1M57C

Structure of cytochrome c oxidase from rhodobacter sphaeroides (eq(i-286) mutant))
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
265
structure length
265
Chain Sequence
AHAKNHDYHILPPSIWPFMASVGAFVMLFGAVLWMHGSGPWMGLIGLVVVLYTMFGWWSDVVTESLEGDHTPVVRLGLRWGFILFIMSEVMFFSAWFWSFFKHALYPMGPESPIIDGIFPPEGIITFDPWHLPLINTLILLCSGCAATWAHHALVHENNRRDVAWGLALAIALGALFTVFQAYEYSHAAFGFAGNIYGANFFMATGFHGFHVIVGTIFLLVCLIRVQRGHFTPEKHVGFEAAIWYWHFVDVVWLFLFASIYIWGQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME C OXIDASE
publication title The X-ray crystal structures of wild-type and EQ(I-286) mutant cytochrome c oxidases from Rhodobacter sphaeroides.
pubmed doi rcsb
source organism Rhodobacter sphaeroides
molecule tags Oxidoreductase
total genus 97
structure length 265
sequence length 265
chains with identical sequence I
ec nomenclature
pdb deposition date 2002-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00510 COX3 Cytochrome c oxidase subunit III
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1m57C01
1.20.120.80 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 1m57C02
3SYAA 1R3IC 2EILC 2HVJC 3F7VC 4PA9A 3OUSA 5E1AC 5B1AC 2WLHA 3EFFK 1G4YB 3LNMB 3ABMC 3LUTB 4JTCB 4G28B 1QLEC 4PDMA 4MVQA 3OUFA 3RBZA 2Y69C 4QE7A 3ABKC 2DYRC 4JTAB 5B3SC 3ASOC 3AG2C 3SPGA 2A9HA 2BOCC 3AG3C 4RAIA 4QNHB 4LP8A 4MVSA 1V55C 3IFXA 4MTFA 5EC1C 2X6BA 2IH1C 1P7BA 4PDRA 3UKMA 2HG5C 4KFMA 4R50A 1S5HC 2QKSA 4PDVA 2WLLB 3TETA 4X8AA 2DWDC 2HJFC 4GX2A 3LDEA 3RVYA 1BL8A 4H33A 3FB7C 3VOUA 3E89A 1V54C 3SYQA 5BZBA 3OR7C 1LNQA 1K4CC 3K03A 4PA7A 1JVMA 2ZXWC 2W0FC 4PA3A 4G27B 4MW3A 4RO2A 4WFEA 3SYOA 3K04A 4X89A 3OR6C 1OCOC 4BW5A 1R3JC 2ZD9A 4R8CA 3RVZA 4XDLA 2H8PC 4RUEA 2WLLA 4MVMA 4J9ZB 3E83A 2WLIB 3T1CA 4HZ3A 2X6AA 4JTDB 2WLKA 3AG1C 4WFGA 4MVUA 1ZWIC 4X88A 5EK0A 2Q6AA 2KB1A 3K0GA 5B1BC 3OGCC 2ITCC 3GB7C 1FFTC 3T4DA 3SYCA 1OCZC 3SPCA 1XL6A 3K0DA 1OCCC 4I9WA 2A0LA 2EIKC 2K1EA 4WFHA 4J9YB 4UUJC 1J95A 2Q67A 1K4DC 4PA4A 3SJQC 4GX0A 2NLJC 2AHZA 4EKWA 3BEHA 4MW8A 4LBEC 4R7CA 2DWEC 2WLIA 3SYPA 2EIMC 3K08A 3K06A 2A79B 4MVRA 1ORQC 4PA6A 3STZC 3F7YC 1OCRC 4P9PA 5KUMA 3PJSK 2AHYA 1R3LC 2WLNA 2DYSC 2Q68A 2OCCC 3E8BA 3LDCA 2ATKC 3IGAC 4MTGA 3UM7A 3ZRSA 4MS2A 4CBCA 4F4LA 5EC2C 4LCUC 2ITDC 5CBGA 2HVKC 3KG2A 5CBHA 3ASNC 3RW0A 3STLC 4ZBMA 4RUFA 4MTOA 2QTOA 2Q69A 5EBMC 4HYOA 5KUKA 2YEVA 2EINC 3HPLC 4GX5A 4XDJA 3X2QC 2IH3C 3E86A 3ZJZA 3FB8C 5EBLC 3SPJA 4P9OA 3SPIA 4GX1A 3JYCA 4XDKA 3TCUA 4QE9A 1M56C 1XL4A 2EIJC 2HFEC 3E8FA 1KKDA 3T2MA 2R9RB 3AG4C 4TWKA 2JK5C 1R3KC 4OXSA 4DXWA 5EBWC 3T4ZA 3F5WC 3ABLC 3R65A 2P7TC 4PDLA 4R6ZA 2WLMA 2WLJA 3LDDA 3E8GA 5J9PC 4H37A 4P30A 3FB6C 3FB5C 3SPHA 5CBFA 1M57C 2X6CA 2BOBC 4MVZA 4WFFA 3E8HA 4MSWC 4P2ZA 3WG7C 5IY5C 4MVOA
chains in the Genus database with same CATH superfamily
