1M57C

Structure of cytochrome c oxidase from rhodobacter sphaeroides (eq(i-286) mutant))
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
265
structure length
265
Chain Sequence
AHAKNHDYHILPPSIWPFMASVGAFVMLFGAVLWMHGSGPWMGLIGLVVVLYTMFGWWSDVVTESLEGDHTPVVRLGLRWGFILFIMSEVMFFSAWFWSFFKHALYPMGPESPIIDGIFPPEGIITFDPWHLPLINTLILLCSGCAATWAHHALVHENNRRDVAWGLALAIALGALFTVFQAYEYSHAAFGFAGNIYGANFFMATGFHGFHVIVGTIFLLVCLIRVQRGHFTPEKHVGFEAAIWYWHFVDVVWLFLFASIYIWGQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The X-ray crystal structures of wild-type and EQ(I-286) mutant cytochrome c oxidases from Rhodobacter sphaeroides.
pubmed doi rcsb
source organism Rhodobacter sphaeroides
molecule tags Oxidoreductase
molecule keywords CYTOCHROME C OXIDASE
total genus 97
structure length 265
sequence length 265
chains with identical sequence I
ec nomenclature
pdb deposition date 2002-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00510 COX3 Cytochrome c oxidase subunit III
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1m57C01
1.20.120.80 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 1m57C02
2WLIB 3LNMB 2WLNA 4PA7A 4WFHA 3SPCA 3UM7A 2HJFC 2W0FC 1QLEC 1R3KC 4MVMA 3OGCC 2IH3C 4LBEC 5EBWC 4G27B 3FB7C 3KG2A 3AG4C 4P9OA 3ASOC 4OXSA 2WLHA 3JYCA 4RUEA 1OCRC 1V55C 1XL6A 2QKSA 1R3JC 2HFEC 2ITCC 4TWKA 2WLKA 3WG7C 2OCCC 4H33A 4R6ZA 4MVQA 3E8FA 2DYRC 2X6CA 4GX2A 2BOBC 2ITDC 4H37A 3RVZA 4MSWC 1J95A 3T2MA 3K03A 4WFGA 3R65A 3K06A 4MTFA 4X88A 4DXWA 3LDEA 3TETA 3UKMA 4HZ3A 2HVKC 3LDDA 2YEVA 3PJSK 4BW5A 2IH1C 3FB8C 4P2ZA 1R3IC 4MW3A 2AHYA 2AHZA 4PA6A 3TCUA 4QNHB 5CBFA 5KUMA 3SPGA 4MTOA 1M56C 3BEHA 3SYOA 2DWEC 4CBCA 4PDVA 4QE9A 4RO2A 2Q68A 4HYOA 1ORQC 3ASNC 2ATKC 4PA4A 3E8GA 1K4CC 4JTDB 3SPHA 3SYCA 3T4ZA 4MVSA 3E8HA 4WFFA 3T4DA 2Y69C 4R50A 4QE7A 3AG2C 1P7BA 1M57C 2EIKC 2KB1A 5EBLC 4XDJA 4LP8A 5EK0A 2Q67A 1K4DC 2EINC 4PA9A 5B1AC 1R3LC 4GX1A 4P30A 3OR7C 2HVJC 3E86A 4MVRA 3SYAA 2WLIA 4MVZA 4RAIA 4R8CA 4WFEA 3SYPA 3ZRSA 1XL4A 5B3SC 5EBMC 3STZC 3RVYA 5KUKA 3T1CA 4GX5A 2A79B 3AG1C 3K04A 4KFMA 4MVUA 5CBGA 1KKDA 3OR6C 4G28B 2WLJA 2EIJC 3STLC 3SYQA 3ABKC 2DWDC 1FFTC 3LDCA 2ZXWC 3RBZA 4PDMA 1OCCC 2HG5C 2JK5C 3FB5C 4MW8A 3E89A 5EC2C 3RW0A 4RUFA 1G4YB 1S5HC 1LNQA 4I9WA 3GB7C 3IGAC 4X89A 4J9ZB 4F4LA 4UUJC 4ZBMA 4EKWA 2BOCC 2EILC 3F5WC 2DYSC 3K0GA 1V54C 2H8PC 4R7CA 5B1BC 3ZJZA 4JTCB 2A9HA 4P9PA 2EIMC 4JTAB 2WLLA 5J9PC 3ABLC 3ABMC 3SPIA 5BZBA 1ZWIC 2X6AA 4PA3A 2R9RB 4PDLA 1JVMA 2Q6AA 2Q69A 2ZD9A 2P7TC 2WLLB 2QTOA 3K0DA 3OUFA 1OCZC 3FB6C 3AG3C 3F7VC 3SPJA 2A0LA 4GX0A 3LUTB 5CBHA 3K08A 3E83A 4PDRA 4MTGA 3IFXA 4MVOA 5E1AC 3HPLC 2K1EA 3F7YC 4XDLA 2WLMA 5IY5C 4X8AA 1OCOC 2X6BA 4XDKA 3E8BA 4MS2A 3X2QC 4LCUC 1BL8A 3OUSA 4J9YB 3VOUA 3EFFK 5EC1C 2NLJC 3SJQC
chains in the Genus database with same CATH superfamily
5B3SB 4JI6B 5A6KA 4NXMB 1U96A 1WPBA 1Y76A 3PHF2 3K1IC 2XAFA 2A68F 1V55C 4BEMJ 4MNDA 1AI5A 4J11A 5GONB 4R6ZA 1LR1A 3UT5B 3AJMA 3UO3A 4ZHQB 4PI2A 2N74A 1ORYA 1TQGA 1J8MF 3MLGA 1FMVA 1V54B 3TETA 5K0IA 4CSAA 1AUEA 2EIMB 2CGEA 5BQGA 2EJRA 3ABLB 3JATA 2QY9A 4JI3O 1KTMA 3ATPA 2P61A 2HEPA 2EULA 4JI1O 1OR3A 4F6EA 4YIOA 3FFQA 2ICWG 5IYZA 5JLIA 1Q0KA 2YL1A 2CYDA 4FZ0A 2MHRA 1ZU4A 3HLZA 1OKKA 2XHBA 2YZSA 1N34O 3WHNA 2OWOA 1LM3B 2LJ2A 3E86A 4MVRA 2VQFO 3SP1A 1SA0A 4MVZA 2WVNA 1VMGA 4CIHA 2W4MA 3CEXA 3LNRA 1ZW3A 4BWAA 3VQWA 3UQ8A 1XMOB 3CB2A 4PACA 4TV9B 1KNYA 1AJNA 2XNDG 2WLJA 2GUZB 1RPOA 3DD7A 5IJ9A 2HSQA 2XL8A 1LE2A 3L34A 3DMDA 3RBZA 1BGYH 4FFBA 1M2VB 4TV8A 2HG5C 1K9MW 1R1BA 3E89A 4CX9A 4DBRA 1FXKA 2Y0IA 2DYRB 3GB7C 1N32O 2YL0A 4WGYA 4DUYB 1F51A 2HJ3A 3OTOO 4CH4A 2G3KA 4YHHB 1JX9A 1ZL8A 1GS9A 4CS4A 2Q00A 3VBBA 1N33O 3DXRA 2MWQA 4P9FA 2IW5A 3T6JA 3TGUH 3OUFA 3PN1A 3S3WA 2OIEA 2Y0PA 2HSBA 2ZM6O 4PDRA 3H1JH 4MTGA 3IFXA 4MVOA 2ZXOA 1O87A 5KMGB 1GRJA 4YJWA 3ZQVA 4OIPF 1XMQO 2P22C 3M4BA 1D5AA 3K7DA 4B3TO 5CA1B 3WB2A 1LS4A 4BJ6C 5FPRA 5B1OA 4X64B 5LP6A 4JW1A 4XQ1A 4WFHA 4PA7A 3AG7A 2HJFC 4U5HA 5DS6A 4JI8O 1TGOA 2Y3BA 4XLPF 2ZE5A 3A2FA 1WGWA 4RUEA 2R72A 3N0TA 3K1IA 3OD4A 4PD4F 1YTFD 3JCUZ 3QVZA 1Y67A 3TJ5A 1BR4A 1K34A 4LF5O 3R66A 1GTOA 1V74B 5LBQA 1KU9A 2EPLX 3B4SA 2UU9B 4XWJA 4DRIB 2CNWD 3I4UA 4DR7O 3V5ZA 1H2KA 1QR9A 4WFGA 1NVPD 2PF4E 3ICXA 3DKAA 4N6CA 2H7VC 4BJ1A 1K5QA 1BQ0A 3FB8C 4OD4A 4MW3A 4PA6A 1GQAA 3QTHA 3G4XA 3M79A 2OTLV 3ITFA 5L3CA 3SJCC 2CE4A 4LDQA 5CB4A 2HUJA 1AI7A 2ILMA 2ZNIA 2UU9O 3DJUB 4KL1A 3WFVA 5L0FA 3FAVB 3ZC4A 3A9CA 1WOLA 2H8AA 3U2MA 3J81N 1RCPA 4OIOF 3FX7A 1M90W 2Q67A 4LACB 2XAGA 1K4DC 2J0WA 3LEVA 4UV9A 3CX5F 1EN4A 3U11A 5IJ9B 2J46A 2JEXA 4MVUA 1QHTA 1O5HA 1YJGA 4A4AA 4B3TB 2CNWA 4IYHA 3WG7B 4BIOA 5EC2C 2ZDIC 5GTHZ 1Q6UA 2FTKA 1SYQA 2D5RB 2EBOA 3CCLV 3L73H 1Z5VA 1C03A 5KYWB 5BXZA 4JTCB 2R7OA 1QQCA 4JI2O 2OKUA 4AE4B 3OMIB 1HNZO 2YL7A 5JWPA 3R7CA 4O4JB 2O57A 4JI8B 1YSCA 4FLYA 4LF7B 4PDLA 3OTOB 2Q6AA 2GV9A 3JAKA 5IJ0A 3B0UX 3ZQYA 3T1YB 4GX0A 1L3PA 1H2LA 1XMQB 2BSKA 3AG2B 5IDJA 1Z23A 3UT5A 3OMNB 2JD3A 3CE2A 2XTAA 4FJCC 4G78A 5L3DA 1AEPA 2F1MA 5EC1C 3G6EV 5LMNO 1C02A 3N2GA 4LLEA 4UB8Z 2F66C 1N33B 3P3NA 2LGQA 4DJ9A 4X9QA 3QW0A 1PNLA 5EBWC 5KHGA 1AILA 3JSNA 5FPOA 1ZAUA 4YHHO 2ZXWB 4HEAJ 1R3JC 1HE1A 4U5EE 2ITCC 2AP3A 1VB5A 5L3QA 2YHSA 1GN6A 4FM0A 4K0KB 3FOPA 3CRCA 3I5QA 1FS0G 4K1OA 2J0XA 4JI1B 4RDAA 3EZHA 1NTMH 4MSWC 4O6NA 2A06H 3RKOF 2UXNA 4YIPA 1H9TA 3UKMA 3NMJA 3EPVA 2FL4A 5L3VA 3G80A 3ZN1A 1GMGA 2AHYA 1ZSPA 2ASRA 3OE7G 3TOLA 3HKCB 1NQTA 4JASA 4FLVA 3LS1A 4PDVA 1W0JG 3NDBB 1MZEA 1Z5WA 1VEWA 1VLTA 2OU6A 4GUNA 3CS5A 1Q6IA 2J9BA 1QBZA 4DR5O 4Q7CA 2XAQA 3DE9A 2ZXRA 1MNGA 2F93B 1C17M 1ZZPA 1UG7A 4BJ5A 3W8HA 3JASA 5EYPB 2UXXA 5KYXA 4WF9V 3JRMO 3C62A 2X0LA 4JI6O 3G6BA 2PX3A 3BFRA 4G2KA 4NTXA 3W7XA 3T6GB 1QLNA 2A79B 4K0DA 1AVOB 3JAMN 3RGBA 2EIJC 4JCZA 2DQ0A 1IBKB 1CEZA 1JOYA 3AG4B 4CH6A 4DR5B 1CPRA 2ZPAA 1V55B 2NSGA 5FCLA 2UXDB 5CIVA 3MHSC 4K3AA 3T9OA 3S90A 3B0PA 4X66B 4DV7O 1D0ZA 2QWOB 3DJNB 3F5WC 1Q43A 3K0GA 1K8AW 4JEAA 1V54C 1JCHA 3MX3A 4GYTA 4JZ2A 2CDQA 5F5FA 1N0NA 5JSLA 3ZRXA 1BMFG 3GM1A 4NXMO 1SA0B 3L8JA 5IYDO 1JVMA 3DSQA 4PI0A 2EPKX 1K97A 4IRUA 3ASNB 1NH2B 2J9VA 1WN0A 3AK1A 5DQTA 4O4IA 1Q0DA 4LF4O 2XM4A 1EZVH 5IYZB 5LA6A 2DQ3A 2JGDB 2CK3G 4MS2A 4J7JA 4J9YB 2LFRA 3CRQA 2QWPB 1FAPB 4OIRF 2ARHA 3ZMSA 2D2CB 1Q0MA 3NKDA 4MVMA 4FLWA 5C93A 1YEWA 1HE9A 4AHCA 3EVKA 4O79A 1B6QA 2QKSA 2Q9BA 1A0BA 4TWKA 3Q6MA 1IXMA 1YJWV 1PL4A 3E8FA 2YRFA 1PPJH 3G4SV 2QLAA 3KMIA 2QE7G 4UVCA 1AP6A 3OGIB 4BJ6A 4PFPA 5EZYA 1HNZB 1SC5B 3QNEA 2BTQB 2GBOA 2UXBB 3I5PA 5LGNA 3V5XA 1R3IC 3DAGA 4LF9O 4NB5A 1Q3EA 3K5LA 2ZQMA 5L0JA 1VIBA 3AG3B 2X0CA 1VLSA 3SPHA 2NUPA 2XLHA 3N2KA 2BC5A 1JPXA 3OEHG 1BSMA 3BRJA 2JGUA 4I1OB 1NH2D 2KB1A 3H65A 2CTPA 5EK0A 3H1KH 4JE9A 5JJEB 5A9GA 1Q86W 1SQQH 4DR6O 2JJ2G 1ZX3A 1YDIA 5A6BD 3JSEO 2R7XA 1Y76B 2Y3DA 3ZX6A 2DOSA 2OTJV 3RF3A 2Q4FA 3HNJA 3Q7LA 3STLC 5L0IA 3SYQA 2ADPA 1FFTC 5IT9N 3RYCA 1NZEA 4LWSA 1JPNA 2QGNA 1OCCC 1QPUA 3L1MA 2VH3A 1SESA 4CSAC 4K8XA 2PUSA 3KYJA 4JVSA 2PTMA 1KU2A 3UGPA 1NBMG 1PP9H 1YZAA 2R9IA 1MG1A 2IJKA 1Y74A 1PD0A 1WP7A 2BOCC 3K5MA 3C90A 4NVPA 3NMKA 1P49A 3JD1A 2C03A 2XXAB 2PY5A 2BTQA 3ZDLA 2YC0A 5JUAA 3JSLA 2ZE6A 4X65O 3NYJA 2R05A 2QEXV 5LGUA 1VF6A 1AVMA 3ZMZA 2HS5A 3T1HO 5CI9A 1QCEA 2OEVA 1NFNA 4Z9HA 3SXMA 3VM6A 2IM9A 4WJ0A 3B77A 4KUMA 4OGQB 3UMKA 3K08A 3E22A 1E1RG 1L7CA 1OR2A 1T01A 2EIKB 2N05A 1RM1B 4FM1A 3ZTZA 2MW2B 4IIJA 3QMKA 1WA8B 3HKEB 1T5OA 4X8AA 1PM9A 5B1AB 2O9XA 4FZ1A 1FNTc 4DV4O 3Q7GA 4ABMA 1PNKA 1S77D 1CPYA 2WPDG 1EN6A 1YF2A 1QLEC 4ZOLB 2Y3GA 4CS9C 3L74H 2KYHA 3K33A 3NRHA 3O10A 5H5NA 3EH1A 5FZTA 5BUOA 1F4MA 4G27B 3IQCA 4P9OA 5EIBD 4GKJB 2WLHA 2HV7A 2ZM6B 3KH2A 2WLKA 3RYFB 3G67A 3KCXA 4XEVA 1SQFA 3EFOB 3FAPB 4DW0A 3FD9A 2Q9LA 1WB7A 1IW7F 2R7WA 1VQ5V 4X20B 5A6BA 5GPGB 2H7BA 1EQ1A 3LDEA 4YXWG 2M7WA 5E2QA 1XREA 1WA8A 3JYHA 4JURI 4PJLA 4P6IC 5FNVB 4MTOA 5D92A 5D91A 2Y39A 3THOA 2BE5F 1ST6A 1H9GA 1EFRG 3SXZA 4D4XA 3E8GA 1K4CC 3E8HA 4WFFA 1P7BA 1MA1A 1O9HA 4IGGA 5JP7A 4XDJA 4JAUA 3TJTA 3ZG1A 4N23A 1FXVA 1T6QA 5A69A 4O7GA 4J7KA 4DK1A 4X1YA 2KQ9A 2UXCB 3ZRSA 4UCOA 1IBLB 2UXDO 2KKWA 2XXAA 3KKYA 1N34B 4NXNB 3FVYA 3K04A 2ZR3A 5CBGA 1G4US 1L0NH 5E33A 1MNDA 2PNOA 2JIZG 4CZZA 1VQOV 5HV9A 1D1CA 2J8WA 3JCUQ 2IBZH 2Z5UA 3UCSC 1OW7A 1NU1H 4JAVA 4F6RA 3RW0A 2XLWA 2XLDA 4I9WA 4X62O 1H2GA 4G0HA 1S05A 2EILC 4TSFG 1VQLV 2DYSC 2A0BA 2FYUH 1K73W 2QA4V 4N4WA 1TFKB 3DM9B 1Y74B 4B7KA 5EGYA 2BSKB 1NU7D 2Q3TA 1S72V 2B5UA 2LW1A 2P7TC 4J7ZA 1L1FA 1GK9A 2MYSA 4EIYA 4O4JA 1Z3IX 2KK1A 3KPHA 1LI7A 3IHUA 3EH2A 3ZHVA 4HNAB 3U0CA 2AXTZ 5BR8B 1Z63A 3ZRWB 3V5YA 3LEOA 1LUWA 4O2BB 3H2UA 3HNIA 3SJQC 2XLEA 4K0KO 3HKKA 1ZUQA 4JI4B 1DTOA 1H2MA 3DXJF 3EQLF 3OGCC 3AG1B 1FJGB 1JAFA 4CS9A 4G7OF 2IOQA 2XLVA 2EIJB 2Q9CA 3ABKB 3EJNA 3VAYA 3B0VC 1NR7A 1KECA 3ETDA 1H8HG 2UXCO 4I0XA 4JJFA 2XS1A 4LDRA 1YTFB 2B1GA 4UFZA 2J9WA 5KA5A 3MDSA 3K57A 3MFNA 5DECA 1RKEA 4O6YA 3T2MA 3KL4A 1WN7A 1FFXA 5JH7A 1I94O 3IC7A 4Q20A 2G38A 