1M57C

Structure of cytochrome c oxidase from rhodobacter sphaeroides (eq(i-286) mutant))
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
265
structure length
265
Chain Sequence
AHAKNHDYHILPPSIWPFMASVGAFVMLFGAVLWMHGSGPWMGLIGLVVVLYTMFGWWSDVVTESLEGDHTPVVRLGLRWGFILFIMSEVMFFSAWFWSFFKHALYPMGPESPIIDGIFPPEGIITFDPWHLPLINTLILLCSGCAATWAHHALVHENNRRDVAWGLALAIALGALFTVFQAYEYSHAAFGFAGNIYGANFFMATGFHGFHVIVGTIFLLVCLIRVQRGHFTPEKHVGFEAAIWYWHFVDVVWLFLFASIYIWGQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The X-ray crystal structures of wild-type and EQ(I-286) mutant cytochrome c oxidases from Rhodobacter sphaeroides.
pubmed doi rcsb
source organism Rhodobacter sphaeroides
molecule tags Oxidoreductase
molecule keywords CYTOCHROME C OXIDASE
total genus 97
structure length 265
sequence length 265
chains with identical sequence I
ec nomenclature
pdb deposition date 2002-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00510 COX3 Cytochrome c oxidase subunit III
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1m57C01
1.20.120.80 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 1m57C02
2H8PC 2Q68A 4MTFA 3IFXA 4X88A 2IH1C 3OR7C 3RW0A 3SPJA 4JTAB 5EC2C 4WFEA 2K1EA 5KUKA 2WLNA 3STLC 4MW3A 4MW8A 4PDMA 3SYCA 2ZD9A 2Q67A 2X6CA 5EK0A 3AG4C 3OR6C 2Q6AA 4JTCB 3T4DA 3ABLC 4GX1A 4MVQA 4RUEA 3STZC 5EBLC 1KKDA 3LUTB 2WLIA 3K04A 4EKWA 1G4YB 3LDDA 4X89A 2A0LA 1P7BA 2HG5C 3E86A 2EIMC 2HVKC 4LBEC 4RO2A 3RVYA 4PDRA 3JYCA 3FB6C 4UUJC 2EINC 3AG3C 3E8HA 2WLMA 2Q69A 3SPHA 3WG7C 1JVMA 1R3IC 2WLKA 2WLJA 4DXWA 3K06A 3UKMA 1ZWIC 2HVJC 3K08A 4MVUA 3FB5C 4PDVA 4MTOA 3ASNC 4MVMA 4PA7A 2A9HA 1R3JC 3F7YC 2P7TC 5CBHA 2NLJC 2DYRC 3K03A 2EIJC 2EILC 3HPLC 4G28B 4P2ZA 5IY5C 1V55C 3ABMC 3GB7C 3IGAC 4H37A 2EIKC 2DWDC 3AG2C 2WLIB 1V54C 4MVRA 3ZRSA 2QTOA 4RUFA 4G27B 2BOCC 4PA6A 2AHYA 3LDCA 2ITDC 3SJQC 2IH3C 3K0DA 4J9ZB 1J95A 3SPCA 2R9RB 3E83A 4GX0A 1OCRC 4HYOA 4XDKA 2Y69C 4PA4A 2QKSA 3E8GA 4R8CA 3T1CA 1FFTC 4OXSA 4F4LA 4P9PA 2DYSC 5KUMA 4H33A 3ASOC 1M56C 5CBGA 1M57C 5B1BC 1R3LC 3TCUA 4WFFA 4KFMA 5J9PC 5BZBA 2OCCC 1BL8A 3PJSK 4ZBMA 4MS2A 5EBMC 3ZJZA 4BW5A 4PA9A 3AG1C 4PDLA 3VOUA 4R6ZA 5B3SC 2ZXWC 3OUFA 3RVZA 2WLHA 2HFEC 4WFGA 5CBFA 2ITCC 3LNMB 2W0FC 2WLLB 4PA3A 2AHZA 3TETA 4GX2A 2ATKC 2HJFC 3SYAA 3T2MA 1OCOC 3SYPA 4GX5A 3E8FA 1S5HC 4P9OA 4QE9A 4QNHB 3T4ZA 2DWEC 5EC1C 3F7VC 4R50A 2YEVA 3ABKC 3K0GA 3SPIA 3LDEA 3OUSA 4QE7A 4RAIA 1XL4A 3E89A 3EFFK 3RBZA 3SYOA 3FB8C 4JTDB 4J9YB 4TWKA 5B1AC 4R7CA 1QLEC 1R3KC 4X8AA 3UM7A 2X6AA 4LP8A 4MVOA 3SPGA 3SYQA 3KG2A 2KB1A 4HZ3A 4XDLA 1K4CC 3F5WC 4LCUC 4CBCA 2BOBC 5EBWC 3BEHA 1K4DC 1OCCC 2JK5C 1XL6A 1ORQC 3OGCC 4WFHA 1LNQA 3FB7C 4MVSA 2WLLA 4XDJA 2X6BA 4P30A 4MVZA 3R65A 4MTGA 3E8BA 2A79B 1OCZC 5E1AC 3X2QC 4I9WA 4MSWC
chains in the Genus database with same CATH superfamily
3CWBH 1LI5A 4EBJA 3CB2A 4X66O 2Q73A 3EQLF 4C7UA 4WFEA 4X1IA 2HJ3A 2RDCA 3DZAA 1VLSA 3A9CA 2XAQA 3BFRA 1SF9A 2YC0A 1GRJA 2ZD9A 4YHHO 2OEVA 3H65A 5GW7A 3ZMUA 2HMQA 1M9NA 2F22A 2P06A 5LGNA 1PM9A 3EVKA 1PL0A 5B1OA 5F2VO 3ZMZA 4EKWA 3W7TA 5IJ9A 1E85A 5KX5A 1SR2A 3B29A 2RNBA 2HHHB 3MLGA 3LEVA 3BCCH 2OJQA 2QY9A 2WLJA 4JI2B 3BABA 4DV4B 3B9QA 1GGQA 3UKMA 3N24A 1P7GA 4K0DA 4I50B 2FKXA 3CCUV 1EN5A 4PFOA 1GM7A 3GWOA 4JYBA 4AHCA 4XWJA 4WBNA 3ZC4A 1NR1A 4JGSA 1J5EB 1ENVA 1QU7A 2DWDC 2XAJA 4X66B 2WB7A 2VH3A 3FYEB 3KZIZ 3OTFA 2QTSA 4FZ0A 3O39A 3D36A 3E83A 4WCEV 1GN3A 1Y67A 1TKNA 1NTMH 4BR6A 2G38A 3S3XA 1Q43A 1Z63A 4H33A 4ZIBA 4G7ZF 5L3VA 3TCUA 3DSQA 1H9TA 4RD9A 4WFFA 4C3BA 4GCZA 5BZBA 4JV5O 1N36B 4O2BA 1HY5A 4E0IA 3ZHSA 4OD4A 2YIBA 3ZG1A 4E18A 2EJRA 5KYNA 1V55B 1FPOA 2LW7A 3K58A 2DGJA 5H2FZ 4BJ5C 4GKJB 3ABUA 4Q5SF 3CCEV 4QE9A 4U9EA 1KP3A 4F6RA 2ARHA 1CPQA 4X1IB 2YEVA 3OWTA 4IWBA 4JZ2A 3OFNG 2CGNA 2R05A 3K9SA 3EHBB 4TWKA 2ZXRA 3J81N 4DR7O 3UM7A 4U3JA 1SZXA 3OGIB 2LGWA 2ZNIA 1E84A 5EZYA 3P3PA 3NRHA 1K8AW 2D2CB 1OR2A 3FB7C 2DJVA 4ZOLA 1J8YF 4FM1A 1KP2A 1PV3A 2L6GA 1S72V 5JP7A 2IBZH 3PN1A 4U5EE 1VEWA 3GWKC 1GM9A 2UXXA 2UU9O 4HEAJ 1YEWA 5AC4A 2B5UA 3RW0A 3SDLA 3C18A 2QWNB 4NTWA 3SPJA 4JTAB 4DR5O 1XHXA 2YXHA 4CJOA 2K1EA 1IBLO 3ITFA 3SXZA 2TMVP 1XZPA 3AQCA 4B3RO 2X6CA 3TGUH 1T6UA 3W2WA 3MX3A 3CSKA 4KL1A 1N33O 2EULA 2CH7A 4EUKB 4AE4A 4EIYA 2P6JA 3JT1A 4DV1O 3E86A 3T4RA 2HJMA 2FL4A 2WLKA 4MT8A 4CDVA 1HNZO 1I7FA 2BE3A 2FTKA 1JJ2U 2OQMA 4PDVA 4MTOA 4JE9A 1NH2B 5LHHA 5DLJA 3LS0A 2W45A 2QE9A 2CE4A 4YIOA 1IXMA 3RF3A 1MMNA 1O5HA 3JYHA 3OD4A 4TSFG 2GSMB 1N32O 1D1CA 2H7VC 1M57B 3MYIA 3ABMC 3MHHC 1XMOB 1WATA 3FFQA 2YLIA 2PY5A 1AI6A 4J41A 3Q7GA 4CS8C 5CA3A 4XDKA 4YIPA 2N05A 2L35A 4LWSB 2OEXA 2DYSC 3NMIA 3G4SV 1NU7D 1LVKA 4AE4B 4U3FH 5LMNO 3JAWA 1TWAA 5LP6A 1BR2A 3HLZA 3SXYA 1KTMA 3BPZA 5GPGB 1VQKV 2WLHA 2XXAA 1Q0DA 5CBFA 4DV2B 3U3BA 4LF4O 3LNMB 4H44B 3NMJA 3TK0A 2OTLV 4JV5B 2YWAA 5KHGA 5H9CA 3AK1A 3Q6NA 4P9OA 1ROPA 1H8EG 4UCSA 2R7VA 3F7VC 3W2VA 3CZ6A 4D7TA 5LL6Y 3WAQA 2E3CA 3ABTA 1N32B 2UUCO 1C03A 1S3JA 2CNWD 5IT9N 2HV6A 4QI2A 5B5EZ 3C8ZA 2HKOA 2Q00A 1VQMV 4MVOA 2ZE8A 5EIBD 4XDLA 4FLTA 5JUAA 3W8IA 2NSFA 4CS3A 4WFHA 4K3AA 2QWRB 3QTCA 5H6RA 1KU2A 4O2AA 2H7BA 2Y3BA 2BE5F 4X62B 4N6CA 4W8PA 3K1IA 3R2PA 3LESA 3ZQVA 1PNKA 3SJBC 2DYRB 2VWJA 3G6EV 3STLC 4FLVA 3SYCA 4NC3A 1S05A 2LIGA 3DXRB 1EN4A 1Q3EA 1K33A 4DR4O 3RIPA 4IRUA 1MZFA 3STZC 3ZEDA 1PNMA 3K04A 1SQQH 4OIOF 2UUCB 1NBMG 4B7KA 2PUSA 3MAQA 4NXMO 5AGFA 4FX5A 1NFOA 1VQLV 4LF9O 2ZXOA 4ZLDA 1QZXA 2WZLA 4O4IA 1AILA 4JI7O 256BA 1Q7YW 4DBRA 3NKDA 3AG1B 1OCZB 4G7OF 1SZTA 1TAEA 2ZE7A 4X62O 3APOA 2HSQA 5IY5C 1N8RW 2M64A 5DVWA 2EIKC 2YI8A 2WLIB 3CCQV 3RGBA 2YEVB 2BOCC 4CDAA 2YLGA 4QDLA 3HNLA 4UCTA 4XLNF 1AVOB 4IJJA 1FFXA 1AR1B 3ASOC 1MNDA 1WN0A 1OKKA 1NSGB 4YJ3A 3CJHB 3SP1A 1FJGB 5KLVH 3U5SA 2ZR3A 3OEOA 3W4YA 3JD4A 2QWPB 5B3SC 4FESA 1ORYA 1L7CA 2AP3A 1ZU5A 4AQYO 4IHJB 5COMA 1S77D 1OHHG 3VBBA 1OV9A 4LF9B 2UUBB 5LMNB 1BT8A 5EYPB 3U10A 3EGXB 1A7DA 4O4JA 4DV2O 1I5NA 3K6BA 2R7TA 5CI8A 1ORJA 2LP7A 1UPGA 3M4BA 3U0CA 4XBFA 1K04A 3JSEO 3LJBA 4M63A 1GH6A 3JD2A 4RQFA 1ZAUA 3OMNB 4YY3O 4CSAC 1LM3B 3L70H 5LYJA 2XM0A 4YN0B 2XTAA 1NH2D 1NFNA 2GDSA 4JI0B 3ZDLA 4Z9JA 2I8BA 5JJJB 4B3SB 3FAPB 4TOIA 1PP9H 4XDJA 2Z0AA 3FAVB 4DUYO 1XNQO 3QVNA 1ZW2A 3JD1A 2M7WA 3N2KB 4RWUA 3C8GD 2LFSA 3JD3A 4JI1O 1VF5B 4U5HA 1S7ZA 2KQ9A 4BJ5A 3CRCA 4MTFA 5IJ9B 1BHAA 5DEDA 1NU1H 1JFFA 3JYYA 3D36C 1ZHYA 2B1IA 2XUMA 1JMKC 1E86A 1EQ1A 5B1AB 3E35A 3AK2A 3CXHF 4I1OB 5L3EA 2EX3A 2Q8VA 1GQAA 4LNUB 4UV9A 5J2TA 5EBLC 3CQZA 2R7QA 1HP8A 4X89A 2HSBA 4FJCC 2ZQMA 3O6XA 1D1BA 1ZZPA 3UT5B 4DV0O 5A9GA 2LGQA 5FZTA 2W9YA 4IAOA 3U8PA 2ZINA 4CDYA 1Q6IA 4TUYA 3L71H 3AG4B 3S3WA 2YKZA 5A2QN 1CGNA 1AP5A 1VQPV 1R3JC 3WB1A 4ZKIA 4FLWA 2NLJC 3SJAC 1US6A 3M99B 4C3DA 4GYTA 3NKEA 3MYFA 1JA8A 5KMGB 2L6FA 2ZXWB 5JQGB 1Q86W 1BSMA 4G27B 3ZX6A 2CGEA 1FFTB 3BRCA 3JAKA 4J80A 5BQGA 2BTOA 1URFA 1VQ6V 3CX5F 2LFFA 3E8GA 3MD0A 1O9HA 2B0HA 5IE9A 2DYSB 2ETNA 1XZQA 3DE9A 2JDIG 5CBGA 1FAFA 4JJFA 2ZDIC 3U0ZA 1I5YA 2EIJB 2ZE6A 2CUGA 4DV3B 3B0UX 4R6ZA 4FFKA 3P3NA 1HNXO 2E74B 3AJMA 2OT5A 2IYLD 3EFOB 4DW0A 1IDSA 1GTOA 3FAVA 4LFAO 2EPMX 2F23A 1T9KA 4TUYB 4B7EA 1Q5OA 2GTSA 1ZHTA 3HR0A 4CIHA 4EB6A 1YSCA 2XLEA 2JEXA 4CC5A 4KHPB 4G7HF 3M79A 1QR8A 1KD1W 2CW0F 3I56V 4Q20A 4IYIA 2KK1A 1QQCA 3FXHA 4Z9HA 2C2AA 1PD3A 3E89A 4CZZA 2ZIMA 1N36O 1R5ID 4DV7O 1I94B 3C3TA 4O2BB 4CS9A 1PD1A 2Y69B 3GANA 4X8AA 3ZRWB 4J7JA 4FM2A 3CC2V 4O79A 1JPXA 1Q8IA 2Y39A 3CCJV 2I15A 4OX9B 2WA3A 2F1MA 3AG2B 3TJ6A 1X59A 2JK5C 1XL6A 3KYIA 1M2VB 3CE2A 4DRXA 1G4WR 1DF5A 5A69A 1Z5ZA 2RCVA 3A0RA 3RYHA 3W8HA 5KYWB 1KKCA 2YL0A 2Q68A 2UUAO 1HNXB 1E2XA 4O6NA 4RBNA 1D1AA 2Y3DA 5TJ5E 4ZI7A 1K97A 4EB6B 3OMIB 1FD9A 2HR3A 1VLTA 2Q5ZA 3CMAV 2JGDB 4AL0A 2IXOA 2HFIA 1IXBA 4PHZA 4MTXA 1TWGA 2R9IA 4JEAA 2HG5C 2UXCB 4YJ3B 3VQYA 5F5FA 5K0IA 1B3QA 3SPHA 2RJZA 1APCA 4X20B 3FKSG 1M4UA 5IYZA 2VQFB 4I0XB 1JAFA 2UUHA 4E2LA 1KC8W 2FFHA 2WL8A 4PA7A 1EM1A 1XILA 5AG2A 3X2QB 1OCOB 1LUVA 3F7YC 2CTPA 1DLBA 3G80A 3Q7LA 2LFRA 1YJ9V 4LFCO 4BWAA 3CP1A 5KHIA 4E7SA 1XUQA 4LF5B 1VQNV 1V54C 5J2UA 3N2ZB 5LP6B 2XM4A 1H2GA 4L6RA 1JOGA 1NI8A 2ZNJA 4QI0A 4NXNB 5IDJA 1B06A 4ZI7B 4LF7B 1DF4A 1J95A 1SMYF 1YDXA 1FFTC 2CDQA 1N1CA 1RCPA 5KUMA 3GEIA 4X64O 2D3OW 3F46A 1DK1A 4UVBA 2EJ7A 4O7GA 2IXNA 3A8TA 1TWHA 3CAXA 3DMDA 4O4JB 3RVZA 2WVNA 3TJ5A 1F4NA 4HNAA 1IBMO 1D0ZA 1KMIZ 2NUTB 3K79A 2E5LO 2IXMA 4CJGA 1JMWA 3CS5A 4QPJA 2NUPB 3ZIBA 3HKEB 1HW2A 4CH6A 4DOZA 3JARB 4AI8A 1Q0GA 2YVKA 1D5AA 3N27A 2KKWA 3SPIA 3NG1A 4LFCB 4DR2B 1BMFG 3FB8C 1MSDA 1XNRB 3B71A 3GM3A 4JTDB 4X1KB 4NQFA 5F5HA 4KHPO 1NKDA 3K9AA 3OTOB 3Q6MA 2J0XA 1YI2V 3K66A 1CEZA 2QGNA 3K5OA 3ZN0A 5IYCO 3W7WA 1I94O 1ZHXA 2R7RA 2DN9A 3EG9A 2WAMA 1T5OA 3SYNA 2IOQA 5GTIZ 4I7ZB 1H6GA 2CNWA 4EWCA 5LP6C 3HNIA 3PCVA 4HFKB 2NSGA 4LLCA 3D8CA 1WP7A 3OW2U 1PPJH 2MWQA 3GWLA 1C17M 2WLNA 3NR7A 2OIGA 3H2UA 2JJ1G 5DECA 2IU0A 2IM8A 5FNVA 1VF6A 5DS6A 5BR8O 3LUTB 1TR2A 4JAAA 2Y4UA 1R4TA 3US6A 2LJ2A 5A6BA 3LSSA 5J2UB 4DR6O 3CRMA 