2IW5A 1IBLB 4DRJB 1VQOV 1M2VB 1NR7A 2KGOA 3C3SA 2XL4A 3QW1A 1WA8A 2ZR2A 4XEFA 4B08A 4U5CE 2IBFA 5B3SC 2NR5A 1SA0A 4JAVA 2VC9A 3G50A 3LAYA 3LSSA 2BTOA 4QNHB 4BAYA 3RF3A 2L6HA 2LP4A 4E7ZA 1WP8A 4TV8B 1ZLZA 3POVA 1TFKB 3J7AU 1J8YF 2W9YA 5HFLA 3A11A 3C8GD 3FDQA 1R6TA 2GA0A 1HNXB 1LNQA 2UU9B 3P32A 1XMOB 3K7DA 3N24A 5A6AA 1FS0G 3OTOO 4LFAB 5JJNB 3H65A 3QTHA 3BY6A 3S28A 4R8CA 2EPNA 4X20A 4DW1A 1EN5A 1NI8A 4J9ZB 1ZHTA 2EULA 3MHSC 4U9EA 2D5RB 4LDQA 2WLKA 1FKAO 1I5NA 2Q0OC 2OEXA 3MDSA 4AL0A 3ETGA 3KMIA 4UCUA 2QY9A 4FVMA 2R7XA 4LF8B 2FL4A 4YXWG 2P4KA 1YIJV 2DWEC 2WLIA 4YJ2B 3K08A 2HZ8A 3K06A 4JZ2A 4JCHA 5DM6V 3ZMVA 4HNAA 5TISZ 2DOSA 1DLBA 1ORJA 3KL4A 4G78A 1Z5WA 1S72V 1F7YA 3G6EV 4UCTA 4O2AB 4D7SA 1A7VA 1NH2B 5HV9A 1DGSA 1K73W 3CMEV 3STLC 3ZQYA 4BIOA 4BJTA 2ZR3A 1Y74B 4U7OA 3OEEG 2YEVA 5H9CA 5JCOC 4IJJA 4NXMO 1P84F 4D6TH 1Q7YW 3SPIA 3GORA 2AW9A 3HNKA 4Q7CA 2R7QA 3C3TA 3ZG1A 4CX9A 3JAMN 5IYZB 2KSFA 3D36A 5CA1A 1CP9A 5JS5A 4NY3A 3ETQA 3C8GB 1XMQO 3B09A 4O2BA 2XM4A 4WFFA 2WAMA 2EILB 1VLSA 2IOQA 4A4AA 4OGQB 5FPRA 1KC8W 3IQ5A 4HAMA 2CH7A 1IBKO 2HVJC 1YA7O 1M2OA 1KECA 1K97A 4NXNB 4GUNA 4KP4A 4IYIA 4PHZA 4K0KB 1AILA 3RBZA 3K5NA 4QE7A 2JEXA 3NDBB 2LFRA 2CUGA 3VAYA 4DR2O 3AG3C 3SXYA 5EC1C 3E22A 3M99B 1Q0GA 4U3JB 2OU6A 3SEOA 1RKCA 2JDIG 3ZRWB 1FJGO 2R7TA 3CEIA 4WBNB 4UVBA 3VYWA 4JYYA 3RYCB 1XWJA 3L34A 2Y3GA 4N6CA 2R9IA 4TUYA 1B68A 3GM2A 2Q7GA 3JD0A 5JQGB 1YJWV 3JALA 1YAUO 1H2MA 1ORSC 4JI2O 1TUEB 2NSFA 4LFCO 3BFRA 4MW3A 4YT4A 1L1FA 3L70H 2EPMX 5IWAO 1XHXA 1TVKA 1GM7A 4XDLA 2YL3A 3E83A 1E86A 1DF4A 2R9AA 1Q90D 2LJ2A 4LFBB 1D1CA 1AROP 2LQTA 3EFOA 3RFYA 5LGTA 4RWUA 1APCA 1I7FA 2BCCH 3DZAA 3K0GA 3GWNA 5J2UB 4O79A 3OGCC 4WJ0A 1K40A 4I9WA 4NTYA 2EIKC 1TR2A 2IYLD 2KK1A 4XPYA 2OKUA 3FAVA 3N0TA 4ULWA 2YZSA 1RM1C 2XT9A 2AHZA 4BG0A 2OG2A 2B5UA 1G1XB 4MVRA 1WAZA 3B40A 1VF7A 2BSKA 4I9QA 4DVZA 2J8WA 3G6BA 1AJPA 1Z2GA 3MX3A 3JAKB 3KG2A 1Z5VA 2UUAO 2UUCB 4NTFA 1K3EA 3K66A 1BR4A 3CRRA 4HYOA 3DTUB 4XDJA 2PGGA 3OEOA 3J81N 5IJ9A 2QSAA 1D1AA 3L75H 4P6IC 2XAGA 3T6BA 4J80A 3G4ZA 2GUZB 5AGFA 1SF9A 1NS1A 1JA8A 2JK5C 1OXKA 2HS5A 4DXWA 4TT3G 4LLCA 4X62B 4K8ZA 2FFHA 2R7SA 5KA5A 4MTXA 4JRZA 1RSOA 4O4JA 4OPHA 4UXNA 3WG7B 1BBHA 1JOGA 2E87A 2YDEA 4X9QA 2QM7A 2BOBC 4UCSA 2PBEA 5KHJA 3CC2V 2LIGA 2QDOA 1AUEA 1SQGA 2W6JG 1WN0A 3HNIA 1Y67A 2V1DA 3E9VA 2ZE5A 2M6YA 4QJFB 1VMAA 4J7ZA 4NCQA 1Q5OA 4FAPB 3OD4A 3JCZA 4I5SA 3BRCA 4EFBA 4C7OB 1YZAA 2ZCEA 3HKBA 4K8XA 2PI4A 4UVAA 4LP8A 1P7BA 1YCIA 4KFMA 2OOCA 1Q43A 4DRXA 3AJMA 2WLLB 3WB1A 1TKNA 2V3CC 1G8MA 5JWPA 1V4AA 3QTCA 5BQHA 4JZGA 3DJUB 4UDVA 2KYHA 3ZHSA 4PA7A 1TWGA 2Z15A 1K92A 5IYCO 2QA4V 4AE4B 4FZ1A 2Y69B 1EN6A 4JI6B 1T01A 1PP9H 2C2AA 4BW5A 2A3QA 1FXKC 4CZZA 2RDCA 4E2LA 2JGDB 4ZIBA 4LF7O 1Y6XA 2B0JA 2XLMA 4QDLA 1SRYA 4MVMA 1SQQH 3CCQV 3L8JA 4LDRA 3RKOF 1AP5A 3BA8A 1BR2A 4YHHO 1IBLO 1T5EA 2OT5A 2LFFA 2Y3HA 3JRTA 1BMFG 4DBRA 4CS7A 2R70A 1OCZB 3EHNA 4X1KB 1KB9F 2XAHA 4IHJB 1JPXA 2E74B 2AWCA 2GV9A 3M7MX 1S7ZA 2XLVA 2A0UA 4O4LA 1L3PA 4CS8A 2L9JA 2EIMC 1AR1B 4X66B 1YDXA 2A79B 1ROPA 5F5FA 2J0WA 2RMKB 5EIBD 4PELA 4AI8A 3CP1A 4BEJA 1QZXA 2AHYA 3LDCA 3UM7A 3U9MA 4BJ5A 3CCLV 4GKJB 4JEAA 1HNXO 5KYXB 2UU9O 4JI8B 3HKKA 1XMOO 1K34A 4I0XA 1GH6A 1L8DA 