4YWQA 5E3AA 4JZGA 4DUZB 2DB4A 2L6GA 1HNXO 2Y3HA 4QNHB 1I08A 3S27A 3W4YA 2F22A 1B06A 1YZBA 1GM7A 2DWEC 4DV5O 4LFAO 3E70C 2GAQA 5LA6B 3T4ZA 2HHHB 3DM5A 2OYQA 1A7VA 2L6HA 3D36A 2OEXA 1Q7YW 4H0LB 2E3CA 4KI2A 5B5EZ 4NC3A 2EINC 1OCOB 4GX1A 4AX2A 1TUBB 3U8PA 1S76D 2P90A 2GDSA 4H54A 3STZC 2LIGA 3HNLA 3ZWIA 5DEDA 3JT1A 1SERA 4YL0A 3ZTMA 4KC9A 3SXKA 3C63A 1NTZH 5DQZA 1BT8A 4CJOA 4RUFA 2YS8A 3QTCA 2L6LA 1A7DA 2D4UA 4FM2A 1EA8A 2NUTB 1PKXA 4I55B 1M93A 4GKKO 3ZJZA 5KLVH 2XAJA 4JYAB 2HKVA 3LESA 2F4VO 2WLLA 3BAAA 3SPIA 5KYXB 1ZWIC 1NTKH 4I5SA 4IHJA 4JI7O 5B66Z 2RDCA 4JI0O 3TD7A 4XTKA 2ZD9A 2WLLB 4C3EA 1EBOA 3CPWU 1SR2A 3AG3C 3SPJA 4ULWA 3GANA 2RD9A 1SZTA 3JARA 3E83A 1NU9C 4NTWA 4JCHA 3B40A 4XLNF 4NCQA 1NR1A 4UDVA 2WLMA 2MK3A 1US6A 4W4LA 3FMSA 4JI7B 3X2QC 1BL8A 4X1KA 3SDLA 1TR2A 1EI7A 1VQKV 1HR0O 4JV5O 4ANJA 4I3MA 2FKXA 3APOA 4DV1O 3JASB 2RMKB 2KQXA 5JJJB 4Q6GA 5L3FA 1Z6AA 4D7TA 4IWBA 2OG2A 1WB8A 4LF6O 2XL4A 2AWYA 2P67A 4TV8B 5T1DB 1FFTB 1KYOF 1M2VA 2R7QA 2YSUB 1I4ZA 1S0VA 4DR6B 1JA8A 3W2WA 2GUZA 4DV2O 2R7RA 2EPMX 2RCVA 2Q7EA 1OXBA 2JX0A 5COGA 2V3CC 1Z2GA 3RT3C 2X6CA 1VYKA 1ROPA 4Z9IA 1L8DA 3FXHA 4HZ3A 2PI4A 4KXRA 2YXHA 4I50B 2GTAA 2M64A 4M63A 5AC5A 2IH1C 5JVDB 4CDYA 4B3SO 1VQPV 4HFKB 4EUKB 1Y6XA 5AC4A 1YHQV 2UUHA 1ORSC 4FESA 1AROP 5IWAB 4E4EA 1S3JA 1JFFA 3RN4A 5ITZB 3CCRV 2QKCA 3U9MA 4J80A 2A69F 4AE4A 4TV9A 1BR1A 2OJQA 3N2GB 3SYAA 2DI3A 4RAIA 4R8CA 3I56V 4PK4A 4LFCO 4DRHB 1BZ4A 2EZPA 5A6AA 1I94B 3O9OA 1R5ID 1RJ9B 4GX5A 4ZLCA 3FHDA 1KKDA 1VYIA 4DRXA 5KYYA 4U7NA 3LDCA 3HKBB 2V26A 5KHKA 4EWCA 4WBNB 4MW8A 4JYYA 1D0XA 5K1XA 1WJZA 3SJAC 4E17A 5HFLA 2E5LO 1SF9A 4X89A 5LHHA 4F4LA 2F43G 2B0HA 1MMAA 3PDMP 3WB0A 1SZXA 2LFDA 2J7PD 5F28E 5K1PA 4NYKA 3CRMA 5DN6G 1UFBA 3C8GD 1SRYA 5J2TA 2WZGA 3NMIA 3AK3A 4KP4A 3NYMA 3B09A 4K8ZA 5BR8O 2R9RB 3L70H 5F2VO 3C8ZA 2XT9A 1XI1A 4JI3B 1XZQA 3K9AA 1DK1A 3ZVRA 3BABA 2GFHA 1OW6A 2Z0AA 2LK4A 3L0IA 3HPLC 2ETSA 3F7YC 4PR9A 3ZMVA 1XNRB 2AWCA 1FPOA 4DV3O 3K66A 1AP5A 4LNUA 2R25A 2X6BA 5L0GA 1D2DA 1TWGA 3HNKA 4H44B 4FK5C 5AG2A 3VOUA 1Q0GA 1R4TA 3S3XA 3ZIBA 1XEQA 2QE9A 1VOMA 1SETA 3ABTA 1FAFA 4NTYA 4BW9A 2IH3C 2QDOA 1PD3A 1YI2V 4U7OA 4KHPO 4U9DA 5JVEA 3JRTA 4O6MA 4OXSA 1W0KG 4X62B 1H8EG 1KMIZ 3JYCA 2VCBA 2HFEC 3WG7C 1Q8IA 1Z7Qc 3FYEB 2W6IG 3QO5A 2FB5A 2KG7A 1YYXA 2KJGA 2P06A 3SEOA 4CC6A 4TOIA 4QPKA 4GX2A 2BOBC 1CGOA 5BQHA 2P0NA 3ZIAG 4FX5A 3T4RA 2EILB 1NZ6A 4K35A 1NFOA 3IC9A 4CC5A 4DV3B 1K7DA 4LH7A 1MSWD 4XEKA 3EGXA 5TJ5E 5TISZ 1JPJA 2CTRA 1SMYF 2Q68A 1OCZB 2EX3A 4MVSA 3D3IA 4K7BA 2Y69C 3AG2C 2NUTA 3EXAA 1VQ7V 5KHHA 1NKDA 3JAWA 4JI5O 4I4TA 4EFBA 2KSFA 3CHXA 2J45A 3QW1A 4P30A 1HNWB 2X51A 2HVJC 3W2VA 4DVZA 2LD6A 2ZDIA 3U0ZA 1KP3A 3DTUB 1IVSA 3ZMUA 1BHBA 1BS3A 2WVOA 4G7ZF 4BAYA 3E35A 1G8MA 2VQEO 3ASOB 1E85A 1F7YA 2NPUA 2CAZC 2H7OA 2JRIA 2DN9A 4U9EA 3S29A 4L87A 2VRZA 3NG1A 1JR9A 1GN3A 3OFNG 4U5CE 3CJHA 2DMXA 1J5EO 5B1BC 4R7CA 4LNUB 1QSPA 2A9HA 4L8JA 3T1YO 2OQMA 2CCYA 2A3QA 5JQGA 3HKBA 1F4NA 4JGSA 2UUCB 2CTQA 3K79A 1X59A 4LF7O 2OT5A 5CN0A 1WATA 1THZA 1URFA 4DR2O 2YVKA 3GEIA 5A6JA 2Q4PA 1RJ9A 3W7WA 2GDCA 3DWWA 5B3IA 5IWAO 5CBHA 1LKXA 2YWAA 5DS4A 1VF5B 2K1EA 3ZHTA 2Y4UA 5E79Z 3CC7V 4JKVA 4AL1A 4LCUC 3VQVA 2JS3A 4I9QA 2RQ6A 3LNMB 1K5SA 3D3QA 1NVPB 5KYWA 1N4CA 4WGZA 4U5BE 2ZE8A 2RN9A 1YA9A 2LSEA 1YVIA 2CH7A 4PJMA 2YXLA 1N36B 2HFIA 3CP1A 3ETEA 4EBJA 4G7HF 4DR4O 1GN4A 1LS1A 1Q6HA 4EFEA 1VMAA 1J95A 3JATB 3R65A 2AZ0A 3N2KB 1HR0B 4HE8D 2IYLD 2J7PA 4HNAA 3I55V 3OT7A 3LDDA 5IE9A 5LOVA 1XILA 3ECSA 2L9JA 1AR1B 4YJ3B 2YLGA 1SQXH 5A2QN 1ZW2A 2UUBO 4CBEA 2PYJA 4FVMA 3SNHA 2YEVB 4IJJA 3C3TA 1ORQC 2CTWA 1WLEA 3F47A 4KBLA 3JTLO 2JJ1G 4PFOA 3VRCA 1M57C 5EBLC 4YN0B 3MYFA 1ZHWA 5EHHA 1R3LC 3X2QB 1T5EA 4OX9B 4JYAO 1IX9A 4N06A 3W7SA 4GKKB 3ZHRA 2HZ8A 2ZINA 2V7QG 4YL1A 2LQTA 5L0CA 2XUMA 3L75H 3RVYA 2YI9A 4HAMA 4D6TH 3DE8A 4UV8A 4IB4A 1UPGA 2UUCO 4X64O 1M2OA 2RSEB 3HTKC 4X1YB 3JD0A 2XS8A 4ONSA 4QJFB 1QU7A 5LXTA 2A6EF 2LCHA 3ZSUA 1J5EB 2NG1A 1TFOB 4J9ZB 3S28A 3U9JA 4UUJC 1YDXA 1BE3H 1HW1A 1ZLZA 3LS0A 3S84A 1S5LZ 3AOUA 4E0HA 2JEUA 2X6AA 3SJBC 1QNMA 3GWOA 4O2AB 5KHIA 1QR8A 2IBFA 5D5PA 3K0DA 3RYHA 3T6BA 1WTYA 3ZEDA 3LLKA 4UCTA 3TK0A 4LF4B 1I5YA 1NSGB 2F95B 5D5QA 3GWLA 2X7RB 4DUYO 3GEEA 1YVWA 1YJNV 4J42A 3KKBA 1JJOA 2G3VA 1XQ8A 4FLXA 1Q0FA 3BPZA 2V4DA 4IYIA 3OUSA 1V9PA 4AK9A 1QZXA 4OINF 3CCQV 1GKFA 3RYIA 3CCVV 1OZ0A 2L6FA 3DI5A 4KNWA 3JSZA 3DGEA 2NNUA 1YA7O 3P30A 4DV7B 2LP7A 2QM4A 5DVWA 3MD0A 4EEQA 3BCCH 4GT1A 1OCCB 5LXTB 2AU5A 2LFSA 2OCCC 1M5IA 2GWWA 1PCXA 1KQSU 4AI8A 3JCZA 2FFHA 3A0HZ 1IBKO 3CSXA 1R6KA 4W4KA 2IM8A 3AQCA 3FOOA 3E22B 256BA 3K06A 1OKKD 2ADQB 2P5OA 3HKEA 4EHPA 3O6XA 5JCOA 3ETQA 4WFBV 1FFHA 2Q0OC 1S5JA 4C3DA 4UB6Z 4U5DE 2Q7GA 1GN2A 1YITV 4WFAV 4DOZA 1VARA 1SQBH 1UJWB 1EN5A 3BA8A 4DW1A 5H6RA 4Z2WA 4QE7A 4XPXA 1H38A 2EIKC 5IY5B 1HWYA 3RFRA 1X4TA 1K3EA 4D7SA 5B1AC 3GODA 2RNBA 5KYNA 2JS5A 3E2EA 1P84F 2QWQB 1N1CA 4C7OA 1H2SB 3SYPA 4WFEA 1RKCA 3W8IA 2IU3A 4GZRB 3O55A 2OIGA 5L3BA 5EBMC 2OCHA 5KX5B 4CDVA 4BIZA 3CCJV 2DGJA 3OR6C 1MMMA 4G28B 2LFFA 2R03A 1I0HA 2YKZA 5LP6C 3CCEV 3L72H 1U89A 2P6JA 4QPJA 1K05A 1OXKA 1G4YB 4MQ9F 1E83A 5EZYB 4NXNO 3OW2U 1Q81W 4ZBMA 1IBLO 1FXKC 3JALA 3BVOA 3A0BZ 4TQFA 1RP3B 2UUIA 4JTAB 3JAKB 3K3WA 3M15A 1IBMO 2YIAA 4FPPA 1Q5OA 4YJ3A 1EKYA 3Q4HA 1VQMV 3RFYA 1HMOA 5BMVA 1GO3F 2QTOA 3LLIA 1OCZC 1AJQA 1E86A 2XL6A 3AGUA 2YI8A 1PL0A 2Y69B 2JDIG 4DR3B 4CIPA 3E8BA 5COMA 3RIPA 2NLJC 3W7UA 1U6HA 1BHAA 2WLIB 2R7UA 2IJJA 2ZT9B 2EPOA 2KNHA 3N24A 1FMWA 3BA9A 3VF0A 3IJ4A 5FNVA 1B3QA 4ICGA 1U97A 4EBBA 5LMUO 1OCRC 3IQ6A 1IURA 2L35A 3QO8A 1H7IA 3N27A 1G1XB 1JMKC 3WU2Z 2XOKG 2PFDA 2LGWA 1SQGA 2VS0A 1R6TA 3L8IA 1N0JA 5B1BB 2M6YA 2FGYA 2QNLA 2CGNA 4BW5A 5BQIA 4P2ZA 1VQNV 3ABMB 2AHZA 1Y4MA 2FMLA 1O9GA 4PELA 3H9VA 4LF6B 3B8MA 4QE9A 1UFIA 3UMIA 1IZ3A 3EG9A 4ZOLA 3Q6NA 4NY3A 4OPHA 4JV5B 1WASA 3AEIA 1NJIW 3MAQA 1XHZA 2YICA 2H3OA 4X65B 1FXHA 4AQYB 1W2BU 4BR6A 5AGFA 1LI5A 1MMGA 1GM8A 3KYIA 4DR1B 3EGXB 3CC2V 4RBNA 3HB3B 4NQFA 1WAZA 3WODF 5H2FZ 5HSWA 1K33A 4C7UA 2UUBB 1MQVA 3HR0A 3X1OA 3OAAG 4KFMA 2J9UA 1JQ0A 3ABKC 4YJ2A 4YT5A 3FKSG 1M9NA 1HDJA 2GTSA 1DOWA 1R73A 2KG7B 2VCCA 1HP8A 3TQOA 3GWKC 4I4TB 3TULA 4WABA 3GM2A 3OM3B 2HMZA 5KMGA 2IU0A 1SS3A 1XDCA 5EYPA 1SQPH 2ZIOA 2HJMA 1AI4A 3CCSV 4GCZA 3RYHB 4B08A 4W8KA 2DJVA 4UCVA 3M4CA 2VWJA 1D1BA 1Y4CA 3ABLC 3SXYA 2Y48A 2Q69A 4DV6B 3FB6C 3CXCU 4E2LA 2PZSA 3CCMV 2I8BA 2Y4TA 2IXNA 2H94A 4DV0O 1M57B 1KB9F 5H9CA 3ZHUA 2W0XA 1Q90D 3M1CB 3WAQA 2EINB 1M4UA 4ER9A 3EFFK 1Y66A 1BQZA 1NBBA 2XLMA 2QJ1A 1W2WA 4DR2B 3UM7A 3SPCA 4B3MB 2W0FC 1A7EA 2E87A 4KNVA 4EB6A 4DR3O 5KYUA 4I1MA 1WPXA 4DV5B 4ZI7A 1HNWO 4U3JB 2R9AA 1HNXB 3M8AA 5DM6V 1MABG 1NG1A 2A6HF 5KHJA 2WZFA 3QO7A 1XHXA 3LSUA 4CS2A 1YXBA 1DF4A 2IXMA 3H1HH 2ITDC 5C8YB 3C18A 2Q9AA 2CH7B 3A8TA 1I5NA 2IXPA 3VYWA 2B9ZA 4H4KC 3EGDA 3ZMTA 2YEVA 3PJSK 2WZLA 4QI2A 2KSDA 4LC1A 3TCUA 4D4NA 3SYOA 4Q4ZF 5IJ0B 4IAQA 4LF8B 3RQGA 1TWHA 3OEOA 4PHZA 4PA4A 2L7AA 2R7SA 4JTDB 3SYCA 1I4YA 4U5GA 4TQDA 4B7EA 4JJGA 2ZCEA 1IZMA 3GORA 3MBGA 1OJHA 4E7SA 1GAXA 4DRJB 1W59A 4PA9A 3TJ6A 1PV0A 1O3UA 1Q82W 1APCA 1MMDA 1AR4A 1PD1A 3SR2C 1RSOA 1SZIA 1DLBA 1M1KW 1VTMP 3BRCA 1ZHYA 4AL0A 3NXSA 3MYIA 3SGIA 4ZI7B 1TKNA 2VCAA 3G4ZA 4JC7A 4GQHA 1QVFU 3KCYA 2P7VA 2W45A 4GYCB 3H01A 4RD9A 5ITZA 3IGAC 3FAVA 5IYBO 1WNSA 1RXQA 3P32A 4P9TA 2PYLA 4GLXA 4KHPB 1L0LH 2JGDA 5JJNB 1ZYRF 1WWPA 2XLOA 4PJ0Z 3UO2A 1I5XA 4OIQF 1M56B 5JVDA 4X1KB 4LF8O 1CGNA 1QKRA 2Q5ZA 1JJ2U 4NR1A 2I15A 3B71A 5CB4B 4CJGA 1P7GA 2WB7A 1SQVH 1LUVA 3U2LA 3JAWB 3LUTB 2W4BA 2QKAA 4YY3O 4UCRA 4FLUA 2AW9A 5EIBC 1XNRO 3UNGC 3IPMO 2GSMB 4B6IA 1XNQO 2VWKA 2A0UA 5KYUB 1BCCH 2UUAO 2XSEA 3V7OA 4IT5A 4TT3G 2HMQA 4B3RB 1A32A 1CP9A 5J2UA 1QQ3A 4WCEV 3NYLA 3M99B 4FMTA 3DC5A 3CRAA 3FYIB 4LFCB 1CPQA 2A7WA 1FYJA 3RWRD 4LBEC 2Q0AA 3HKCA 3ZRVA 2IJHA 5LYJB 5LP6B 2F23A 4ZKIA 2JPUA 3MHHC 3VQXA 5LHGA 4B3MO 1KUQA 1ZHXA 4C3BA 4A2NB 5LYJA 1A41A 4DO2A 3K5NA 2R02A 1GH6A 3B9QA 3DZAA 5LMNB 4X88A 1FXKB 4DXWA 1QVGU 3R2PA 3D8CA 4DV0B 4BEJA 1QVXA 4IHJB 3TOMA 2JVDA 4RWUA 4GKJO 5CBFA 5J2UB 3UR3C 3BEHA 1B68A 4DV6O 1ZL8B 4XPYA 1HW2A 5JT4A 1DGSA 2YXYA 1K04A 1S7ZA 1NI8A 3QZCA 1XOUA 1H6GA 1MNEA 4J7YA 2YIDA 1MOFA 1F1MA 5DLJA 2Q7RA 3OA1A 1HY5A 2BL2A 2QM7A 3U8VA 5T3WA 1ZHTA 1TA8A 4OX9O 4DV1B 4JEBA 4B3SB 1B04A 1FFXB 5JH7B 1JMWA 3I5DA 2P4KA 3BHPA 3J80N 2A1DD 2YIBA 2D3OW 2ZXWC 4QGPA 3PMRA 3QVYA 1TUBA 4PDMA 3CCUV 1TAEA 3E9VA 3K58A 3EG9B 2Q7HA 4H13B 1YYJA 4I0XB 2HV6A 3SYNA 1VP7A 3G50A 1VF7A 4DR1O 2NR5A 4DV2B 1AB3A 5E3CA 2K9PA 2FAPB 4AQYO 2H8PC 5KYYB 3BY6A 1TVKA 1VK5A 3CXHF 2F4VB 3ABMC 2W9YA 4R32A 3TXSA 1WP8A 4YL3A 2QSAA 3ZRWA 1I7FA 4UCUA 1XZPA 1FTSA 2QTSA 1N8RW 1BBHA 5B1NA 2E75B 3EHBB 4QDLA 3Q4HB 1E2XA 1RKEB 5E1AC 2EJ7A 1RPRA 4UXNA 4NTBA 2QTVA 3CYOA 4ASUG 3EGDB 4WBNA 4CH3A 4N6HA 3S9OA 3AGTA 1G4WR 4U3FH 4NTFA 4JI0B 2B0JA 2WLNA 4FIPC 4NKGB 4DR7B 1R3KC 1F23A 4DRXB 1YLMA 2P1AA 4BIUA 5GONA 3CQZA 1GM5A 5LMUB 3F46A 2ZKOA 4LF9B 3L71H 