1RSOA 1DOVA 4JYYA 3E8HA 2WLMA 2Q69A 2Q4PA 4ZLCA 3J06A 1JVMA 4MQ9F 1EBOA 3LLIA 5CN0A 3DGEA 2GBOA 2Q9CA 4ZHQB 1IZMA 2ASRA 3LAYA 1VMGA 3EH1A 1RP3B 4DR7B 1T6IA 3L75H 5CBHA 4AX2A 2OCCB 4B3TO 2Z15A 4ASUG 2J45A 2PF4E 2VQEB 4GKJO 5L0GA 5L0IA 4IAQA 4RUFA 3QO7A 1FXHA 1YJWV 1TFOB 3HNKA 4DO2A 4J7TA 1M1KW 3ZMSA 4LF6B 3K3WA 2QWQB 4FFBB 4LF5O 3SNHA 5EYPA 3TQOA 4FVMA 2H8AA 3K5NA 3RYIA 5J9PC 2VASA 3UO2A 5JCOC 3RT3C 3JTLO 3GVMA 1YZAA 2Y3GA 5A6AA 4BIOA 4A2NB 2P61A 5FCLA 1MABG 3N2GA 1BQZA 3GEEA 5KYYB 1YJGA 1OR3A 3BHPA 4LFBO 4ICGA 4JKVA 3H1HH 5LYJB 1S5HC 4KBLA 3RQFA 3T4ZA 4I44A 1MNGA 3GM1A 3HKBA 1ZYRF 3S9OA 3JCZA 1BBHA 3EFFK 3SYOA 2ADPA 4E0HA 3X1OA 4EFEA 1WB8A 3I5PA 1Q0KA 1JR9A 1VQ4V 1YARO 2E75B 3IEEA 4J11A 3BEHA 1K4DC 1E79G 1XNRO 5C93A 4Z2WA 1YYJA 3ZSUA 4OIQF 3A0HZ 1Q82W 5E1AC 3X2QC 3HNJA 2Y0PA 4YJ2A 4MSWC 2DI3A 3ZRVA 2X0CA 2JJ2G 1MA1A 2JGDA 2Q9AA 4JI5B 4P6IC 2QTVA 2OCHA 4K0KB 3U8VA 2XS8A 4LFBB 3DAFA 4DK1A 4BG0A 1CXZB 1QQ3A 1WPXA 5KHHA 1EN6A 3UMHA 1SS3A 1CGME 3T9OA 2W4MA 1VQOV 1L3PA 1QLEB 3JRTA 1NZ6A 4XQ1A 1G8MA 4RO2A 4DRJB 1BS3A 2YL1A 3GEHA 4YK5A 4FWVA 4B3MO 4HFFB 1FKAO 2NUTA 3T6JA 4K7BA 4LDKA 5E2QA 4BW9A 3NYJA 3CRAA 3RWRD 2LSEA 1KUQA 2VC9A 3QW1A 1T5EA 4P9TA 1IW7F 4CIPA 2D5RB 4CH5A 4BIUA 3PMRA 5L3DA 3DC5A 4JRZA 4HYOA 1P84F 3DI5A 1AR5A 4F4LA 2VQEO 2XLOA 5JWPA 1NTKH 2P1AA 4PJNA 2R7XA 3WFVA 3RYCB 1H9GA 2A6HF 1V4AA 1M57C 3RYFA 3RFRA 4QGPA 1L0NH 2EILB 1WGWA 3E9VA 1K5SA 2FAPB 4FK5C 4BJ6A 4W4KA 3ZHUA 3JCUZ 1HE9A 1NQTA 4WFGA 3JARA 3I5DA 1IURA 4PA3A 2N04A 3QNEA 3TETA 2YDEA 1RKCA 4XTKA 4GX2A 1I5XA 3H2VA 3JD0A 3K1IC 4AILC 4PFPA 3JAKB 1X4TA 1YJNV 2A3QA 2XLWA 3QZCA 2O57A 4U5FE 5KYXA 2A06H 3T6BA 3RYHB 2AXTZ 3JZ0A 4I55A 5FNVB 2XASA 1EKYA 5L3FA 2JX0A 1MG1A 3EG9B 3N0TA 1QSPA 4LP8A 2LQTA 1BGYH 3QMKA 5JJEB 4TV9B 2J7PA 2A6EF 2HS5A 3I4UA 2XL6A 4YL0A 4MTGA 2QR4A 2NNUA 1RM1B 2QM4A 4IHJA 1V54B 1R73A 1TUBA 1FYJA 1Q81W 2CAZC 2XS1A 1LS4A 1CPYA 5CA1A 4DBQA 3W7UA 2ZM6B 4OPAA 2WWWA 4JI3O 1FJGO 4NTYA 5DS4A 4MW8A 2RMKB 4KUMA 4UDVA 2V26A 3C3SA 3FDQA 1HW1A 1MMAA 1G5ZA 2HZ8A 3B09A 3LSUA 3DM9B 4J30B 1Y74B 2FYUH 1AJPA 3B0PA 1BR4A 4BJ1A 2J0WA 3AEIA 4QIWF 3T1HB 2YXYA 3EZHA 2ETSA 2UUAB 2QNLA 1WASA 3AQBA 2XSEA 2Q4FA 3EHMA 3DM5A 4N23A 1HNZB 3K06A 3GORA 1AI4A 2BSKB 3OE7G 1N0JA 4MVUA 1A0BA 2QEXV 2R7OA 3UQ8A 1ZHZA 3NXSA 1K40A 2HKVA 3ZHTA 1D2DA 3TOLA 1TUEB 3AG2C 3L34A 2F66C 1RM1C 1F7YA 1XNQB 2L6HA 3WU2Z 1OZ0A 2ITDC 3SJQC 2OG2A 4TQFA 2R9RB 1WLEA 4OXSA 3V5YA 1YITV 4DR3O 2VQFO 1AROP 5T3TA 3OEEG 5DS5A 1M56C 5IYBO 3E70C 5IY5B 2HP8A 4BEMJ 3NYLA 1RPOA 5LGUA 1BL8A 4ZBMA 1WPBA 4PA9A 1LE2A 4PDLA 1M2OA 2E87A 4YT2A 5L0HA 2ZXWC 2HFEC 3RKOF 3FOOA 3LEOA 4B3SO 2J7PD 2XT9A 2XNDG 1XEQA 4PJ0Z 3B2EE 2MYSA 2GHYA 3A0BZ 5LXTA 2UXBB 2HJFC 1MMGA 2PBEA 1Z6AA 1WTYA 5JVDB 3JASB 2ZCEA 2PFDA 2OKUA 4P9FA 4QNHB 1EZVH 2CTWA 1Z2GA 3A2FA 3EFOA 5HSWA 5FLXN 4DV6B 4D7SA 3CD6V 4L8JA 4RAIA 1QR9A 3D3QA 1THZA 2VRZA 1WP8A 3QF7A 4YJWA 2ODMA 4GKKB 1JPJA 3FAJA 2LQGA 3BAAA 4JZAA 2E5LB 5EBWC 3OGCC 2YUAA 3MFNA 1VF6C 4KXRA 1PD0A 1SYQA 3TD7A 1XREA 3FMSA 3ZRWA 1OCZC 1Q6UA 3CCVV 1Y4MA 4JASA 4CS2A 1HNWB 2FGYA 3GWNA 1HR0B 2H8PC 2GA0A 4X65B 5A6JA 1EFRG 4DR2O 1ZU4A 2OWOA 4D4NA 2W6IG 1NU9C 3FX7A 1YIJV 3CRRA 4JI6B 4TQDA 4NB5A 1MNEA 3JASA 3JSNA 1E1QG 3VF0A 1W2BU 4N6HA 2WZGA 2AVKA 2Q3TA 4Z9IA 4LDRA 1YLMA 3DKAA 3U9JA 2GWWA 4I5SA 4KNVA 4DV4O 2QE7G 3FD9A 1F51A 3DE8A 4DV6O 1SESA 1COWG 3HKDA 3LDDA 3ECSA 1UJWB 2ADQB 1HMOA 4MNDA 1WA8A 2EIMC 2HVKC 2W6JG 3C8GB 1V74B 5L0CA 3AG3C 3T1YB 2NPUA 5BXZA 3IC7A 2P90A 1XMQB 2P67A 2QKCA 1XBLA 1NVPD 1OQCA 3HTKC 2R70A 3ASNC 4BIZA 2HHHO 1H8HG 2DQ0A 1OW6A 4C3EA 5JS5A 2X0LA 1KBHA 3QTHA 3S0XA 4HBNA 5JVEA 3S84A 4X65O 1IX9A 2QUPA 3DC6A 2Z5UA 1UFIA 3G67A 4N06A 3K0DA 2MK3A 2OU6A 1SQVH 3E2EA 2XLMA 1SQFA 2AGAA 2LO1A 4DR4B 1HE1A 1LPEA 2QM7A 1J5EO 5B1NA 4DV5O 1VQ5V 1W2WA 3CSXA 5T3WA 1F4MA 4JYAB 1A41A 3ZTMA 2CGOA 1Q90D 4D6TH 1SQXH 2F43G 3C8GA 4DYLA 1MZEA 3ABMB 1O87A 1H2NA 3IQCA 4F4BA 4TV9A 2A69F 4OD5A 3L8JA 1Y66A 3BRJA 3WG7B 2A1DD 2V4DA 5CB4B 1OW7A 1GN4A 2J9VA 4J7YA 2B9ZA 1ORSC 1PL4A 4JYCA 2Q7EA 2UXBO 4NCQA 3C7JA 5L3BA 2KQXA 5KAIZ 1NR7A 3AG3B 2XLHA 5B3SB 1E1RG 2IXPA 4O4LB 5B1AC 4WGYA 4NTXA 5L3QA 3M4CA 2XRHA 4XEFA 3KG2A 3JALB 4E4EA 4DVYP 3U9MA 3QG5A 1SQGA 3G4XA 1QHTA 5K1XA 4BAYA 3ZHRA 4LF8O 4U5DE 5DQTA 3FYIB 2YRFA 4H0LB 2KYHA 1M6TA 4JI1B 5LMUO 1WWPA 3UCSC 4HE8D 1PCXA 2EBOA 3Q4HA 1OKKD 3QVYA 4GUNA 2XAFA 2A0BA 3HKCA 4CBEA 1YZBA 3OR6C 4JC7A 4FLYA 3ZBHA 5KAFZ 4X1KA 2PX0A 4JCZA 2WLIA 3ZMTA 1JCHA 2RD9A 3RVYA 4FMTA 4PDRA 1YVWA 1M2VA 2KSFA 3LS1A 3J80N 1JPNA 2B1GA 3H1IH 3WG7C 2L81A 1D0YA 4CH3A 1M5IA 1BR1A 1YTFD 2IU3A 2HVJC 2VS0A 1H2KA 1VMAA 4EHPA 2DQ3A 3OTOO 1IBMB 2J9BA 2MHRA 2XXAB 4Q6GA 5E3AA 1QNMA 3ETEA 4BEJA 2YICA 4CS4A 4UB8Z 5A6BD 1V55C 2EZPA 2L9JA 4I4TB 2NN4A 2QTOA 1DOWA 1R6NA 5KX5B 4CS7A 4FLUA 3AOUA 5IYDO 2IH3C 5GTHZ 1J8MF 2JIZG 4CSAA 4UCOA 2L6LA 3HKCB 3CCSV 2Z3YA 4ER9A 4NTFA 2RQ6A 4B3MB 4DRHB 3IQ5A 2JD3A 2Q7GA 4KC9A 1K9MW 4O4LA 3UR3C 4K8ZA 4CX9A 1U0BB 1RMVA 3ZMVA 1SC5B 3TXSA 4DV3O 2Q7RA 5L0JA 1AR4A 5C8YA 2LW1A 3M15A 3M1CB 2EZOA 4G0HA 4IB4A 1BZKA 4DJ9A 3L73H 5BR8B 1FR0A 2QJ1A 4AK9A 2ZPAA 4JI4O 4FIPC 1FMVA 2KC3A 2VCAA 1QLNA 3E8FA 1H38A 5DM6V 4DR6B 4LR3A 1VTMP 4OIPF 4UVAA 2JS3A 2OTJV 5KYYA 4ANJA 3NYMA 2JS5A 3K0GA 3VYWA 1BDJB 2XLVA 3L8IA 2PP4A 4J10A 1JR8A 1R3KC 2J8WA 2Q9BA 3SPGA 1NG1A 3M8AA 1CPRA 1YA9A 2ZR2A 3JATA 5B1BB 2HJDA 4C7OB 4PK4A 3F5WC 1GO3F 3RQEA 4JI2O 2R72A 2KG7B 1UFBA 4I3MA 5A6KA 4JI8B 3HB3B 1YZCA 1ORQC 1H7IA 1T6QA 3ZIAG 2PI4A 1VYIA 4MVZA 5KHKA 3N2GB 3E8BA 5CMUA 3ETGA 3ETDA 4F6RB 5C8YB 4FM0A 1BCCH 3BVOA 3IFXA 1XDCA 3KCYA 4UB6Z 3U3FA 3ZHVA 2JEUA 2XAHA 3ZRXA 4WF9V 4X1YB 1AP6A 2Q9LA 4PDMA 4A5UB 3JCUQ 3QW0A 4Q4ZF 5EK0A 2CTRA 5D92A 1NVPB 3LNNA 4QPKA 4PR9A 2RN9A 1W0JG 4KNWA 2X51A 2YZSA 3JAMN 4PJJA 3DJUB 1GK9A 2EIMB 1WN7A 2UXCO 1LR1A 3FB6C 2YS8A 4ULVA 1U96A 2AW9A 4CS8A 3DTUB 4CH4A 1Y6XA 4H54A 3LSQA 3CMEV 2P0NA 3FHDA 4NKGB 4HAMA 1A7VA 3UMKA 2ILMA 4MVMA 4JI8O 1HMDA 3IC9A 3U2LA 3OT7A 2V1DA 1YHQV 1TWCA 1S5JA 5JH7B 2LFDA 2KSDA 2ZE5A 4J9ZB 1P4RA 3VAYA 1I4YA 4DK0A 3L74H 2Y69C 3ETQA 1NT2B 2IJIA 2EPOA 4P9PA 2VWKA 1GMGA 2PX3A 2GDCA 3B40A 2YIDA 5LOVB 4IL6Z 2RSEB 3C62A 3VOUA 3IAYA 1G4US 2EPLX 3RFYA 3CC4V 1XHZA 3OUFA 4Z1VA 2UU9B 1QCEA 2WLLB 2QM8A 4C7OA 3P32A 2ATKC 4I50A 1GN2A 1SQPH 1Y76A 3SYPA 5BMVA 4DRXB 4IT5A 3S28A 3R66A 1JOYA 3UGPA 4B3RB 1M90W 2NR5A 1KQSU 1NS1A 2PNOA 4K1OA 3G6BA 5BQHA 1VF7A 4K0KO 4PJMA 2DW4A 1PV0A 3Q4HB 3CCMV 2VB6A 4DUZB 2B0JA 3K7DA 3V5XA 1GN6A 1RPRA 2EPKX 2OIEA 3JAWB 4J9YB 1I4ZA 2NG1A 5HFMA 3RH3A 2ICWG 1OCRB 1HWYA 1N34O 3EJNA 3SYQA 3RYCA 1XOUA 1BE3H 5KYXB 3D3IA 1SZIA 3C90A 4H13B 3C63A 3H9VA 2HUJA 3G50A 4UXNA 3R65A 1V9PA 3SR2C 2GTAA 1GS9A 3ASNB 1KNYA 5IJ0B 4X88A 4U5CE 1XMOO 2GV9A 3IHUA 3HKBB 1IBLB 1G1XB 4BJ6C 5BMVB 1SERA 3MHSC 5IYZB 4LH7A 5BQIA 1BHBA 2FMLA 4NTBA 3AG4C 4DV0B 1ZW3A 3DAGA 3LLKA 3L72H 4I4TA 3AK3A 1KKDA 2H7OA 2IJHA 5KA6A 5E33A 1EI7A 4DVZA 1R6TA 4YWQA 1QVFU 3B77A 3UNGC 4L87A 2C04A 2BCCH 1H2MA 4KI2A 1GM5A 5E3CA 2P4KA 3K5LA 3DJNB 3S90A 2YQYA 4B08A 1ZWIC 2QKAA 4JI6O 4FLXA 3O55A 4JVSA 4UFZA 1RJ9B 1RXQA 3P30A 2QSAA 4R32A 4E7ZA 3AG7A 5KYUA 1FMWA 2XLDA 3K03A 2OJED 3EPVA 4FZ1A 5EGYA 1RKEB 1OCCB 4XLPF 5LHIA 3ASOB 2P22C 1I08A 3DXJF 4O4HB 1H2LA 4EFBA 1Y76B 1AB3A 5JLIA 3HKEA 2R7SA 2EPNA 3OEHG 4J42A 5DQZA 2WPDG 2G3KA 4LFAB 1AJNA 3JATB 2ZM6O 1D5NA 5EHHA 2OCCC 3FVYA 3ZJZA 1NBBA 2XOKG 3L9DA 4U9DA 1KU9A 1AJQA 1TVKA 1VP7A 2UXDB 3H01A 3I5QA 1K05A 2KG7A 1FTSA 4LERA 1VIBA 2R03A 1XWJA 3B8NA 3T2MA 1GAXA 3FOPA 3I55V 4K8XA 4GX5A 4TV8B 1OW8A 4U7NA 3T1HO 2FB5A 5D5PA 3MBGA 3F47A 2PI5A 1B6QA 1QKRA 1SA0B 2AZ0A 2G62A 5AC5A 2AZ2A 4JYAO 4K35A 2QDOA 1YCIA 1NZEA 2Q7HA 1KECA 3RYFB 4R7CA 1GM8A 5LHGA 4N21A 1O9GA 1M93A 1ZX3A 2F4VO 4CBCA 4LWSA 4YT8A 2ZT9B 4Q7CA 3O65A 1LNQA 3S27A 4NVPA 1ZSPA 2Y0IA 1N34B 1CGOA 1FFHA 1U89A 3IQTA 4XEVA 1YF2A 1HW7A 1IBKO 4I9WA 4X0RA 1NJIW 3G4ZA 3QVZA 4DR3B 3OM3B 4IGGA 1K3EA 4I0XA 3SXMA 1KYOF 1W0KG 4ABMA 4CC6A 1FXKA 4MW3A 4TV8A 3KKYA 4ZHQA 2XL8A 2J46A 2R02A 4G2KA 2Q6AA 2W4BA 1P49A 3CCLV 4H4KC 1SQBH 5JH7A 1WNSA 3OAAG 1RKEA 3IPMO 5JSLA 2PZSA 3B4SA 3U2MA 1VYKA 4G78A 2AU5A 3CPWU 2V3CC 5CI9A 3KKBA 3ICXA 4WFBV 2F4VB 4W8KA 1L1FA 5CA1B 2IBFA 2A9HA 3THOA 3K5MA 1UG7A 2PYJA 3JRMO 2L7AA 2BC5A 3CCRV 4G28B 1IBKB 4JAUA 5KHJA 5JJNB 4H37A 2G3VA 1OXBA 1K5QA 4LDQA 2R9AA 3RN4A 5HV9A 1OCRC 3TOMA 3DXRA 4PA4A 4IIJB 3K57A 2W0XA 2YIAA 2WVOA 4OPHA 2WSSG 5EZYB 4X20A 1R3LC 2P4VA 2GUZB 1LI7A 3H1LH 1SA0A 2X7RB 3PJSK 4MS2A 2YL3A 1YXBA 3H1JH 4EBBA 4PD4F 5L3CA 4X9QA 1N33B 3UGOA 4W4LA 4U5GA 4O2AB 3TULA 4LLEA 1WOLA 4O4IB 5GONA 5TISZ 4LACB 3ZCCA 3U11A 1Q0MA 1HR0O 2UXDO 1W59A 3T1YO 3ZWIA 1JRAA 4NR1A 1M56B 3OUSA 1N0NA 3F5TA 2V7QG 1Q6HA 2CH7B 5CB4A 1TGOA 1QLEC 5CA0A 2DB4A 3K1HA 5ITZA 1FXKB 1LIHA 4IYHA 1A32A 1N4CA 1K4CC 4LCUC 4JI0O 3VQXA 4X1YA 2BSKA 1ZTEA 2Y4TA 1OCCC 4LF4B 3O9OA 4YT5A 2X6BA 3A11A 4E17A 4PI0A 1IVSA 4I9QA 1XMQO 4WABA 1OJHA 1G6UA 1QPUA 1SF8A 2AWCA 4JCHA 3SZRA 5LBQA 1MMMA 4U5BE 