4LFAO 4WFAV 1VYKA 1BQ0A 4I4TA 4GX5A 2EINC 4DRHB 3ZJZA 3ZDLA 4LLEA 1V9PA 2DW4A 3TXSA 3OMAB 2YVKA 2XL8A 2R9RB 4KHPB 3S90A 5LMNO 4QI0A 1SZIA 3AGUA 1WA8B 3QZCA 1I94B 4LF8O 3KKBA 3E8GA 3SXZA 1SA0B 3L72H 4KNVA 5JUAA 3R7CA 3AG7A 3TULA 3X2QB 3FAPB 5C8YA 3JASA 4NKGB 4DR3B 3OUSA 3WAQA 1M56B 3C62A 4OX9B 5COMA 2Y3BA 2E5LB 1R5ID 2XLDA 5KHHA 1F4NA 2VASA 4JJGA 4CDVA 3E35A 3IFXA 5JRAA 2RN9A 1QQCA 2WZLA 4X20B 3TOMA 2EX3A 2QE7G 2E3CA 2QWPB 4F6RA 2OQMA 3U10A 5ITZA 1QHTA 5IY5B 4U5HA 2ZQMA 3NMIA 5DQZA 2WL8A 1Y6DA 1MMGA 3RH3A 1GTOA 3L8IA 3ATPA 4B7EA 1HDJA 2ZINA 2VCCA 2HJ3A 4IAQA 3ASOB 4MNDA 3ZSUA 3P3PA 4Z2WA 1L0LH 4KNWA 1BGYH 1G4WR 2DN9A 2CTRA 4TQFA 2WLIB 4GKKO 4I1MA 5LYJA 5JJEB 4HNAB 2Q5ZA 2PZSA 3DSQA 3T4DA 3CE2A 1NU7D 2DQ3A 5JJJB 4DV2B 1OHHG 5FNVA 2IJIA 3JZ0A 2LFSA 2CTPA 2JS3A 4C3DA 2JJ2G 3B0VC 3QNEA 1E2XA 2YEVB 1RMVA 2P6VA 2GAQA 3F7YC 1N33O 1ORYA 2GWWA 4DO2A 4TV9A 3H9VA 4DV7B 4MTGA 4HE8D 3IGAC 256BA 3FVYA 4LCUC 2ITDC 3LLIA 2VQFO 3J80N 1EKYA 1YVIA 5B1BB 2QWQB 2P06A 3SJCC 1US6A 5H5NA 3W4YA 5CA1B 3CRMA 1R6NA 2TMVP 4O2BB 5EBLC 1Y4CA 3UMKA 1NTMH 5JH7A 4LFBO 4B3TB 4O6NA 2BTQA 4JV5B 1MZEA 1TWCA 2FYUH 4FLXA 5EZYA 4Q20A 3V5YA 1H2GA 1SF8A 1W0JG 4YL3A 5F5HA 4BPMA 2J9UA 3E22B 2ZXPA 4J42A 2AZ0A 5CI8A 3Q4HA 2UXNA 2IJJA 5L3VA 1K33A 4TUYB 1YZBA 4XWJA 3AG2B 3JALB 2UUCO 4B7KA 1OKKA 3D3QA 1VLTA 4U5GA 5KLVH 4MTFA 2J9BA 1NFNA 3GWKC 2BE3A 3EHBB 1QKRA 5H6QA 4KC9A 1TVKB 1M9NA 2QKSA 2A69F 3CQZA 4CSAA 1QU7A 5A9GA 4D4XA 4CS9C 2H94A 2HJMA 5F2VO 1EI7A 1RXQA 3OM3B 3EFOB 3VQVA 1K7DA 4X62O 4B6IA 2C03A 2AXTZ 2MW2B 1OCOC 2DYRB 1ZYRF 1BE3H 3FAVB 2HSQA 3DC6A 4OPAA 5B66Z 2H8PC 3DM9B 2ZDIA 1WASA 1WGWA 2UXDO 3EVKA 3K5LA 2ZE7A 5D91A 2X6AA 1XREA 1NU1H 2BSKB 3RT3C 3I5QA 3HKEA 2V4DA 3TJTA 4NR1A 2ODMA 2KC3A 4RQEA 2XHBA 4DUYB 1N0NA 2DQ0A 3ML0A 4UV8A 3I56V 2QKAA 3SYPA 3LSQA 5DS4A 1Q6HA 2DYSB 3FD9A 4H44B 3EG9A 2QJ1A 4LF6O 5IJ0A 4U5DE 5IJ9B 1U89A 4E17A 1D0ZA 2F4VB 5EC2C 3HR0A 1A7EA 3RN4A 2OIEA 2IU0A 3TXQA 4PJ0Z 3NMKA 4FLZA 4RUFA 2I8BA 1I4YA 3HKDA 3QMKA 1RSOB 2VWKA 2YIBA 4O4JB 2MK3A 5EBMC 1FFTC 1KNYA 3K1IC 5DS5A 2Y0IA 3JYCA 2H8AA 3DE9A 1HW1A 5L0IA 4DR4B 4PFOA 4JCZA 4PV1B 3PN1A 3L9DA 2V7QG 2OCCB 3VQWA 5J2TA 1NKDA 2LSEA 1PV3A 1YJNV 3DMDA 3F5WC 1Z3IX 1GM5A 2P7TC 3EH1A 2WLMA 4IHJA 1QVXA 3B71A 3HKBB 5KYUA 1YSCA 4MVZA 4X66O 3UMIA 3U8VA 3DM5A 4JPRA 4CJOA 1N32B 2VQEB 3K58A 4DRXB 1JMWA 4FLWA 3LESA 5E1AC 1QLEB 4LF5B 4GKJO 1G4YB 3LNMB 4JI8O 1FMWA 4JTCB 1YEWA 3ZWIA 2Y69C 4B3MO 3GM1A 2JRIA 1URFA 1Q86W 4ULVA 2XLOA 4XEVA 1QSPA 1H8HG 4JAUA 1W0KG 3WHNA 3MAQA 3N2KA 4NTXA 4CH6A 1M93A 5B1AB 2ZM6B 3ZHQA 1I4ZA 2FTKA 3RGBA 3C18A 1I94O 1K5SA 4G27B 4LH6A 5KX5A 4D7TA 3IQTA 1TGOA 2R7UA 1R3JC 5EYPA 1FMVA 3OT7A 2PX0A 3AK3A 4O4LB 1RPRA 3CWBH 4DR3O 1VP7A 5D5PA 5K0IA 4JKVA 5A6BA 1NG1A 2Q6AA 1I5YA 3HTKC 4ER9A 2E5LO 1R1BA 2IJKA 3PHF2 5FCLA 2QWRB 2YUAA 1COWG 2ASRA 1C03A 3UO2A 4I0XB 5JVEA 3RFRA 3BEHA 2FGYA 3S3WA 2P0NA 1N34B 1VQNV 2Q4FA 4I4TB 5CMUA 4J7YA 2JIZG 2Y4UA 5JSLA 4P9PA 1ZL8A 2PP4A 3B77A 1EN4A 3O9OA 4DUZB 2ZKOA 1ZZPA 5T3WA 5L3QA 3AG1B 