1VQ8V 2QM8A 3KG2A 3AG4C 5C8YA 3ASOC 4O2BA 2HKOA 1XL6A 2TMVP 1ZVZA 4H33A 1YARO 3H2VA 2WVQA 3IQTA 3W7TA 5BMVB 3JYYA 3POVA 3J06A 4IARA 2LP4A 1E79G 3RVZA 4U3JA 2HLDG 4CS8A 2Q8VA 1JFFB 1JR8A 3B8NA 1FD9A 2AGAA 1TWAA 3A11A 1M6TA 3CMAV 4E18A 3K6BA 4FWVA 3JALB 1NLXA 4J41A 4DUZO 1IXBA 1CGME 1FR0A 2R70A 3JD3A 1AR5A 4I50A 1KBHA 4Z1VA 4HYOA 3ASNC 3L9DA 1Y6DA 2B1IA 3LJBA 1P4RA 3IAYA 3JARB 2VQEB 4FLZA 1KD1W 5CA1A 4Q5SF 4LP8A 1ZU5A 4F6RB 2Z3YA 2M4EA 4LLCA 1D5NA 4UVAA 5IYCO 2ZXPA 4X0RA 1E1QG 1XL4A 5B3SC 3T1CA 4LFBO 2DE0X 5GTIZ 3DXRB 2PBEA 2DWDC 1YJ9V 1LPEA 3D36C 4YK5A 1OV9A 2JK5C 1EZJA 4B3RO 3CAXA 2YLDA 4IL6Z 4E7ZA 3RYFA 1S5HC 3ETGA 3K1HA 3H1LH 4YJ2B 4A5UB 1XMOO 1YZCA 2ETNA 1KC8W 3CSKA 4IAOA 4CDAA 4EKWA 2KW3C 4JPRA 1T6UA 4DVYP 2VQFB 4P9PA 2EIMC 3QF7A 2XAHA 1BDJB 4FFBB 3CC4V 2QR4A 2WL8A 2WA3A 5BZBA 2AVKA 3GVMA 3JD2A 3SZRA 2NN4A 2ODMA 4CS3A 1KKCA 3TXQA 4J30B 1JRAA 3F7VC 3CEIA 5LL6Y 2A0LA 1MZFA 4I55A 1G5ZA 3U3FA 2P4VA 5KAFZ 3UMHA 3LSQA 3CWBH 3B29A 3EFOA 5CI8A 4JZAA 3CRRA 3APQA 3U10A 3J7AU 4FFKA 1VQ4V 1PV3A 2NSFA 2E74B 4JF3A 3LSSA 4O4HA 3NKEA 4J10A 2VASA 1YIJV 3M7MX 2PGGA 4LH6A 2WAMA 3ZHSA 3AQBA 1D0YA 4XEFA 2BE3A 3EHNA 4RQEA 3CD6V 2P6VA 3FDQA 4MVQA 4IIJB 2EZOA 2DYRC 5JRAA 5JS5A 2V1DA 3EHMA 3K03A 4J7TA 4LFBB 3ZBHA 1RSOB 3ZS8C 1BR2A 3OMAB 1LIHA 3PCVA 2VB6A 1FKAO 3KZIZ 4I44A 3H1IH 5L3EA 2YUAA 4N21A 5KUMA 2E5LB 4JRZA 1M56C 5JCOC 3OTFA 1RMVA 2OOCA 4CBCA 4UVBA 4UCSA 4RO2A 1XUQA 3DAFA 4LDKA 5L0DA 3LNNA 4AILC 2ATKC 3TK1A 1GM9A 3LAYA 1AJPA 2ZR2A 4R50A 1XWJA 2CDYA 1RM1C 1TUEB 4LR3A 3IEEA 1G6UA 1YAUO 2QWNB 5GW7A 4W8PA 2WLIA 4ZHQA 2YL3A 1LVKA 1T6IA 3ML0A 3G71V 4YT8A 1DF5A 1QLEB 3JZ0A 2VC9A 1IDSA 1DOVA 2PP4A 3QG5A 3O39A 3DC6A 4JAAA 4Z1MG 5LHIA 3O65A 2YIBD 2ZNJA 4XBFA 4JI2B 2OCCB 5L3GA 3FB5C 5T3TA 3HKDB 4HBNA 3RYLA 4BJTA 1AI6A 5CA0A 3CZ6A 2BCCH 5H6QA 3GWNA 5HFMA 1CXZB 1LE4A 3T1HB 1K40A 1OW8A 3K5OA 1VQ6V 1OQCA 4JYCA 4EB6B 3UGOA 5KX5A 1HMDA 5LGTA 1G8XA 4L6RA 1H2NA 2HR3A 1VF6C 5COFA 4JIOA 5DS5A 2QWRB 4PA3A 4HFFB 4C7OB 1KP2A 1ORJA 4LERA 4CS7A 4ZLDA 2WWWA 2RJZA 3F5TA 2LW7A 1TVKB 4ZIBA 1GGQA 4DV4B 3ZCCA 2C04A 4YT2A 4X1IA 3GM3A 4PJJA 2DW4A 3ZHQA 5IY5C 2CW0F 1J8YF 2LO1A 3C3SA 1U0BB 1YCIA 3GEHA 4BPMA 1HW7A 4DR4B 2ZE7A 4CS8C 4TUYA 4QI0A 3CJHB 1N36O 2Z15A 1D1AA 1RFYA 4BJ5C 1ZTEA 3OEEG 3QVNA 2GA0A 3FB7C 1E84A 2LQGA 3U3BA 4X20A 5L0HA 4O4HB 4JYBA 3B2EE 2BTOA 2PI5A 3C8GB 2R7TA 2KGOA 2YQYA 1EM1A 3EZIA 4J32B 5CMUA 4DK0A 4OPAA 4H37A 3WB1A 1ZHZA 2EPNA 4O4IB 2QUPA 1R6NA 4MTFA 2DYSB 2R7VA 4LF5B 5JQGB 2HVKC 3P3PA 4FLTA 2E76B 3AK2A 3C8GA 3ZN0A 2YLIA 2UXBO 4O4LB 2GHYA 3SPGA 2Q73A 2YDEA 4DBQA 4F4BA 2W6JG 2IXOA 4OD5A 4YT4A 4O4LA 3A0RA 3T4DA 4U5FE 3C7JA 2L81A 4Z9JA 2OJED 2XRHA 1SKVA 4BG0A 4PJNA 4MT8A 3OR7C 4X1IB 4O2AA 5FL7G 3RYIB 1SF8A 1VQ9V 3RH3A 4XPWA 1BZKA 5KUKA 2HP8A 1ENVA 3FAJA 3AG1C 2WA4A 1MMNA 2CGOA 3S0XA 3VQYA 1OCRB 3N2ZB 5CA3A 3IQ5A 4QIWF 3RQEA 4FAPB 1MSDA 4DYLA 5FLXN 2HHHO 2PX0A 1COWG 3NR7A 2CUGA 4LFAB 2G62A 1LNQA 3CMEV 5KAIZ 2ZIMA 4TUYB 2WSSG 4LWSB 1Z5ZA 3RYCB 1N32B 4I7ZB 2KC3A 4GEHA 2N04A 1PNMA 4PV1B 4JI5B 1XBLA 5CA0B 3K59A 3HKDA 1V4AA 3JD4A 5J9PC 1NT2B 3U5SA 5KA6A 2AZ2A 5BY1A 2XASA 4RQFA 2UUAB 1K92A 2HJDA 4E0IA 1IBMB 1TWCA 3K9SA 4MTXA 1XNQB 1T9KA 4X66O 4EBKA 5F5HA 4YY3B 4CH5A 4ULVA 1OHHG 3OWTA 3HJCA 4XDLA 2NUPB 2XM0A 5J2TB 3US6A 3ABUA 5LOVB 1FJGO 1JOGA 2IJIA 1OCOC 4XDKA 4JI4O 3RQFA 4NTAA 2C2AA 1NS1A
chains in the Genus database with same CATH topology
5B3SB 3LNMB 4FMTA 1K5SA 3FYIB 1QLEC 2Y3GA 4CS9C 1NVPB 3K33A 5KYWA 3NRHA 3EH1A 3PHF2 5BUOA 4LBEC 4U5BE 1F4MA 4G27B 3K1IC 4P9OA 3ZRVA 2IJHA 2XAFA 2LSEA 2A68F 2WLHA 3MLGA 4PJMA 1V55C 2HV7A 3KH2A 4ZKIA 1AI5A 2WLKA 4MNDA 3MHHC 5LHGA 4R6ZA 1ZHXA 4OIOF 3EFOB 4C3BA 4A2NB 3ETEA 3CP1A 4G7HF 1IW7F 4DO2A 2R7WA 1VQ5V 1LS1A 3B9QA 1VMAA 1J95A 3DZAA 4X88A 3R65A 1FXKB 4DXWA 1J8MF 2H7BA 1FMVA 1V54B 3LDEA 3TETA 4YXWG 2M7WA 1QVGU 3I55V 2IYLD 2J7PA 4CSAA 5E2QA 3LDDA 2EIMB 2CGEA 3ECSA 2L9JA 4BEJA 1AR1B 2EJRA 3ABLB 2QY9A 3JYHA 4JURI 4PJLA 3NYLA 5CBFA 4P6IC 3UR3C 4CBEA 4MTOA 3SNHA 3BEHA 5D92A 5D91A 2YEVB 2Y39A 4IJJA 2BE5F 1ST6A 1EFRG 1ORQC 3E8GA 1K4CC 1WLEA 3F47A 1S7ZA 4KBLA 3E8HA 4WFFA 3QZCA 2JJ1G 4PFOA 1P7BA 1M57C 5EBLC 4XDJA 4JAUA 4YN0B 1MNEA 1ZU4A 3HLZA 1ZHWA 1OKKA 3ZG1A 1MOFA 4N23A 2YZSA 1FXVA 5EHHA 1R3LC 3X2QB 4O7GA 2KQ9A 3E86A 4MVRA 3OA1A 4N06A 2WVNA 4MVZA 3W7SA 3SP1A 5DLJA 4CIHA 2W4MA 3ZRSA 3LNRA 2QM7A 3X1OA 2V7QG 5T3WA 1ZHTA 2XXAA 3RVYA 3FVYA 3K04A 1AJNA 2ZR3A 5CBGA 2XNDG 5E33A 4HAMA 2WLJA 1MNDA 4UV8A 1RPOA 2JIZG 3DD7A 4CZZA 1VQOV 2A1DD 2D3OW 3L34A 2ZXWC 1D1CA 3DMDA 1M2OA 3RBZA 1M2VB 3HTKC 4PDMA 2Z5UA 3JCUQ 3CCUV 3PMRA 3E9VA 2HG5C 3JD0A 1K9MW 3E89A 3EG9B 4JAVA 3RW0A 2HV6A 4QJFB 3SYNA 4DBRA 1FXKA 2A6EF 4I9WA 2DYRB 3GB7C 3ZSUA 2NG1A 1H2GA 4J9ZB 3S28A 1F51A 4UUJC 4G0HA 5E3CA 2EILC 4TSFG 1VQLV 2DYSC 5KYYB 2H8PC 2G3KA 3BY6A 1K73W 1JX9A 2QA4V 3LS0A 1VK5A 3DM9B 2JEUA 3ABMC 2W9YA 2X6AA 5EGYA 3GWOA 3VBBA 1QR8A 1NU7D 2Q3TA 2MWQA 3ZRWA 2IW5A 1S72V 2B5UA 3T6JA 2P7TC 3K0DA 3OUFA 1FTSA 3T6BA 4KI2A 1N8RW 1L1FA 3LLKA 5B1NA 3EHBB 1GK9A 1I5YA 2MYSA 4PDRA 4QDLA 4MTGA 3IFXA 4MVOA 5E1AC 2X7RB 1Z3IX 1RPRA 2ZXOA 1O87A 4UXNA 2QTVA 1YJNV 3EH2A 4YJWA 3KKBA 4OIPF 3CYOA 4ASUG 2G3VA 3EGDB 3K7DA 1Z63A 4AK9A 3OUSA 3ZRWB 1QZXA 4BJ6C 4OINF 3CCQV 5B1OA 1GKFA 3SJQC 4JW1A 2B0JA 3CCVV 4WFHA 2WLNA 1OZ0A 4FIPC 4PA7A 2HJFC 1DTOA 4KNWA 1R3KC 1F23A 4U5HA 5DS6A 3DXJF 4BIUA 3DGEA 3OGCC 2NNUA 3EQLF 3CQZA 3JSZA 3AG1B 4CS9A 3EJNA 4G7OF 2IOQA 2Y3BA 3P30A 2EIJB 3F46A 1VQ8V 2LP7A 2QM8A 3ABKB 3AG4C 3ASOC 3KG2A 3MD0A 2HKOA 1NR7A 4RUEA 1KECA 1WGWA 1XL6A 3ETDA 3N0TA 3B0VC 1H8HG 4GT1A 1OCCB 1YTFD 2LFSA 2OCCC 4H33A 4JJFA 1YTFB 1PCXA 2B1GA 1K34A 1KQSU 3W7TA 1GTOA 5KA5A 1BR4A 5LBQA 2J9WA 3JCZA 2FFHA 4XWJA 3POVA 1E79G 3RVZA 2CNWD 2HLDG 3I4UA 4CS8A 3AQCA 1R6KA 4O6YA 1QR9A 3T2MA 4WFGA 1TWAA 3K06A 3B8NA 1OKKD 3KL4A 1NVPD 3CMAV 2PF4E 3IC7A 4Q20A 4YWQA 2H7VC 3K6BA 4BJ1A 1K5QA 4FWVA 5E3AA 3O6XA 3FB8C 4OD4A 4MW3A 2Y3HA 4PA6A 4QNHB 3S27A 4WFBV 2OTLV 1FFHA 3ITFA 5L3CA 1GM7A 2DWEC 4C3DA 3JD3A 4U5DE 1YITV 3E70C 4WFAV 4HYOA 4DOZA 4HE8D 3ASNC 1AI7A 3T4ZA 3DM5A 1UJWB 3DJUB 3WFVA 2B1IA 5H6RA 3LJBA 1P4RA 3D36A 4QE7A 3ZC4A 1Q7YW 1H38A 2EIKC 1KD1W 4Q5SF 5IY5B 1HWYA 4LP8A 1M90W 2Z3YA 1ZU5A 2M4EA 2Q67A 4UVAA 2XAGA 4LACB 3GODA 1K4DC 1K3EA 2EINC 5B1AC 1OCOB 2J0WA 3LEVA 4GX1A 4AX2A 5KYNA 3E2EA 1N1CA 4UV9A 4C7OA 1S76D 3SYPA 2P90A 4WFEA 5IYCO 2ZXPA 3W8IA 2J46A 2IU3A 4X0RA 1E1QG 1XL4A 5B3SC 5L3BA 5EBMC 3STZC 4BIZA 3T1CA 3CCJV 2JEXA 2DGJA 4MVUA 3OR6C 1O5HA 4G28B 3JT1A 2DWDC 1YJ9V 1SERA 2CNWA 3CCEV 3WG7B 4KC9A 2JK5C 1EZJA 5DQZA 2P6JA 4QPJA 4E7ZA 5EC2C 4RUFA 1G4YB 1S5HC 3ETGA 4MQ9F 3K1HA 2ZDIC 3OW2U 2FTKA 1Q81W 1KC8W 2D5RB 1PKXA 2EBOA 4ZBMA 3CCLV 2NUTB 4EKWA 2KW3C 1FXKC 3CSKA 4IAOA 4JPRA 3ZJZA 5KYWB 4DVYP 2R7OA 2XAJA 4JTCB 4P9PA 3LESA 2EIMC 4JTAB 4AE4B 2WLLA 2XAHA 3K3WA 3CC4V 3OMIB 2WL8A 3SPIA 5BZBA 5KYXB 1ZWIC 4FPPA 3JD2A 4I5SA 3SZRA 1YSCA 1VQMV 3RFYA 4PDLA 2Q6AA 3TD7A 4XTKA 2ZD9A 2WLLB 1GO3F 2QTOA 3LLIA 4C3EA 1OCZC 1AJQA 3B0UX 1EBOA 3CPWU 4J30B 3AG3C 3F7VC 3SPJA 4ULWA 2A0LA 4GX0A 3GANA 1SZTA 1NU9C 3E83A 3UMHA 1PL0A 2Y69B 4JCHA 3AG2B 4XLNF 3LSQA 5IDJA 1NR1A 2WLMA 1Z23A 2MK3A 3EFOA 3OMNB 2JDIG 2JD3A 5CI8A 4FJCC 4JZAA 5L3DA 3E8BA 3X2QC 1BL8A 1TR2A 3RIPA 1VQ4V 3G6EV 5EC1C 4JF3A 2NLJC 3W7UA 1VQKV 3LSSA 1BHAA 4I3MA 4ANJA 2WLIB 2R7UA 2IJJA 4LLEA 5L3FA 1Z6AA 2KNHA 3NKEA 3N24A 4IWBA 3VAYA 1FMWA 2OG2A 2VASA 2XL4A 2P67A 1PNLA 5EBWC 1YIJV 5T1DB 1FFTB 1M2VA 2R7QA 2YSUB 4EBBA 1OCRC 2ZXWB 2WAMA 1S0VA 3AQBA 1R3JC 4HEAJ 4U5EE 2ITCC 3QO8A 3W2WA 1D0YA 2R7RA 3EHNA 4RQEA 3CD6V 2P6VA 2WVQA 2YHSA 5L3QA 3FDQA 4MVQA 3I5QA 2V3CC 2EZOA 1FS0G 2XOKG 2DYRC 2PFDA 2X6CA 2J0XA 4RDAA 3EZHA 4O6NA 4MSWC 1VYKA 2V1DA 1ROPA 3EHMA 5DVWA 3K03A 5B1BB 2FGYA 2UXNA 3RKOF 1BR2A 3OMAB 3UKMA 4HZ3A 2PI4A 3EPVA 4BW5A 4M63A 2VB6A 5L3VA 2IH1C 4P2ZA 3ZN1A 1VQNV 1GMGA 3ABMB 2AHYA 2AHZA 4I44A 5L3EA 3OE7G 4N21A 5KUMA 1Y4MA 1VQPV 4HFKB 1NQTA 1M56C 4JASA 4PELA 1YHQV 4UVBA 4CBCA 3B8MA 1W0JG 4PDVA 4QE9A 4RO2A 3DAFA 3LS1A 4FESA 3EG9A 3UMIA 1AROP 2ATKC 3TK1A 3Q6NA 1GM9A 1S3JA 3LAYA 4NY3A 1AJPA 1QBZA 2ZR2A 4R50A 3AEIA 4Q7CA 2XAQA 3CCRV 1NJIW 2ZXRA 1RM1C 4ZLCA 1TUEB 1W2BU 1FXHA 2A69F 4AE4A 3IEEA 1MMGA 1BR1A 4BJ5A 1GM8A 3W8HA 3EGXB 3CC2V 5GW7A 3HB3B 3SYAA 2UXXA 2WLIA 4RBNA 4RAIA 4R8CA 3I56V 5KYXA 4WF9V 4PK4A 2X0LA 1LVKA 3WODF 5HSWA 1K33A 2EZPA 3ML0A 3G71V 1DF5A 1QLEB 2PX3A 4G2KA 4YT8A 3W7XA 4GX5A 3OAAG 1QLNA 2A79B 1KKDA 4KFMA 1RJ9B 1VYIA 2Q9CA 3FHDA 2PP4A 4K0DA 2J9UA 3O39A 5KYYA 1JQ0A 2EIJC 2DQ0A 4U7NA 4Z1MG 3ABKC 3AG4B 5LHIA 3LDCA 3FKSG 1CEZA 1JOYA 2ZPAA 1M9NA 4YT5A 1V55B 5FCLA 4XBFA 2V26A 4EWCA 1R73A 2OCCB 5L3GA 3FB5C 4MW8A 5T3TA 1D0XA 3RYLA 4BJTA 1AI6A 3CZ6A 5H6QA 3MHSC 5HFMA 3B0PA 3OM3B 5HFLA 2IU0A 4X89A 5LHHA 1D0ZA 4F4LA 3DJNB 3NDBB 2F43G 1MMAA 3F5WC 3K0GA 1VQ6V 1K8AW 1V54C 1JCHA 4JYCA 1AI4A 3CCSV 2CDQA 2J7PD 4GCZA 3MX3A 4GYTA 3UGOA 5LGTA 5DN6G 1G8XA 4W8KA 1D1BA 2HR3A 3ZRXA 1SRYA 3ABLC 2WZGA 1BMFG 