2MW2B 5EC2C 4JIOA 5KUKA 4N4WA 3KL4A 5FPOA 3EGXA 1K34A 2ZDIA 4B6IA 3L1MA 4JPRA 3HJCA 3T4DA 1Z23A 1F1MA 1JQ0A 2PTMA 1H2SB 5KYWA 1FAPB 3SXKA 3KCXA 4LBEC 1RJ9A 4I1MA 4BPMA 3JYCA 5KYUB 2IM9A 5COGA 3CJHA 3CRQA 3PHF2 3H1KH 1NTZH 5LXTB 4NY3A 2M6YA 2JVDA 3ML0A 3OMAB 1AVMA 3TK1A 1B68A 3OA1A 3NMKA 5T1DB 3HPLC 1OXKA 1YAUO 1MSWD 2YIBD 3QO5A 4LF8B 4PA6A 1YYXA 3TXQA 5GONB 2CYDA 5H6QA 3B0VC 3T1CA 1S0VA 4PACA 5B3IA 4OX9O 2M4EA 5H5NA 1ZVZA 2GFHA 2WA4A 4Z1MG 3BA9A 4I55B 1QVXA 3HKKA 4F6EA 3E22A 2VCBA 2HLDG 1LUWA 1AI5A 2N74A 2QA4V 1ZLZA 2W0FC 4RDAA 2AHZA 4RQEA 2OYQA 4D4XA 3SYAA 5D5QA 2PGGA 4PI2A 1LS1A 4O6YA 4ZOLB 2LD6A 2HV7A 1QVGU 3VQWA 5LMUB 5JRAA 4YJ2B 1VOMA 1VK5A 1WAZA 1ZUQA 1SKVA 2DWEC 2YSUB 3KPHA 4R50A 3APQA 2KW3C 1QBZA 1TUBB 1JJOA 5K1PA 3HKDB 1TA8A 3RBZA 1XQ8A 4JI7B 1L0LH 1Z5WA 3RYIB 5LOVA 3WHNA 2ZKOA 1G8XA 4KP4A 1TQGA 2XAGA 4JZGA 3W7SA 2X6AA 4DR1B 5J2TB 4TT3G 4JAVA 1PKXA 1R6KA 4FPPA 5L3GA 4AQYB 2VCCA 4MVSA 2CK3G 2GAQA 1SETA 3K33A 4DV1B 4PELA 1F23A 2F93B 1HNWO 1Z5VA 3GM2A 4OIRF 2R7WA 1VARA 5LA6B 1YVIA 4DUZO 4JEBA 4XPXA 2IH1C 3OR7C 1YDIA 3ZTZA 1WJZA 3SEOA 2UUIA 4NXNO 1KB9F 2J9UA 2JRIA 2J9WA 1SRYA 3JSZA 4JF3A 1LE4A 5LGTA 5KMGA 4GEHA 5JQGA 3ABLC 3EXAA 4ONSA 4JI5O 1ZHWA 1Z7Qc 5HFLA 1HDJA 2A0LA 4PJLA 2HMZA 2GUZA 3EGDA 3V7OA 4UUJC 2EINC 5COFA 1R3IC 4DR1O 1EA8A 3RQGA 4OGQB 5IWAO 3ABLB 3IJ4A 4DXWA 1E83A 3AGTA 2WZFA 2LCHA 3VRCA 4YY3B 2JGUA 4FLZA 2QWOB 4FAPB 2EILC 3CXCU 3BA8A 5D91A 1T01A 3ZVRA 5JT4A 4NYKA 2P5OA 3ZRSA 2CDYA 4DUYB 5CIVA 5JVDA 3SPCA 4LF7O 1FXVA 3UMIA 4GX0A 4DW1A 3WB2A 4R8CA 4LC1A 3SJCC 2Y48A 5ITZB 2YHSA 1AUEA 2XL4A 1Y4CA 1TFKB 5B1BC 1JX9A 2H3OA 2H94A 3WODF 4O4HA 3AG1C 3V5ZA 2YLDA 3EGDB 2Q0AA 2P7VA 4WBNB 4QJFB 1K7DA 3B8MA 2KNHA 4J7KA 2DOSA 2ITCC 3PDMP 3IQ6A 3KMIA 1S76D 1JFFB 3CYOA 3DWWA 3O10A 4J7ZA 1NLXA 2P6VA 4J32B 3JSLA 2LP4A 3ZQYA 4EEQA 2JPUA 3POVA 2EINB 1VB5A 5LA6A 1CP9A 1Y6DA 4XPYA 3BY6A 2A7WA 1Q0FA 5FPRA 4GQHA 4AL1A 2A0UA 1FNTc 2IJJA 4UCUA 4IARA 5E79Z 1YA7O 3EHNA 4DRIB 2KB1A 3UO3A 2AWYA 3AGUA 3ZN1A 4YXWG 3TJTA 3KYJA 4DV5B 3UT5A 2EIKB 1K73W 2YL7A 1WB7A 4JI3B 3DD7A 2ZXPA 4WFAV 4JW1A 4U3JB 2CTQA 2WVQA 1WA8B 5EIBC 4NXMB 2E76B 4LNUA 3EH2A 5B66Z 1B04A 4UVCA 1MQVA 4PV1B 4UCRA 1L8DA 4O6MA 3CEXA 2K9PA 2NUPA 1AI7A 4UV8A 4OINF 3T6GB 2Q67A 1O3UA 1VQ8V 1YTFB 4JTCB 2BTQA 5JCOA 4GYCB 4RUEA 4GX1A 4MVQA 5L0DA 2C03A 4GT1A 2ZIOA 4JURI 4YL1A 3ATPA 1G4YB 2O9XA 3QO8A 1C02A 3LNRA 3CHXA 1P7BA 2F95B 3ZHQA 2YI9A 3R7CA 1MOFA 3NDBB 3W7XA 2QLAA 3J7AU 1FFXB 2BL2A 1XI1A 3KH2A 1D0XA 4XPWA 3ZS8C 2KGOA 5L0FA 1MMDA 2HEPA 2CCYA 3K08A 3FB5C 4DV7B 4IIJA 4HNAB 1DTOA 3E22B 4JJGA 2P7TC 5IJ0A 1LKXA 4B3TB 2DYRC 5IWAB 1VQ9V 2LK4A 5BUOA 2EIJC 2R25A 1I0HA 4P2ZA 1EZJA 1R1BA 1ST6A 4MVRA 3GB7C 3IGAC 5F28E 2D4UA 4U7OA 1GKFA 1Y74A 2YXLA 3GODA 2UUBO 1PNLA 2AHYA 1FXKC 3LDCA 1U6HA 3RYLA 4EBKA 1RFYA 5FL7G 2XHBA 2QKSA 4BJTA 4LF6O 1ZL8B 4WGZA 2R7UA 3G71V 4YT4A 4GZRB 3CC7V 2DMXA 4KFMA 3VQVA 4BW5A 4XEKA 5EBMC 1RSOB 2KJGA 3MDSA 1VQ7V 1IZ3A 2OOCA 5BY1A 3ABKB 3WB0A 3JALA 2PYLA 1DGSA 3M7MX 3L0IA 1U97A 1OCOC 2Q0OC 5CA0B 4JI4B 1FS0G 4YHHB 4GKKO 4NTAA 1K92A 5EC1C 2UXNA 4LH6A 3ABKC 3LDEA 3SGIA 4QE7A 1XL4A 3N2KA 4YL3A 4UCVA 5KA5A 1AEPA 1Z3IX 4X64B 1BQ0A 4A4AA 4GLXA 2BTQB 3S29A 3VM6A 2DE0X 3CEIA 1ZL8A 4HZ3A 5DN6G 3EZIA 4FFBA 1BZ4A 2BOBC 2IJKA 1A7EA 2WLLA 4P30A 4DR5B 4WJ0A 4CS9C 2A68F 1TVKB 2A79B 2IW5A 4ULWA 3K59A 2Y3HA 1S5LZ
chains in the Genus database with same CATH topology
2H8PC 2Q68A 1NJIW 1EFRG 4O6NA 3OM3B 1K3EA 1ZU4A 3EQLF 4RBNA 1D1AA 2Y3DA 4WFEA 2W6IG 1NU9C 3DZAA 1W0KG 1YIJV 2XAQA 1FXKA 1K97A 4MW3A 1MNEA 1E1QG 2ZD9A 1W2BU 3H65A 3OMIB 5GW7A 3ZMUA 2J46A 2R7UA 2WZGA 2HR3A 2Q3TA 1M9NA 2Q6AA 4G2KA 3CMAV 2W4BA 5LGNA 4I5SA 2IXOA 4KNVA 2QE7G 1F51A 1PL0A 5B1OA 3CCLV 1SESA 3ZMZA 4H4KC 1COWG 4EKWA 4MTXA 3LDDA 3OAAG 3W7TA 1UJWB 3ECSA 1TWGA 2R9IA 4MNDA 2HG5C 2EIMC 2HVKC 2W6JG 1VYKA 3LEVA 3MLGA 5F5FA 3AG3C 3CPWU 2V3CC 3IC7A 3SPHA 2P90A 5CI9A 2QY9A 2WLJA 3KKBA 2P67A 3B9QA 4WFBV 3FKSG 3N24A 3UKMA 4K0DA 4W8KA 3CCUV 1NVPD 1L1FA 4E2LA 1KC8W 3ASNC 2FFHA 3HTKC 4PFOA 1GM7A 4PA7A 4BIZA 2A9HA 2WL8A 1H8HG 2DQ0A 3GWOA 4JYBA 1OCOB 3F7YC 3X2QB 4XWJA 4C3EA 1DLBA 3Q7LA 3ZC4A 1NR1A 2LFRA 2X0LA 4JGSA 3S0XA 3CCRV 4G28B 1YJ9V 4JAUA 3CP1A 4H37A 1ENVA 2G3VA 2DWDC 2XAJA 1VQNV 1V54C 2WB7A 3N2ZB 2VH3A 3FYEB 2Z5UA 1H2GA 1K5QA 4QI0A 4N06A 5IDJA 3K0DA 3O39A 1DF4A 1J95A 2MK3A 3D36A 3E83A 1OCRC 4WCEV 1SMYF 4PA4A 3E2EA 1FFTC 1TKNA 2CDQA 1N1CA 2WVOA 2QM7A 5KUMA 1Z63A 4H33A 5B1NA 2WSSG 1VQ5V 1W2WA 4G7ZF 2D3OW 1R3LC 5L3VA 3TCUA 3F46A 5T3WA 4RD9A 4WFFA 4UVBA 4C3BA 1F4MA 2X7RB 4GCZA 3PJSK 5BZBA 4MS2A 2IXNA 4O7GA 1TWHA 4OD4A 2F43G 3DMDA 3RVZA 2WVNA 3ZG1A 1F4NA 2EJRA 5KYNA 1D0ZA 1V55B 3ABMB 1O87A 4EBBA 3UGOA 5L3CA 4E7SA 2NUTB 4F4BA 2DGJA 4U5GA 2A69F 3K79A 4OD5A 2IXMA 4LLEA 4BJ5C 1Y66A 3WG7B 4LACB 4QPJA 2A1DD 2NUPB 3ZIBA 3ABUA 3ZCCA 4DOZA 4Q5SF 3CCEV 4QE9A 1KP3A 2J9VA 4JYCA 2YEVA 3OWTA 4IWBA 5L3BA 3SPIA 3NG1A 1M56B 3OFNG 3OUSA 1NR7A 3AG3B 2V7QG 1BMFG 3FB8C 5B3SB 5F5HA 3EHBB 4JTDB 4TWKA 1E1RG 2IXPA 5B1AC 1NKDA 1QLEC 3K9AA 2ZXRA 2J0XA 1YI2V 3UM7A 3Q6MA 3K66A 5L3QA 1CEZA 3K1HA 4XLPF 2XRHA 3KG2A 1FXKB 3ZN0A 4DVYP 1K4CC 4LCUC 5IYCO 3NRHA 1K8AW 3W7WA 4BAYA 1OCCC 1ZHXA 3FB7C 1J8YF 4U5DE 4YT5A 5DQTA 2X6BA 2R7RA 3FYIB 1KP2A 3EG9A 1S72V 2WAMA 3SYNA 2IOQA 4U5EE 4EWCA 2CNWA 4HFKB 1GM9A 2UXXA 1SF8A 4HEAJ 2B5UA 4HE8D 4JCHA 1PCXA 4LLCA 3SZRA 3RW0A 2EBOA 5LBQA 3OW2U 3SPJA 1OKKD 4JTAB 4U5BE 5EC2C 2K1EA 2MWQA 5KUKA 3ITFA 3KL4A 2WLNA 3EGXA 2JJ1G 2XAFA 3AQCA 2IU0A 1K34A 2ZDIA 2X6CA 4B6IA 3W2WA 4CBEA 3OR6C 4JPRA 3HJCA 3MX3A 3T4DA 3CSKA 1Z23A 5DS6A 2PX0A 3LUTB 1TR2A 4AE4A 2WLIA 3ZMTA 1JQ0A 5KYWA 2P6JA 3JT1A 1JCHA 3LSSA 3E86A 3RVYA 4LBEC 1RJ9A 4FMTA 4I1MA 4PDRA 1M2VA 3JYCA 3LS1A 5KYUB 3T4RA 3E8HA 2WLMA 2Q69A 1JPNA 2B1GA 4ZLCA 3WG7C 1JVMA 4MQ9F 2WLKA 1EBOA 3LLIA 2L81A 1D0YA 3PHF2 5CN0A 4MT8A 3DGEA 2FTKA 1JJ2U 1BR1A 1YTFD 2IU3A 4NY3A 2HVJC 2Q9CA 4PDVA 4MTOA 1IZMA 1VMAA 1NH2B 3ML0A 3OMAB 5LHHA 3LAYA 3LS0A 2DQ3A 2W45A 5DLJA 3EH1A 5CBHA 1IXMA 3TK1A 4AX2A 1MMNA 2OCCB 5E3AA 3OA1A 1O5HA 2Z15A 2XXAB 3ETEA 3JYHA 3HPLC 5T1DB 4TSFG 2GSMB 4ASUG 1D1CA 2H7VC 1M57B 4BEJA 1V55C 2EZPA 3ABMC 3MHHC 2J45A 2L9JA 1MSWD 2PF4E 3QO5A 2QTOA 4RUFA 1R6NA 3QO7A 1FXHA 4CS7A 4PA6A 1YJWV 1AI6A 5IYDO 3Q7GA 2IH3C 4DO2A 5CA3A 4CS8C 1J8MF 2JIZG 4CSAA 1M1KW 4XDKA 5H6QA 3B0VC 3T1CA 1S0VA 3ZMSA 3CCSV 2Z3YA 3K3WA 3SNHA 2DYSC 2JD3A 4KC9A 2M4EA 1K9MW 3G4SV 1NU7D 1LVKA 3UR3C 4AE4B 5J9PC 2VASA 2GFHA 4Z1MG 1TWAA 3ZMVA 1BR2A 2Y3GA 3HLZA 3M1CB 4A2NB 2EZOA 2HLDG 1AI5A 2WLHA 1VQKV 5FCLA 1MABG 2XXAA 5CBFA 5KYYB 2QA4V 4G0HA 3LNMB 2W0FC 4RDAA 2AHZA 4RQEA 2OTLV 3SYAA 4AK9A 2ZPAA 1LS1A 4FIPC 5H9CA 4O6YA 1FMVA 3Q6NA 1QLNA 3E8FA 1QVGU 1S5HC 5DM6V 1H38A 4P9OA 2HV7A 4KBLA 1ROPA 4OIPF 4UVAA 1VOMA 1H8EG 3T4ZA 1VK5A 2DWEC 2OTJV 2YSUB 3F7VC 4I44A 4ANJA 4R50A 3W2VA 5KYYA 1ZYRF 3CZ6A 2KW3C 3NYMA 3K0GA 3JCZA 3VYWA 1QBZA 3ABTA 2CNWD 2HV6A 1S3JA 3EFFK 3RBZA 3SYOA 2PP4A 4QI2A 3X1OA 1G8XA 4KP4A 3I5PA 1R3KC 2HKOA 2XAGA 3W7SA 1VQMV 2X6AA 3SPGA 4MVOA 1VQ4V 1NG1A 2Q9BA 2ZR2A 4TT3G 5B1BB 4C7OB 4XDLA 4PK4A 3F5WC 4JAVA 1GO3F 1PKXA 1R6KA 3BEHA 4FPPA 3IEEA 1K4DC 1E79G 3W8IA 5C93A 5L3GA 4I3MA 3HB3B 1ORQC 4WFHA 3ZSUA 4MVSA 3ZIAG 2PI4A 5H6RA 4MVZA 1KU2A 2CK3G 1VYIA 4OIQF 1SETA 1Q82W 3E8BA 5CMUA 5E1AC 3ETGA 3X2QC 2H7BA 3ETDA 4PELA 1F23A 2BE5F 2Y3BA 3K33A 4MSWC 4OIRF 3ZRVA 2R7WA 2JJ2G 3IFXA 2Q9AA 2IH1C 3OR7C 4P6IC 2QTVA 3LESA 1PNKA 2JEUA 2DYRB 2XAHA 3ZRXA 4WF9V 3G6EV 3DAFA 3STLC 3SEOA 3JCUQ 4PDMA 3SYCA 2J9UA 4BG0A 4Q4ZF 2J9WA 1SRYA 3JSZA 4JF3A 1WPXA 5EK0A 5LGTA 1K33A 5D92A 3RIPA 1NVPB 4GEHA 4IRUA 4QPKA 3ABLC 3UMHA 3STZC 1W0JG 4KNWA 1ZHWA 2X51A 1PNMA 3K04A 2YZSA 5HFLA 2W4MA 1VQOV 4OIOF 2A0LA 4PJJA 1QLEB 4PJLA 3JRTA 3DJUB 1NBMG 1GK9A 2EIMB 1G8MA 4RO2A 3EGDA 3V7OA 3FB6C 4UUJC 2EINC 4FX5A 4CS8A 3DTUB 1VQLV 1R3IC 4FWVA 3ABLB 3LSQA 3CMEV 2ZXOA 4DXWA 4ZLDA 1QZXA 2WZLA 4HFFB 3FHDA 1Q7YW 4HAMA 2WZFA 2NUTA 3T6JA 4MVMA 3NKDA 4K7BA 3UMKA 5E2QA 4DBRA 5EGYA 3AG1B 1OCZB 3NYJA 4G7OF 1SZTA 2LSEA 2EILC 2V1DA 3CXCU 1YHQV 5D91A 3ZVRA 5IY5C 1N8RW 3ZRSA 1TWCA 1IW7F 2EIKC 5DVWA 2WLIB 3CCQV 2D5RB 2YEVB 2BOCC 4BIUA 3PMRA 4QDLA 5L3DA 3SPCA 4J9ZB 1FXVA 1P4RA 3UMIA 4GX0A 3VAYA 4HYOA 2Y69C 4XLNF 4R8CA 4LC1A 4IJJA 2IJIA 4F4LA 4P9PA 1AR1B 2Y48A 2YHSA 4PJNA 3ASOC 3WFVA 1GMGA 1MNDA 1OKKA 2A6HF 1M57C 5B1BC 1JX9A 2PX3A 2XL4A 2H94A 2EILB 1WGWA 3SP1A 3WODF 3E9VA 1K5SA 2ZR3A 3OEOA 3AG1C 4FK5C 3JD4A 3VOUA 3EGDB 3RFYA 4BJ6A 5B3SC 3CC4V 2P7VA 3OUFA 4FESA 1NQTA 4QJFB 4WFGA 1K7DA 1QCEA 3B8MA 1ZU5A 2KNHA 2ITCC 4PA3A 2WLLB 1OHHG 1S77D 3QNEA 2QM8A 3VBBA 3TETA 4XTKA 3P32A 4GX2A 1I5XA 2ATKC 4C7OA 3JD0A 3K1IC 3KMIA 3SYPA 4PFPA 3S28A 1S76D 3EGXB 1YJNV 3CYOA 1JOYA 3UGPA 1M90W 1KQSU 3K6BA 2R7TA 3QZCA 5CI8A 2LP7A 2P6VA 4J32B 4U5FE 5KYXA 4XBFA 4PJMA 2DW4A 3T6BA 3CCMV 3POVA 3LJBA 2VB6A 2R7VA 2EINB 4M63A 2B0JA 3K7DA 2XASA 1CP9A 1RPRA 5L3FA 3JD2A 3BY6A 4RQFA 4J9YB 1MG1A 3OMNB 5HFMA 2NG1A 3EG9B 3N0TA 3RH3A 1OCRB 4CSAC 