4FPPA 1AJNA 3GODA 4C3EA 2HVKC 1GGQA 2R03A 3W8IA 1WNSA 4FIPC 3ZRVA 2LP7A 4CS2A 1OCCB 1E1QG 2G38A 1SZXA 2GTAA 5KUKA 3X2QC 1IXMA 3HPLC 4JW1A 1XNRB 3KYIA 1FR0A 3CHXA 3JAWA 4FM1A 4EFEA 3AG4B 1S05A 5C8YB 1M56C 1IZMA 1ST6A 3JASB 1G8XA 1F51A 4TWKA 1BSMA 2RD9A 2BE5F 4EB6A 4DV2O 2JS5A 2PYJA 5JCOA 1QR8A 2WLJA 4FK5C 4PK4A 5CBFA 5EHHA 3LNNA 1DK1A 4P2ZA 1NQTA 3CXHF 5IY5C 3G71V 1LS4A 1GM9A 1R3IC 4PJNA 4F6RB 4DV7O 4FFBA 5ITZB 1M4UA 3G4SV 1D2DA 3K59A 1J8MF 5EIBC 1FYJA 3O65A 4IRUA 2UXCB 5KYYB 3ASOC 2JX0A 2XSEA 2BOCC 1QBZA 1R73A 1CPYA 4MVSA 5A6JA 1A32A 1EBOA 1VIBA 2X6BA 4Q6GA 2LFDA 2XLHA 3JT1A 3QG5A 1SYQA 1GK9A 3RQGA 3U3BA 4AHCA 4Z9HA 4XTKA 4X8AA 2DWDC 1OJHA 4JV5O 1OKKD 3VOUA 1MMMA 5LYJB 1AI4A 3ABMB 1EA8A 3DWWA 4JVSA 4J7JA 4DR5O 1EFRG 1WN7A 2CGNA 4AL1A 1WATA 5FNVB 4J11A 1Q3EA 2KKWA 2W45A 1Q82W 1IW7F 2PX3A 4CDAA 3B8MA 3BPZA 4KUMA 1Z5ZA 1DF5A 2CYDA 1SETA 1B06A 5FL7G 1AEPA 5BMVA 3GEHA 5AG2A 3OW2U 3QW0A 3PDMP 2R7VA 4J41A 2QTSA 1FFXA 3JD2A 1NSGB 2W0XA 4TV9B 2AU5A 1MNEA 4JAAA 5B1BC 2YL0A 3N27A 3D36C 2IM8A 3K0DA 3EGDA 2A0LA 1D0YA 1GAXA 2ZXWB 4MQ9F 2M4EA 1K4DC 2Z0AA 2EZOA 4GX0A 4X64B 1VARA 4LBEC 2HSBA 2MHRA 1OCRB 1JOYA 1KD1W 4Z1MG 3M4BA 4PA6A 5LXTA 1YYJA 5FLXN 4FLTA 2YS8A 5JH7B 3E8BA 4CBCA 3FX7A 3U9JA 2BTQB 3W2VA 5KHIA 1JPNA 4JYAB 4YJ3A 5EZYB 2HKVA 3IPMO 4BEMJ 1K8AW 2Y4TA 4O4HA 4PACA 5FPOA 4ZBMA 4FM2A 5A6KA 3O6XA 3MBGA 2YRFA 1PD0A 1IDSA 3DXJF 3ZX6A 3JYYA 4GX1A 2HKOA 3SXKA 1UPGA 1IBMB 1MG1A 4E18A 3CCSV 3Q4HB 1KKDA 4QI2A 1EQ1A 4EUKB 2DJVA 2YI9A 4OXSA 1D5NA 1LE4A 2PNOA 2YIBD 2B9ZA 3JSNA 4DUYO 4GLXA 2A0BA 4PDLA 2YWAA 4OINF 1WB7A 4I55A 1XQ8A 2DGJA 3ZTMA 3U11A 1VQ7V 3JCUZ 3TK0A 4O7GA 1A41A 2WLHA 2F4VO 2EIJB 3LUTB 1LE2A 1LUWA 3CCEV 3TK1A 1YF2A 2DYRC 5CN0A 4JI4B 2VCAA 3H1JH 1SKVA 2XAQA 3DKAA 4PFPA 3DJNB 3MYIA 1YITV 1IXBA 1L0NH 3CAXA 3U2LA 2D3OW 1H38A 4B3RO 1T9KA 2WPDG 2GDSA 2D4UA 3RVYA 1RFYA 5LP6A 4CC5A 2Q3TA 2BL2A 5BZBA 3RYHA 1BCCH 5L0GA 1TFOB 1XZPA 2IJHA 3HKEB 3EXAA 3IEEA 1FNTc 3OR6C 4OD4A 3CMAV 4XEKA 1QNMA 2XAJA 1D5AA 2P6JA 1E83A 4CIHA 5B5EZ 1N32O 2VQEO 3CRCA 1RP3B 2HHHO 1NT2B 3ICXA 4ICGA 4J32B 4U5BE 2XNDG 4YT2A 4JTDB 4LF5O 3EG9B 2F23A 5DVWA 5IJ0B 1NBBA 2YI8A 1T5OA 2LW1A 1MABG 3LS1A 4DW0A 2QNLA 2QM8A 3RQEA 5B1OA 1YA9A 3CCRV 1AI6A 4FLVA 2L7AA 4OIRF 2QWOB 2NLJC 3T4RA 1XILA 4R7CA 2IM9A 1HW2A 4YN0B 3HKDB 5A6BD 3ZVRA 3GANA 4IWBA 1VOMA 4BWAA 3ZMSA 2HMZA 2YXYA 4DV6B 2OCCC 3ZN0A 1QR9A 2X0LA 2ZM6O 3B0UX 1U97A 3VQYA 3FMSA 1JPJA 3VBBA 3G4XA 4W8KA 2YXHA 2Q8VA 5J2TB 1W2WA 5GONA 2JPUA 4I50A 3ZQVA 3K1HA 1L7CA 5KYUB 3LS0A 1G4US 1GN6A 3X1OA 4PI2A 2L6LA 2YIAA 3FOOA 3H1LH 4DYLA 3CCVV 3T2MA 2QGNA 3N2ZB 4FLUA 3ZHVA 3QVNA 2JGUA 5COGA 1YZCA 2HR3A 1BR1A 1PNMA 2QUPA 4GYCB 1GO3F 3MLGA 3UMHA 1AR4A 4PI0A 3FB5C 3ZS8C 1M57C 1N34O 2MWQA 3SP1A 4GQHA 1XUQA 3T6GB 4UCVA 3SJBC 1I5XA 1WLEA 3SYAA 1HY5A 1BQZA 5KHGA 4JI0B 4PA9A 1UFBA 3DAGA 4ZLCA 4DUZO 5B1AC 1BT8A 4XQ1A 3N2KB 1WOLA 3W7SA 3OEHG 4MVQA 2F66C 3EH2A 2WVNA 4JTAB 3SPGA 1H8EG 3NR7A 4X1IA 5KX5B 1S0VA 2KNHA 5LOVA 3ECSA 3C63A 3T9OA 5EYPB 3K79A 1SS3A 