3SYO A;  1TR2 A;  3IGA C;  4K7B A;  2XRH A;  4TSF G;  3SYC A;  2EIK B;  4RAI A;  2KNH A;  3ZIB A;  3SYP A;  3ZRW A;  3LNR A;  2NG1 A;  1VQO V;  2CDQ A;  5LGT A;  3F5W C;  1FFH A;  1PNM A;  2W6I G;  1R3K C;  2J0W A;  2W6J G;  1O87 A;  1ARO P;  3CME V;  3SYQ A;  3DM5 A;  1LVK A;  3CSK A;  5T3W A;  4ZBM A;  3CCR V;  4F4L A;  3JRT A;  5E2Q A;  5DN6 G;  2EIL B;  1H38 A;  4J9Z B;  2ZD9 A;  3FB5 C;  1R6K A;  2R7V A;  4JJF A;  5F5H A;  3LEV A;  3STL C;  4YT2 A;  3CMA V;  3VYW A;  1THZ A;  4BW5 A;  4PEL A;  3ABM C;  2W4B A;  2V1D A;  4KUM A;  3ABT A;  1QR8 A;  1M2V B;  1H8H G;  4MVM A;  1IZM A;  2EZP A;  1SMY F;  2X51 A;  1K34 A;  3NYM A;  2GSM B;  5DM6 V;  2NLJ C;  1IW7 F;  2WZL A;  3ZC4 A;  1OCC C;  3QO5 A;  4LCU C;  3OW2 U;  4MVR A;  3EGX A;  3DJU B;  1BR1 A;  1GMG A;  4C3B A;  5CBH A;  5L3D A;  5IYD O;  4BJ5 C;  2GHY A;  4GCZ A;  3DAG A;  4G7O F;  1Y66 A;  2DYR B;  3WG7 C;  1QR9 A;  2DYS C;  3V7O A;  4U7N A;  1V54 C;  2W0F C;  4LP8 A;  2IH1 C;  2K1E A;  3VAY A;  3KL4 A;  2NUP B;  3OM3 B;  3W2W A;  4LLE A;  2HG5 C;  4O6Y A;  3P32 A;  4MW8 A;  3AG4 B;  3WFV A;  1DLB A;  1O5H A;  1KP2 A;  2FTK A;  1K4D C;  1HWY A;  1VQ5 V;  3TD7 A;  2PX0 A;  2DQ3 A;  3K7D A;  4RBN A;  4C7O B;  2J46 A;  3N2Z B;  4H33 A;  2C04 A;  2VAS A;  4OIO F;  5DS6 A;  3E8B A;  1CP9 A;  1VQ7 V;  5KYW A;  2DWE C;  1ST6 A;  3NYL A;  1VQ9 V;  2HV6 A;  1R3J C;  4Z1M G;  1DTO A;  3OMA B;  3E70 C;  3ZMT A;  2IXO A;  3R65 A;  2Q69 A;  4IAO A;  4HZ3 A;  1I5X A;  2WAM A;  3NKD A;  3CCQ V;  3B8N A;  4ZLC A;  1PKX A;  4CS9 C;  3CCV V;  2Q67 A;  4MVQ A;  1QZX A;  4U5B E;  4JW1 A;  3GB7 C;  1R3L C;  3SZR A;  2X6B A;  4FPP A;  1E1Q G;  1ZWI C;  4MTG A;  1SZT A;  4FES A;  3K79 A;  1JX9 A;  2VH3 A;  5DQZ A;  4O79 A;  1JOY A;  3RFY A;  1M57 B;  1SRY A;  3FYI B;  2Z5U A;  1VMA A;  3ZRS A;  1RJ9 B;  1TWC A;  4M63 A;  3FDQ A;  3W8I A;  2XAF A;  3E8G A;  1D0X A;  1NZE A;  4CS8 C;  3NXS A;  4XLN F;  3OR6 C;  1YJN V;  1NH2 B;  4PDM A;  3SPG A;  4UV8 A;  4PJN A;  4MVS A;  3LS0 A;  4N21 A;  2HFE C;  3CP1 A;  1VYI A;  2WZF A;  3SEO A;  2R7W A;  3ZN1 A;  1VQ8 V;  1F4M A;  2CK3 G;  3X2Q C;  3DJN B;  3SYA A;  2Q3T A;  1YI2 V;  2OTJ V;  3LAY A;  3DAF A;  1OKK D;  2PI5 A;  3E86 A;  3K33 A;  2NUT A;  2X7R B;  1PD3 A;  2Q9A A;  1K3E A;  1VYK A;  2OCC B;  3AEI A;  1GO3 F;  3L0I A;  4BIU A;  2PP4 A;  4YT4 A;  4ZLD A;  5KA6 A;  5D92 A;  3EFF K;  4OXS A;  1SET A;  4ANJ A;  5CN0 