3NYMA 4KP4A 5DS5A 4PA3A 4HFFB 4C7OB 1KP2A 2Y48A 4LERA 5IYDO 2R9RB 4CS7A 1JVMA 2WWWA 4ZLDA 2Q69A 4IRUA 1K97A 3FB6C 3CXCU 3ASNB 3K9AA 1NH2B 4E2LA 2J9VA 3ZCCA 5DQTA 3ZVRA 3CCMV 2I8BA 2IXNA 2GFHA 2C04A 2H94A 3L0IA 4YT2A 3HPLC 3F7YC 1M57B 2DQ3A 4PJJA 2DW4A 3ZMVA 5H9CA 5IY5C 2CK3G 2CW0F 3K66A 1J8YF 3M1CB 2EINB 2X6BA 4MS2A 1TWGA 4J9YB 3VOUA 2LFRA 3EFFK 1Y66A 4FK5C 3ZIBA 1W2WA 4CS8C 4QI0A 3UM7A 3SPCA 1VOMA 3ZMSA 4OIRF 1SETA 2W0FC 2Z15A 2E87A 3ABTA 4MVMA 3NKDA 4KNVA 1D1AA 2IH3C 4I1MA 5KYUA 4BJ5C 1WPXA 5C93A 3OEEG 1YI2V 1PD3A 3FB7C 4U7OA 3JRTA 4O6MA 4OXSA 1W0KG 4O79A 1H8EG 3JYCA 4JYBA 1B6QA 2QKSA 5DM6V 2Q9BA 2HFEC 2PI5A 4TWKA 3WG7C 1MABG 3Q6MA 1NG1A 1IXMA 3FYEB 1YJWV 2R7TA 2W6IG 2A6HF 3QO5A 2WZFA 3QO7A 2KGOA 3E8FA 3EZIA 3G4SV 5CMUA 2KJGA 1DF4A 3KMIA 4J32B 2QE7G 4UVCA 2IXMA 4QPKA 4GX2A 3SEOA 2BOBC 2ITDC 4H37A 1ZHZA 2Q9AA 4PFPA 4BJ6A 3ZIAG 5F5FA 4FX5A 3T4RA 3QNEA 1R6NA 2EILB 4MTFA 2DYSB 2IXPA 3VYWA 2R7VA 2HVKC 4H4KC 3EGDA 3ZMTA 3I5PA 2YEVA 3PJSK 5LGNA 1R3IC 2WZLA 3DAGA 3TCUA 4LC1A 1K7DA 3ZN0A 4QI2A 3SPGA 2GHYA 1MSWD 3EGXA 3SYOA 4Q4ZF 1JPJA 1SMYF 2ZQMA 2Q68A 4DBQA 1TWHA 4F4BA 1OCZB 3OEOA 2W6JG 4PA4A 2IXOA 4OD5A 3AG3B 2R7SA 4JTDB 3SYCA 3SPHA 2NUPA 4YT4A 4MVSA 4U5GA 3D3IA 3A0RA 1JPXA 3OEHG 2Y69C 3T4DA 4I1OB 4JJGA 4K7BA 3AG2C 1IZMA 4U5FE 2NUTA 1VQ7V 2L81A 1NH2D 2KB1A 1NKDA 3H65A 4E7SA 5EK0A 2XRHA 4XLPF 4BG0A 4PJNA 4PA9A 2J45A 4MT8A 4P30A 3OR7C 2HVJC 2X51A 5FL7G 1SF8A 3W2VA 1Q86W 4DVZA 1Q82W 1VQ9V 2ZDIA 2JJ2G 1MMDA 3RH3A 2R7XA 1PD1A 2Y3DA 1KP3A 3DTUB 5KUKA 3ZMUA 3FAJA 1ENVA 1BHBA 3AG1C 2OTJV 1SZIA 2WVOA 4LLCA 1MMNA 4BAYA 4G7ZF 1DLBA 1M1KW 3Q7LA 3STLC 3E35A 3S0XA 3SYQA 1G8MA 1FFTC 1ZHYA 3ASOB 1NZEA 1OCRB 3NXSA 3N2ZB 5CA3A 1JPNA 4QIWF 2H7OA 3S29A 1OCCC 1TKNA 4L87A 2PX0A 1COWG 1SESA 2VH3A 4CSAC 1QVFU 3NG1A 4JVSA 2G62A 1LNQA 3CMEV 1KU2A 3OFNG 2P7VA 1Z5ZA 1NBMG 2WSSG 2W45A 4U5CE 3H01A 4RD9A 3UGPA 2R9IA 1MG1A 3IGAC 5IYBO 2IJKA 4GEHA 1PD0A 2BOCC 1PNMA 5B1BC 3P32A 4R7CA 3JD1A 2A9HA 2C03A 2XXAB 3JD4A 5J9PC 1ZYRF 1F4NA 4JGSA 5KA6A 3K79A 3NYJA 2XASA 2QEXV 1I5XA 2OT5A 5CN0A 5LGUA 1M56B 1K92A 4RQFA 1THZA 4OIQF 1TWCA 3ZMZA 4MTXA 1RJ9A 1QCEA 1JJ2U 3W7WA 5CI9A 2WB7A 4WJ0A 3B77A 4KUMA 3LUTB 2W4BA 5CBHA 1LKXA 5F5HA 3K08A 1OHHG 3UMKA 1E1RG 5DS4A 2K1EA 3OWTA 2EIKB 3HJCA 2GSMB 4XDLA 1RM1B 2NUPB 3UNGC 4B6IA 3QMKA 3ABUA 3CC7V 4X8AA 5KYUB 2IJIA 5B1AB 2O9XA 1OCOC 4XDKA 4TT3G 2XSEA 3V7OA 4LCUC 3Q7GA 1CP9A 1PNKA 1S77D 4WCEV 1CPYA 2WPDG 2C2AA 3M99B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WLI B;  3LNM B;  2WLN A;  4PA7 A;  4WFH A;  3SPC A;  3UM7 A;  2HJF C;  2W0F C;  1QLE C;  1R3K C;  4MVM A;  3OGC C;  2IH3 C;  4LBE C;  5EBW C;  4G27 B;  3FB7 C;  3KG2 A;  3AG4 C;  4P9O A;  3ASO C;  4OXS A;  2WLH A;  3JYC A;  4RUE A;  1OCR C;  1V55 C;  1XL6 A;  2QKS A;  1R3J C;  2HFE C;  2ITC C;  4TWK A;  2WLK A;  3WG7 C;  2OCC C;  4H33 A;  4R6Z A;  4MVQ A;  3E8F A;  2DYR C;  2X6C A;  4GX2 A;  2BOB C;  2ITD C;  4H37 A;  3RVZ A;  4MSW C;  1J95 A;  3T2M A;  3K03 A;  4WFG A;  3R65 A;  3K06 A;  4MTF A;  4X88 A;  4DXW A;  3LDE A;  3TET A;  3UKM A;  4HZ3 A;  2HVK C;  3LDD A;  2YEV A;  3PJS K;  4BW5 A;  2IH1 C;  3FB8 C;  4P2Z A;  1R3I C;  4MW3 A;  2AHY A;  2AHZ A;  4PA6 A;  3TCU A;  4QNH B;  5CBF A;  5KUM A;  3SPG A;  4MTO A;  1M56 C;  3BEH A;  3SYO A;  2DWE C;  4CBC A;  4PDV A;  4QE9 A;  4RO2 A;  2Q68 A;  4HYO A;  1ORQ C;  3ASN C;  2ATK C;  4PA4 A;  3E8G A;  1K4C C;  4JTD B;  3SPH A;  3SYC A;  3T4Z A;  4MVS A;  3E8H A;  4WFF A;  3T4D A;  2Y69 C;  4R50 A;  4QE7 A;  3AG2 C;  1P7B A;  1M57 C;  2EIK C;  2KB1 A;  5EBL C;  4XDJ A;  4LP8 A;  5EK0 A;  2Q67 A;  1K4D C;  2EIN C;  4PA9 A;  5B1A C;  1R3L C;  4GX1 A;  4P30 A;  3OR7 C;  2HVJ C;  3E86 A;  4MVR A;  3SYA A;  2WLI A;  4MVZ A;  4RAI A;  4R8C A;  4WFE A;  3SYP A;  3ZRS A;  1XL4 A;  5B3S C;  5EBM C;  3STZ C;  3RVY A;  5KUK A;  3T1C A;  4GX5 A;  2A79 B;  3AG1 C;  3K04 A;  4KFM A;  4MVU A;  5CBG A;  1KKD A;  3OR6 C;  4G28 B;  2WLJ A;  2EIJ C;  3STL C;  3SYQ A;  3ABK C;  2DWD C;  1FFT C;  3LDC A;  2ZXW C;  3RBZ A;  4PDM A;  1OCC C;  2HG5 C;  2JK5 C;  3FB5 C;  4MW8 A;  3E89 A;  5EC2 C;  3RW0 A;  4RUF A;  1G4Y B;  1S5H C;  1LNQ A;  4I9W A;  3GB7 C;  3IGA C;  4X89 A;  4J9Z B;  4F4L A;  4UUJ C;  4ZBM A;  4EKW A;  2BOC C;  2EIL C;  3F5W C;  2DYS C;  3K0G A;  1V54 C;  2H8P C;  4R7C A;  5B1B C;  3ZJZ A;  4JTC B;  2A9H A;  4P9P A;  2EIM C;  4JTA B;  2WLL A;  5J9P C;  3ABL C;  3ABM C;  3SPI A;  5BZB A;  1ZWI C;  2X6A A;  4PA3 A;  2R9R B;  4PDL A;  1JVM A;  2Q6A A;  2Q69 A;  2ZD9 A;  2P7T C;  2WLL B;  2QTO A;  3K0D A;  3OUF A;  1OCZ C;  3FB6 C;  3AG3 C;  3F7V C;  3SPJ A;  2A0L A;  4GX0 A;  3LUT B;  5CBH A;  3K08 A;  3E83 A;  4PDR A;  4MTG A;  3IFX A;  4MVO A;  5E1A C;  3HPL C;  2K1E A;  3F7Y C;  4XDL A;  2WLM A;  5IY5 C;  4X8A A;  1OCO C;  2X6B A;  4XDK A;  3E8B A;  4MS2 A;  3X2Q C;  4LCU C;  1BL8 A;  3OUS A;  4J9Y B;  3VOU A;  3EFF K;  5EC1 C;  2NLJ C;  3SJQ C; 
#chains in the Genus database with same CATH topology
 5B3S B;  4JI6 B;  5A6K A;  4NXM B;  1U96 A;  1WPB A;  1Y76 A;  3PHF 2;  3K1I C;  2XAF A;  2A68 F;  1V55 C;  4BEM J;  4MND A;  1AI5 A;  4J11 A;  5GON B;  4R6Z A;  1LR1 A;  3UT5 B;  3AJM A;  3UO3 A;  4ZHQ B;  4PI2 A;  2N74 A;  1ORY A;  1TQG A;  1J8M F;  3MLG A;  1FMV A;  1V54 B;  3TET A;  5K0I A;  4CSA A;  1AUE A;  2EIM B;  2CGE A;  5BQG A;  2EJR A;  3ABL B;  3JAT A;  2QY9 A;  4JI3 O;  1KTM A;  3ATP A;  2P61 A;  2HEP A;  2EUL A;  4JI1 O;  1OR3 A;  4F6E A;  4YIO A;  3FFQ A;  2ICW G;  5IYZ A;  5JLI A;  1Q0K A;  2YL1 A;  2CYD A;  4FZ0 A;  2MHR A;  1ZU4 A;  3HLZ A;  1OKK A;  2XHB A;  2YZS A;  1N34 O;  3WHN A;  2OWO A;  1LM3 B;  2LJ2 A;  3E86 A;  4MVR A;  2VQF O;  3SP1 A;  1SA0 A;  4MVZ A;  2WVN A;  1VMG A;  4CIH A;  2W4M A;  3CEX A;  3LNR A;  1ZW3 A;  4BWA A;  3VQW A;  3UQ8 A;  1XMO B;  3CB2 A;  4PAC A;  4TV9 B;  1KNY A;  1AJN A;  2XND G;  2WLJ A;  2GUZ B;  1RPO A;  3DD7 A;  5IJ9 A;  2HSQ A;  2XL8 A;  1LE2 A;  3L34 A;  3DMD A;  3RBZ A;  1BGY H;  4FFB A;  1M2V B;  4TV8 A;  2HG5 C;  1K9M W;  1R1B A;  3E89 A;  4CX9 A;  4DBR A;  1FXK A;  2Y0I A;  2DYR B;  3GB7 C;  1N32 O;  2YL0 A;  4WGY A;  4DUY B;  1F51 A;  2HJ3 A;  3OTO O;  4CH4 A;  2G3K A;  4YHH B;  1JX9 A;  1ZL8 A;  1GS9 A;  4CS4 A;  2Q00 A;  3VBB A;  1N33 O;  3DXR A;  2MWQ A;  4P9F A;  2IW5 A;  3T6J A;  3TGU H;  3OUF A;  3PN1 A;  3S3W A;  2OIE A;  2Y0P A;  2HSB A;  2ZM6 O;  4PDR A;  3H1J H;  4MTG A;  3IFX A;  4MVO A;  2ZXO A;  1O87 A;  5KMG B;  1GRJ A;  4YJW A;  3ZQV A;  4OIP F;  1XMQ O;  2P22 C;  3M4B A;  1D5A A;  3K7D A;  4B3T O;  5CA1 B;  3WB2 A;  1LS4 A;  4BJ6 C;  5FPR A;  5B1O A;  4X64 B;  5LP6 A;  4JW1 A;  4XQ1 A;  4WFH A;  4PA7 A;  3AG7 A;  2HJF C;  4U5H A;  5DS6 A;  4JI8 O;  1TGO A;  2Y3B A;  4XLP F;  2ZE5 A;  3A2F A;  1WGW A;  4RUE A;  2R72 A;  3N0T A;  3K1I A;  3OD4 A;  4PD4 F;  1YTF D;  3JCU Z;  3QVZ A;  1Y67 A;  3TJ5 A;  1BR4 A;  1K34 A;  4LF5 O;  3R66 A;  1GTO A;  1V74 B;  5LBQ A;  1KU9 A;  2EPL X;  3B4S A;  2UU9 B;  4XWJ A;  4DRI B;  2CNW D;  3I4U A;  4DR7 O;  3V5Z A;  1H2K A;  1QR9 A;  4WFG A;  1NVP D;  2PF4 E;  3ICX A;  3DKA A;  4N6C A;  2H7V C;  4BJ1 A;  1K5Q A;  1BQ0 A;  3FB8 C;  4OD4 A;  4MW3 A;  4PA6 A;  1GQA A;  3QTH A;  3G4X A;  3M79 A;  2OTL V;  3ITF A;  5L3C A;  3SJC C;  2CE4 A;  4LDQ A;  5CB4 A;  2HUJ A;  1AI7 A;  2ILM A;  2ZNI A;  2UU9 O;  3DJU B;  4KL1 A;  3WFV A;  5L0F A;  3FAV B;  3ZC4 A;  3A9C A;  1WOL A;  2H8A A;  3U2M A;  3J81 N;  1RCP A;  4OIO F;  3FX7 A;  1M90 W;  2Q67 A;  4LAC B;  2XAG A;  1K4D C;  2J0W A;  3LEV A;  4UV9 A;  3CX5 F;  1EN4 A;  3U11 A;  5IJ9 B;  2J46 A;  2JEX A;  4MVU A;  1QHT A;  1O5H A;  1YJG A;  4A4A A;  4B3T B;  2CNW A;  4IYH A;  3WG7 B;  4BIO A;  5EC2 C;  2ZDI C;  5GTH Z;  1Q6U A;  2FTK A;  1SYQ A;  2D5R B;  2EBO A;  3CCL V;  3L73 H;  1Z5V A;  1C03 A;  5KYW B;  5BXZ A;  4JTC B;  2R7O A;  1QQC A;  4JI2 O;  2OKU A;  4AE4 B;  3OMI B;  1HNZ O;  2YL7 A;  5JWP A;  3R7C A;  4O4J B;  2O57 A;  4JI8 B;  1YSC A;  4FLY A;  4LF7 B;  4PDL A;  3OTO B;  2Q6A A;  2GV9 A;  3JAK A;  5IJ0 A;  3B0U X;  3ZQY A;  3T1Y B;  4GX0 A;  1L3P A;  1H2L A;  1XMQ B;  2BSK A;  3AG2 B;  5IDJ A;  1Z23 A;  3UT5 A;  3OMN B;  2JD3 A;  3CE2 A;  2XTA A;  4FJC C;  4G78 A;  5L3D A;  1AEP A;  2F1M A;  5EC1 C;  3G6E V;  5LMN O;  1C02 A;  3N2G A;  4LLE A;  4UB8 Z;  2F66 C;  1N33 B;  3P3N A;  2LGQ A;  4DJ9 A;  4X9Q A;  3QW0 A;  1PNL A;  5EBW C;  5KHG A;  1AIL A;  3JSN A;  5FPO A;  1ZAU A;  4YHH O;  2ZXW B;  4HEA J;  1R3J C;  1HE1 A;  4U5E E;  2ITC C;  2AP3 A;  1VB5 A;  5L3Q A;  2YHS A;  1GN6 A;  4FM0 A;  4K0K B;  3FOP A;  3CRC A;  3I5Q A;  1FS0 G;  4K1O A;  2J0X A;  4JI1 B;  4RDA A;  3EZH A;  1NTM H;  4MSW C;  4O6N A;  2A06 H;  3RKO F;  2UXN A;  4YIP A;  1H9T A;  3UKM A;  3NMJ A;  3EPV A;  2FL4 A;  5L3V A;  3G80 A;  3ZN1 A;  1GMG A;  2AHY A;  1ZSP A;  2ASR A;  3OE7 G;  3TOL A;  3HKC B;  1NQT A;  4JAS A;  