4CS8C 2F43G 2HG5C 1JMKC 1XNRO 4R32A 2J9VA 1NR1A 3P30A 2Y0PA 1CEZA 2XM0A 3CCJV 3CRQA 2HJFC 3O10A 4BJ5C 3FAJA 4IIJA 3SYQA 1S5LZ 2HEPA 5LA6A 3S29A 1JVMA 4IT5A 4DR7B 2EJ7A 4BJ6A 3BA9A 1Q0FA 2XOKG 3NRHA 1PPJH 4XLNF 2Y48A 5BQIA 4DV3B 1UFIA 1Q0DA 4CH4A 3EPVA 4U3FH 4LR3A 4JIOA 2VS0A 1F1MA 3NKEA 3SDLA 4M63A 4NVPA 3AG1C 3C7JA 3KH2A 1ZL8B 4G2KA 2CCYA 5CIVA 1XI1A 4FMTA 2UXCO 2YHSA 1OCCC 2Q67A 1H7IA 2KG7A 1TUBA 2Q9CA 4JI5B 4N21A 4Z1VA 5KYYA 1MMNA 2R02A 3FHDA 1FD9A 5LGUA 1DOVA 1R4TA 1HR0B 5LMUB 3JAWB 4IGGA 1H6GA 4JE9A 3K33A 1GN3A 4LC1A 4W4LA 4FM0A 4MT8A 4NXNO 2CGOA 3W7UA 1A7DA 4EB6B 2DB4A 4O4IA 4K0KO 2NUTA 1UJWB 2Q4PA 3WODF 1PL4A 4PD4F 4L8JA 3H1IH 2F22A 1VF6A 5K1XA 2VWJA 3KZIZ 3SPJA 5BR8B 3MYFA 2ZPAA 1HE9A 3W7WA 4JZAA 2WVOA 1YDIA 3D8CA 1LKXA 1VK5A 3H2UA 4FFBB 3JD3A 3N2GA 2PFDA 3HKCA 2DI3A 4QIWF 1M5IA 2YSUB 3TD7A 1JRAA 3UQ8A 5J9PC 4X64O 4JF3A 5CA0A 4OD5A 1SR2A 3TETA 2DE0X 2GFHA 2EILC 3NKDA 1YHQV 2OIGA 3ABMC 1J5EB 4BR6A 2C04A 4Q4ZF 2HV7A 2WWWA 3OUFA 1H2SB 3DAFA 1S5JA 2XUMA 1N36B 1ZX3A 4XLPF 2P7VA 2W6IG 3UT5A 3IJ4A 1QVFU 5A2QN 5KA6A 5JP7A 4TOIA 1MSWD 1S5HC 5JT4A 4DK0A 1G6UA 3CYOA 1OR3A 3QVYA 1IBMO 5L0CA 5IE9A 3IC7A 1HE1A 4GX2A 4K35A 2P61A 1BL8A 5BMVB 3FB7C 5E3CA 3RYLA 3ABTA 3MFNA 4FESA 1Z7Qc 1FFXB 3KCXA 4ONSA 1K4CC 3SZRA 2ZXWC 4AQYB 4IYHA 1H9TA 4FWVA 3ABKB 3EGDB 4P9FA 3M8AA 4YT8A 1GN4A 4UB8Z 2P5OA 3M4CA 5BUOA 3T1CA 4EEQA 2ETSA 4CIPA 1SQFA 2NSGA 5IDJA 5LXTB 1N1CA 3KYJA 3UR3C 4L87A 1XHZA 5IT9N 3L74H 2H7OA 2QEXV 2CTWA 1OV9A 2RCVA 3LLKA 3SPCA 4JI4O 2Z3YA 1DOWA 3HJCA 3OFNG 1RM1B 3DD7A 4YJ3B 1FJGB 4O4HB 2HJDA 1KP3A 2YXLA 4IAOA 5CB4A 1KKCA 1RJ9A 4QPJA 1LM3B 4O6YA 2RQ6A 1BS3A 1ORQC 3NMJA 2ZXRA 4WGZA 2Q7RA 1PV0A 2Q68A 4JEBA 4EWCA 3Q6NA 2YLIA 1M1KW 1Q6UA 2VB6A 3GWLA 1VF5B 5DS6A 4NYKA 4G7OF 2B1IA 3J06A 4XBFA 2QTOA 3WB0A 3O55A 4DOZA 4I55B 1AI5A 3CEXA 5K1PA 4G7HF 4QE9A 3BAAA 3DXRA 1R6KA 2CNWA 2EIJC 4ZHQA 4LF4B 4LWSA 2PI5A 3B9QA 3EGXA 3BCCH 3JTLO 4ZKIA 2D2CB 2ZXOA 5DQTA 4UB6Z 3T4ZA 2YL1A 2RJZA 2Q9BA 3LSUA 1U6HA 1ZW2A 4P30A 1N8RW 3L1MA 2AWYA 2ZDIC 3RYFA 3WG7C 4JI6O 2Q7HA 4K3AA 1QPUA 5B1NA 3C8ZA 2Z5UA 3EHMA 3K5MA 4DV6O 4FX5A 3VRCA 4X65B 1SQPH 2ZE8A 2UUAB 1NU9C 3LJBA 5LP6B 3ZIAG 4PDMA 3ZTZA 3RYHB 4JC7A 1CXZB 3EJNA 4PJLA 1S3JA 3ABUA 4DR6B 2A9HA 1WPXA 1BZ4A 3IAYA 1YTFD 3FYIB 3S3XA 3APQA 1VQPV 1GM8A 1PCXA 2EPOA 4AK9A 2WZGA 2YKZA 4XPXA 2RNBA 3A0BZ 1FAPB 3NG1A 2P22C 2GTSA 3F47A 4X0RA 4H33A 1MMAA 1PNKA 3OR7C 3CJHA 3E70C 4RO2A 1AB3A 4WFEA 5DECA 3CPWU 3K6BA 4DVYP 2L35A 1QQ3A 4KBLA 4EHPA 4DV4B 1JQ0A 3B8NA 2E76B 4LF9B 3LEOA 1VB5A 1Y76A 3CSKA 5BXZA 4JI0O 4BW9A 4B3SB 3VQXA 3F46A 4HEAJ 5KYWA 2KQ9A 2ICWG 2QR4A 4UFZA 2N04A 1K5QA 1OCZC 4KHPO 4YWQA 4ZOLA 4IB4A 4J7KA 5GONB 1FXHA 2QKCA 1LVKA 4I50B 3K5OA 1WB8A 4MW8A 1ZHWA 4DV5B 1GRJA 1K9MW 2XL6A 2XS1A 4YY3B 1ZVZA 5H6RA 1C02A 2PF4E 3PJSK 2ZNJA 2IBZH 1R3LC 4WF9V 3ZMZA 2NUPA 1ZW3A 1YLMA 1ENVA 3UGPA 1XDCA 2B1GA 3A0RA 1MNGA 4OX9O 4DR7O 1NLXA 3V5ZA 2A6HF 2EINB 1FPOA 3FOPA 3S27A 4YHHB 2A68F 2NNUA 4DV3O 3MD0A 3R66A 1O9HA 2IH3C 2UUBB 1AP6A 1YARO 2P4VA 