A;  3N24 A;  2Y48 A;  4RQF A;  5L3F A;  1MMD A;  4G7Z F;  2AHZ A;  4DXW A;  1K73 W;  4CBC A;  5KYU A;  3EZI A;  4HEA J;  1WGW A;  1JCH A;  1YSC A;  4O6M A;  1BMF G;  4BJ1 A;  4GX0 A;  2EIJ C;  4I44 A;  2QY9 A;  3QZC A;  1VQ4 V;  1FXK C;  4UVB A;  3UGO A;  4RUE A;  3M99 B;  3JCZ A;  2R7S A;  4X88 A;  1N1C A;  2WLL A;  3F46 A;  3ECS A;  3O6X A;  1AR1 B;  4Q20 A;  2ZR2 A;  5IY5 B;  2P67 A;  1VQ6 V;  1D0Y A;  3UM7 A;  3LES A;  3JCU Q;  4C3E A;  1BR4 A;  4WFE A;  2QEX V;  4I3M A;  4FJC C;  3QMK A;  2FGY A;  2XAQ A;  5EBM C;  3STZ C;  3AG2 B;  1S76 D;  3OR7 C;  3T4Z A;  5HFL A;  3ASN C;  4G2K A;  4ULW A;  2YHS A;  4N23 A;  3S29 A;  5D91 A;  4AE4 A;  3Q7G A;  1FXH A;  4RDA A;  4XTK A;  4JVS A;  1EFR G;  4I1O B;  1Y4M A;  4CS9 A;  4EBB A;  1JJ2 U;  1NQT A;  2P6J A;  5L3C A;  1AJP A;  3QNE A;  3EFO A;  2A68 F;  4XBF A;  2LFR A;  3LDE A;  3KH2 A;  3T6B A;  3ABU A;  3OUS A;  3AQC A;  3RYL A;  4CSA C;  1QLE C;  3IC7 A;  1YTF B;  3SNH A;  1MNE A;  4CS8 A;  3RH3 A;  2HJF C;  2YZS A;  3LLI A;  4G27 B;  3I5Q A;  1YTF D;  2EIN C;  2J0X A;  3E83 A;  4HFK B;  3D3I A;  2EIL C;  2IU0 A;  3I56 V;  2CGE A;  1SES A;  3ZMU A;  5KYX B;  3GWO A;  1M56 B;  4OIP F;  1Q81 W;  2X6C A;  1L1F A;  2WVQ A;  4GT1 A;  2MYS A;  1FS0 G;  3O39 A;  3ABL B;  5CMU A;  3ZCC A;  4ZKI A;  2WPD G;  1OHH G;  2L9J A;  2A9H A;  1NU7 D;  3AG3 C;  2QE7 G;  4P9O A;  4CBE A;  5LGN A;  4AK9 A;  2ZDI A;  3W7S A;  4U5C E;  3S28 A;  4JAV A;  3VOU A;  2R9R B;  4UVC A;  2ZXO A;  3RW0 A;  5EGY A;  4E2L A;  2YSU B;  3K6B A;  3EJN A;  2P90 A;  4LAC B;  2FFH A;  5J9P C;  2BOC C;  5B1B C;  3A0R A;  1IXM A;  2UXN A;  2JEX A;  1TKN A;  4P30 A;  3RBZ A;  3EG9 B;  4KFM A;  4QJF B;  1DF5 A;  3SPC A;  2Y69 C;  2IJJ A;  4JTA B;  3PMR A;  2WVN A;  4KNV A;  4BJ6 C;  3TK1 A;  3AG4 C;  4MT8 A;  3K9A A;  3DZA A;  4I5S A;  3T1C A;  2KB1 A;  5B3S B;  4PJL A;  2HKO A;  2ZQM A;  2R7X A;  1G8M A;  4J30 B;  1MOF A;  4TT3 G;  3CCE V;  3UNG C;  3EG9 A;  4WJ0 A;  3K08 A;  5DLJ A;  3E8H A;  1COW G;  2G3V A;  4JF3 A;  5LHI A;  4JPR A;  3HPL C;  2H8P C;  3EGX B;  3Q6N A;  1KQS U;  2EZO A;  1GM8 A;  4HAM A;  4QE7 A;  3K0G A;  3NG1 A;  4HFF B;  2LP7 A;  2Y3B A;  2HLD G;  2Q6A A;  3NDB B;  1LKX A;  2IW5 A;  2C2A A;  5IDJ A;  1XL6 A;  4UXN A;  5EK0 A;  4WCE V;  4FK5 C;  4UV9 A;  3JD4 A;  3OMN B;  4I9W A;  4MQ9 F;  4KI2 A;  3MHS C;  4QE9 A;  1UJW B;  4IRU A;  1AI7 A;  1QVG U;  2Q9B A;  3K1I C;  