4FLV A;  3LS1 A;  4PDV A;  1W0J G;  3NDB B;  1MZE A;  1Z5W A;  1VEW A;  1VLT A;  2OU6 A;  4GUN A;  3CS5 A;  1Q6I A;  2J9B A;  1QBZ A;  4DR5 O;  4Q7C A;  2XAQ A;  3DE9 A;  2ZXR A;  1MNG A;  2F93 B;  1C17 M;  1ZZP A;  1UG7 A;  4BJ5 A;  3W8H A;  3JAS A;  5EYP B;  2UXX A;  5KYX A;  4WF9 V;  3JRM O;  3C62 A;  2X0L A;  4JI6 O;  3G6B A;  2PX3 A;  3BFR A;  4G2K A;  4NTX A;  3W7X A;  3T6G B;  1QLN A;  2A79 B;  4K0D A;  1AVO B;  3JAM N;  3RGB A;  2EIJ C;  4JCZ A;  2DQ0 A;  1IBK B;  1CEZ A;  1JOY A;  3AG4 B;  4CH6 A;  4DR5 B;  1CPR A;  2ZPA A;  1V55 B;  2NSG A;  5FCL A;  2UXD B;  5CIV A;  3MHS C;  4K3A A;  3T9O A;  3S90 A;  3B0P A;  4X66 B;  4DV7 O;  1D0Z A;  2QWO B;  3DJN B;  3F5W C;  1Q43 A;  3K0G A;  1K8A W;  4JEA A;  1V54 C;  1JCH A;  3MX3 A;  4GYT A;  4JZ2 A;  2CDQ A;  5F5F A;  1N0N A;  5JSL A;  3ZRX A;  1BMF G;  3GM1 A;  4NXM O;  1SA0 B;  3L8J A;  5IYD O;  1JVM A;  3DSQ A;  4PI0 A;  2EPK X;  1K97 A;  4IRU A;  3ASN B;  1NH2 B;  2J9V A;  1WN0 A;  3AK1 A;  5DQT A;  4O4I A;  1Q0D A;  4LF4 O;  2XM4 A;  1EZV H;  5IYZ B;  5LA6 A;  2DQ3 A;  2JGD B;  2CK3 G;  4MS2 A;  4J7J A;  4J9Y B;  2LFR A;  3CRQ A;  2QWP B;  1FAP B;  4OIR F;  2ARH A;  3ZMS A;  2D2C B;  1Q0M A;  3NKD A;  4MVM A;  4FLW A;  5C93 A;  1YEW A;  1HE9 A;  4AHC A;  3EVK A;  4O79 A;  1B6Q A;  2QKS A;  2Q9B A;  1A0B A;  4TWK A;  3Q6M A;  1IXM A;  1YJW V;  1PL4 A;  3E8F A;  2YRF A;  1PPJ H;  3G4S V;  2QLA A;  3KMI A;  2QE7 G;  4UVC A;  1AP6 A;  3OGI B;  4BJ6 A;  4PFP A;  5EZY A;  1HNZ B;  1SC5 B;  3QNE A;  2BTQ B;  2GBO A;  2UXB B;  3I5P A;  5LGN A;  3V5X A;  1R3I C;  3DAG A;  4LF9 O;  4NB5 A;  1Q3E A;  3K5L A;  2ZQM A;  5L0J A;  1VIB A;  3AG3 B;  2X0C A;  1VLS A;  3SPH A;  2NUP A;  2XLH A;  3N2K A;  2BC5 A;  1JPX A;  3OEH G;  1BSM A;  3BRJ A;  2JGU A;  4I1O B;  1NH2 D;  2KB1 A;  3H65 A;  2CTP A;  5EK0 A;  3H1K H;  4JE9 A;  5JJE B;  5A9G A;  1Q86 W;  1SQQ H;  4DR6 O;  2JJ2 G;  1ZX3 A;  1YDI A;  5A6B D;  3JSE O;  2R7X A;  1Y76 B;  2Y3D A;  3ZX6 A;  2DOS A;  2OTJ V;  3RF3 A;  2Q4F A;  3HNJ A;  3Q7L A;  3STL C;  5L0I A;  3SYQ A;  2ADP A;  1FFT C;  5IT9 N;  3RYC A;  1NZE A;  4LWS A;  1JPN A;  2QGN A;  1OCC C;  1QPU A;  3L1M A;  2VH3 A;  1SES A;  4CSA C;  4K8X A;  2PUS A;  3KYJ A;  4JVS A;  2PTM A;  1KU2 A;  3UGP A;  1NBM G;  1PP9 H;  1YZA A;  2R9I A;  1MG1 A;  2IJK A;  1Y74 A;  1PD0 A;  1WP7 A;  2BOC C;  3K5M A;  3C90 A;  4NVP A;  3NMK A;  1P49 A;  3JD1 A;  2C03 A;  2XXA B;  2PY5 A;  2BTQ A;  3ZDL A;  2YC0 A;  5JUA A;  3JSL A;  2ZE6 A;  4X65 O;  3NYJ A;  2R05 A;  2QEX V;  5LGU A;  1VF6 A;  1AVM A;  3ZMZ A;  2HS5 A;  3T1H O;  5CI9 A;  1QCE A;  2OEV A;  1NFN A;  4Z9H A;  3SXM A;  3VM6 A;  2IM9 A;  4WJ0 A;  3B77 A;  4KUM A;  4OGQ B;  3UMK A;  3K08 A;  3E22 A;  1E1R G;  1L7C A;  1OR2 A;  1T01 A;  2EIK B;  2N05 A;  1RM1 B;  4FM1 A;  3ZTZ A;  2MW2 B;  4IIJ A;  3QMK A;  1WA8 B;  3HKE B;  1T5O A;  4X8A A;  1PM9 A;  5B1A B;  2O9X A;  4FZ1 A;  1FNT c;  4DV4 O;  3Q7G A;  4ABM A;  1PNK A;  1S77 D;  1CPY A;  2WPD G;  1EN6 A;  1YF2 A;  1QLE C;  4ZOL B;  2Y3G A;  4CS9 C;  3L74 H;  2KYH A;  3K33 A;  3NRH A;  3O10 A;  5H5N A;  3EH1 A;  5FZT A;  5BUO A;  1F4M A;  4G27 B;  3IQC A;  4P9O A;  5EIB D;  4GKJ B;  2WLH A;  2HV7 A;  2ZM6 B;  3KH2 A;  2WLK A;  3RYF B;  3G67 A;  3KCX A;  4XEV A;  1SQF A;  3EFO B;  3FAP B;  4DW0 A;  3FD9 A;  2Q9L A;  1WB7 A;  1IW7 F;  2R7W A;  1VQ5 V;  4X20 B;  5A6B A;  5GPG B;  2H7B A;  1EQ1 A;  3LDE A;  4YXW G;  2M7W A;  5E2Q A;  1XRE A;  1WA8 A;  3JYH A;  4JUR I;  4PJL A;  4P6I C;  5FNV B;  4MTO A;  5D92 A;  5D91 A;  2Y39 A;  3THO A;  2BE5 F;  1ST6 A;  1H9G A;  1EFR G;  3SXZ A;  4D4X A;  3E8G A;  1K4C C;  3E8H A;  4WFF A;  1P7B A;  1MA1 A;  1O9H A;  4IGG A;  5JP7 A;  4XDJ A;  4JAU A;  3TJT A;  3ZG1 A;  4N23 A;  1FXV A;  1T6Q A;  5A69 A;  4O7G A;  4J7K A;  4DK1 A;  4X1Y A;  2KQ9 A;  2UXC B;  3ZRS A;  4UCO A;  1IBL B;  2UXD O;  2KKW A;  2XXA A;  3KKY A;  1N34 B;  4NXN B;  3FVY A;  3K04 A;  2ZR3 A;  5CBG A;  1G4U S;  1L0N H;  5E33 A;  1MND A;  2PNO A;  2JIZ G;  4CZZ A;  1VQO V;  5HV9 A;  1D1C A;  2J8W A;  3JCU Q;  2IBZ H;  2Z5U A;  3UCS C;  1OW7 A;  1NU1 H;  4JAV A;  4F6R A;  3RW0 A;  2XLW A;  2XLD A;  4I9W A;  4X62 O;  1H2G A;  4G0H A;  1S05 A;  2EIL C;  4TSF G;  1VQL V;  2DYS C;  2A0B A;  2FYU H;  1K73 W;  2QA4 V;  4N4W A;  1TFK B;  3DM9 B;  1Y74 B;  4B7K A;  5EGY A;  2BSK B;  1NU7 D;  2Q3T A;  1S72 V;  2B5U A;  2LW1 A;  2P7T C;  4J7Z A;  1L1F A;  1GK9 A;  2MYS A;  4EIY A;  4O4J A;  1Z3I X;  2KK1 A;  3KPH A;  1LI7 A;  3IHU A;  3EH2 A;  3ZHV A;  4HNA B;  3U0C A;  2AXT Z;  5BR8 B;  1Z63 A;  3ZRW B;  3V5Y A;  3LEO A;  1LUW A;  4O2B B;  3H2U A;  3HNI A;  3SJQ C;  2XLE A;  4K0K O;  3HKK A;  1ZUQ A;  4JI4 B;  1DTO A;  1H2M A;  3DXJ F;  3EQL F;  3OGC C;  3AG1 B;  1FJG B;  1JAF A;  4CS9 A;  4G7O F;  2IOQ A;  2XLV A;  2EIJ B;  2Q9C A;  3ABK B;  3EJN A;  3VAY A;  3B0V C;  1NR7 A;  1KEC A;  3ETD A;  1H8H G;  2UXC O;  4I0X A;  4JJF A;  2XS1 A;  4LDR A;  1YTF B;  2B1G A;  4UFZ A;  2J9W A;  5KA5 A;  3MDS A;  3K57 A;  3MFN A;  5DEC A;  1RKE A;  4O6Y A;  3T2M A;  3KL4 A;  1WN7 A;  1FFX A;  5JH7 A;  1I94 O;  3IC7 A;  4Q20 A;  2G38 A;  4YWQ A;  5E3A A;  4JZG A;  4DUZ B;  2DB4 A;  2L6G A;  1HNX O;  2Y3H A;  4QNH B;  1I08 A;  3S27 A;  3W4Y A;  2F22 A;  1B06 A;  1YZB A;  1GM7 A;  2DWE C;  4DV5 O;  4LFA O;  3E70 C;  2GAQ A;  5LA6 B;  3T4Z A;  2HHH B;  3DM5 A;  2OYQ A;  1A7V A;  2L6H A;  3D36 A;  2OEX A;  1Q7Y W;  4H0L B;  2E3C A;  4KI2 A;  5B5E Z;  4NC3 A;  2EIN C;  1OCO B;  4GX1 A;  4AX2 A;  1TUB B;  3U8P A;  1S76 D;  2P90 A;  2GDS A;  4H54 A;  3STZ C;  2LIG A;  3HNL A;  3ZWI A;  5DED A;  3JT1 A;  1SER A;  4YL0 A;  3ZTM A;  4KC9 A;  3SXK A;  3C63 A;  1NTZ H;  5DQZ A;  1BT8 A;  4CJO A;  4RUF A;  2YS8 A;  3QTC A;  2L6L A;  1A7D A;  2D4U A;  4FM2 A;  1EA8 A;  2NUT B;  1PKX A;  4I55 B;  1M93 A;  4GKK O;  3ZJZ A;  5KLV H;  2XAJ A;  4JYA B;  2HKV A;  3LES A;  2F4V O;  2WLL A;  3BAA A;  3SPI A;  5KYX B;  1ZWI C;  1NTK H;  4I5S A;  4IHJ A;  4JI7 O;  5B66 Z;  2RDC A;  4JI0 O;  3TD7 A;  4XTK A;  2ZD9 A;  2WLL B;  4C3E A;  1EBO A;  3CPW U;  1SR2 A;  3AG3 C;  3SPJ A;  4ULW A;  3GAN A;  2RD9 A;  1SZT A;  3JAR A;  3E83 A;  1NU9 C;  4NTW A;  4JCH A;  3B40 A;  4XLN F;  4NCQ A;  1NR1 A;  4UDV A;  2WLM A;  2MK3 A;  1US6 A;  4W4L A;  3FMS A;  4JI7 B;  3X2Q C;  1BL8 A;  4X1K A;  3SDL A;  1TR2 A;  1EI7 A;  1VQK V;  1HR0 O;  4JV5 O;  4ANJ A;  4I3M A;  2FKX A;  3APO A;  4DV1 O;  3JAS B;  2RMK B;  2KQX A;  5JJJ B;  4Q6G A;  5L3F A;  1Z6A A;  4D7T A;  4IWB A;  2OG2 A;  1WB8 A;  4LF6 O;  2XL4 A;  2AWY A;  2P67 A;  4TV8 B;  5T1D B;  1FFT B;  1KYO F;  1M2V A;  2R7Q A;  2YSU B;  1I4Z A;  1S0V A;  4DR6 B;  1JA8 A;  3W2W A;  2GUZ A;  4DV2 O;  2R7R A;  2EPM X;  2RCV A;  2Q7E A;  1OXB A;  2JX0 A;  5COG A;  2V3C C;  1Z2G A;  3RT3 C;  2X6C A;  1VYK A;  1ROP A;  4Z9I A;  1L8D A;  3FXH A;  4HZ3 A;  2PI4 A;  4KXR A;  2YXH A;  4I50 B;  2GTA A;  2M64 A;  4M63 A;  5AC5 A;  2IH1 C;  5JVD B;  4CDY A;  4B3S O;  1VQP V;  4HFK B;  4EUK B;  1Y6X A;  5AC4 A;  1YHQ V;  2UUH A;  1ORS C;  4FES A;  1ARO P;  5IWA B;  4E4E A;  1S3J A;  1JFF A;  3RN4 A;  5ITZ B;  3CCR V;  2QKC A;  3U9M A;  4J80 A;  2A69 F;  4AE4 A;  4TV9 A;  1BR1 A;  2OJQ A;  3N2G B;  3SYA A;  2DI3 A;  4RAI A;  4R8C A;  3I56 V;  4PK4 A;  4LFC O;  4DRH B;  1BZ4 A;  2EZP A;  5A6A A;  1I94 B;  3O9O A;  1R5I D;  1RJ9 B;  4GX5 A;  4ZLC A;  3FHD A;  1KKD A;  1VYI A;  4DRX A;  5KYY A;  4U7N A;  3LDC A;  3HKB B;  2V26 A;  5KHK A;  4EWC A;  4WBN B;  4MW8 A;  4JYY A;  1D0X A;  5K1X A;  1WJZ A;  3SJA C;  4E17 A;  5HFL A;  2E5L O;  1SF9 A;  4X89 A;  5LHH A;  4F4L A;  2F43 G;  2B0H A;  1MMA A;  3PDM P;  3WB0 A;  1SZX A;  2LFD A;  2J7P D;  5F28 E;  5K1P A;  4NYK A;  3CRM A;  5DN6 G;  1UFB A;  3C8G D;  1SRY A;  5J2T A;  2WZG A;  3NMI A;  3AK3 A;  4KP4 A;  3NYM A;  3B09 A;  4K8Z A;  5BR8 O;  2R9R B;  3L70 H;  5F2V O;  3C8Z A;  2XT9 A;  1XI1 A;  4JI3 B;  1XZQ A;  3K9A A;  1DK1 A;  3ZVR A;  3BAB A;  2GFH A;  1OW6 A;  2Z0A A;  2LK4 A;  3L0I A;  3HPL C;  2ETS A;  3F7Y C;  4PR9 A;  3ZMV A;  1XNR B;  2AWC A;  1FPO A;  4DV3 O;  3K66 A;  1AP5 A;  4LNU A;  2R25 A;  2X6B A;  5L0G A;  1D2D A;  1TWG A;  3HNK A;  4H44 B;  4FK5 C;  5AG2 A;  3VOU A;  1Q0G A;  1R4T A;  3S3X A;  3ZIB A;  1XEQ A;  2QE9 A;  1VOM A;  1SET A;  3ABT A;  1FAF A;  4NTY A;  4BW9 A;  2IH3 C;  2QDO A;  1PD3 A;  1YI2 V;  4U7O A;  4KHP O;  4U9D A;  5JVE A;  3JRT A;  4O6M A;  4OXS A;  1W0K G;  4X62 B;  1H8E G;  1KMI Z;  3JYC A;  2VCB A;  2HFE C;  3WG7 C;  1Q8I A;  1Z7Q c;  3FYE B;  2W6I G;  3QO5 A;  2FB5 A;  2KG7 A;  1YYX A;  2KJG A;  2P06 A;  3SEO A;  4CC6 A;  4TOI A;  4QPK A;  4GX2 A;  2BOB C;  1CGO A;  5BQH A;  2P0N A;  3ZIA G;  4FX5 A;  3T4R A;  2EIL B;  1NZ6 A;  4K35 A;  1NFO A;  3IC9 A;  4CC5 A;  4DV3 B;  1K7D A;  4LH7 A;  1MSW D;  4XEK A;  3EGX A;  5TJ5 E;  