2PTMA 3KPHA 4JI7B 2GDCA 2J0XA 2R25A 2XXAA 1OQCA 3A9CA 4DK1A 1SQXH 3SJAC 3P3NA 3AQCA 1YTFB 1AR5A 1ZU5A 2PYLA 3FKSG 2P90A 1NZEA 3OMIB 3B4SA 4OIQF 3JD4A 3W2WA 3L73H 1GKFA 4QPKA 2ETNA 4C7UA 3R65A 2H3OA 4LERA 2IXOA 4X1YA 5T1DB 4JI5O 4OIOF 3ASNB 4H37A 1LI7A 1SERA 4F6EA 4X1IB 3CCUV 5EGYA 5LOVB 1IURA 1HR0O 5LMUO 1NVPD 1B04A 3ZEDA 2F1MA 3AQBA 4D4NA 4H0LB 4JYCA 5JLIA 1JJOA 4ZI7A 3EFFK 2L6FA 3B0PA 3EZHA 1AVMA 4FLYA 3CD6V 4IIJB 2CK3G 1HNZB 3D3IA 1GMGA 5LA6B 5AC5A 1VQ5V 1ZHXA 3C90A 3H1KH 3U0CA 2WA4A 4YK5A 5JVDA 4JI3B 5AC4A 5BR8O 3G67A 1UG7A 1CPRA 3ZHTA 3ZRXA 5LMNB 2KQXA 3RWRD 2YLGA 3PMRA 1E84A 3UCSC 3FFQA 4BIZA 1QLNA 1KU2A 4CS3A 1JFFA 1SESA 1Q6IA 1OW7A 1V74B 4NTWA 3SR2C 4HBNA 2J9WA 2EPLX 2ZIOA 1PD3A 2UXXA 4DV0B 5BY1A 2KG7B 3L71H 1TUBB 4LACB 3OA1A 1LI5A 2X0CA 2XRHA 3CCMV 2LK4A 1LPEA 2A06H 3QO8A 1J5EO 2YLDA 2JD3A 4B3TO 1NZ6A 3QF7A 4JYBA 4DR1B 4U5EE 4KL1A 3SYCA 1N36O 1ZU4A 2XTAA 1XL6A 3T1HB 2R7WA 2UUIA 1HMOA 4O4IB 2NUTB 2FAPB 3AGTA 4CH3A 1JX9A 2IU3A 3OGIB 2NG1A 3O39A 4G0HA 4YL0A 4W8PA 1PNLA 3CC4V 1U96A 3JRMO 3JSZA 1CGNA 4ANJA 1KMIZ 1E85A 1SZTA 1MQVA 2YC0A 3ZRSA 2Q9LA 2EZPA 3JARA 5E2QA 1KQSU 4AQYO 3N2GB 4YIOA 5CBGA 3HKCB 1NVPB 4GCZA 4TQDA 1PL0A 1TAEA 4U7NA 3SYNA 3THOA 5B3IA 3Q7LA 3RYIA 2J7PA 3EZIA 1LIHA 4GKKB 1CPQA 5CA0B 3E86A 2YIDA 1PD1A 4TSFG 2CDYA 3APOA 1MZFA 4JASA 4EBBA 1OZ0A 2GHYA 2OEVA 2YL7A 2L6GA 2Q73A 4XPWA 3IC9A 3ZHRA 3IQ6A 5KAFZ 4LNUA 4I1OB 1MOFA 5IYBO 3T1YB 2LQGA 3LDDA 3AEIA 4JI1B 3WFVA 3SPHA 3UT5B 1N33B 3JATA 4E4EA 2CNWD 4MSWC 5KYNA 2UXBB 1D1BA 4MVOA 2X51A 3U2MA 4DV1B 4YIPA 4AX2A 2VQFB 3JYHA 4P9TA 3JSLA 3BRJA 1Q0MA 4WFBV 3BHPA 1GQAA 3ABKC 4UV9A 1SQVH 3AG2C 1JR8A 1S76D 2F93B 4K1OA 5D5QA 1VQ9V 4GT1A 4PDRA 1HMDA 3A2FA 1LUVA 4R50A 4PDVA 1IX9A 2WA3A 3T6JA 3ZMUA 4N06A 4CDYA 3K57A 3CB2A 1TA8A 1HNWB 4LF4O 2ZNIA 2P1AA 4N4WA 2XLWA 3E89A 3IQCA 2OJQA 3I4UA 1KYOF 1OCOB 2JEUA 1FXVA 1QCEA 4CS4A 1VQ6V 3ZC4A 4ZLDA 2ZD9A 4Z9IA 3RVZA 5E79Z 4RUEA 1V55B 1RKEA 2R72A 1SQBH 3B2EE 5CB4B 1RJ9B 1WWPA 2OJED 1ZSPA 1K04A 2AP3A 4CC6A 3OMNB 1VQMV 4X65O 1C17M 4MVUA 5KMGA 1ZWIC 2K9PA 4DR4O 1V54B 4Z9JA 1KU9A 5F28E 2K1EA 3W7XA 4DR6O 3ZIBA 5LHHA 4PA4A 3DE8A 1WP7A 2N05A 4I3MA 2LD6A 4YJWA 4W4KA 1ZAUA 4ASUG 1VYIA 1NBMG 2ADQB 1HP8A 4GYTA 3HNLA 3STZC 5FZTA 3ZCCA 3UGOA 2VRZA 3VM6A 2DYSC 3DXRB 2ATKC 2HLDG 2W4BA 4ZHQB 4NC3A 4LWSB 5L3CA 5LHIA 2AVKA 1VQLV 3EGXB 1U0BB 1X59A 3S84A 4WCEV 1HWYA 1T6QA 1THZA 3DGEA 4DV4O 4GEHA 1FFTB 3RW0A 1FXKA 4MTOA 1XNQB 2UXDB 4LF9O 5L0DA 2WVQA 1X4TA 3FB8C 1EM1A 2NN4A 3RYFB 4B3SO 2Q00A 2BC5A 2AGAA 3BABA 2HFEC 3E8FA 5LP6C 1I0HA 5EBWC 2QM4A 5KAIZ 4RQFA 5E33A 4OIPF 1AJQA 4PR9A 4DV5O 3NYMA 3G80A 1NTKH 4LF6B 4PJMA 3ETEA 1MMDA 2ADPA 4YY3O 2P67A 3ETDA 4I44A 3WB2A 3QVZA 2FKXA 1SMYF 4K7BA 3LEVA 3GEEA 5LL6Y 1QLEC 1W2BU 1D0XA 1VQ8V 1GS9A 2IXMA 3I55V 3CJHB 2NPUA 2XLEA 5GTIZ 1AVOB 2CTQA 4E0HA 3ABLB 4RAIA 2G3KA 3ITFA 2V26A 1O5HA 5DLJA 2UUBO 5HSWA 4JI7O 3TGUH 2F95B 4QGPA 3JD1A 3L0IA 4N6HA 1BHAA 1Y76B 1Y66A 1M2VA 1BZKA 5L3DA 1JCHA 5KYWB 1FTSA 3K03A 4PA3A 2W0FC 3SYOA 1Q0KA 4UCOA 