2IJJA 4LP8A 1HWYA 3EJNA 3SYQA 3EHNA 2KB1A 4YN0B 5KYXB 1NH2D 3ZN1A 3D3IA 4YXWG 1SZIA 3QMKA 2EIKB 2I8BA 1K73W 2J7PA 4XDJA 3DD7A 2ZXPA 4UXNA 2A6EF 3I4UA 4WFAV 3JD1A 2M7WA 3R65A 4MTGA 4JW1A 2NNUA 2LFSA 1RM1B 3JD3A 4U5HA 4BJ5A 1S7ZA 2KQ9A 2WVQA 1V54B 1R73A 3ASNB 1Q81W 4MTFA 1BHAA 4X88A 1CPYA 3EH2A 4U5CE 3W7UA 4DBQA 4UVCA 4O6MA 4BJ6C 2WWWA 5DS4A 1ZHYA 2B1IA 1SERA 4MW8A 3MHSC 2NUPA 1AI7A 4KUMA 4UV8A 1BHBA 5B1AB 4OINF 2Q67A 3E35A 2V26A 3FDQA 3AG4C 1VQ8V 1YTFB 5L3EA 1MMAA 4JTCB 3DAGA 4I1OB 4UV9A 4RUEA 4GX1A 4MVQA 3LLKA 5EBLC 1KKDA 2C03A 4GT1A 2H7OA 3DM9B 2IJHA 5KA6A 2R7QA 3CQZA 4J30B 1AJPA 4JURI 3B0PA 1G4YB 2O9XA 4X89A 5E33A 3QO8A 1BR4A 4DVZA 3LNRA 4BJ1A 1QVFU 1P7BA 2J0WA 3AEIA 3B77A 4QIWF 3UNGC 4L87A 4YWQA 2C04A 3EZHA 4FJCC 1MOFA 2ZQMA 3O6XA 4KI2A 1D1BA 3NDBB 3W7XA 3AQBA 2XSEA 3DJNB 5E3CA 3KH2A 1D0XA 3EHMA 2KGOA 4N23A 2W9YA 3DM5A 3K06A 4IAOA 1AI4A 1MMDA 1ZWIC 3OE7G 3AG4B 3K08A 3FB5C 4MVUA 4X0RA 2QEXV 2R7OA 4JVSA 1RJ9B 3P30A 1VQPV 1DTOA 4E7ZA 1R3JC 5KYUA 4ZKIA 1FMWA 2R7XA 4JJGA 2P7TC 2NLJC 1LKXA 2DYRC 3K03A 1VQ9V 3M99B 5BUOA 2EIJC 3NXSA 1ZHZA 3EPVA 1ST6A 4P2ZA 1EZJA 3NKEA 4GYTA 4C3DA 1OCCB 3GB7C 3IGAC 3ASOB 1TUEB 3AG2C 4MVRA 5LHIA 3DXJF 2ZXWB 1GKFA 4U7OA 3L34A 1Q86W 3GODA 1RM1C 4G27B 2CGEA 1FFTB 1PNLA 2AHYA 1FXKC 1OZ0A 2ITDC 3LDCA 3SJQC 2OG2A 3RYLA 5FL7G 2R9RB 1WLEA 1VQ6V 2QKSA 3E8GA 3MD0A 4BJTA 2R7SA 4OXSA 3OEHG 5DQZA 2DYSB 2WPDG 1YITV 2G3KA 1AROP 5T3TA 3OEEG 2JDIG 3G71V 1AJNA 1M56C 5IYBO 5CBGA 5IY5B 3E70C 4JJFA 4YT4A 5DS5A 2ZDIC 3CC7V 3NYLA 1RPOA 5EHHA 4KFMA 1I5YA 2EIJB 5LGUA 2OCCC 1BL8A 4ZBMA 3ZJZA 5EBMC 4BW5A 3FVYA 4PA9A 3B0UX 4PDLA 1M2OA 4R6ZA 2E87A 4YT2A 2XOKG 2ZXWC 2KJGA 1AJQA 2HFEC 3RKOF 2OT5A 2IYLD 1VQ7V 3EFOB 3H01A 3ABKB 2J7PD 3I5QA 1GTOA 4LERA 2XNDG 1FTSA 2MYSA 2GHYA 1MMGA 3L0IA 3B8NA 2HJFC 3T2MA 1Z6AA 1OCOC 3I55V 4GX5A 1FS0G 1ZHTA 4CIHA 4U7NA 2PFDA 1YSCA 4QNHB 2JEXA 4G7HF 1K92A 1QR8A 1KD1W 2CW0F 3EFOA 3F47A 5EC1C 4Q20A 3I56V 2PI5A 5HSWA 1B6QA 2UXNA 3CD6V 3ABKC 2G62A 3LDEA 2C2AA 4QE7A 1QR9A 1PD3A 3E89A 1THZA 1XL4A 4RAIA 4CZZA 5KA5A 1NZEA 1Z3IX 1KECA 4CS9A 4YJWA 1PD1A 4R7CA 2Y69B 3S29A 3GANA 4X8AA 1GM8A 3ZRWB 5LHGA 1JPJA 3FAJA 4O79A 3CC2V 4N21A 1JPXA 2Y39A 4HZ3A 3CCJV 5DN6G 3EZIA 4CBCA 4JZAA 2BOBC 2IJKA 5EBWC 4YT8A 4Q7CA 3AG2B 2JK5C 1XL6A 3OGCC 1M2VB 1LNQA 3S27A 2WLLA 1DF5A 1PD0A 4P30A 4WJ0A 3TD7A 1Z5ZA 4CS9C 2A68F 3A0RA 1FFHA 3ZRWA 3W8HA 2A79B 1OCZC 2IW5A 3CCVV 5KYWB 1Y4MA 4JASA 4I9WA 2FGYA 4ULWA 2Y3HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H8P C;  2Q68 A;  4MTF A;  3IFX A;  4X88 A;  2IH1 C;  3OR7 C;  3RW0 A;  3SPJ A;  4JTA B;  5EC2 C;  4WFE A;  2K1E A;  5KUK A;  2WLN A;  3STL C;  4MW3 A;  4MW8 A;  4PDM A;  3SYC A;  2ZD9 A;  2Q67 A;  2X6C A;  5EK0 A;  3AG4 C;  3OR6 C;  2Q6A A;  4JTC B;  3T4D A;  3ABL C;  4GX1 A;  4MVQ A;  4RUE A;  3STZ C;  5EBL C;  1KKD A;  3LUT B;  2WLI A;  3K04 A;  4EKW A;  1G4Y B;  3LDD A;  4X89 A;  2A0L A;  1P7B A;  2HG5 C;  3E86 A;  2EIM C;  2HVK C;  4LBE C;  4RO2 A;  3RVY A;  4PDR A;  3JYC A;  3FB6 C;  4UUJ C;  2EIN C;  3AG3 C;  3E8H A;  2WLM A;  2Q69 A;  3SPH A;  3WG7 C;  1JVM A;  1R3I C;  2WLK A;  2WLJ A;  4DXW A;  3K06 A;  3UKM A;  1ZWI C;  2HVJ C;  3K08 A;  4MVU A;  3FB5 C;  4PDV A;  4MTO A;  3ASN C;  4MVM A;  4PA7 A;  2A9H A;  1R3J C;  3F7Y C;  2P7T C;  5CBH A;  2NLJ C;  2DYR C;  3K03 A;  2EIJ C;  2EIL C;  3HPL C;  4G28 B;  4P2Z A;  5IY5 C;  1V55 C;  3ABM C;  3GB7 C;  3IGA C;  4H37 A;  2EIK C;  2DWD C;  3AG2 C;  2WLI B;  1V54 C;  4MVR A;  3ZRS A;  2QTO A;  4RUF A;  4G27 B;  2BOC C;  4PA6 A;  2AHY A;  3LDC A;  2ITD C;  3SJQ C;  2IH3 C;  3K0D A;  4J9Z B;  1J95 A;  3SPC A;  2R9R B;  3E83 A;  4GX0 A;  1OCR C;  4HYO A;  4XDK A;  2Y69 C;  4PA4 A;  2QKS A;  3E8G A;  4R8C A;  3T1C A;  1FFT C;  4OXS A;  4F4L A;  4P9P A;  2DYS C;  5KUM A;  4H33 A;  3ASO C;  1M56 C;  5CBG A;  1M57 C;  5B1B C;  1R3L C;  3TCU A;  4WFF A;  4KFM A;  5J9P C;  5BZB A;  2OCC C;  1BL8 A;  3PJS K;  4ZBM A;  4MS2 A;  5EBM C;  3ZJZ A;  4BW5 A;  4PA9 A;  3AG1 C;  4PDL A;  3VOU A;  4R6Z A;  5B3S C;  2ZXW C;  3OUF A;  3RVZ A;  2WLH A;  2HFE C;  4WFG A;  5CBF A;  2ITC C;  3LNM B;  2W0F C;  2WLL B;  4PA3 A;  2AHZ A;  3TET A;  4GX2 A;  2ATK C;  2HJF C;  3SYA A;  3T2M A;  1OCO C;  3SYP A;  4GX5 A;  3E8F A;  1S5H C;  4P9O A;  4QE9 A;  4QNH B;  3T4Z A;  2DWE C;  5EC1 C;  3F7V C;  4R50 A;  2YEV A;  3ABK C;  3K0G A;  3SPI A;  3LDE A;  3OUS A;  4QE7 A;  4RAI A;  1XL4 A;  3E89 A;  3EFF K;  3RBZ A;  3SYO A;  3FB8 C;  4JTD B;  4J9Y B;  4TWK A;  5B1A C;  4R7C A;  1QLE C;  1R3K C;  4X8A A;  3UM7 A;  2X6A A;  4LP8 A;  4MVO A;  3SPG A;  3SYQ A;  3KG2 A;  2KB1 A;  4HZ3 A;  4XDL A;  1K4C C;  3F5W C;  4LCU C;  4CBC A;  2BOB C;  5EBW C;  3BEH A;  1K4D C;  1OCC C;  2JK5 C;  1XL6 A;  1ORQ C;  3OGC C;  4WFH A;  1LNQ A;  3FB7 C;  4MVS A;  2WLL A;  4XDJ A;  2X6B A;  4P30 A;  4MVZ A;  3R65 A;  4MTG A;  3E8B A;  2A79 B;  1OCZ C;  5E1A C;  3X2Q C;  4I9W A;  4MSW C; 
#chains in the Genus database with same CATH topology
 3CWB H;  1LI5 A;  4EBJ A;  3CB2 A;  4X66 O;  2Q73 A;  3EQL F;  4C7U A;  4WFE A;  4X1I A;  2HJ3 A;  2RDC A;  3DZA A;  1VLS A;  3A9C A;  2XAQ A;  3BFR A;  1SF9 A;  2YC0 A;  1GRJ A;  2ZD9 A;  4YHH O;  2OEV A;  3H65 A;  5GW7 A;  3ZMU A;  2HMQ A;  1M9N A;  2F22 A;  2P06 A;  5LGN A;  1PM9 A;  3EVK A;  1PL0 A;  5B1O A;  5F2V O;  3ZMZ A;  4EKW A;  3W7T A;  5IJ9 A;  1E85 A;  5KX5 A;  1SR2 A;  3B29 A;  2RNB A;  2HHH B;  3MLG A;  3LEV A;  3BCC H;  2OJQ A;  2QY9 A;  2WLJ A;  4JI2 B;  3BAB A;  4DV4 B;  3B9Q A;  1GGQ A;  3UKM A;  3N24 A;  1P7G A;  4K0D A;  4I50 B;  2FKX A;  3CCU V;  1EN5 A;  4PFO A;  1GM7 A;  3GWO A;  4JYB A;  4AHC A;  4XWJ A;  4WBN A;  3ZC4 A;  1NR1 A;  4JGS A;  1J5E B;  1ENV A;  1QU7 A;  2DWD C;  2XAJ A;  4X66 B;  2WB7 A;  2VH3 A;  3FYE B;  3KZI Z;  3OTF A;  2QTS A;  4FZ0 A;  3O39 A;  3D36 A;  3E83 A;  4WCE V;  1GN3 A;  1Y67 A;  1TKN A;  1NTM H;  4BR6 A;  2G38 A;  3S3X A;  1Q43 A;  1Z63 A;  4H33 A;  4ZIB A;  4G7Z F;  5L3V A;  3TCU A;  3DSQ A;  1H9T A;  4RD9 A;  4WFF A;  4C3B A;  4GCZ A;  5BZB A;  4JV5 O;  1N36 B;  4O2B A;  1HY5 A;  4E0I A;  3ZHS A;  4OD4 A;  2YIB A;  3ZG1 A;  4E18 A;  2EJR A;  5KYN A;  1V55 B;  1FPO A;  2LW7 A;  3K58 A;  2DGJ A;  5H2F Z;  4BJ5 C;  4GKJ B;  3ABU A;  4Q5S F;  3CCE V;  4QE9 A;  4U9E A;  1KP3 A;  4F6R A;  2ARH A;  1CPQ A;  4X1I B;  2YEV A;  3OWT A;  4IWB A;  4JZ2 A;  3OFN G;  2CGN A;  2R05 A;  3K9S A;  3EHB B;  4TWK A;  2ZXR A;  3J81 N;  4DR7 O;  3UM7 A;  4U3J A;  1SZX A;  3OGI B;  2LGW A;  2ZNI A;  1E84 A;  5EZY A;  3P3P A;  3NRH A;  1K8A W;  2D2C B;  1OR2 A;  3FB7 C;  2DJV A;  4ZOL A;  1J8Y F;  4FM1 A;  1KP2 A;  1PV3 A;  2L6G A;  1S72 V;  5JP7 A;  2IBZ H;  3PN1 A;  4U5E E;  1VEW A;  3GWK C;  1GM9 A;  2UXX A;  2UU9 O;  4HEA J;  1YEW A;  5AC4 A;  2B5U A;  3RW0 A;  3SDL A;  3C18 A;  2QWN B;  4NTW A;  3SPJ A;  4JTA B;  4DR5 O;  1XHX A;  2YXH A;  4CJO A;  2K1E A;  1IBL O;  3ITF A;  3SXZ A;  2TMV P;  1XZP A;  3AQC A;  4B3R O;  2X6C A;  3TGU H;  1T6U A;  3W2W A;  3MX3 A;  3CSK A;  4KL1 A;  1N33 O;  2EUL A;  2CH7 A;  4EUK B;  4AE4 A;  4EIY A;  2P6J A;  3JT1 A;  4DV1 O;  3E86 A;  3T4R A;  2HJM A;  2FL4 A;  2WLK A;  4MT8 A;  4CDV A;  1HNZ O;  1I7F A;  2BE3 A;  2FTK A;  1JJ2 U;  2OQM A;  4PDV A;  4MTO A;  4JE9 A;  1NH2 B;  5LHH A;  5DLJ A;  3LS0 A;  2W45 A;  2QE9 A;  2CE4 A;  4YIO A;  1IXM A;  3RF3 A;  1MMN A;  1O5H A;  3JYH A;  3OD4 A;  4TSF G;  2GSM B;  1N32 O;  1D1C A;  2H7V C;  1M57 B;  3MYI A;  3ABM C;  3MHH C;  1XMO B;  1WAT A;  3FFQ A;  2YLI A;  2PY5 A;  1AI6 A;  4J41 A;  3Q7G A;  4CS8 C;  5CA3 A;  4XDK A;  4YIP A;  2N05 A;  2L35 A;  4LWS B;  2OEX A;  2DYS C;  3NMI A;  3G4S V;  1NU7 D;  1LVK A;  4AE4 B;  4U3F H;  5LMN O;  3JAW A;  1TWA A;  5LP6 A;  1BR2 A;  3HLZ A;  3SXY A;  1KTM A;  3BPZ A;  5GPG B;  1VQK V;  2WLH A;  2XXA A;  1Q0D A;  5CBF A;  4DV2 B;  3U3B A;  4LF4 O;  3LNM B;  4H44 B;  3NMJ A;  3TK0 A;  2OTL V;  4JV5 B;  2YWA A;  5KHG A;  5H9C A;  3AK1 A;  3Q6N A;  4P9O A;  1ROP A;  1H8E G;  4UCS A;  2R7V A;  3F7V C;  3W2V A;  3CZ6 A;  4D7T A;  5LL6 Y;  3WAQ A;  2E3C A;  3ABT A;  1N32 B;  2UUC O;  1C03 A;  1S3J A;  2CNW D;  5IT9 N;  2HV6 A;  4QI2 A;  5B5E Z;  3C8Z A;  2HKO A;  2Q00 A;  1VQM V;  4MVO A;  2ZE8 A;  5EIB D;  4XDL A;  4FLT A;  5JUA A;  3W8I A;  2NSF A;  4CS3 A;  4WFH A;  4K3A A;  2QWR B;  3QTC A;  5H6R A;  1KU2 A;  4O2A A;  2H7B A;  2Y3B A;  2BE5 F;  4X62 B;  4N6C A;  4W8P A;  3K1I A;  3R2P A;  3LES A;  3ZQV A;  1PNK A;  3SJB C;  2DYR B;  2VWJ A;  3G6E V;  3STL C;  4FLV A;  3SYC A;  4NC3 A;  1S05 A;  2LIG A;  3DXR B;  1EN4 A;  1Q3E A;  1K33 A;  4DR4 O;  3RIP A;  4IRU A;  1MZF A;  3STZ C;  3ZED A;  1PNM A;  3K04 A;  1SQQ H;  4OIO F;  2UUC B;  1NBM G;  4B7K A;  2PUS A;  3MAQ A;  4NXM O;  5AGF A;  4FX5 A;  1NFO A;  1VQL V;  4LF9 O;  2ZXO A;  4ZLD A;  1QZX A;  2WZL A;  4O4I A;  1AIL A;  4JI7 O;  256B A;  1Q7Y W;  