5TIS Z;  1JPJ A;  2CTR A;  1SMY F;  2Q68 A;  1OCZ B;  2EX3 A;  4MVS A;  3D3I A;  4K7B A;  2Y69 C;  3AG2 C;  2NUT A;  3EXA A;  1VQ7 V;  5KHH A;  1NKD A;  3JAW A;  4JI5 O;  4I4T A;  4EFB A;  2KSF A;  3CHX A;  2J45 A;  3QW1 A;  4P30 A;  1HNW B;  2X51 A;  2HVJ C;  3W2V A;  4DVZ A;  2LD6 A;  2ZDI A;  3U0Z A;  1KP3 A;  3DTU B;  1IVS A;  3ZMU A;  1BHB A;  1BS3 A;  2WVO A;  4G7Z F;  4BAY A;  3E35 A;  1G8M A;  2VQE O;  3ASO B;  1E85 A;  1F7Y A;  2NPU A;  2CAZ C;  2H7O A;  2JRI A;  2DN9 A;  4U9E A;  3S29 A;  4L87 A;  2VRZ A;  3NG1 A;  1JR9 A;  1GN3 A;  3OFN G;  4U5C E;  3CJH A;  2DMX A;  1J5E O;  5B1B C;  4R7C A;  4LNU B;  1QSP A;  2A9H A;  4L8J A;  3T1Y O;  2OQM A;  2CCY A;  2A3Q A;  5JQG A;  3HKB A;  1F4N A;  4JGS A;  2UUC B;  2CTQ A;  3K79 A;  1X59 A;  4LF7 O;  2OT5 A;  5CN0 A;  1WAT A;  1THZ A;  1URF A;  4DR2 O;  2YVK A;  3GEI A;  5A6J A;  2Q4P A;  1RJ9 A;  3W7W A;  2GDC A;  3DWW A;  5B3I A;  5IWA O;  5CBH A;  1LKX A;  2YWA A;  5DS4 A;  1VF5 B;  2K1E A;  3ZHT A;  2Y4U A;  5E79 Z;  3CC7 V;  4JKV A;  4AL1 A;  4LCU C;  3VQV A;  2JS3 A;  4I9Q A;  2RQ6 A;  3LNM B;  1K5S A;  3D3Q A;  1NVP B;  5KYW A;  1N4C A;  4WGZ A;  4U5B E;  2ZE8 A;  2RN9 A;  1YA9 A;  2LSE A;  1YVI A;  2CH7 A;  4PJM A;  2YXL A;  1N36 B;  2HFI A;  3CP1 A;  3ETE A;  4EBJ A;  4G7H F;  4DR4 O;  1GN4 A;  1LS1 A;  1Q6H A;  4EFE A;  1VMA A;  1J95 A;  3JAT B;  3R65 A;  2AZ0 A;  3N2K B;  1HR0 B;  4HE8 D;  2IYL D;  2J7P A;  4HNA A;  3I55 V;  3OT7 A;  3LDD A;  5IE9 A;  5LOV A;  1XIL A;  3ECS A;  2L9J A;  1AR1 B;  4YJ3 B;  2YLG A;  1SQX H;  5A2Q N;  1ZW2 A;  2UUB O;  4CBE A;  2PYJ A;  4FVM A;  3SNH A;  2YEV B;  4IJJ A;  3C3T A;  1ORQ C;  2CTW A;  1WLE A;  3F47 A;  4KBL A;  3JTL O;  2JJ1 G;  4PFO A;  3VRC A;  1M57 C;  5EBL C;  4YN0 B;  3MYF A;  1ZHW A;  5EHH A;  1R3L C;  3X2Q B;  1T5E A;  4OX9 B;  4JYA O;  1IX9 A;  4N06 A;  3W7S A;  4GKK B;  3ZHR A;  2HZ8 A;  2ZIN A;  2V7Q G;  4YL1 A;  2LQT A;  5L0C A;  2XUM A;  3L75 H;  3RVY A;  2YI9 A;  4HAM A;  4D6T H;  3DE8 A;  4UV8 A;  4IB4 A;  1UPG A;  2UUC O;  4X64 O;  1M2O A;  2RSE B;  3HTK C;  4X1Y B;  3JD0 A;  2XS8 A;  4ONS A;  4QJF B;  1QU7 A;  5LXT A;  2A6E F;  2LCH A;  3ZSU A;  1J5E B;  2NG1 A;  1TFO B;  4J9Z B;  3S28 A;  3U9J A;  4UUJ C;  1YDX A;  1BE3 H;  1HW1 A;  1ZLZ A;  3LS0 A;  3S84 A;  1S5L Z;  3AOU A;  4E0H A;  2JEU A;  2X6A A;  3SJB C;  1QNM A;  3GWO A;  4O2A B;  5KHI A;  1QR8 A;  2IBF A;  5D5P A;  3K0D A;  3RYH A;  3T6B A;  1WTY A;  3ZED A;  3LLK A;  4UCT A;  3TK0 A;  4LF4 B;  1I5Y A;  1NSG B;  2F95 B;  5D5Q A;  3GWL A;  2X7R B;  4DUY O;  3GEE A;  1YVW A;  1YJN V;  4J42 A;  3KKB A;  1JJO A;  2G3V A;  1XQ8 A;  4FLX A;  1Q0F A;  3BPZ A;  2V4D A;  4IYI A;  3OUS A;  1V9P A;  4AK9 A;  1QZX A;  4OIN F;  3CCQ V;  1GKF A;  3RYI A;  3CCV V;  1OZ0 A;  2L6F A;  3DI5 A;  4KNW A;  3JSZ A;  3DGE A;  2NNU A;  1YA7 O;  3P30 A;  4DV7 B;  2LP7 A;  2QM4 A;  5DVW A;  3MD0 A;  4EEQ A;  3BCC H;  4GT1 A;  1OCC B;  5LXT B;  2AU5 A;  2LFS A;  2OCC C;  1M5I A;  2GWW A;  1PCX A;  1KQS U;  4AI8 A;  3JCZ A;  2FFH A;  3A0H Z;  1IBK O;  3CSX A;  1R6K A;  4W4K A;  2IM8 A;  3AQC A;  3FOO A;  3E22 B;  256B A;  3K06 A;  1OKK D;  2ADQ B;  2P5O A;  3HKE A;  4EHP A;  3O6X A;  5JCO A;  3ETQ A;  4WFB V;  1FFH A;  2Q0O C;  1S5J A;  4C3D A;  4UB6 Z;  4U5D E;  2Q7G A;  1GN2 A;  1YIT V;  4WFA V;  4DOZ A;  1VAR A;  1SQB H;  1UJW B;  1EN5 A;  3BA8 A;  4DW1 A;  5H6R A;  4Z2W A;  4QE7 A;  4XPX A;  1H38 A;  2EIK C;  5IY5 B;  1HWY A;  3RFR A;  1X4T A;  1K3E A;  4D7S A;  5B1A C;  3GOD A;  2RNB A;  5KYN A;  2JS5 A;  3E2E A;  1P84 F;  2QWQ B;  1N1C A;  4C7O A;  1H2S B;  3SYP A;  4WFE A;  1RKC A;  3W8I A;  2IU3 A;  4GZR B;  3O55 A;  2OIG A;  5L3B A;  5EBM C;  2OCH A;  5KX5 B;  4CDV A;  4BIZ A;  3CCJ V;  2DGJ A;  3OR6 C;  1MMM A;  4G28 B;  2LFF A;  2R03 A;  1I0H A;  2YKZ A;  5LP6 C;  3CCE V;  3L72 H;  1U89 A;  2P6J A;  4QPJ A;  1K05 A;  1OXK A;  1G4Y B;  4MQ9 F;  1E83 A;  5EZY B;  4NXN O;  3OW2 U;  1Q81 W;  4ZBM A;  1IBL O;  1FXK C;  3JAL A;  3BVO A;  3A0B Z;  4TQF A;  1RP3 B;  2UUI A;  4JTA B;  3JAK B;  3K3W A;  3M15 A;  1IBM O;  2YIA A;  4FPP A;  1Q5O A;  4YJ3 A;  1EKY A;  3Q4H A;  1VQM V;  3RFY A;  1HMO A;  5BMV A;  1GO3 F;  2QTO A;  3LLI A;  1OCZ C;  1AJQ A;  1E86 A;  2XL6 A;  3AGU A;  2YI8 A;  1PL0 A;  2Y69 B;  2JDI G;  4DR3 B;  4CIP A;  3E8B A;  5COM A;  3RIP A;  2NLJ C;  3W7U A;  1U6H A;  1BHA A;  2WLI B;  2R7U A;  2IJJ A;  2ZT9 B;  2EPO A;  2KNH A;  3N24 A;  1FMW A;  3BA9 A;  3VF0 A;  3IJ4 A;  5FNV A;  1B3Q A;  4ICG A;  1U97 A;  4EBB A;  5LMU O;  1OCR C;  3IQ6 A;  1IUR A;  2L35 A;  3QO8 A;  1H7I A;  3N27 A;  1G1X B;  1JMK C;  3WU2 Z;  2XOK G;  2PFD A;  2LGW A;  1SQG A;  2VS0 A;  1R6T A;  3L8I A;  1N0J A;  5B1B B;  2M6Y A;  2FGY A;  2QNL A;  2CGN A;  4BW5 A;  5BQI A;  4P2Z A;  1VQN V;  3ABM B;  2AHZ A;  1Y4M A;  2FML A;  1O9G A;  4PEL A;  3H9V A;  4LF6 B;  3B8M A;  4QE9 A;  1UFI A;  3UMI A;  1IZ3 A;  3EG9 A;  4ZOL A;  3Q6N A;  4NY3 A;  4OPH A;  4JV5 B;  1WAS A;  3AEI A;  1NJI W;  3MAQ A;  1XHZ A;  2YIC A;  2H3O A;  4X65 B;  1FXH A;  4AQY B;  1W2B U;  4BR6 A;  5AGF A;  1LI5 A;  1MMG A;  1GM8 A;  3KYI A;  4DR1 B;  3EGX B;  3CC2 V;  4RBN A;  3HB3 B;  4NQF A;  1WAZ A;  3WOD F;  5H2F Z;  5HSW A;  1K33 A;  4C7U A;  2UUB B;  1MQV A;  3HR0 A;  3X1O A;  3OAA G;  4KFM A;  2J9U A;  1JQ0 A;  3ABK C;  4YJ2 A;  4YT5 A;  3FKS G;  1M9N A;  1HDJ A;  2GTS A;  1DOW A;  1R73 A;  2KG7 B;  2VCC A;  1HP8 A;  3TQO A;  3GWK C;  4I4T B;  3TUL A;  4WAB A;  3GM2 A;  3OM3 B;  2HMZ A;  5KMG A;  2IU0 A;  1SS3 A;  1XDC A;  5EYP A;  1SQP H;  2ZIO A;  2HJM A;  1AI4 A;  3CCS V;  4GCZ A;  3RYH B;  4B08 A;  4W8K A;  2DJV A;  4UCV A;  3M4C A;  2VWJ A;  1D1B A;  1Y4C A;  3ABL C;  3SXY A;  2Y48 A;  2Q69 A;  4DV6 B;  3FB6 C;  3CXC U;  4E2L A;  2PZS A;  3CCM V;  2I8B A;  2Y4T A;  2IXN A;  2H94 A;  4DV0 O;  1M57 B;  1KB9 F;  5H9C A;  3ZHU A;  2W0X A;  1Q90 D;  3M1C B;  3WAQ A;  2EIN B;  1M4U A;  4ER9 A;  3EFF K;  1Y66 A;  1BQZ A;  1NBB A;  2XLM A;  2QJ1 A;  1W2W A;  4DR2 B;  3UM7 A;  3SPC A;  4B3M B;  2W0F C;  1A7E A;  2E87 A;  4KNV A;  4EB6 A;  4DR3 O;  5KYU A;  4I1M A;  1WPX A;  4DV5 B;  4ZI7 A;  1HNW O;  4U3J B;  2R9A A;  1HNX B;  3M8A A;  5DM6 V;  1MAB G;  1NG1 A;  2A6H F;  5KHJ A;  2WZF A;  3QO7 A;  1XHX A;  3LSU A;  4CS2 A;  1YXB A;  1DF4 A;  2IXM A;  3H1H H;  2ITD C;  5C8Y B;  3C18 A;  2Q9A A;  2CH7 B;  3A8T A;  1I5N A;  2IXP A;  3VYW A;  2B9Z A;  4H4K C;  3EGD A;  3ZMT A;  2YEV A;  3PJS K;  2WZL A;  4QI2 A;  2KSD A;  4LC1 A;  3TCU A;  4D4N A;  3SYO A;  4Q4Z F;  5IJ0 B;  4IAQ A;  4LF8 B;  3RQG A;  1TWH A;  3OEO A;  4PHZ A;  4PA4 A;  2L7A A;  2R7S A;  4JTD B;  3SYC A;  1I4Y A;  4U5G A;  4TQD A;  4B7E A;  4JJG A;  2ZCE A;  1IZM A;  3GOR A;  3MBG A;  1OJH A;  4E7S A;  1GAX A;  4DRJ B;  1W59 A;  4PA9 A;  3TJ6 A;  1PV0 A;  1O3U A;  1Q82 W;  1APC A;  1MMD A;  1AR4 A;  1PD1 A;  3SR2 C;  1RSO A;  1SZI A;  1DLB A;  1M1K W;  1VTM P;  3BRC A;  1ZHY A;  4AL0 A;  3NXS A;  3MYI A;  3SGI A;  4ZI7 B;  1TKN A;  2VCA A;  3G4Z A;  4JC7 A;  4GQH A;  1QVF U;  3KCY A;  2P7V A;  2W45 A;  4GYC B;  3H01 A;  4RD9 A;  5ITZ A;  3IGA C;  3FAV A;  5IYB O;  1WNS A;  1RXQ A;  3P32 A;  4P9T A;  2PYL A;  4GLX A;  4KHP B;  1L0L H;  2JGD A;  5JJN B;  1ZYR F;  1WWP A;  2XLO A;  4PJ0 Z;  3UO2 A;  1I5X A;  4OIQ F;  1M56 B;  5JVD A;  4X1K B;  4LF8 O;  1CGN A;  1QKR A;  2Q5Z A;  1JJ2 U;  4NR1 A;  2I15 A;  3B71 A;  5CB4 B;  4CJG A;  1P7G A;  2WB7 A;  1SQV H;  1LUV A;  3U2L A;  3JAW B;  3LUT B;  2W4B A;  2QKA A;  4YY3 O;  4UCR A;  4FLU A;  2AW9 A;  5EIB C;  1XNR O;  3UNG C;  3IPM O;  2GSM B;  4B6I A;  1XNQ O;  2VWK A;  2A0U A;  5KYU B;  1BCC H;  2UUA O;  2XSE A;  3V7O A;  4IT5 A;  4TT3 G;  2HMQ A;  4B3R B;  1A32 A;  1CP9 A;  5J2U A;  1QQ3 A;  4WCE V;  3NYL A;  3M99 B;  4FMT A;  3DC5 A;  3CRA A;  3FYI B;  4LFC B;  1CPQ A;  2A7W A;  1FYJ A;  3RWR D;  4LBE C;  2Q0A A;  3HKC A;  3ZRV A;  2IJH A;  5LYJ B;  5LP6 B;  2F23 A;  4ZKI A;  2JPU A;  3MHH C;  3VQX A;  5LHG A;  4B3M O;  1KUQ A;  1ZHX A;  4C3B A;  4A2N B;  5LYJ A;  1A41 A;  4DO2 A;  3K5N A;  2R02 A;  1GH6 A;  3B9Q A;  3DZA A;  5LMN B;  4X88 A;  1FXK B;  4DXW A;  1QVG U;  3R2P A;  3D8C A;  4DV0 B;  4BEJ A;  1QVX A;  4IHJ B;  3TOM A;  2JVD A;  4RWU A;  4GKJ O;  5CBF A;  5J2U B;  3UR3 C;  3BEH A;  1B68 A;  4DV6 O;  1ZL8 B;  4XPY A;  1HW2 A;  5JT4 A;  1DGS A;  2YXY A;  1K04 A;  1S7Z A;  1NI8 A;  3QZC A;  1XOU A;  1H6G A;  1MNE A;  4J7Y A;  2YID A;  1MOF A;  1F1M A;  5DLJ A;  2Q7R A;  3OA1 A;  1HY5 A;  2BL2 A;  2QM7 A;  3U8V A;  5T3W A;  1ZHT A;  1TA8 A;  4OX9 O;  4DV1 B;  4JEB A;  4B3S B;  1B04 A;  1FFX B;  5JH7 B;  1JMW A;  3I5D A;  2P4K A;  3BHP A;  3J80 N;  2A1D D;  2YIB A;  2D3O W;  2ZXW C;  4QGP A;  3PMR A;  3QVY A;  1TUB A;  4PDM A;  3CCU V;  1TAE A;  3E9V A;  3K58 A;  3EG9 B;  2Q7H A;  4H13 B;  1YYJ A;  4I0X B;  