3ASO C;  1FFT B;  1JVM A;  2Z15 A;  4JUR I;  1CPY A;  3DM9 B;  5KYW B;  4WFF A;  3ZMZ A;  4H37 A;  3EHN A;  4MS2 A;  1F51 A;  3POV A;  1AI4 A;  4BJT A;  3F7V C;  2ZPA A;  4YJW A;  2WSS G;  3PJS K;  1B6Q A;  4L87 A;  1WPX A;  3DMD A;  2ATK C;  1ZYR F;  1VOM A;  3Q7L A;  3Q6M A;  1EBO A;  3KKB A;  3AG1 B;  5DS5 A;  3ZMV A;  1E79 G;  3TET A;  2XAJ A;  3LSQ A;  3UMH A;  2JIZ G;  4LBE C;  1RM1 B;  3EH2 A;  1SZI A;  1R73 A;  4UUJ C;  1ZHZ A;  4U5H A;  4MVU A;  2B5U A;  1W0K G;  3OWT A;  1N8R W;  3CCJ V;  5E3C A;  4PDR A;  3B0U X;  2EIM B;  2DW4 A;  2QTO A;  4IJJ A;  2M4E A;  3W2V A;  3OEH G;  1SF8 A;  2P6V A;  3JD1 A;  5EC2 C;  2HV7 A;  3EGD A;  5KYN A;  2XSE A;  1P7B A;  3ML0 A;  4Q5S F;  1R6N A;  3DD7 A;  2CNW A;  3ABM B;  5KYY B;  3VBB A;  1KC8 W;  1S5H C;  1DF4 A;  5IY5 C;  1VQL V;  4O6N A;  3LUT B;  3OEO A;  3MD0 A;  2YEV A;  4OD5 A;  1LNQ A;  2WLK A;  2JD3 A;  2NUT B;  2H7B A;  4RUF A;  3CXC U;  2QM7 A;  3T4R A;  1VK5 A;  1OCR B;  2QKS A;  3B8M A;  4YXW G;  3OA1 A;  3QO7 A;  3AG2 C;  2R7Q A;  3NKE A;  1NBM G;  2XAS A;  4DVZ A;  1KKD A;  3FYE B;  3RVZ A;  5KYU B;  3K1H A;  3HB3 B;  4PFO A;  2R9I A;  5KYY A;  2NNU A;  2ZXW C;  1V55 B;  4IWB A;  2WL8 A;  2QM8 A;  2IJK A;  3BEH A;  4QPJ A;  3SP1 A;  4OIQ F;  3LLK A;  2WLL B;  2WLH A;  3RIP A;  1Q7Y W;  3SJQ C;  1MMA A;  3ZMS A;  1K4C C;  1W2B U;  1XL4 A;  3FVY A;  1JPX A;  4PDV A;  1ZHY A;  4BJ5 A;  3FB6 C;  5KA5 A;  2WLI B;  5H6Q A;  5FCL A;  2KW3 C;  4PA3 A;  2IOQ A;  3FAJ A;  1ENV A;  1YIT V;  3FHD A;  3CC4 V;  5DVW A;  2WB7 A;  2A69 F;  2Z3Y A;  2ITC C;  1MND A;  4R6Z A;  4TWK A;  3K66 A;  1M56 C;  3ZJZ A;  4GEH A;  2EJR A;  4YT8 A;  2XOK G;  1K97 A;  4MVO A;  4AE4 B;  4FX5 A;  2PFD A;  2A0L A;  5FL7 G;  2WLI A;  1OCO C;  3EFO B;  1GTO A;  2A6H F;  1MSW D;  3GAN A;  3MX3 A;  3HJC A;  2WLM A;  2L81 A;  1K8A W;  5L3V A;  3LSS A;  2IJH A;  5B1A B;  3CPW U;  2ITD C;  2JEU A;  1H2G A;  3LDD A;  2IXN A;  3GOD A;  1NVP D;  3MHH C;  1PNL A;  2LFS A;  5B1N A;  2DWD C;  4MTX A;  1PD0 A;  1PD1 A;  2Q68 A;  2XAG A;  5LHG A;  4PJJ A;  2X0L A;  1FXV A;  4LC1 A;  3JYC A;  3LJB A;  3W7X A;  2EIK C;  1MMG A;  3OMI B;  3CD6 V;  2B1I A;  1YHQ V;  4KNW A;  4N06 A;  3UMI A;  4BAY A;  3KG2 A;  1ZHX A;  2IU3 A;  4XDK A;  1SER A;  5B3S C;  2IXM A;  4X0R A;  1YIJ V;  4KC9 A;  1KU2 A;  3W8H A;  3K04 A;  4QI0 A;  4FWV A;  4F4B A;  3HLZ A;  1H8E G;  3I4U A;  4EWC A;  1J8Y F;  