4DBR A;  3NKD A;  3AG1 B;  1OCZ B;  4G7O F;  1SZT A;  1TAE A;  2ZE7 A;  4X62 O;  3APO A;  2HSQ A;  5IY5 C;  1N8R W;  2M64 A;  5DVW A;  2EIK C;  2YI8 A;  2WLI B;  3CCQ V;  3RGB A;  2YEV B;  2BOC C;  4CDA A;  2YLG A;  4QDL A;  3HNL A;  4UCT A;  4XLN F;  1AVO B;  4IJJ A;  1FFX A;  1AR1 B;  3ASO C;  1MND A;  1WN0 A;  1OKK A;  1NSG B;  4YJ3 A;  3CJH B;  3SP1 A;  1FJG B;  5KLV H;  3U5S A;  2ZR3 A;  3OEO A;  3W4Y A;  3JD4 A;  2QWP B;  5B3S C;  4FES A;  1ORY A;  1L7C A;  2AP3 A;  1ZU5 A;  4AQY O;  4IHJ B;  5COM A;  1S77 D;  1OHH G;  3VBB A;  1OV9 A;  4LF9 B;  2UUB B;  5LMN B;  1BT8 A;  5EYP B;  3U10 A;  3EGX B;  1A7D A;  4O4J A;  4DV2 O;  1I5N A;  3K6B A;  2R7T A;  5CI8 A;  1ORJ A;  2LP7 A;  1UPG A;  3M4B A;  3U0C A;  4XBF A;  1K04 A;  3JSE O;  3LJB A;  4M63 A;  1GH6 A;  3JD2 A;  4RQF A;  1ZAU A;  3OMN B;  4YY3 O;  4CSA C;  1LM3 B;  3L70 H;  5LYJ A;  2XM0 A;  4YN0 B;  2XTA A;  1NH2 D;  1NFN A;  2GDS A;  4JI0 B;  3ZDL A;  4Z9J A;  2I8B A;  5JJJ B;  4B3S B;  3FAP B;  4TOI A;  1PP9 H;  4XDJ A;  2Z0A A;  3FAV B;  4DUY O;  1XNQ O;  3QVN A;  1ZW2 A;  3JD1 A;  2M7W A;  3N2K B;  4RWU A;  3C8G D;  2LFS A;  3JD3 A;  4JI1 O;  1VF5 B;  4U5H A;  1S7Z A;  2KQ9 A;  4BJ5 A;  3CRC A;  4MTF A;  5IJ9 B;  1BHA A;  5DED A;  1NU1 H;  1JFF A;  3JYY A;  3D36 C;  1ZHY A;  2B1I A;  2XUM A;  1JMK C;  1E86 A;  1EQ1 A;  5B1A B;  3E35 A;  3AK2 A;  3CXH F;  4I1O B;  5L3E A;  2EX3 A;  2Q8V A;  1GQA A;  4LNU B;  4UV9 A;  5J2T A;  5EBL C;  3CQZ A;  2R7Q A;  1HP8 A;  4X89 A;  2HSB A;  4FJC C;  2ZQM A;  3O6X A;  1D1B A;  1ZZP A;  3UT5 B;  4DV0 O;  5A9G A;  2LGQ A;  5FZT A;  2W9Y A;  4IAO A;  3U8P A;  2ZIN A;  4CDY A;  1Q6I A;  4TUY A;  3L71 H;  3AG4 B;  3S3W A;  2YKZ A;  5A2Q N;  1CGN A;  1AP5 A;  1VQP V;  1R3J C;  3WB1 A;  4ZKI A;  4FLW A;  2NLJ C;  3SJA C;  1US6 A;  3M99 B;  4C3D A;  4GYT A;  3NKE A;  3MYF A;  1JA8 A;  5KMG B;  2L6F A;  2ZXW B;  5JQG B;  1Q86 W;  1BSM A;  4G27 B;  3ZX6 A;  2CGE A;  1FFT B;  3BRC A;  3JAK A;  4J80 A;  5BQG A;  2BTO A;  1URF A;  1VQ6 V;  3CX5 F;  2LFF A;  3E8G A;  3MD0 A;  1O9H A;  2B0H A;  5IE9 A;  2DYS B;  2ETN A;  1XZQ A;  3DE9 A;  2JDI G;  5CBG A;  1FAF A;  4JJF A;  2ZDI C;  3U0Z A;  1I5Y A;  2EIJ B;  2ZE6 A;  2CUG A;  4DV3 B;  3B0U X;  4R6Z A;  4FFK A;  3P3N A;  1HNX O;  2E74 B;  3AJM A;  2OT5 A;  2IYL D;  3EFO B;  4DW0 A;  1IDS A;  1GTO A;  3FAV A;  4LFA O;  2EPM X;  2F23 A;  1T9K A;  4TUY B;  4B7E A;  1Q5O A;  2GTS A;  1ZHT A;  3HR0 A;  4CIH A;  4EB6 A;  1YSC A;  2XLE A;  2JEX A;  4CC5 A;  4KHP B;  4G7H F;  3M79 A;  1QR8 A;  1KD1 W;  2CW0 F;  3I56 V;  4Q20 A;  4IYI A;  2KK1 A;  1QQC A;  3FXH A;  4Z9H A;  2C2A A;  1PD3 A;  3E89 A;  4CZZ A;  2ZIM A;  1N36 O;  1R5I D;  4DV7 O;  1I94 B;  3C3T A;  4O2B B;  4CS9 A;  1PD1 A;  2Y69 B;  3GAN A;  4X8A A;  3ZRW B;  4J7J A;  4FM2 A;  3CC2 V;  4O79 A;  1JPX A;  1Q8I A;  2Y39 A;  3CCJ V;  2I15 A;  4OX9 B;  2WA3 A;  2F1M A;  3AG2 B;  3TJ6 A;  1X59 A;  2JK5 C;  1XL6 A;  3KYI A;  1M2V B;  3CE2 A;  4DRX A;  1G4W R;  1DF5 A;  5A69 A;  1Z5Z A;  2RCV A;  3A0R A;  3RYH A;  3W8H A;  5KYW B;  1KKC A;  2YL0 A;  2Q68 A;  2UUA O;  1HNX B;  1E2X A;  4O6N A;  4RBN A;  1D1A A;  2Y3D A;  5TJ5 E;  4ZI7 A;  1K97 A;  4EB6 B;  3OMI B;  1FD9 A;  2HR3 A;  1VLT A;  2Q5Z A;  3CMA V;  2JGD B;  4AL0 A;  2IXO A;  2HFI A;  1IXB A;  4PHZ A;  4MTX A;  1TWG A;  2R9I A;  4JEA A;  2HG5 C;  2UXC B;  4YJ3 B;  3VQY A;  5F5F A;  5K0I A;  1B3Q A;  3SPH A;  2RJZ A;  1APC A;  4X20 B;  3FKS G;  1M4U A;  5IYZ A;  2VQF B;  4I0X B;  1JAF A;  2UUH A;  4E2L A;  1KC8 W;  2FFH A;  2WL8 A;  4PA7 A;  1EM1 A;  1XIL A;  5AG2 A;  3X2Q B;  1OCO B;  1LUV A;  3F7Y C;  2CTP A;  1DLB A;  3G80 A;  3Q7L A;  2LFR A;  1YJ9 V;  4LFC O;  4BWA A;  3CP1 A;  5KHI A;  4E7S A;  1XUQ A;  4LF5 B;  1VQN V;  1V54 C;  5J2U A;  3N2Z B;  5LP6 B;  2XM4 A;  1H2G A;  4L6R A;  1JOG A;  1NI8 A;  2ZNJ A;  4QI0 A;  4NXN B;  5IDJ A;  1B06 A;  4ZI7 B;  4LF7 B;  1DF4 A;  1J95 A;  1SMY F;  1YDX A;  1FFT C;  2CDQ A;  1N1C A;  1RCP A;  5KUM A;  3GEI A;  4X64 O;  2D3O W;  3F46 A;  1DK1 A;  4UVB A;  2EJ7 A;  4O7G A;  2IXN A;  3A8T A;  1TWH A;  3CAX A;  3DMD A;  4O4J B;  3RVZ A;  2WVN A;  3TJ5 A;  1F4N A;  4HNA A;  1IBM O;  1D0Z A;  1KMI Z;  2NUT B;  3K79 A;  2E5L O;  2IXM A;  4CJG A;  1JMW A;  3CS5 A;  4QPJ A;  2NUP B;  3ZIB A;  3HKE B;  1HW2 A;  4CH6 A;  4DOZ A;  3JAR B;  4AI8 A;  1Q0G A;  2YVK A;  1D5A A;  3N27 A;  2KKW A;  3SPI A;  3NG1 A;  4LFC B;  4DR2 B;  1BMF G;  3FB8 C;  1MSD A;  1XNR B;  3B71 A;  3GM3 A;  4JTD B;  4X1K B;  4NQF A;  5F5H A;  4KHP O;  1NKD A;  3K9A A;  3OTO B;  3Q6M A;  2J0X A;  1YI2 V;  3K66 A;  1CEZ A;  2QGN A;  3K5O A;  3ZN0 A;  5IYC O;  3W7W A;  1I94 O;  1ZHX A;  2R7R A;  2DN9 A;  3EG9 A;  2WAM A;  1T5O A;  3SYN A;  2IOQ A;  5GTI Z;  4I7Z B;  1H6G A;  2CNW A;  4EWC A;  5LP6 C;  3HNI A;  3PCV A;  4HFK B;  2NSG A;  4LLC A;  3D8C A;  1WP7 A;  3OW2 U;  1PPJ H;  2MWQ A;  3GWL A;  1C17 M;  2WLN A;  3NR7 A;  2OIG A;  3H2U A;  2JJ1 G;  5DEC A;  2IU0 A;  2IM8 A;  5FNV A;  1VF6 A;  5DS6 A;  5BR8 O;  3LUT B;  1TR2 A;  4JAA A;  2Y4U A;  1R4T A;  3US6 A;  2LJ2 A;  5A6B A;  3LSS A;  5J2U B;  4DR6 O;  3CRM A;  1RSO A;  1DOV A;  4JYY A;  3E8H A;  2WLM A;  2Q69 A;  2Q4P A;  4ZLC A;  3J06 A;  1JVM A;  4MQ9 F;  1EBO A;  3LLI A;  5CN0 A;  3DGE A;  2GBO A;  2Q9C A;  4ZHQ B;  1IZM A;  2ASR A;  3LAY A;  1VMG A;  3EH1 A;  1RP3 B;  4DR7 B;  1T6I A;  3L75 H;  5CBH A;  4AX2 A;  2OCC B;  4B3T O;  2Z15 A;  4ASU G;  2J45 A;  2PF4 E;  2VQE B;  4GKJ O;  5L0G A;  5L0I A;  4IAQ A;  4RUF A;  3QO7 A;  1FXH A;  1YJW V;  1TFO B;  3HNK A;  4DO2 A;  4J7T A;  1M1K W;  3ZMS A;  4LF6 B;  3K3W A;  2QWQ B;  4FFB B;  4LF5 O;  3SNH A;  5EYP A;  3TQO A;  4FVM A;  2H8A A;  3K5N A;  3RYI A;  5J9P C;  2VAS A;  3UO2 A;  5JCO C;  3RT3 C;  3JTL O;  3GVM A;  1YZA A;  2Y3G A;  5A6A A;  4BIO A;  4A2N B;  2P61 A;  5FCL A;  1MAB G;  3N2G A;  1BQZ A;  3GEE A;  5KYY B;  1YJG A;  1OR3 A;  3BHP A;  4LFB O;  4ICG A;  4JKV A;  3H1H H;  5LYJ B;  1S5H C;  4KBL A;  3RQF A;  3T4Z A;  4I44 A;  1MNG A;  3GM1 A;  3HKB A;  1ZYR F;  3S9O A;  3JCZ A;  1BBH A;  3EFF K;  3SYO A;  2ADP A;  4E0H A;  3X1O A;  4EFE A;  1WB8 A;  3I5P A;  1Q0K A;  1JR9 A;  1VQ4 V;  1YAR O;  2E75 B;  3IEE A;  4J11 A;  3BEH A;  1K4D C;  1E79 G;  1XNR O;  5C93 A;  4Z2W A;  1YYJ A;  3ZSU A;  4OIQ F;  3A0H Z;  1Q82 W;  5E1A C;  3X2Q C;  3HNJ A;  2Y0P A;  4YJ2 A;  4MSW C;  2DI3 A;  3ZRV A;  2X0C A;  2JJ2 G;  1MA1 A;  2JGD A;  2Q9A A;  4JI5 B;  4P6I C;  2QTV A;  2OCH A;  4K0K B;  3U8V A;  2XS8 A;  4LFB B;  3DAF A;  4DK1 A;  4BG0 A;  1CXZ B;  1QQ3 A;  1WPX A;  5KHH A;  1EN6 A;  3UMH A;  1SS3 A;  1CGM E;  3T9O A;  2W4M A;  1VQO V;  1L3P A;  1QLE B;  3JRT A;  1NZ6 A;  4XQ1 A;  1G8M A;  4RO2 A;  4DRJ B;  1BS3 A;  2YL1 A;  3GEH A;  4YK5 A;  4FWV A;  4B3M O;  4HFF B;  1FKA O;  2NUT A;  3T6J A;  4K7B A;  4LDK A;  5E2Q A;  4BW9 A;  3NYJ A;  3CRA A;  3RWR D;  2LSE A;  1KUQ A;  2VC9 A;  3QW1 A;  1T5E A;  4P9T A;  1IW7 F;  4CIP A;  2D5R B;  4CH5 A;  4BIU A;  3PMR A;  5L3D A;  3DC5 A;  4JRZ A;  4HYO A;  1P84 F;  3DI5 A;  1AR5 A;  4F4L A;  2VQE O;  2XLO A;  5JWP A;  1NTK H;  2P1A A;  4PJN A;  2R7X A;  3WFV A;  3RYC B;  1H9G A;  2A6H F;  1V4A A;  1M57 C;  3RYF A;  3RFR A;  4QGP A;  1L0N H;  2EIL B;  1WGW A;  3E9V A;  1K5S A;  2FAP B;  4FK5 C;  4BJ6 A;  4W4K A;  3ZHU A;  3JCU Z;  1HE9 A;  1NQT A;  4WFG A;  3JAR A;  3I5D A;  1IUR A;  4PA3 A;  2N04 A;  3QNE A;  3TET A;  2YDE A;  1RKC A;  4XTK A;  4GX2 A;  1I5X A;  3H2V A;  3JD0 A;  3K1I C;  4AIL C;  4PFP A;  3JAK B;  1X4T A;  1YJN V;  2A3Q A;  2XLW A;  3QZC A;  2O57 A;  4U5F E;  5KYX A;  2A06 H;  3T6B A;  3RYH B;  2AXT Z;  3JZ0 A;  4I55 A;  5FNV B;  2XAS A;  1EKY A;  5L3F A;  2JX0 A;  1MG1 A;  3EG9 B;  3N0T A;  1QSP A;  4LP8 A;  2LQT A;  1BGY H;  3QMK A;  5JJE B;  4TV9 B;  2J7P A;  2A6E F;  2HS5 A;  3I4U A;  2XL6 A;  4YL0 A;  4MTG A;  2QR4 A;  2NNU A;  1RM1 B;  2QM4 A;  4IHJ A;  1V54 B;  1R73 A;  1TUB A;  1FYJ A;  1Q81 W;  2CAZ C;  2XS1 A;  1LS4 A;  1CPY A;  5CA1 A;  4DBQ A;  3W7U A;  2ZM6 B;  4OPA A;  2WWW A;  4JI3 O;  1FJG O;  4NTY A;  5DS4 A;  4MW8 A;  2RMK B;  4KUM A;  4UDV A;  2V26 A;  3C3S A;  3FDQ A;  1HW1 A;  1MMA A;  1G5Z A;  2HZ8 A;  3B09 A;  3LSU A;  3DM9 B;  4J30 B;  1Y74 B;  2FYU H;  1AJP A;  3B0P A;  1BR4 A;  4BJ1 A;  2J0W A;  3AEI A;  4QIW F;  3T1H B;  2YXY A;  3EZH A;  2ETS A;  2UUA B;  2QNL A;  1WAS A;  3AQB A;  2XSE A;  2Q4F A;  3EHM A;  3DM5 A;  4N23 A;  1HNZ B;  3K06 A;  3GOR A;  1AI4 A;  2BSK B;  3OE7 G;  1N0J A;  4MVU A;  1A0B A;  2QEX V;  2R7O A;  3UQ8 A;  1ZHZ A;  3NXS A;  1K40 A;  2HKV A;  3ZHT A;  1D2D A;  3TOL A;  1TUE B;  3AG2 C;  3L34 A;  2F66 C;  1RM1 C;  1F7Y A;  1XNQ B;  2L6H A;  3WU2 Z;  1OZ0 A;  2ITD C;  3SJQ C;  2OG2 A;  4TQF A;  2R9R B;  1WLE A;  4OXS A;  3V5Y A;  1YIT V;  4DR3 O;  2VQF O;  1ARO P;  5T3T A;  