2HV6 A;  3SYN A;  1VP7 A;  3G50 A;  1VF7 A;  4DR1 O;  2NR5 A;  4DV2 B;  1AB3 A;  5E3C A;  2K9P A;  2FAP B;  4AQY O;  2H8P C;  5KYY B;  3BY6 A;  1TVK A;  1VK5 A;  3CXH F;  2F4V B;  3ABM C;  2W9Y A;  4R32 A;  3TXS A;  1WP8 A;  4YL3 A;  2QSA A;  3ZRW A;  1I7F A;  4UCU A;  1XZP A;  1FTS A;  2QTS A;  1N8R W;  1BBH A;  5B1N A;  2E75 B;  3EHB B;  4QDL A;  3Q4H B;  1E2X A;  1RKE B;  5E1A C;  2EJ7 A;  1RPR A;  4UXN A;  4NTB A;  2QTV A;  3CYO A;  4ASU G;  3EGD B;  4WBN A;  4CH3 A;  4N6H A;  3S9O A;  3AGT A;  1G4W R;  4U3F H;  4NTF A;  4JI0 B;  2B0J A;  2WLN A;  4FIP C;  4NKG B;  4DR7 B;  1R3K C;  1F23 A;  4DRX B;  1YLM A;  2P1A A;  4BIU A;  5GON A;  3CQZ A;  1GM5 A;  5LMU B;  3F46 A;  2ZKO A;  4LF9 B;  3L71 H;  1VQ8 V;  2QM8 A;  3KG2 A;  3AG4 C;  5C8Y A;  3ASO C;  4O2B A;  2HKO A;  1XL6 A;  2TMV P;  1ZVZ A;  4H33 A;  1YAR O;  3H2V A;  2WVQ A;  3IQT A;  3W7T A;  5BMV B;  3JYY A;  3POV A;  3J06 A;  4IAR A;  2LP4 A;  1E79 G;  3RVZ A;  4U3J A;  2HLD G;  4CS8 A;  2Q8V A;  1JFF B;  1JR8 A;  3B8N A;  1FD9 A;  2AGA A;  1TWA A;  3A11 A;  1M6T A;  3CMA V;  4E18 A;  3K6B A;  4FWV A;  3JAL B;  1NLX A;  4J41 A;  4DUZ O;  1IXB A;  1CGM E;  1FR0 A;  2R70 A;  3JD3 A;  1AR5 A;  4I50 A;  1KBH A;  4Z1V A;  4HYO A;  3ASN C;  3L9D A;  1Y6D A;  2B1I A;  3LJB A;  1P4R A;  3IAY A;  3JAR B;  2VQE B;  4FLZ A;  1KD1 W;  5CA1 A;  4Q5S F;  4LP8 A;  1ZU5 A;  4F6R B;  2Z3Y A;  2M4E A;  4LLC A;  1D5N A;  4UVA A;  5IYC O;  2ZXP A;  4X0R A;  1E1Q G;  1XL4 A;  5B3S C;  3T1C A;  4LFB O;  2DE0 X;  5GTI Z;  3DXR B;  2PBE A;  2DWD C;  1YJ9 V;  1LPE A;  3D36 C;  4YK5 A;  1OV9 A;  2JK5 C;  1EZJ A;  4B3R O;  3CAX A;  2YLD A;  4IL6 Z;  4E7Z A;  3RYF A;  1S5H C;  3ETG A;  3K1H A;  3H1L H;  4YJ2 B;  4A5U B;  1XMO O;  1YZC A;  2ETN A;  1KC8 W;  3CSK A;  4IAO A;  4CDA A;  4EKW A;  2KW3 C;  4JPR A;  1T6U A;  4DVY P;  2VQF B;  4P9P A;  2EIM C;  3QF7 A;  2XAH A;  1BDJ B;  4FFB B;  3CC4 V;  2QR4 A;  2WL8 A;  2WA3 A;  5BZB A;  2AVK A;  3GVM A;  3JD2 A;  3SZR A;  2NN4 A;  2ODM A;  4CS3 A;  1KKC A;  3TXQ A;  4J30 B;  1JRA A;  3F7V C;  3CEI A;  5LL6 Y;  2A0L A;  1MZF A;  4I55 A;  1G5Z A;  3U3F A;  2P4V A;  5KAF Z;  3UMH A;  3LSQ A;  3CWB H;  3B29 A;  3EFO A;  5CI8 A;  4JZA A;  3CRR A;  3APQ A;  3U10 A;  3J7A U;  4FFK A;  1VQ4 V;  1PV3 A;  2NSF A;  2E74 B;  4JF3 A;  3LSS A;  4O4H A;  3NKE A;  4J10 A;  2VAS A;  1YIJ V;  3M7M X;  2PGG A;  4LH6 A;  2WAM A;  3ZHS A;  3AQB A;  1D0Y A;  4XEF A;  2BE3 A;  3EHN A;  4RQE A;  3CD6 V;  2P6V A;  3FDQ A;  4MVQ A;  4IIJ B;  2EZO A;  2DYR C;  5JRA A;  5JS5 A;  2V1D A;  3EHM A;  3K03 A;  4J7T A;  4LFB B;  3ZBH A;  1RSO B;  3ZS8 C;  1BR2 A;  3OMA B;  1LIH A;  3PCV A;  2VB6 A;  1FKA O;  3KZI Z;  4I44 A;  3H1I H;  5L3E A;  2YUA A;  4N21 A;  5KUM A;  2E5L B;  4JRZ A;  1M56 C;  5JCO C;  3OTF A;  1RMV A;  2OOC A;  4CBC A;  4UVB A;  4UCS A;  4RO2 A;  1XUQ A;  3DAF A;  4LDK A;  5L0D A;  3LNN A;  4AIL C;  2ATK C;  3TK1 A;  1GM9 A;  3LAY A;  1AJP A;  2ZR2 A;  4R50 A;  1XWJ A;  2CDY A;  1RM1 C;  1TUE B;  4LR3 A;  3IEE A;  1G6U A;  1YAU O;  2QWN B;  5GW7 A;  4W8P A;  2WLI A;  4ZHQ A;  2YL3 A;  1LVK A;  1T6I A;  3ML0 A;  3G71 V;  4YT8 A;  1DF5 A;  1QLE B;  3JZ0 A;  2VC9 A;  1IDS A;  1DOV A;  2PP4 A;  3QG5 A;  3O39 A;  3DC6 A;  4JAA A;  4Z1M G;  5LHI A;  3O65 A;  2YIB D;  2ZNJ A;  4XBF A;  4JI2 B;  2OCC B;  5L3G A;  3FB5 C;  5T3T A;  3HKD B;  4HBN A;  3RYL A;  4BJT A;  1AI6 A;  5CA0 A;  3CZ6 A;  2BCC H;  5H6Q A;  3GWN A;  5HFM A;  1CXZ B;  1LE4 A;  3T1H B;  1K40 A;  1OW8 A;  3K5O A;  1VQ6 V;  1OQC A;  4JYC A;  4EB6 B;  3UGO A;  5KX5 A;  1HMD A;  5LGT A;  1G8X A;  4L6R A;  1H2N A;  2HR3 A;  1VF6 C;  5COF A;  4JIO A;  5DS5 A;  2QWR B;  4PA3 A;  4HFF B;  4C7O B;  1KP2 A;  1ORJ A;  4LER A;  4CS7 A;  4ZLD A;  2WWW A;  2RJZ A;  3F5T A;  2LW7 A;  1TVK B;  4ZIB A;  1GGQ A;  4DV4 B;  3ZCC A;  2C04 A;  4YT2 A;  4X1I A;  3GM3 A;  4PJJ A;  2DW4 A;  3ZHQ A;  5IY5 C;  2CW0 F;  1J8Y F;  2LO1 A;  3C3S A;  1U0B B;  1YCI A;  3GEH A;  4BPM A;  1HW7 A;  4DR4 B;  2ZE7 A;  4CS8 C;  4TUY A;  4QI0 A;  3CJH B;  1N36 O;  2Z15 A;  1D1A A;  1RFY A;  4BJ5 C;  1ZTE A;  3OEE G;  3QVN A;  2GA0 A;  3FB7 C;  1E84 A;  2LQG A;  3U3B A;  4X20 A;  5L0H A;  4O4H B;  4JYB A;  3B2E E;  2BTO A;  2PI5 A;  3C8G B;  2R7T A;  2KGO A;  2YQY A;  1EM1 A;  3EZI A;  4J32 B;  5CMU A;  4DK0 A;  4OPA A;  4H37 A;  3WB1 A;  1ZHZ A;  2EPN A;  4O4I B;  2QUP A;  1R6N A;  4MTF A;  2DYS B;  2R7V A;  4LF5 B;  5JQG B;  2HVK C;  3P3P A;  4FLT A;  2E76 B;  3AK2 A;  3C8G A;  3ZN0 A;  2YLI A;  2UXB O;  4O4L B;  2GHY A;  3SPG A;  2Q73 A;  2YDE A;  4DBQ A;  4F4B A;  2W6J G;  2IXO A;  4OD5 A;  4YT4 A;  4O4L A;  3A0R A;  3T4D A;  4U5F E;  3C7J A;  2L81 A;  4Z9J A;  2OJE D;  2XRH A;  1SKV A;  4BG0 A;  4PJN A;  4MT8 A;  3OR7 C;  4X1I B;  4O2A A;  5FL7 G;  3RYI B;  1SF8 A;  1VQ9 V;  3RH3 A;  4XPW A;  1BZK A;  5KUK A;  2HP8 A;  1ENV A;  3FAJ A;  3AG1 C;  2WA4 A;  1MMN A;  2CGO A;  3S0X A;  3VQY A;  1OCR B;  3N2Z B;  5CA3 A;  3IQ5 A;  4QIW F;  3RQE A;  4FAP B;  1MSD A;  4DYL A;  5FLX N;  2HHH O;  2PX0 A;  1COW G;  3NR7 A;  2CUG A;  4LFA B;  2G62 A;  1LNQ A;  3CME V;  5KAI Z;  2ZIM A;  4TUY B;  2WSS G;  4LWS B;  1Z5Z A;  3RYC B;  1N32 B;  4I7Z B;  2KC3 A;  4GEH A;  2N04 A;  1PNM A;  4PV1 B;  4JI5 B;  1XBL A;  5CA0 B;  3K59 A;  3HKD A;  1V4A A;  3JD4 A;  5J9P C;  1NT2 B;  3U5S A;  5KA6 A;  2AZ2 A;  5BY1 A;  2XAS A;  4RQF A;  2UUA B;  1K92 A;  2HJD A;  4E0I A;  1IBM B;  1TWC A;  3K9S A;  4MTX A;  1XNQ B;  1T9K A;  4X66 O;  4EBK A;  5F5H A;  4YY3 B;  4CH5 A;  4ULV A;  1OHH G;  3OWT A;  3HJC A;  4XDL A;  2NUP B;  2XM0 A;  5J2T B;  3US6 A;  3ABU A;  5LOV B;  1FJG O;  1JOG A;  2IJI A;  1OCO C;  4XDK A;  4JI4 O;  3RQF A;  4NTA A;  2C2A A;  1NS1 A; 
#chains in the Genus database with same CATH homology
 5B3S B;  3LNM B;  4FMT A;  1K5S A;  3FYI B;  1QLE C;  2Y3G A;  4CS9 C;  1NVP B;  3K33 A;  5KYW A;  3NRH A;  3EH1 A;  3PHF 2;  5BUO A;  4LBE C;  4U5B E;  1F4M A;  4G27 B;  3K1I C;  4P9O A;  3ZRV A;  2IJH A;  2XAF A;  2LSE A;  2A68 F;  2WLH A;  3MLG A;  4PJM A;  1V55 C;  2HV7 A;  3KH2 A;  4ZKI A;  1AI5 A;  2WLK A;  4MND A;  3MHH C;  5LHG A;  4R6Z A;  1ZHX A;  4OIO F;  3EFO B;  4C3B A;  4A2N B;  3ETE A;  3CP1 A;  4G7H F;  1IW7 F;  4DO2 A;  2R7W A;  1VQ5 V;  1LS1 A;  3B9Q A;  1VMA A;  1J95 A;  3DZA A;  4X88 A;  3R65 A;  1FXK B;  4DXW A;  1J8M F;  2H7B A;  1FMV A;  1V54 B;  3LDE A;  3TET A;  4YXW G;  2M7W A;  1QVG U;  3I55 V;  2IYL D;  2J7P A;  4CSA A;  5E2Q A;  3LDD A;  2EIM B;  2CGE A;  3ECS A;  2L9J A;  4BEJ A;  1AR1 B;  2EJR A;  3ABL B;  2QY9 A;  3JYH A;  4JUR I;  4PJL A;  3NYL A;  5CBF A;  4P6I C;  3UR3 C;  4CBE A;  4MTO A;  3SNH A;  3BEH A;  5D92 A;  5D91 A;  2YEV B;  2Y39 A;  4IJJ A;  2BE5 F;  1ST6 A;  1EFR G;  1ORQ C;  3E8G A;  1K4C C;  1WLE A;  3F47 A;  1S7Z A;  4KBL A;  3E8H A;  4WFF A;  3QZC A;  2JJ1 G;  4PFO A;  1P7B A;  1M57 C;  5EBL C;  4XDJ A;  4JAU A;  4YN0 B;  1MNE A;  1ZU4 A;  3HLZ A;  1ZHW A;  1OKK A;  3ZG1 A;  1MOF A;  4N23 A;  2YZS A;  1FXV A;  5EHH A;  1R3L C;  3X2Q B;  4O7G A;  2KQ9 A;  3E86 A;  4MVR A;  3OA1 A;  4N06 A;  2WVN A;  4MVZ A;  3W7S A;  3SP1 A;  5DLJ A;  4CIH A;  2W4M A;  3ZRS A;  3LNR A;  2QM7 A;  3X1O A;  2V7Q G;  5T3W A;  1ZHT A;  2XXA A;  3RVY A;  3FVY A;  3K04 A;  1AJN A;  2ZR3 A;  5CBG A;  2XND G;  5E33 A;  4HAM A;  2WLJ A;  1MND A;  4UV8 A;  1RPO A;  2JIZ G;  3DD7 A;  4CZZ A;  1VQO V;  2A1D D;  2D3O W;  3L34 A;  2ZXW C;  1D1C A;  3DMD A;  1M2O A;  3RBZ A;  1M2V B;  3HTK C;  4PDM A;  2Z5U A;  3JCU Q;  3CCU V;  3PMR A;  3E9V A;  2HG5 C;  3JD0 A;  1K9M W;  3E89 A;  3EG9 B;  4JAV A;  3RW0 A;  2HV6 A;  4QJF B;  3SYN A;  4DBR A;  1FXK A;  2A6E F;  4I9W A;  2DYR B;  3GB7 C;  3ZSU A;  2NG1 A;  1H2G A;  4J9Z B;  3S28 A;  1F51 A;  4UUJ C;  4G0H A;  5E3C A;  2EIL C;  4TSF G;  1VQL V;  2DYS C;  5KYY B;  2H8P C;  2G3K A;  3BY6 A;  1K73 W;  1JX9 A;  2QA4 V;  3LS0 A;  1VK5 A;  3DM9 B;  2JEU A;  3ABM C;  2W9Y A;  2X6A A;  5EGY A;  3GWO A;  3VBB A;  1QR8 A;  1NU7 D;  2Q3T A;  2MWQ A;  3ZRW A;  2IW5 A;  1S72 V;  2B5U A;  3T6J A;  2P7T C;  3K0D A;  3OUF A;  1FTS A;  3T6B A;  4KI2 A;  1N8R W;  1L1F A;  3LLK A;  5B1N A;  3EHB B;  1GK9 A;  1I5Y A;  2MYS A;  4PDR A;  4QDL A;  4MTG A;  3IFX A;  4MVO A;  5E1A C;  2X7R B;  1Z3I X;  1RPR A;  2ZXO A;  1O87 A;  4UXN A;  2QTV A;  1YJN V;  3EH2 A;  4YJW A;  3KKB A;  4OIP F;  3CYO A;  4ASU G;  2G3V A;  3EGD B;  3K7D A;  1Z63 A;  4AK9 A;  3OUS A;  3ZRW B;  1QZX A;  4BJ6 C;  4OIN F;  3CCQ V;  5B1O A;  1GKF A;  3SJQ C;  4JW1 A;  2B0J A;  3CCV V;  4WFH A;  2WLN A;  1OZ0 A;  4FIP C;  4PA7 A;  2HJF C;  1DTO A;  4KNW A;  1R3K C;  1F23 A;  4U5H A;  5DS6 A;  3DXJ F;  4BIU A;  3DGE A;  3OGC C;  2NNU A;  3EQL F;  3CQZ A;  3JSZ A;  3AG1 B;  4CS9 A;  3EJN A;  4G7O F;  2IOQ A;  2Y3B A;  3P30 A;  2EIJ B;  3F46 A;  1VQ8 V;  2LP7 