3HNJA 4BJ1A 3SXMA 2M64A 5B3SB 4ZOLB 4FJCC 1I08A 2KW3C 2ZT9B 4TV8A 1S77D 1VTMP 2A1DD 3PCVA 4HFFB 1E79G 4HZ3A 3K3WA 2QWNB 4B3MB 1ZHYA 3OE7G 4AILC 1P4RA 2Q7EA 1HNZO 2NUPB 2ITCC 3GB7C 2I15A 3UO3A 3NXSA 4F4BA 4J9YB 1VQ4V 4L6RA 3W8HA 4JI3O 2OWOA 4KXRA 1P49A 3AK1A 3E2EA 4IARA 4U9DA 5GW7A 5KUMA 2XXAB 1YXBA 2JVDA 3F5TA 2WLNA 4FFKA 3JCUQ 4F4LA 2GSMB 1H2LA 4NQFA 1T6IA 2QTVA 3V5XA 2E75B 3ASNC 1NJIW 5BQGA 4YJ2A 4DV0O 4X1YB 4J10A 2LW7A 1CGOA 4A5UB 3NYJA 2JJ1G 5L0HA 2DMXA 4P9OA 4DBQA 4XDKA 2HFIA 3TCUA 1H2KA 3U3FA 1KTMA 3DI5A 2EBOA 1XL4A 2RSEB 1WPBA 4I7ZB 5CA3A 3CSXA 3AG4C 3SNHA 4O2AA 2N74A 4ZI7B 4DR1O 2KJGA 4H13B 3UNGC 2J7PD 1FAFA 3T1HO 2L81A 4PJJA 2IXPA 5H2FZ 1E1RG 1MA1A 1SC5B 4O6MA 1Y74A 2EPKX 5GPGB 4BJ6C 2GBOA 4EBKA 3FB6C 3OTOB 3OTFA 4IL6Z 2X6CA 5JVDB 4WABA 4UCRA 1EZJA 5E3AA 3H1HH 5L3GA 3AOUA 2WSSG 3F7VC 4CH5A 1YJGA 1YI2V 2H7BA 2H7VC 1IZ3A 4G7ZF 5IYZA 3R2PA 1VEWA 5L3FA 1Z23A 1OW8A 3M79A 4G28B 1KUQA 4EBJA 1NFOA 3C8GA 1B6QA 1JFFB 2UUHA 3M15A 3JSEO 4H4KC 4A2NB 3UKMA 2QLAA 1ZHZA 2IH1C 2M7WA 2O9XA 1B3QA 3EQLF 1XBLA 2VH3A 2CAZC 3S9OA 1LS1A 2R05A 3LDEA 3QO5A 1H2NA 5T3TA 2B0HA 2FB5A 3ZBHA 1WJZA 4YL1A 3T1YO 2O57A 4JI1O 4U3JA 3GWOA 4JYAO 4JJFA 3ZRWA 2Y39A 4WBNA 3AG3B 1VQKV 1VF6C 4Q5SF 2UXBO 3RYCA 4J30B 3CRAA 4NXMB 4DV1O 1LR1A 1PKXA 5JQGA 1K05A 4WFGA 5C93A 1ZTEA 5D92A 2LO1A 3US6A 1CGME 5EK0A 1TQGA 2KB1A 3K9SA 4H54A 5L3EA 3U0ZA 3JARB 1H9GA 3M1CB 1YVWA 4WFHA 4UUJC 2FMLA 2ILMA 1J95A 2OTLV 4J7TA 3GVMA 1ZUQA 4EKWA 4DRIB 1AI7A 3WU2Z 1XMQB 1M90W 5GTHZ 2QE9A 2CH7B 3RYIB 2A7WA 1MNDA 3LNRA 3VF0A 2G62A 3Q7GA 3U8PA 1O9GA 4CBEA 1OCRC 1HNWO 2WZFA 4CS9A 3ZHUA 1IBKB 1BHBA 3QO7A 5J2UA 1G5ZA 1N0JA 4DR5B 1WTYA 1QVGU 1P7GA 1Z6AA 4FZ0A 2AZ2A 5LBQA 5CBHA 2R7OA 3IHUA 1XOUA 3BVOA 4C3BA 3ZMTA 4LNUB 1F23A 2EIKB 4DR2B 3GM3A 4ABMA 5L3BA 1W59A 4CJGA 3JATB 3A8TA 2MYSA 4LH7A 1Z63A 2WB7A 2LCHA 3RIPA 1EZVH 1IVSA 1OW6A 2CGEA 2XASA 1R3KC 3JAKA 1YJ9V 5KHKA 4JI2B 2Q0AA 1O3UA 4LFCB 1Y4MA 5L0FA 4RBNA 4R6ZA 2YQYA 4E7SA 2A6EF 3V7OA 1N4CA 3A0HZ 5IWAB 2HMQA 1JR9A 2OTJV 4JGSA 2ZIMA 5TJ5E 2GUZA 1KBHA 3AK2A 5COFA 1XZQA 4WGYA 2CDQA 4GZRB 4CSAC 2W4MA 2XS8A 1M6TA 4YT5A 2Q9AA 3HB3B 3TJ6A 2LGWA 4N23A 1XNQO 2J45A 1HW7A 1V55C 1A0BA 3K1IA 2R7RA 2IXNA 2ARHA 4UVCA 1RKEB 3CXCU 1JAFA 1Q81W 3K9AA 5L0JA 1FFHA 2HV6A 1DTOA 2PUSA 3CC7V 1V54C 3OAAG 3H01A 2X7RB 4KI2A 3TJ5A 3I5PA 2ZE6A 5KMGB 3CS5A 4C7OA 5LGNA 4DJ9A 4EIYA 1O87A 3K04A 4X89A 5LHGA 2G3VA 2OCHA 2YICA 1JJ2U 5HFMA 3OWTA 2WLLA 2KSDA 3KCYA 1YYXA 3FXHA 3SGIA 1VMGA 3W7TA 1NTZH 4X88A 2CE4A 4AE4A 5DEDA 3NYLA 2J46A 4NTAA 3TQOA 2JGDA 3DC5A 1Q8IA 3SJQC 3GEIA 2HP8A 4B3RB 4JURI 3CZ6A 1GN2A 1FXKB 3Q6MA 3ZN1A 4HFKB 4U5FE 2PY5A 5A69A 2XAFA 1BDJB 4X1KA 4MS2A 4K0DA 3I5DA 4RDAA 3HLZA 2LGQA 2VCBA 4RD9A 4NB5A 3H2VA 1RPOA 3RQFA 1OXBA 2HHHB 2Q69A 1T6UA 5IYDO 1TWAA 4E0IA 5CI9A 3KKYA 1OR2A 3FYEB 2EIMB 2OYQA 5KYXA 3B29A 2Y3DA 3U5SA 4NTBA 1PM9A 4LDKA 1MSDA 2CW0F 3S0XA 3ABLC 1M57B 1TWHA 1RCPA 1KP2A 1F4MA 3MHHC 5DN6G 3TOLA 1XEQA 4BIUA 3CX5F 2HUJA 2EJRA 4LF7B 3E8HA 1NH2D