3OEE G;  5DS5 A;  1M56 C;  5IYB O;  3E70 C;  5IY5 B;  2HP8 A;  4BEM J;  3NYL A;  1RPO A;  5LGU A;  1BL8 A;  4ZBM A;  1WPB A;  4PA9 A;  1LE2 A;  4PDL A;  1M2O A;  2E87 A;  4YT2 A;  5L0H A;  2ZXW C;  2HFE C;  3RKO F;  3FOO A;  3LEO A;  4B3S O;  2J7P D;  2XT9 A;  2XND G;  1XEQ A;  4PJ0 Z;  3B2E E;  2MYS A;  2GHY A;  3A0B Z;  5LXT A;  2UXB B;  2HJF C;  1MMG A;  2PBE A;  1Z6A A;  1WTY A;  5JVD B;  3JAS B;  2ZCE A;  2PFD A;  2OKU A;  4P9F A;  4QNH B;  1EZV H;  2CTW A;  1Z2G A;  3A2F A;  3EFO A;  5HSW A;  5FLX N;  4DV6 B;  4D7S A;  3CD6 V;  4L8J A;  4RAI A;  1QR9 A;  3D3Q A;  1THZ A;  2VRZ A;  1WP8 A;  3QF7 A;  4YJW A;  2ODM A;  4GKK B;  1JPJ A;  3FAJ A;  2LQG A;  3BAA A;  4JZA A;  2E5L B;  5EBW C;  3OGC C;  2YUA A;  3MFN A;  1VF6 C;  4KXR A;  1PD0 A;  1SYQ A;  3TD7 A;  1XRE A;  3FMS A;  3ZRW A;  1OCZ C;  1Q6U A;  3CCV V;  1Y4M A;  4JAS A;  4CS2 A;  1HNW B;  2FGY A;  3GWN A;  1HR0 B;  2H8P C;  2GA0 A;  4X65 B;  5A6J A;  1EFR G;  4DR2 O;  1ZU4 A;  2OWO A;  4D4N A;  2W6I G;  1NU9 C;  3FX7 A;  1YIJ V;  3CRR A;  4JI6 B;  4TQD A;  4NB5 A;  1MNE A;  3JAS A;  3JSN A;  1E1Q G;  3VF0 A;  1W2B U;  4N6H A;  2WZG A;  2AVK A;  2Q3T A;  4Z9I A;  4LDR A;  1YLM A;  3DKA A;  3U9J A;  2GWW A;  4I5S A;  4KNV A;  4DV4 O;  2QE7 G;  3FD9 A;  1F51 A;  3DE8 A;  4DV6 O;  1SES A;  1COW G;  3HKD A;  3LDD A;  3ECS A;  1UJW B;  2ADQ B;  1HMO A;  4MND A;  1WA8 A;  2EIM C;  2HVK C;  2W6J G;  3C8G B;  1V74 B;  5L0C A;  3AG3 C;  3T1Y B;  2NPU A;  5BXZ A;  3IC7 A;  2P90 A;  1XMQ B;  2P67 A;  2QKC A;  1XBL A;  1NVP D;  1OQC A;  3HTK C;  2R70 A;  3ASN C;  4BIZ A;  2HHH O;  1H8H G;  2DQ0 A;  1OW6 A;  4C3E A;  5JS5 A;  2X0L A;  1KBH A;  3QTH A;  3S0X A;  4HBN A;  5JVE A;  3S84 A;  4X65 O;  1IX9 A;  2QUP A;  3DC6 A;  2Z5U A;  1UFI A;  3G67 A;  4N06 A;  3K0D A;  2MK3 A;  2OU6 A;  1SQV H;  3E2E A;  2XLM A;  1SQF A;  2AGA A;  2LO1 A;  4DR4 B;  1HE1 A;  1LPE A;  2QM7 A;  1J5E O;  5B1N A;  4DV5 O;  1VQ5 V;  1W2W A;  3CSX A;  5T3W A;  1F4M A;  4JYA B;  1A41 A;  3ZTM A;  2CGO A;  1Q90 D;  4D6T H;  1SQX H;  2F43 G;  3C8G A;  4DYL A;  1MZE A;  3ABM B;  1O87 A;  1H2N A;  3IQC A;  4F4B A;  4TV9 A;  2A69 F;  4OD5 A;  3L8J A;  1Y66 A;  3BRJ A;  3WG7 B;  2A1D D;  2V4D A;  5CB4 B;  1OW7 A;  1GN4 A;  2J9V A;  4J7Y A;  2B9Z A;  1ORS C;  1PL4 A;  4JYC A;  2Q7E A;  2UXB O;  4NCQ A;  3C7J A;  5L3B A;  2KQX A;  5KAI Z;  1NR7 A;  3AG3 B;  2XLH A;  5B3S B;  1E1R G;  2IXP A;  4O4L B;  5B1A C;  4WGY A;  4NTX A;  5L3Q A;  3M4C A;  2XRH A;  4XEF A;  3KG2 A;  3JAL B;  4E4E A;  4DVY P;  3U9M A;  3QG5 A;  1SQG A;  3G4X A;  1QHT A;  5K1X A;  4BAY A;  3ZHR A;  4LF8 O;  4U5D E;  5DQT A;  3FYI B;  2YRF A;  4H0L B;  2KYH A;  1M6T A;  4JI1 B;  5LMU O;  1WWP A;  3UCS C;  4HE8 D;  1PCX A;  2EBO A;  3Q4H A;  1OKK D;  3QVY A;  4GUN A;  2XAF A;  2A0B A;  3HKC A;  4CBE A;  1YZB A;  3OR6 C;  4JC7 A;  4FLY A;  3ZBH A;  5KAF Z;  4X1K A;  2PX0 A;  4JCZ A;  2WLI A;  3ZMT A;  1JCH A;  2RD9 A;  3RVY A;  4FMT A;  4PDR A;  1YVW A;  1M2V A;  2KSF A;  3LS1 A;  3J80 N;  1JPN A;  2B1G A;  3H1I H;  3WG7 C;  2L81 A;  1D0Y A;  4CH3 A;  1M5I A;  1BR1 A;  1YTF D;  2IU3 A;  2HVJ C;  2VS0 A;  1H2K A;  1VMA A;  4EHP A;  2DQ3 A;  3OTO O;  1IBM B;  2J9B A;  2MHR A;  2XXA B;  4Q6G A;  5E3A A;  1QNM A;  3ETE A;  4BEJ A;  2YIC A;  4CS4 A;  4UB8 Z;  5A6B D;  1V55 C;  2EZP A;  2L9J A;  4I4T B;  2NN4 A;  2QTO A;  1DOW A;  1R6N A;  5KX5 B;  4CS7 A;  4FLU A;  3AOU A;  5IYD O;  2IH3 C;  5GTH Z;  1J8M F;  2JIZ G;  4CSA A;  4UCO A;  2L6L A;  3HKC B;  3CCS V;  2Z3Y A;  4ER9 A;  4NTF A;  2RQ6 A;  4B3M B;  4DRH B;  3IQ5 A;  2JD3 A;  2Q7G A;  4KC9 A;  1K9M W;  4O4L A;  3UR3 C;  4K8Z A;  4CX9 A;  1U0B B;  1RMV A;  3ZMV A;  1SC5 B;  3TXS A;  4DV3 O;  2Q7R A;  5L0J A;  1AR4 A;  5C8Y A;  2LW1 A;  3M15 A;  3M1C B;  2EZO A;  4G0H A;  4IB4 A;  1BZK A;  4DJ9 A;  3L73 H;  5BR8 B;  1FR0 A;  2QJ1 A;  4AK9 A;  2ZPA A;  4JI4 O;  4FIP C;  1FMV A;  2KC3 A;  2VCA A;  1QLN A;  3E8F A;  1H38 A;  5DM6 V;  4DR6 B;  4LR3 A;  1VTM P;  4OIP F;  4UVA A;  2JS3 A;  2OTJ V;  5KYY A;  4ANJ A;  3NYM A;  2JS5 A;  3K0G A;  3VYW A;  1BDJ B;  2XLV A;  3L8I A;  2PP4 A;  4J10 A;  1JR8 A;  1R3K C;  2J8W A;  2Q9B A;  3SPG A;  1NG1 A;  3M8A A;  1CPR A;  1YA9 A;  2ZR2 A;  3JAT A;  5B1B B;  2HJD A;  4C7O B;  4PK4 A;  3F5W C;  1GO3 F;  3RQE A;  4JI2 O;  2R72 A;  2KG7 B;  1UFB A;  4I3M A;  5A6K A;  4JI8 B;  3HB3 B;  1YZC A;  1ORQ C;  1H7I A;  1T6Q A;  3ZIA G;  2PI4 A;  1VYI A;  4MVZ A;  5KHK A;  3N2G B;  3E8B A;  5CMU A;  3ETG A;  3ETD A;  4F6R B;  5C8Y B;  4FM0 A;  1BCC H;  3BVO A;  3IFX A;  1XDC A;  3KCY A;  4UB6 Z;  3U3F A;  3ZHV A;  2JEU A;  2XAH A;  3ZRX A;  4WF9 V;  4X1Y B;  1AP6 A;  2Q9L A;  4PDM A;  4A5U B;  3JCU Q;  3QW0 A;  4Q4Z F;  5EK0 A;  2CTR A;  5D92 A;  1NVP B;  3LNN A;  4QPK A;  4PR9 A;  2RN9 A;  1W0J G;  4KNW A;  2X51 A;  2YZS A;  3JAM N;  4PJJ A;  3DJU B;  1GK9 A;  2EIM B;  1WN7 A;  2UXC O;  1LR1 A;  3FB6 C;  2YS8 A;  4ULV A;  1U96 A;  2AW9 A;  4CS8 A;  3DTU B;  4CH4 A;  1Y6X A;  4H54 A;  3LSQ A;  3CME V;  2P0N A;  3FHD A;  4NKG B;  4HAM A;  1A7V A;  3UMK A;  2ILM A;  4MVM A;  4JI8 O;  1HMD A;  3IC9 A;  3U2L A;  3OT7 A;  2V1D A;  1YHQ V;  1TWC A;  1S5J A;  5JH7 B;  2LFD A;  2KSD A;  2ZE5 A;  4J9Z B;  1P4R A;  3VAY A;  1I4Y A;  4DK0 A;  3L74 H;  2Y69 C;  3ETQ A;  1NT2 B;  2IJI A;  2EPO A;  4P9P A;  2VWK A;  1GMG A;  2PX3 A;  2GDC A;  3B40 A;  2YID A;  5LOV B;  4IL6 Z;  2RSE B;  3C62 A;  3VOU A;  3IAY A;  1G4U S;  2EPL X;  3RFY A;  3CC4 V;  1XHZ A;  3OUF A;  4Z1V A;  2UU9 B;  1QCE A;  2WLL B;  2QM8 A;  4C7O A;  3P32 A;  2ATK C;  4I50 A;  1GN2 A;  1SQP H;  1Y76 A;  3SYP A;  5BMV A;  4DRX B;  4IT5 A;  3S28 A;  3R66 A;  1JOY A;  3UGP A;  4B3R B;  1M90 W;  2NR5 A;  1KQS U;  1NS1 A;  2PNO A;  4K1O A;  3G6B A;  5BQH A;  1VF7 A;  4K0K O;  4PJM A;  2DW4 A;  1PV0 A;  3Q4H B;  3CCM V;  2VB6 A;  4DUZ B;  2B0J A;  3K7D A;  3V5X A;  1GN6 A;  1RPR A;  2EPK X;  2OIE A;  3JAW B;  4J9Y B;  1I4Z A;  2NG1 A;  5HFM A;  3RH3 A;  2ICW G;  1OCR B;  1HWY A;  1N34 O;  3EJN A;  3SYQ A;  3RYC A;  1XOU A;  1BE3 H;  5KYX B;  3D3I A;  1SZI A;  3C90 A;  4H13 B;  3C63 A;  3H9V A;  2HUJ A;  3G50 A;  4UXN A;  3R65 A;  1V9P A;  3SR2 C;  2GTA A;  1GS9 A;  3ASN B;  1KNY A;  5IJ0 B;  4X88 A;  4U5C E;  1XMO O;  2GV9 A;  3IHU A;  3HKB B;  1IBL B;  1G1X B;  4BJ6 C;  5BMV B;  1SER A;  3MHS C;  5IYZ B;  4LH7 A;  5BQI A;  1BHB A;  2FML A;  4NTB A;  3AG4 C;  4DV0 B;  1ZW3 A;  3DAG A;  3LLK A;  3L72 H;  4I4T A;  3AK3 A;  1KKD A;  2H7O A;  2IJH A;  5KA6 A;  5E33 A;  1EI7 A;  4DVZ A;  1R6T A;  4YWQ A;  1QVF U;  3B77 A;  3UNG C;  4L87 A;  2C04 A;  2BCC H;  1H2M A;  4KI2 A;  1GM5 A;  5E3C A;  2P4K A;  3K5L A;  3DJN B;  3S90 A;  2YQY A;  4B08 A;  1ZWI C;  2QKA A;  4JI6 O;  4FLX A;  3O55 A;  4JVS A;  4UFZ A;  1RJ9 B;  1RXQ A;  3P30 A;  2QSA A;  4R32 A;  4E7Z A;  3AG7 A;  5KYU A;  1FMW A;  2XLD A;  3K03 A;  2OJE D;  3EPV A;  4FZ1 A;  5EGY A;  1RKE B;  1OCC B;  4XLP F;  5LHI A;  3ASO B;  2P22 C;  1I08 A;  3DXJ F;  4O4H B;  1H2L A;  4EFB A;  1Y76 B;  1AB3 A;  5JLI A;  3HKE A;  2R7S A;  2EPN A;  3OEH G;  4J42 A;  5DQZ A;  2WPD G;  2G3K A;  4LFA B;  1AJN A;  3JAT B;  2ZM6 O;  1D5N A;  5EHH A;  2OCC C;  3FVY A;  3ZJZ A;  1NBB A;  2XOK G;  3L9D A;  4U9D A;  1KU9 A;  1AJQ A;  1TVK A;  1VP7 A;  2UXD B;  3H01 A;  3I5Q A;  1K05 A;  2KG7 A;  1FTS A;  4LER A;  1VIB A;  2R03 A;  1XWJ A;  3B8N A;  3T2M A;  1GAX A;  3FOP A;  3I55 V;  4K8X A;  4GX5 A;  4TV8 B;  1OW8 A;  4U7N A;  3T1H O;  2FB5 A;  5D5P A;  3MBG A;  3F47 A;  2PI5 A;  1B6Q A;  1QKR A;  1SA0 B;  2AZ0 A;  2G62 A;  5AC5 A;  2AZ2 A;  4JYA O;  4K35 A;  2QDO A;  1YCI A;  1NZE A;  2Q7H A;  1KEC A;  3RYF B;  4R7C A;  1GM8 A;  5LHG A;  4N21 A;  1O9G A;  1M93 A;  1ZX3 A;  2F4V O;  4CBC A;  4LWS A;  4YT8 A;  2ZT9 B;  4Q7C A;  3O65 A;  1LNQ A;  3S27 A;  4NVP A;  1ZSP A;  2Y0I A;  1N34 B;  1CGO A;  1FFH A;  1U89 A;  3IQT A;  4XEV A;  1YF2 A;  1HW7 A;  1IBK O;  4I9W A;  4X0R A;  1NJI W;  3G4Z A;  3QVZ A;  4DR3 B;  3OM3 B;  4IGG A;  1K3E A;  4I0X A;  3SXM A;  1KYO F;  1W0K G;  4ABM A;  4CC6 A;  1FXK A;  4MW3 A;  4TV8 A;  3KKY A;  4ZHQ A;  2XL8 A;  2J46 A;  2R02 A;  4G2K A;  2Q6A A;  2W4B A;  1P49 A;  3CCL V;  4H4K C;  1SQB H;  5JH7 A;  1WNS A;  3OAA G;  1RKE A;  3IPM O;  5JSL A;  2PZS A;  3B4S A;  3U2M A;  1VYK A;  4G78 A;  2AU5 A;  3CPW U;  2V3C C;  5CI9 A;  3KKB A;  3ICX A;  4WFB V;  2F4V B;  4W8K A;  1L1F A;  5CA1 B;  2IBF A;  2A9H A;  3THO A;  3K5M A;  1UG7 A;  2PYJ A;  3JRM O;  2L7A A;  2BC5 A;  3CCR V;  4G28 B;  1IBK B;  4JAU A;  5KHJ A;  5JJN B;  4H37 A;  2G3V A;  1OXB A;  1K5Q A;  4LDQ A;  2R9A A;  3RN4 A;  5HV9 A;  1OCR C;  3TOM A;  3DXR A;  4PA4 A;  4IIJ B;  3K57 A;  2W0X A;  2YIA A;  2WVO A;  4OPH A;  2WSS G;  5EZY B;  4X20 A;  1R3L C;  2P4V A;  2GUZ B;  1LI7 A;  3H1L H;  1SA0 A;  2X7R B;  3PJS K;  