A;  2QM8 A;  3ABK B;  3AG4 C;  3ASO C;  3KG2 A;  3MD0 A;  2HKO A;  1NR7 A;  4RUE A;  1KEC A;  1WGW A;  1XL6 A;  3ETD A;  3N0T A;  3B0V C;  1H8H G;  4GT1 A;  1OCC B;  1YTF D;  2LFS A;  2OCC C;  4H33 A;  4JJF A;  1YTF B;  1PCX A;  2B1G A;  1K34 A;  1KQS U;  3W7T A;  1GTO A;  5KA5 A;  1BR4 A;  5LBQ A;  2J9W A;  3JCZ A;  2FFH A;  4XWJ A;  3POV A;  1E79 G;  3RVZ A;  2CNW D;  2HLD G;  3I4U A;  4CS8 A;  3AQC A;  1R6K A;  4O6Y A;  1QR9 A;  3T2M A;  4WFG A;  1TWA A;  3K06 A;  3B8N A;  1OKK D;  3KL4 A;  1NVP D;  3CMA V;  2PF4 E;  3IC7 A;  4Q20 A;  4YWQ A;  2H7V C;  3K6B A;  4BJ1 A;  1K5Q A;  4FWV A;  5E3A A;  3O6X A;  3FB8 C;  4OD4 A;  4MW3 A;  2Y3H A;  4PA6 A;  4QNH B;  3S27 A;  4WFB V;  2OTL V;  1FFH A;  3ITF A;  5L3C A;  1GM7 A;  2DWE C;  4C3D A;  3JD3 A;  4U5D E;  1YIT V;  3E70 C;  4WFA V;  4HYO A;  4DOZ A;  4HE8 D;  3ASN C;  1AI7 A;  3T4Z A;  3DM5 A;  1UJW B;  3DJU B;  3WFV A;  2B1I A;  5H6R A;  3LJB A;  1P4R A;  3D36 A;  4QE7 A;  3ZC4 A;  1Q7Y W;  1H38 A;  2EIK C;  1KD1 W;  4Q5S F;  5IY5 B;  1HWY A;  4LP8 A;  1M90 W;  2Z3Y A;  1ZU5 A;  2M4E A;  2Q67 A;  4UVA A;  2XAG A;  4LAC B;  3GOD A;  1K4D C;  1K3E A;  2EIN C;  5B1A C;  1OCO B;  2J0W A;  3LEV A;  4GX1 A;  4AX2 A;  5KYN A;  3E2E A;  1N1C A;  4UV9 A;  4C7O A;  1S76 D;  3SYP A;  2P90 A;  4WFE A;  5IYC O;  2ZXP A;  3W8I A;  2J46 A;  2IU3 A;  4X0R A;  1E1Q G;  1XL4 A;  5B3S C;  5L3B A;  5EBM C;  3STZ C;  4BIZ A;  3T1C A;  3CCJ V;  2JEX A;  2DGJ A;  4MVU A;  3OR6 C;  1O5H A;  4G28 B;  3JT1 A;  2DWD C;  1YJ9 V;  1SER A;  2CNW A;  3CCE V;  3WG7 B;  4KC9 A;  2JK5 C;  1EZJ A;  5DQZ A;  2P6J A;  4QPJ A;  4E7Z A;  5EC2 C;  4RUF A;  1G4Y B;  1S5H C;  3ETG A;  4MQ9 F;  3K1H A;  2ZDI C;  3OW2 U;  2FTK A;  1Q81 W;  1KC8 W;  2D5R B;  1PKX A;  2EBO A;  4ZBM A;  3CCL V;  2NUT B;  4EKW A;  2KW3 C;  1FXK C;  3CSK A;  4IAO A;  4JPR A;  3ZJZ A;  5KYW B;  4DVY P;  2R7O A;  2XAJ A;  4JTC B;  4P9P A;  3LES A;  2EIM C;  4JTA B;  4AE4 B;  2WLL A;  2XAH A;  3K3W A;  3CC4 V;  3OMI B;  2WL8 A;  3SPI A;  5BZB A;  5KYX B;  1ZWI C;  4FPP A;  3JD2 A;  4I5S A;  3SZR A;  1YSC A;  1VQM V;  3RFY A;  4PDL A;  2Q6A A;  3TD7 A;  4XTK A;  2ZD9 A;  2WLL B;  1GO3 F;  2QTO A;  3LLI A;  4C3E A;  1OCZ C;  1AJQ A;  3B0U X;  1EBO A;  3CPW U;  4J30 B;  3AG3 C;  3F7V C;  3SPJ A;  4ULW A;  2A0L A;  4GX0 A;  3GAN A;  1SZT A;  1NU9 C;  3E83 A;  3UMH A;  1PL0 A;  2Y69 B;  4JCH A;  3AG2 B;  4XLN F;  3LSQ A;  5IDJ A;  1NR1 A;  2WLM A;  1Z23 A;  2MK3 A;  3EFO A;  3OMN B;  2JDI G;  2JD3 A;  5CI8 A;  4FJC C;  4JZA A;  5L3D A;  3E8B A;  3X2Q C;  1BL8 A;  1TR2 A;  3RIP A;  1VQ4 V;  3G6E V;  5EC1 C;  4JF3 A;  2NLJ C;  3W7U A;  1VQK V;  3LSS A;  1BHA A;  4I3M A;  4ANJ A;  2WLI B;  2R7U A;  2IJJ A;  4LLE A;  5L3F A;  1Z6A A;  2KNH A;  3NKE A;  3N24 A;  4IWB A;  3VAY A;  1FMW A;  2OG2 A;  2VAS A;  2XL4 A;  2P67 A;  1PNL A;  5EBW C;  1YIJ V;  5T1D B;  1FFT B;  1M2V A;  2R7Q A;  2YSU B;  4EBB A;  1OCR C;  2ZXW B;  2WAM A;  1S0V A;  3AQB A;  1R3J C;  4HEA J;  4U5E E;  2ITC C;  3QO8 A;  3W2W A;  1D0Y A;  2R7R A;  3EHN A;  4RQE A;  3CD6 V;  2P6V A;  2WVQ A;  2YHS A;  5L3Q A;  3FDQ A;  4MVQ A;  3I5Q A;  2V3C C;  2EZO A;  1FS0 G;  2XOK G;  2DYR C;  2PFD A;  2X6C A;  2J0X A;  4RDA A;  3EZH A;  4O6N A;  4MSW C;  1VYK A;  2V1D A;  1ROP A;  3EHM A;  5DVW A;  3K03 A;  5B1B B;  2FGY A;  2UXN A;  3RKO F;  1BR2 A;  3OMA B;  3UKM A;  4HZ3 A;  2PI4 A;  3EPV A;  4BW5 A;  4M63 A;  2VB6 A;  5L3V A;  2IH1 C;  4P2Z A;  3ZN1 A;  1VQN V;  1GMG A;  3ABM B;  2AHY A;  2AHZ A;  4I44 A;  5L3E A;  3OE7 G;  4N21 A;  5KUM A;  1Y4M A;  1VQP V;  4HFK B;  1NQT A;  1M56 C;  4JAS A;  4PEL A;  1YHQ V;  4UVB A;  4CBC A;  3B8M A;  1W0J G;  4PDV A;  4QE9 A;  4RO2 A;  3DAF A;  3LS1 A;  4FES A;  3EG9 A;  3UMI A;  1ARO P;  2ATK C;  3TK1 A;  3Q6N A;  1GM9 A;  1S3J A;  3LAY A;  4NY3 A;  1AJP A;  1QBZ A;  2ZR2 A;  4R50 A;  3AEI A;  4Q7C A;  2XAQ A;  3CCR V;  1NJI W;  2ZXR A;  1RM1 C;  4ZLC A;  1TUE B;  1W2B U;  1FXH A;  2A69 F;  4AE4 A;  3IEE A;  1MMG A;  1BR1 A;  4BJ5 A;  1GM8 A;  3W8H A;  3EGX B;  3CC2 V;  5GW7 A;  3HB3 B;  3SYA A;  2UXX A;  2WLI A;  4RBN A;  4RAI A;  4R8C A;  3I56 V;  5KYX A;  4WF9 V;  4PK4 A;  2X0L A;  1LVK A;  3WOD F;  5HSW A;  1K33 A;  2EZP A;  3ML0 A;  3G71 V;  1DF5 A;  1QLE B;  2PX3 A;  4G2K A;  4YT8 A;  3W7X A;  4GX5 A;  3OAA G;  1QLN A;  2A79 B;  1KKD A;  4KFM A;  1RJ9 B;  1VYI A;  2Q9C A;  3FHD A;  2PP4 A;  4K0D A;  2J9U A;  3O39 A;  5KYY A;  1JQ0 A;  2EIJ C;  2DQ0 A;  4U7N A;  4Z1M G;  3ABK C;  3AG4 B;  5LHI A;  3LDC A;  3FKS G;  1CEZ A;  1JOY A;  2ZPA A;  1M9N A;  4YT5 A;  1V55 B;  5FCL A;  4XBF A;  2V26 A;  4EWC A;  1R73 A;  2OCC B;  5L3G A;  3FB5 C;  4MW8 A;  5T3T A;  1D0X A;  3RYL A;  4BJT A;  1AI6 A;  3CZ6 A;  5H6Q A;  3MHS C;  5HFM A;  3B0P A;  3OM3 B;  5HFL A;  2IU0 A;  4X89 A;  5LHH A;  1D0Z A;  4F4L A;  3DJN B;  3NDB B;  2F43 G;  1MMA A;  3F5W C;  3K0G A;  1VQ6 V;  1K8A W;  1V54 C;  1JCH A;  4JYC A;  1AI4 A;  3CCS V;  2CDQ A;  2J7P D;  4GCZ A;  3MX3 A;  4GYT A;  3UGO A;  5LGT A;  5DN6 G;  1G8X A;  4W8K A;  1D1B A;  2HR3 A;  3ZRX A;  1SRY A;  3ABL C;  2WZG A;  1BMF G;  3NYM A;  4KP4 A;  5DS5 A;  4PA3 A;  4HFF B;  4C7O B;  1KP2 A;  2Y48 A;  4LER A;  5IYD O;  2R9R B;  4CS7 A;  1JVM A;  2WWW A;  4ZLD A;  2Q69 A;  4IRU A;  1K97 A;  3FB6 C;  3CXC U;  3ASN B;  3K9A A;  1NH2 B;  4E2L A;  2J9V A;  3ZCC A;  5DQT A;  3ZVR A;  3CCM V;  2I8B A;  2IXN A;  2GFH A;  2C04 A;  2H94 A;  3L0I A;  4YT2 A;  3HPL C;  3F7Y C;  1M57 B;  2DQ3 A;  4PJJ A;  2DW4 A;  3ZMV A;  5H9C A;  5IY5 C;  2CK3 G;  2CW0 F;  3K66 A;  1J8Y F;  3M1C B;  2EIN B;  2X6B A;  4MS2 A;  1TWG A;  4J9Y B;  3VOU A;  2LFR A;  3EFF K;  1Y66 A;  4FK5 C;  3ZIB A;  1W2W A;  4CS8 C;  4QI0 A;  3UM7 A;  3SPC A;  1VOM A;  3ZMS A;  4OIR F;  1SET A;  2W0F C;  2Z15 A;  2E87 A;  3ABT A;  4MVM A;  3NKD A;  4KNV A;  1D1A A;  2IH3 C;  4I1M A;  5KYU A;  4BJ5 C;  1WPX A;  5C93 A;  3OEE G;  1YI2 V;  1PD3 A;  3FB7 C;  4U7O A;  3JRT A;  4O6M A;  4OXS A;  1W0K G;  4O79 A;  1H8E G;  3JYC A;  4JYB A;  1B6Q A;  2QKS A;  5DM6 V;  2Q9B A;  2HFE C;  2PI5 A;  4TWK A;  3WG7 C;  1MAB G;  3Q6M A;  1NG1 A;  1IXM A;  3FYE B;  1YJW V;  2R7T A;  2W6I G;  2A6H F;  3QO5 A;  2WZF A;  3QO7 A;  2KGO A;  3E8F A;  3EZI A;  3G4S V;  5CMU A;  2KJG A;  1DF4 A;  3KMI A;  4J32 B;  2QE7 G;  4UVC A;  2IXM A;  4QPK A;  4GX2 A;  3SEO A;  2BOB C;  2ITD C;  4H37 A;  1ZHZ A;  2Q9A A;  4PFP A;  4BJ6 A;  3ZIA G;  5F5F A;  4FX5 A;  3T4R A;  3QNE A;  1R6N A;  2EIL B;  4MTF A;  2DYS B;  2IXP A;  3VYW A;  2R7V A;  2HVK C;  4H4K C;  3EGD A;  3ZMT A;  3I5P A;  2YEV A;  3PJS K;  5LGN A;  1R3I C;  2WZL A;  3DAG A;  3TCU A;  4LC1 A;  1K7D A;  3ZN0 A;  4QI2 A;  3SPG A;  2GHY A;  1MSW D;  3EGX A;  3SYO A;  4Q4Z F;  1JPJ A;  1SMY F;  2ZQM A;  2Q68 A;  4DBQ A;  1TWH A;  4F4B A;  1OCZ B;  3OEO A;  2W6J G;  4PA4 A;  2IXO A;  4OD5 A;  3AG3 B;  2R7S A;  4JTD B;  3SYC A;  3SPH A;  2NUP A;  4YT4 A;  4MVS A;  4U5G A;  3D3I A;  3A0R A;  1JPX A;  3OEH G;  2Y69 C;  3T4D A;  4I1O B;  4JJG A;  4K7B A;  3AG2 C;  1IZM A;  4U5F E;  2NUT A;  1VQ7 V;  2L81 A;  1NH2 D;  2KB1 A;  1NKD A;  3H65 A;  4E7S A;  5EK0 A;  2XRH A;  4XLP F;  4BG0 A;  4PJN A;  4PA9 A;  2J45 A;  4MT8 A;  4P30 A;  3OR7 C;  2HVJ C;  2X51 A;  5FL7 G;  1SF8 A;  3W2V A;  1Q86 W;  4DVZ A;  1Q82 W;  1VQ9 V;  2ZDI A;  2JJ2 G;  1MMD A;  3RH3 A;  2R7X A;  1PD1 A;  2Y3D A;  1KP3 A;  3DTU B;  5KUK A;  3ZMU A;  3FAJ A;  1ENV A;  1BHB A;  3AG1 C;  2OTJ V;  1SZI A;  2WVO A;  4LLC A;  1MMN A;  4BAY A;  4G7Z F;  1DLB A;  1M1K W;  3Q7L A;  3STL C;  3E35 A;  3S0X A;  3SYQ A;  1G8M A;  1FFT C;  1ZHY A;  3ASO B;  1NZE A;  1OCR B;  3NXS A;  3N2Z B;  5CA3 A;  1JPN A;  4QIW F;  2H7O A;  3S29 A;  1OCC C;  1TKN A;  4L87 A;  2PX0 A;  1COW G;  1SES A;  2VH3 A;  4CSA C;  1QVF U;  3NG1 A;  4JVS A;  2G62 A;  1LNQ A;  3CME V;  1KU2 A;  3OFN G;  2P7V A;  1Z5Z A;  1NBM G;  2WSS G;  2W45 A;  4U5C E;  3H01 A;  4RD9 A;  3UGP A;  2R9I A;  1MG1 A;  3IGA C;  5IYB O;  2IJK A;  4GEH A;  1PD0 A;  2BOC C;  1PNM A;  5B1B C;  3P32 A;  4R7C A;  3JD1 A;  2A9H A;  2C03 A;  2XXA B;  3JD4 A;  5J9P C;  1ZYR F;  1F4N A;  4JGS A;  5KA6 A;  3K79 A;  3NYJ A;  2XAS A;  2QEX V;  1I5X A;  2OT5 A;  5CN0 A;  5LGU A;  1M56 B;  1K92 A;  4RQF A;  1THZ A;  4OIQ F;  1TWC A;  3ZMZ A;  4MTX A;  1RJ9 A;  1QCE A;  1JJ2 U;  3W7W A;  5CI9 A;  2WB7 A;  4WJ0 A;  3B77 A;  4KUM A;  3LUT B;  2W4B A;  5CBH A;  1LKX A;  5F5H A;  3K08 A;  1OHH G;  3UMK A;  1E1R G;  5DS4 A;  2K1E A;  3OWT A;  2EIK B;  3HJC A;  2GSM B;  4XDL A;  1RM1 B;  2NUP B;  3UNG C;  4B6I A;  3QMK A;  3ABU A;  3CC7 V;  4X8A A;  5KYU B;  2IJI A;  5B1A B;  2O9X A;  1OCO C;  4XDK A;  4TT3 G;  2XSE A;  3V7O A;  4LCU C;  3Q7G A;  1CP9 A;  1PNK A;  1S77 D;  4WCE V;  1CPY A;  2WPD G;  2C2A A;  3M99 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...