4KBL A;  4BIZ A;  4MTF A;  3QO8 A;  4WF9 V;  4C3D A;  1J8M F;  3SYN A;  1EZJ A;  4R50 A;  1ZHT A;  2IH3 C;  4HE8 D;  4GX1 A;  1VQM V;  3FB8 C;  3G6E V;  2EIJ B;  5H6R A;  3EH1 A;  4JTC B;  4XDJ A;  1FXK B;  1ZU4 A;  2BOB C;  3EPV A;  2V3C C;  5KUM A;  2OTL V;  1ZHW A;  2J9U A;  3FB7 C;  4HYO A;  1GKF A;  5DQT A;  1NR7 A;  2V26 A;  3I55 V;  3ZIA G;  3CZ6 A;  3E35 A;  2R7T A;  5CA3 A;  3ETE A;  2B0J A;  5CBF A;  3B77 A;  3SPH A;  3ZN0 A;  4LER A;  4MND A;  4FIP C;  3L34 A;  5B1O A;  1J95 A;  1FFT C;  2XXA A;  1JPJ A;  4PDL A;  4WFG A;  3CCU V;  4E7S A;  2Y3H A;  4R8C A;  5T3T A;  3IEE A;  3JT1 A;  3CCM V;  2DYR C;  1FXK A;  2E87 A;  3JSZ A;  1MG1 A;  3FKS G;  1VQK V;  1QVF U;  5H9C A;  4PK4 A;  1I5Y A;  1VQP V;  3ASN B;  2AHY A;  3T4D A;  4QPK A;  1MAB G;  2H94 A;  4BG0 A;  4RO2 A;  1FMW A;  4Q4Z F;  3K3W A;  4R7C A;  2HVJ C;  4FMT A;  4U7O A;  3OE7 G;  4JAU A;  1F4N A;  1PL0 A;  4G28 B;  1W0J G;  2W4M A;  5T1D B;  1NR1 A;  3AG1 C;  1D1B A;  1D0Z A;  1G8X A;  3P30 A;  3SPJ A;  3I5P A;  1M90 W;  4LLC A;  1ROP A;  1TWH A;  1RM1 C;  3B0P A;  1Q86 W;  3JYH A;  2A6E F;  5EHH A;  1NG1 A;  1OCZ B;  1QLE B;  1NU9 C;  2EIM C;  1S72 V;  2WLN A;  3LDC A;  1BL8 A;  3G71 V;  2PX3 A;  2EIN B;  4MTO A;  2P7V A;  3ABK B;  4OIR F;  1Z23 A;  1WLE A;  2F43 G;  2OG2 A;  1PCX A;  3N0T A;  5F5F A;  3DXJ F;  4EKW A;  2XAH A;  3CQZ A;  3ZRV A;  1AJQ A;  3T6J A;  2BE5 F;  1FMV A;  4PFP A;  2CW0 F;  1M57 C;  4CSA A;  4G0H A;  1QLN A;  3AG3 B;  5E33 A;  3KMI A;  1LS1 A;  2W45 A;  1D1A A;  2J7P D;  4PA9 A;  1OCR C;  4A2N B;  4WFA V;  3CC2 V;  5HSW A;  4JTD B;  4Q7C A;  3ZG1 A;  1GK9 A;  2PI4 A;  5HFM A;  1JQ0 A;  4E7Z A;  1KP3 A;  4JAS A;  1Z5Z A;  3ETG A;  1W2W A;  3CCS V;  5B1B B;  1K5Q A;  1QCE A;  3OFN G;  5BUO A;  3ITF A;  4PA4 A;  1BHA A;  1M2V A;  2J7P A;  1V55 C;  2GFH A;  5IYC O;  5LHH A;  1G4Y B;  4CZZ A;  4P9P A;  2Y69 B;  4I1M A;  3EGD B;  5GW7 A;  2D3O W;  2Y3G A;  2IYL D;  2OCC C;  2V7Q G;  5CI9 A;  4RD9 A;  2KJG A;  1S0V A;  1GM7 A;  2HR3 A;  4O7G A;  4OIN F;  3RVY A;  1BHB A;  5DS4 A;  1RPO A;  4DBQ A;  2HVK C;  2CNW D;  2YEV B;  4U5D E;  2WWW A;  3DTU B;  3D36 A;  3ZSU A;  4JCH A;  1JPN A;  2NUP A;  3UGP A;  4BJ6 A;  1TWA A;  2EBO A;  1VQN V;  4XWJ A;  3HTK C;  2IJI A;  4B6I A;  3OEE G;  4CIH A;  4C7O A;  3TCU A;  1FTS A;  3T2M A;  4H4K C;  3LS1 A;  4J9Y B;  2XL4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...