4MS2 A;  2YL3 A;  1YXB A;  3H1J H;  4EBB A;  4PD4 F;  5L3C A;  4X9Q A;  1N33 B;  3UGO A;  4W4L A;  4U5G A;  4O2A B;  3TUL A;  4LLE A;  1WOL A;  4O4I B;  5GON A;  5TIS Z;  4LAC B;  3ZCC A;  3U11 A;  1Q0M A;  1HR0 O;  2UXD O;  1W59 A;  3T1Y O;  3ZWI A;  1JRA A;  4NR1 A;  1M56 B;  3OUS A;  1N0N A;  3F5T A;  2V7Q G;  1Q6H A;  2CH7 B;  5CB4 A;  1TGO A;  1QLE C;  5CA0 A;  2DB4 A;  3K1H A;  5ITZ A;  1FXK B;  1LIH A;  4IYH A;  1A32 A;  1N4C A;  1K4C C;  4LCU C;  4JI0 O;  3VQX A;  4X1Y A;  2BSK A;  1ZTE A;  2Y4T A;  1OCC C;  4LF4 B;  3O9O A;  4YT5 A;  2X6B A;  3A11 A;  4E17 A;  4PI0 A;  1IVS A;  4I9Q A;  1XMQ O;  4WAB A;  1OJH A;  1G6U A;  1QPU A;  1SF8 A;  2AWC A;  4JCH A;  3SZR A;  5LBQ A;  1MMM A;  4U5B E;  2MW2 B;  5EC2 C;  4JIO A;  5KUK A;  4N4W A;  3KL4 A;  5FPO A;  3EGX A;  1K34 A;  2ZDI A;  4B6I A;  3L1M A;  4JPR A;  3HJC A;  3T4D A;  1Z23 A;  1F1M A;  1JQ0 A;  2PTM A;  1H2S B;  5KYW A;  1FAP B;  3SXK A;  3KCX A;  4LBE C;  1RJ9 A;  4I1M A;  4BPM A;  3JYC A;  5KYU B;  2IM9 A;  5COG A;  3CJH A;  3CRQ A;  3PHF 2;  3H1K H;  1NTZ H;  5LXT B;  4NY3 A;  2M6Y A;  2JVD A;  3ML0 A;  3OMA B;  1AVM A;  3TK1 A;  1B68 A;  3OA1 A;  3NMK A;  5T1D B;  3HPL C;  1OXK A;  1YAU O;  1MSW D;  2YIB D;  3QO5 A;  4LF8 B;  4PA6 A;  1YYX A;  3TXQ A;  5GON B;  2CYD A;  5H6Q A;  3B0V C;  3T1C A;  1S0V A;  4PAC A;  5B3I A;  4OX9 O;  2M4E A;  5H5N A;  1ZVZ A;  2GFH A;  2WA4 A;  4Z1M G;  3BA9 A;  4I55 B;  1QVX A;  3HKK A;  4F6E A;  3E22 A;  2VCB A;  2HLD G;  1LUW A;  1AI5 A;  2N74 A;  2QA4 V;  1ZLZ A;  2W0F C;  4RDA A;  2AHZ A;  4RQE A;  2OYQ A;  4D4X A;  3SYA A;  5D5Q A;  2PGG A;  4PI2 A;  1LS1 A;  4O6Y A;  4ZOL B;  2LD6 A;  2HV7 A;  1QVG U;  3VQW A;  5LMU B;  5JRA A;  4YJ2 B;  1VOM A;  1VK5 A;  1WAZ A;  1ZUQ A;  1SKV A;  2DWE C;  2YSU B;  3KPH A;  4R50 A;  3APQ A;  2KW3 C;  1QBZ A;  1TUB B;  1JJO A;  5K1P A;  3HKD B;  1TA8 A;  3RBZ A;  1XQ8 A;  4JI7 B;  1L0L H;  1Z5W A;  3RYI B;  5LOV A;  3WHN A;  2ZKO A;  1G8X A;  4KP4 A;  1TQG A;  2XAG A;  4JZG A;  3W7S A;  2X6A A;  4DR1 B;  5J2T B;  4TT3 G;  4JAV A;  1PKX A;  1R6K A;  4FPP A;  5L3G A;  4AQY B;  2VCC A;  4MVS A;  2CK3 G;  2GAQ A;  1SET A;  3K33 A;  4DV1 B;  4PEL A;  1F23 A;  2F93 B;  1HNW O;  1Z5V A;  3GM2 A;  4OIR F;  2R7W A;  1VAR A;  5LA6 B;  1YVI A;  4DUZ O;  4JEB A;  4XPX A;  2IH1 C;  3OR7 C;  1YDI A;  3ZTZ A;  1WJZ A;  3SEO A;  2UUI A;  4NXN O;  1KB9 F;  2J9U A;  2JRI A;  2J9W A;  1SRY A;  3JSZ A;  4JF3 A;  1LE4 A;  5LGT A;  5KMG A;  4GEH A;  5JQG A;  3ABL C;  3EXA A;  4ONS A;  4JI5 O;  1ZHW A;  1Z7Q c;  5HFL A;  1HDJ A;  2A0L A;  4PJL A;  2HMZ A;  2GUZ A;  3EGD A;  3V7O A;  4UUJ C;  2EIN C;  5COF A;  1R3I C;  4DR1 O;  1EA8 A;  3RQG A;  4OGQ B;  5IWA O;  3ABL B;  3IJ4 A;  4DXW A;  1E83 A;  3AGT A;  2WZF A;  2LCH A;  3VRC A;  4YY3 B;  2JGU A;  4FLZ A;  2QWO B;  4FAP B;  2EIL C;  3CXC U;  3BA8 A;  5D91 A;  1T01 A;  3ZVR A;  5JT4 A;  4NYK A;  2P5O A;  3ZRS A;  2CDY A;  4DUY B;  5CIV A;  5JVD A;  3SPC A;  4LF7 O;  1FXV A;  3UMI A;  4GX0 A;  4DW1 A;  3WB2 A;  4R8C A;  4LC1 A;  3SJC C;  2Y48 A;  5ITZ B;  2YHS A;  1AUE A;  2XL4 A;  1Y4C A;  1TFK B;  5B1B C;  1JX9 A;  2H3O A;  2H94 A;  3WOD F;  4O4H A;  3AG1 C;  3V5Z A;  2YLD A;  3EGD B;  2Q0A A;  2P7V A;  4WBN B;  4QJF B;  1K7D A;  3B8M A;  2KNH A;  4J7K A;  2DOS A;  2ITC C;  3PDM P;  3IQ6 A;  3KMI A;  1S76 D;  1JFF B;  3CYO A;  3DWW A;  3O10 A;  4J7Z A;  1NLX A;  2P6V A;  4J32 B;  3JSL A;  2LP4 A;  3ZQY A;  4EEQ A;  2JPU A;  3POV A;  2EIN B;  1VB5 A;  5LA6 A;  1CP9 A;  1Y6D A;  4XPY A;  3BY6 A;  2A7W A;  1Q0F A;  5FPR A;  4GQH A;  4AL1 A;  2A0U A;  1FNT c;  2IJJ A;  4UCU A;  4IAR A;  5E79 Z;  1YA7 O;  3EHN A;  4DRI B;  2KB1 A;  3UO3 A;  2AWY A;  3AGU A;  3ZN1 A;  4YXW G;  3TJT A;  3KYJ A;  4DV5 B;  3UT5 A;  2EIK B;  1K73 W;  2YL7 A;  1WB7 A;  4JI3 B;  3DD7 A;  2ZXP A;  4WFA V;  4JW1 A;  4U3J B;  2CTQ A;  2WVQ A;  1WA8 B;  5EIB C;  4NXM B;  2E76 B;  4LNU A;  3EH2 A;  5B66 Z;  1B04 A;  4UVC A;  1MQV A;  4PV1 B;  4UCR A;  1L8D A;  4O6M A;  3CEX A;  2K9P A;  2NUP A;  1AI7 A;  4UV8 A;  4OIN F;  3T6G B;  2Q67 A;  1O3U A;  1VQ8 V;  1YTF B;  4JTC B;  2BTQ A;  5JCO A;  4GYC B;  4RUE A;  4GX1 A;  4MVQ A;  5L0D A;  2C03 A;  4GT1 A;  2ZIO A;  4JUR I;  4YL1 A;  3ATP A;  1G4Y B;  2O9X A;  3QO8 A;  1C02 A;  3LNR A;  3CHX A;  1P7B A;  2F95 B;  3ZHQ A;  2YI9 A;  3R7C A;  1MOF A;  3NDB B;  3W7X A;  2QLA A;  3J7A U;  1FFX B;  2BL2 A;  1XI1 A;  3KH2 A;  1D0X A;  4XPW A;  3ZS8 C;  2KGO A;  5L0F A;  1MMD A;  2HEP A;  2CCY A;  3K08 A;  3FB5 C;  4DV7 B;  4IIJ A;  4HNA B;  1DTO A;  3E22 B;  4JJG A;  2P7T C;  5IJ0 A;  1LKX A;  4B3T B;  2DYR C;  5IWA B;  1VQ9 V;  2LK4 A;  5BUO A;  2EIJ C;  2R25 A;  1I0H A;  4P2Z A;  1EZJ A;  1R1B A;  1ST6 A;  4MVR A;  3GB7 C;  3IGA C;  5F28 E;  2D4U A;  4U7O A;  1GKF A;  1Y74 A;  2YXL A;  3GOD A;  2UUB O;  1PNL A;  2AHY A;  1FXK C;  3LDC A;  1U6H A;  3RYL A;  4EBK A;  1RFY A;  5FL7 G;  2XHB A;  2QKS A;  4BJT A;  4LF6 O;  1ZL8 B;  4WGZ A;  2R7U A;  3G71 V;  4YT4 A;  4GZR B;  3CC7 V;  2DMX A;  4KFM A;  3VQV A;  4BW5 A;  4XEK A;  5EBM C;  1RSO B;  2KJG A;  3MDS A;  1VQ7 V;  1IZ3 A;  2OOC A;  5BY1 A;  3ABK B;  3WB0 A;  3JAL A;  2PYL A;  1DGS A;  3M7M X;  3L0I A;  1U97 A;  1OCO C;  2Q0O C;  5CA0 B;  4JI4 B;  1FS0 G;  4YHH B;  4GKK O;  4NTA A;  1K92 A;  5EC1 C;  2UXN A;  4LH6 A;  3ABK C;  3LDE A;  3SGI A;  4QE7 A;  1XL4 A;  3N2K A;  4YL3 A;  4UCV A;  5KA5 A;  1AEP A;  1Z3I X;  4X64 B;  1BQ0 A;  4A4A A;  4GLX A;  2BTQ B;  3S29 A;  3VM6 A;  2DE0 X;  3CEI A;  1ZL8 A;  4HZ3 A;  5DN6 G;  3EZI A;  4FFB A;  1BZ4 A;  2BOB C;  2IJK A;  1A7E A;  2WLL A;  4P30 A;  4DR5 B;  4WJ0 A;  4CS9 C;  2A68 F;  1TVK B;  2A79 B;  2IW5 A;  4ULW A;  3K59 A;  2Y3H A;  1S5L Z; 
#chains in the Genus database with same CATH homology
 2H8P C;  2Q68 A;  1NJI W;  1EFR G;  4O6N A;  3OM3 B;  1K3E A;  1ZU4 A;  3EQL F;  4RBN A;  1D1A A;  2Y3D A;  4WFE A;  2W6I G;  1NU9 C;  3DZA A;  1W0K G;  1YIJ V;  2XAQ A;  1FXK A;  1K97 A;  4MW3 A;  1MNE A;  1E1Q G;  2ZD9 A;  1W2B U;  3H65 A;  3OMI B;  5GW7 A;  3ZMU A;  2J46 A;  2R7U A;  2WZG A;  2HR3 A;  2Q3T A;  1M9N A;  2Q6A A;  4G2K A;  3CMA V;  2W4B A;  5LGN A;  4I5S A;  2IXO A;  4KNV A;  2QE7 G;  1F51 A;  1PL0 A;  5B1O A;  3CCL V;  1SES A;  3ZMZ A;  4H4K C;  1COW G;  4EKW A;  4MTX A;  3LDD A;  3OAA G;  3W7T A;  1UJW B;  3ECS A;  1TWG A;  2R9I A;  4MND A;  2HG5 C;  2EIM C;  2HVK C;  2W6J G;  1VYK A;  3LEV A;  3MLG A;  5F5F A;  3AG3 C;  3CPW U;  2V3C C;  3IC7 A;  3SPH A;  2P90 A;  5CI9 A;  2QY9 A;  2WLJ A;  3KKB A;  2P67 A;  3B9Q A;  4WFB V;  3FKS G;  3N24 A;  3UKM A;  4K0D A;  4W8K A;  3CCU V;  1NVP D;  1L1F A;  4E2L A;  1KC8 W;  3ASN C;  2FFH A;  3HTK C;  4PFO A;  1GM7 A;  4PA7 A;  4BIZ A;  2A9H A;  2WL8 A;  1H8H G;  2DQ0 A;  3GWO A;  4JYB A;  1OCO B;  3F7Y C;  3X2Q B;  4XWJ A;  4C3E A;  1DLB A;  3Q7L A;  3ZC4 A;  1NR1 A;  2LFR A;  2X0L A;  4JGS A;  3S0X A;  3CCR V;  4G28 B;  1YJ9 V;  4JAU A;  3CP1 A;  4H37 A;  1ENV A;  2G3V A;  2DWD C;  2XAJ A;  1VQN V;  1V54 C;  2WB7 A;  3N2Z B;  2VH3 A;  3FYE B;  2Z5U A;  1H2G A;  1K5Q A;  4QI0 A;  4N06 A;  5IDJ A;  3K0D A;  3O39 A;  1DF4 A;  1J95 A;  2MK3 A;  3D36 A;  3E83 A;  1OCR C;  4WCE V;  1SMY F;  4PA4 A;  3E2E A;  1FFT C;  1TKN A;  2CDQ A;  1N1C A;  2WVO A;  2QM7 A;  5KUM A;  1Z63 A;  4H33 A;  5B1N A;  2WSS G;  1VQ5 V;  1W2W A;  4G7Z F;  2D3O W;  1R3L C;  5L3V A;  3TCU A;  3F46 A;  5T3W A;  4RD9 A;  4WFF A;  4UVB A;  4C3B A;  1F4M A;  2X7R B;  4GCZ A;  3PJS K;  5BZB A;  4MS2 A;  2IXN A;  4O7G A;  1TWH A;  4OD4 A;  2F43 G;  3DMD A;  3RVZ A;  2WVN A;  3ZG1 A;  1F4N A;  2EJR A;  5KYN A;  1D0Z A;  1V55 B;  3ABM B;  1O87 A;  4EBB A;  3UGO A;  5L3C A;  4E7S A;  2NUT B;  4F4B A;  2DGJ A;  4U5G A;  2A69 F;  3K79 A;  4OD5 A;  2IXM A;  4LLE A;  4BJ5 C;  1Y66 A;  3WG7 B;  4LAC B;  4QPJ A;  2A1D D;  2NUP B;  3ZIB A;  3ABU A;  3ZCC A;  4DOZ A;  4Q5S F;  3CCE V;  4QE9 A;  1KP3 A;  2J9V A;  4JYC A;  2YEV A;  3OWT A;  4IWB A;  5L3B A;  3SPI A;  3NG1 A;  1M56 B;  3OFN G;  3OUS A;  1NR7 A;  3AG3 B;  2V7Q G;  1BMF G;  3FB8 C;  5B3S B;  5F5H A;  3EHB B;  4JTD B;  4TWK A;  1E1R G;  2IXP A;  5B1A C;  1NKD A;  1QLE C;  3K9A A;  2ZXR A;  2J0X A;  1YI2 V;  3UM7 A;  3Q6M A;  3K66 A;  5L3Q A;  1CEZ A;  3K1H A;  4XLP F;  2XRH A;  3KG2 A;  1FXK B;  3ZN0 A;  4DVY P;  1K4C C;  4LCU C;  5IYC O;  3NRH A;  1K8A W;  3W7W A;  4BAY A;  1OCC C;  1ZHX A;  3FB7 C;  1J8Y F;  4U5D E;  4YT5 A;  5DQT A;  2X6B A;  2R7R A;  3FYI B;  1KP2 A;  3EG9 A;  1S72 V;  2WAM A;  3SYN A;  2IOQ A;  4U5E E;  4EWC A;  2CNW A;  4HFK B;  1GM9 A;  2UXX A;  1SF8 A;  4HEA J;  2B5U A;  4HE8 D;  4JCH A;  1PCX A;  4LLC A;  3SZR A;  3RW0 A;  2EBO A;  5LBQ A;  3OW2 U;  3SPJ A;  1OKK D;  4JTA B;  4U5B E;  5EC2 C;  2K1E A;  2MWQ A;  5KUK A;  3ITF A;  3KL4 A;  2WLN A;  3EGX A;  2JJ1 G;  2XAF A;  3AQC A;  2IU0 A;  1K34 A;  2ZDI A;  2X6C A;  4B6I A;  3W2W A;  4CBE A;  3OR6 C;  4JPR A;  3HJC A;  3MX3 A;  3T4D A;  3CSK A;  1Z23 A;  5DS6 A;  2PX0 A;  3LUT B;  1TR2 A;  4AE4 A;  2WLI A;  3ZMT A;  1JQ0 A;  5KYW A;  2P6J A;  3JT1 A;  1JCH A;  3LSS A;  3E86 A;  3RVY A;  4LBE C;  1RJ9 A;  4FMT A;  4I1M A;  4PDR A;  1M2V A;  3JYC A;  3LS1 A;  5KYU B;  3T4R A;  3E8H A;  2WLM A;  2Q69 A;  1JPN A;  2B1G A;  4ZLC A;  3WG7 C;  1JVM A;  4MQ9 F;  2WLK A;  1EBO A;  3LLI A;  2L81 A;  1D0Y A;  3PHF 2;  5CN0 A;  4MT8 A;  3DGE A;  2FTK A;  1JJ2 U;  1BR1 A;  1YTF D;  2IU3 A;  4NY3 A;  2HVJ C;  2Q9C A;  4PDV A;  4MTO A;  1IZM A;  1VMA A;  1NH2 B;  3ML0 A;  3OMA B;  5LHH A;  3LAY A;  3LS0 A;  2DQ3 A;  2W45 A;  5DLJ A;  3EH1 A;  5CBH A;  1IXM A;  3TK1 A;  4AX2 A;  1MMN A;  2OCC B;  5E3A A;  3OA1 A;  1O5H A;  2Z15 A;  2XXA B;  3ETE A;  3JYH A;  3HPL C;  5T1D B;  4TSF G;  2GSM B;  4ASU G;  1D1C A;  2H7V C;  1M57 B;  4BEJ A;  1V55 C;  2EZP A;  3ABM C;  3MHH C;  2J45 A;  2L9J A;  1MSW D;  2PF4 E;  3QO5 A;  2QTO A;  4RUF A;  1R6N A;  3QO7 A;  1FXH A;  4CS7 A;  4PA6 A;  1YJW V;  1AI6 A;  5IYD O;  3Q7G A;  2IH3 C;  4DO2 A;  5CA3 A;  4CS8 C;  1J8M F;  2JIZ G;  4CSA A;  1M1K W;  4XDK A;  5H6Q A;  3B0V C;  3T1C A;  1S0V A;  3ZMS A;  3CCS V;  2Z3Y A;  3K3W A;  3SNH A;  2DYS C;  2JD3 A;  4KC9 A;  2M4E A;  1K9M W;  3G4S V;  1NU7 D;  1LVK A;  3UR3 C;  4AE4 B;  5J9P C;  2VAS A;  2GFH A;  4Z1M G;  1TWA A;  3ZMV A;  1BR2 A;  2Y3G A;  3HLZ A;  3M1C B;  4A2N B;  2EZO A;  2HLD G;  1AI5 A;  2WLH A;  1VQK V;  5FCL A;  1MAB G;  2XXA A;  5CBF A;  5KYY B;  2QA4 V;  4G0H A;  3LNM B;  2W0F C;  4RDA A;  2AHZ A;  4RQE A;  2OTL V;  3SYA A;  4AK9 A;  2ZPA A;  1LS1 A;  4FIP C;  5H9C A;  4O6Y A;  1FMV A;  3Q6N A;  1QLN A;  3E8F A;  1QVG U;  1S5H C;  5DM6 V;  1H38 A;  4P9O A;  2HV7 A;  4KBL A;  1ROP A;  4OIP F;  4UVA A;  1VOM A;  1H8E G;  3T4Z A;  1VK5 A;  2DWE C;  2OTJ V;  2YSU B;  3F7V C;  4I44 A;  4ANJ A;  4R50 A;  3W2V A;  5KYY A;  1ZYR F;  3CZ6 A;  2KW3 C;  3NYM A;  3K0G A;  3JCZ A;  3VYW A;  1QBZ A;  3ABT A;  2CNW D;  2HV6 A;  1S3J A;  3EFF K;  3RBZ A;  3SYO A;  2PP4 A;  4QI2 A;  3X1O A;  1G8X A;  4KP4 A;  3I5P A;  1R3K C;  2HKO A;  2XAG A;  3W7S A;  1VQM V;  2X6A A;  3SPG A;  4MVO A;  1VQ4 V;  1NG1 A;  2Q9B A;  2ZR2 A;  4TT3 G;  5B1B B;  4C7O B;  4XDL A;  4PK4 A;  3F5W C;  4JAV A;  1GO3 F;  1PKX A;  1R6K A;  3BEH A;  4FPP A;  3IEE A;  1K4D C;  1E79 G;  3W8I A;  5C93 A;  5L3G A;  4I3M A;  3HB3 B;  1ORQ C;  4WFH A;  3ZSU A;  4MVS A;  3ZIA G;  2PI4 A;  5H6R A;  4MVZ A;  1KU2 A;  2CK3 G;  1VYI A;  4OIQ F;  1SET A;  1Q82 W;  3E8B A;  5CMU A;  5E1A C;  3ETG A;  3X2Q C;  2H7B A;  3ETD A;  4PEL A;  1F23 A;  2BE5 F;  2Y3B A;  3K33 A;  4MSW C;  4OIR F;  3ZRV A;  2R7W A;  2JJ2 G;  3IFX A;  2Q9A A;  2IH1 C;  3OR7 C;  4P6I C;  2QTV A;  3LES A;  1PNK A;  2JEU A;  2DYR B;  2XAH A;  3ZRX A;  4WF9 V;  3G6E V;  3DAF A;  3STL C;  3SEO A;  3JCU Q;  4PDM A;  3SYC A;  2J9U A;  4BG0 A;  4Q4Z F;  2J9W A;  1SRY A;  3JSZ A;  4JF3 A;  1WPX A;  5EK0 A;  5LGT A;  1K33 A;  5D92 A;  3RIP A;  1NVP B;  4GEH A;  4IRU A;  4QPK A;  3ABL C;  3UMH A;  3STZ C;  1W0J G;  4KNW A;  1ZHW A;  2X51 A;  1PNM A;  3K04 A;  2YZS A;  5HFL A;  2W4M A;  1VQO V;  4OIO F;  2A0L A;  4PJJ A;  1QLE B;  4PJL A;  3JRT A;  3DJU B;  1NBM G;  1GK9 A;  2EIM B;  1G8M A;  4RO2 A;  3EGD A;  3V7O A;  3FB6 C;  4UUJ C;  2EIN C;  4FX5 A;  4CS8 A;  3DTU B;  1VQL V;  1R3I C;  4FWV A;  3ABL B;  3LSQ A;  3CME V;  2ZXO A;  4DXW A;  4ZLD A;  1QZX A;  2WZL A;  4HFF B;  3FHD A;  1Q7Y W;  4HAM A;  2WZF A;  2NUT A;  3T6J A;  4MVM A;  3NKD A;  4K7B A;  3UMK A;  5E2Q A;  4DBR A;  5EGY A;  3AG1 B;  1OCZ B;  3NYJ A;  4G7O F;  1SZT A;  2LSE A;  2EIL C;  2V1D A;  3CXC U;  1YHQ V;  5D91 A;  3ZVR A;  5IY5 C;  1N8R W;  3ZRS A;  1TWC A;  1IW7 F;  2EIK C;  5DVW A;  2WLI B;  3CCQ V;  2D5R B;  2YEV B;  2BOC C;  4BIU A;  3PMR A;  4QDL A;  5L3D A;  3SPC A;  4J9Z B;  1FXV A;  1P4R A;  3UMI A;  4GX0 A;  3VAY A;  4HYO A;  2Y69 C;  4XLN F;  4R8C A;  4LC1 A;  4IJJ A;  2IJI A;  4F4L A;  4P9P A;  1AR1 B;  2Y48 A;  2YHS A;  4PJN A;  3ASO C;  3WFV A;  1GMG A;  1MND A;  1OKK A;  2A6H F;  1M57 C;  5B1B C;  1JX9 A;  2PX3 A;  2XL4 A;  2H94 A;  2EIL B;  1WGW A;  3SP1 A;  3WOD F;  3E9V A;  1K5S A;  2ZR3 A;  3OEO A;  3AG1 C;  4FK5 C;  3JD4 A;  3VOU A;  3EGD B;  3RFY A;  4BJ6 A;  5B3S C;  3CC4 V;  2P7V A;  3OUF A;  4FES A;  1NQT A;  4QJF B;  4WFG A;  1K7D A;  1QCE A;  3B8M A;  1ZU5 A;  2KNH A;  2ITC C;  4PA3 A;  2WLL B;  1OHH G;  1S77 D;  3QNE A;  2QM8 A;  3VBB A;  3TET A;  4XTK A;  3P32 A;  4GX2 A;  1I5X A;  2ATK C;  4C7O A;  3JD0 A;  3K1I C;  3KMI A;  3SYP A;  4PFP A;  3S28 A;  1S76 D;  3EGX B;  1YJN V;  3CYO A;  1JOY A;  3UGP A;  1M90 W;  1KQS U;  3K6B A;  2R7T A;  3QZC A;  5CI8 A;  2LP7 A;  2P6V A;  4J32 B;  4U5F E;  5KYX A;  4XBF A;  4PJM A;  2DW4 A;  3T6B A;  3CCM V;  3POV A;  3LJB A;  2VB6 A;  2R7V A;  2EIN B;  4M63 A;  2B0J A;  3K7D A;  2XAS A;  1CP9 A;  1RPR A;  5L3F A;  3JD2 A;  3BY6 A;  4RQF A;  4J9Y B;  1MG1 A;  3OMN B;  5HFM A;  2NG1 A;  3EG9 B;  3N0T A;  3RH3 A;  1OCR B;  4CSA C;  2IJJ A;  4LP8 A;  1HWY A;  3EJN A;  3SYQ A;  3EHN A;  2KB1 A;  4YN0 B;  5KYX B;  1NH2 D;  3ZN1 A;  3D3I A;  4YXW G;  1SZI A;  3QMK A;  2EIK B;  2I8B A;  1K73 W;  2J7P A;  4XDJ A;  3DD7 A;  2ZXP A;  4UXN A;  2A6E F;  3I4U A;  4WFA V;  3JD1 A;  2M7W A;  3R65 A;  4MTG A;  4JW1 A;  2NNU A;  2LFS A;  1RM1 B;  3JD3 A;  4U5H A;  4BJ5 A;  1S7Z A;  2KQ9 A;  2WVQ A;  1V54 B;  1R73 A;  3ASN B;  1Q81 W;  4MTF A;  1BHA A;  4X88 A;  1CPY A;  3EH2 A;  4U5C E;  3W7U A;  4DBQ A;  4UVC A;  4O6M A;  4BJ6 C;  2WWW A;  5DS4 A;  1ZHY A;  2B1I A;  1SER A;  4MW8 A;  3MHS C;  2NUP A;  1AI7 A;  4KUM A;  4UV8 A;  1BHB A;  5B1A B;  4OIN F;  2Q67 A;  3E35 A;  2V26 A;  3FDQ A;  3AG4 C;  1VQ8 V;  1YTF B;  5L3E A;  1MMA A;  4JTC B;  3DAG A;  4I1O B;  4UV9 A;  4RUE A;  4GX1 A;  4MVQ A;  3LLK A;  5EBL C;  1KKD A;  2C03 A;  4GT1 A;  2H7O A;  3DM9 B;  2IJH A;  5KA6 A;  2R7Q A;  3CQZ A;  4J30 B;  1AJP A;  4JUR I;  3B0P A;  1G4Y B;  2O9X A;  4X89 A;  5E33 A;  3QO8 A;  1BR4 A;  4DVZ A;  3LNR A;  4BJ1 A;  1QVF U;  1P7B A;  2J0W A;  3AEI A;  3B77 A;  4QIW F;  3UNG C;  4L87 A;  4YWQ A;  2C04 A;  3EZH A;  4FJC C;  1MOF A;  2ZQM A;  3O6X A;  4KI2 A;  1D1B A;  3NDB B;  3W7X A;  3AQB A;  2XSE A;  3DJN B;  5E3C A;  3KH2 A;  1D0X A;  3EHM A;  2KGO A;  4N23 A;  2W9Y A;  3DM5 A;  3K06 A;  4IAO A;  1AI4 A;  1MMD A;  1ZWI C;  3OE7 G;  3AG4 B;  3K08 A;  3FB5 C;  4MVU A;  4X0R A;  2QEX V;  2R7O A;  4JVS A;  1RJ9 B;  3P30 A;  1VQP V;  1DTO A;  4E7Z A;  1R3J C;  5KYU A;  4ZKI A;  1FMW A;  2R7X A;  4JJG A;  2P7T C;  2NLJ C;  1LKX A;  2DYR C;  3K03 A;  1VQ9 V;  3M99 B;  5BUO A;  2EIJ C;  3NXS A;  1ZHZ A;  3EPV A;  1ST6 A;  4P2Z A;  1EZJ A;  3NKE A;  4GYT A;  4C3D A;  1OCC B;  3GB7 C;  3IGA C;  3ASO B;  1TUE B;  3AG2 C;  4MVR A;  5LHI A;  3DXJ F;  2ZXW B;  1GKF A;  4U7O A;  3L34 A;  1Q86 W;  3GOD A;  1RM1 C;  4G27 B;  2CGE A;  1FFT B;  1PNL A;  2AHY A;  1FXK C;  1OZ0 A;  2ITD C;  3LDC A;  3SJQ C;  2OG2 A;  3RYL A;  5FL7 G;  2R9R B;  1WLE A;  1VQ6 V;  2QKS A;  3E8G A;  3MD0 A;  4BJT A;  2R7S A;  4OXS A;  3OEH G;  5DQZ A;  2DYS B;  2WPD G;  1YIT V;  2G3K A;  1ARO P;  5T3T A;  3OEE G;  2JDI G;  3G71 V;  1AJN A;  1M56 C;  5IYB O;  5CBG A;  5IY5 B;  3E70 C;  4JJF A;  4YT4 A;  5DS5 A;  2ZDI C;  3CC7 V;  3NYL A;  1RPO A;  5EHH A;  4KFM A;  1I5Y A;  2EIJ B;  5LGU A;  2OCC C;  1BL8 A;  4ZBM A;  3ZJZ A;  5EBM C;  4BW5 A;  3FVY A;  4PA9 A;  3B0U X;  4PDL A;  1M2O A;  4R6Z A;  2E87 A;  4YT2 A;  2XOK G;  2ZXW C;  2KJG A;  1AJQ A;  2HFE C;  3RKO F;  2OT5 A;  2IYL D;  1VQ7 V;  3EFO B;  3H01 A;  3ABK B;  2J7P D;  3I5Q A;  1GTO A;  4LER A;  2XND G;  1FTS A;  2MYS A;  2GHY A;  1MMG A;  3L0I A;  3B8N A;  2HJF C;  3T2M A;  1Z6A A;  1OCO C;  3I55 V;  4GX5 A;  1FS0 G;  1ZHT A;  4CIH A;  4U7N A;  2PFD A;  1YSC A;  4QNH B;  2JEX A;  4G7H F;  1K92 A;  1QR8 A;  1KD1 W;  2CW0 F;  3EFO A;  3F47 A;  5EC1 C;  4Q20 A;  3I56 V;  2PI5 A;  5HSW A;  1B6Q A;  2UXN A;  3CD6 V;  3ABK C;  2G62 A;  3LDE A;  2C2A A;  4QE7 A;  1QR9 A;  1PD3 A;  3E89 A;  1THZ A;  1XL4 A;  4RAI A;  4CZZ A;  5KA5 A;  1NZE A;  1Z3I X;  1KEC A;  4CS9 A;  4YJW A;  1PD1 A;  4R7C A;  2Y69 B;  3S29 A;  3GAN A;  4X8A A;  1GM8 A;  3ZRW B;  5LHG A;  1JPJ A;  3FAJ A;  4O79 A;  3CC2 V;  4N21 A;  1JPX A;  2Y39 A;  4HZ3 A;  3CCJ V;  5DN6 G;  3EZI A;  4CBC A;  4JZA A;  2BOB C;  2IJK A;  5EBW C;  4YT8 A;  4Q7C A;  3AG2 B;  2JK5 C;  1XL6 A;  3OGC C;  1M2V B;  1LNQ A;  3S27 A;  2WLL A;  1DF5 A;  1PD0 A;  4P30 A;  4WJ0 A;  3TD7 A;  1Z5Z A;  4CS9 C;  2A68 F;  3A0R A;  1FFH A;  3ZRW A;  3W8H A;  2A79 B;  1OCZ C;  2IW5 A;  3CCV V;  5KYW B;  1Y4M A;  4JAS A;  4I9W A;  2FGY A;  4ULW A;  2Y3H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...