chains in the Genus database with same CATH topology
2IW5A 1VQOV 1M2VB 1NR7A 2KGOA 2XL4A 2ZR2A 4U5CE 5B3SC 4JAVA 3LAYA 3LSSA 4QNHB 4BAYA 4E7ZA 3POVA 1J8YF 2W9YA 5HFLA 3FDQA 1LNQA 3P32A 3N24A 3K7DA 1FS0G 3H65A 3BY6A 3S28A 4R8CA 4J9ZB 1ZHTA 3MHSC 2D5RB 2WLKA 3ETGA 3KMIA 2QY9A 2R7XA 4YXWG 1YIJV 2DWEC 2WLIA 3K08A 3K06A 4JCHA 5DM6V 3ZMVA 1DLBA 3KL4A 1S72V 3G6EV 1NH2B 1K73W 3CMEV 3STLC 4BJTA 2ZR3A 4U7OA 3OEEG 2YEVA 5H9CA 4IJJA 1Q7YW 3SPIA 4Q7CA 2R7QA 3ZG1A 3D36A 1CP9A 4NY3A 4WFFA 2WAMA 2EILB 2IOQA 1KC8W 4HAMA 2HVJC 1M2OA 1KECA 1K97A 4KP4A 3RBZA 4QE7A 2JEXA 3NDBB 2LFRA 3VAYA 3AG3C 5EC1C 3M99B 3SEOA 2JDIG 3ZRWB 2R7TA 4UVBA 3VYWA 3L34A 2Y3GA 2R9IA 3JD0A 1YJWV 1TUEB 4MW3A 4YT4A 1L1FA 1GM7A 4XDLA 3E83A 1DF4A 1D1CA 1AROP 3EFOA 3RFYA 5LGTA 3DZAA 3K0GA 4O79A 3OGCC 4WJ0A 4I9WA 2EIKC 1TR2A 2IYLD 3N0TA 4ULWA 2YZSA 1RM1C 2AHZA 4BG0A 2OG2A 2B5UA 4MVRA 4DVZA 1AJPA 3MX3A 3KG2A 1K3EA 3K66A 1BR4A 4HYOA 3DTUB 4XDJA 3OEOA 1D1AA 4P6IC 3T6BA 2XAGA 2JK5C 4DXWA 4TT3G 4LLCA 2FFHA 2R7SA 5KA5A 4MTXA 4UXNA 3WG7B 2E87A 2QM7A 2BOBC 3CC2V 2W6JG 2V1DA 3E9VA 4QJFB 1VMAA 3JCZA 4I5SA 4C7OB 2PI4A 4UVAA 4LP8A 1P7BA 4KFMA 2WLLB 1TKNA 2V3CC 1G8MA 3DJUB 4PA7A 1TWGA 2Z15A 1K92A 5IYCO 2QA4V 4AE4B 2Y69B 2C2AA 4BW5A 4CZZA 1FXKC 4E2LA 2B0JA 4QDLA 1SRYA 4MVMA 3CCQV 3RKOF 1BR2A 2OT5A 2Y3HA 3JRTA 1BMFG 4DBRA 4CS7A 1OCZB 3EHNA 2XAHA 1JPXA 1S7ZA 4CS8A 2L9JA 2EIMC 1AR1B 2A79B 1ROPA 5F5FA 2J0WA 4PELA 3CP1A 4BEJA 1QZXA 2AHYA 3LDCA 3UM7A 4BJ5A 3CCLV 5KYXB 1K34A 4WFAV 1VYKA 4GX5A 2EINC 3ZJZA 4LLEA 2DW4A 3OMAB 2R9RB 4QI0A 1SZIA 3QZCA 3KKBA 3E8GA 4KNVA 3X2QB 3OUSA 1M56B 2Y3BA 1F4NA 2VASA 4JJGA 3E35A 3IFXA 2WZLA 2QE7G 5IY5B 4U5HA 2ZQMA 5DQZA 2WL8A 1MMGA 3RH3A 1GTOA 4MNDA 3ASOB 3ZSUA 4KNWA 2WLIB 4I1MA 3T4DA 1NU7D 2DQ3A 1OHHG 2IJIA 2LFSA 4C3DA 2JJ2G 3B0VC 3QNEA 2YEVB 2P6VA 3F7YC 4DO2A 4MTGA 4HE8D 3IGAC 3FVYA 4LCUC 2ITDC 3LLIA 5B1BB 1R6NA 5EBLC 3UMKA 4O6NA 1TWCA 4Q20A 1H2GA 1SF8A 1W0JG 5F5HA 2J9UA 2ZXPA 5CI8A 2UXNA 2IJJA 5L3VA 1K33A 4XWJA 3AG2B 1OKKA 4U5GA 4MTFA 3EHBB 5H6QA 4KC9A 1M9NA 2QKSA 2A69F 3CQZA 4CSAA 4CS9C 2H94A 3OM3B 3EFOB 1K7DA 4B6IA 2C03A 1OCOC 2DYRB 1ZYRF 2H8PC 3DM9B 2ZDIA 1WGWA 5D91A 2X6AA 3I5QA 4RQEA 2DQ0A 3ML0A 4UV8A 3I56V 3SYPA 3LSQA 5DS4A 2DYSB 3EG9A 4U5DE 1D0ZA 5EC2C 2IU0A 4RUFA 2I8BA 3QMKA 5EBMC 3K1IC 2MK3A 1FFTC 5DS5A 3JYCA 4PFOA 2V7QG 2OCCB 1NKDA 2LSEA 3DMDA 1YJNV 3F5WC 1Z3IX 2P7TC 3EH1A 2WLMA 5KYUA 1YSCA 4MVZA 3UMIA 3DM5A 4JPRA 3LESA 5E1AC 1QLEB 1G4YB 3LNMB 1FMWA 4JTCB 2Y69C 1Q86W 1H8HG 4JAUA 1W0KG 5B1AB 2FTKA 1K5SA 4G27B 2R7UA 1R3JC 1FMVA 2PX0A 1RPRA 1NG1A 2Q6AA 1I5YA 3HTKC 2IJKA 3PHF2 5FCLA 1COWG 2FGYA 3BEHA 1VQNV 5CMUA 2JIZG 4P9PA 2PP4A 3B77A 5T3WA 5L3QA 3AG1B 4FPPA 1AJNA 3GODA 4C3EA 2HVKC 3W8IA 4FIPC 3ZRVA 2LP7A 1OCCB 1E1QG 5KUKA 3X2QC 1IXMA 3HPLC 4JW1A 3AG4B 1M56C 1IZMA 1ST6A 1G8XA 1F51A 4TWKA 2BE5F 1QR8A 2WLJA 4FK5C 4PK4A 5CBFA 5EHHA 4P2ZA 1NQTA 5IY5C 3G71V 1GM9A 1R3IC 4PJNA 3G4SV 1J8MF 4IRUA 5KYYB 3ASOC 2XSEA 2BOCC 1QBZA 1R73A 1CPYA 4MVSA 1EBOA 2X6BA 3JT1A 1GK9A 4XTKA 4X8AA 2DWDC 1OKKD 3VOUA 1AI4A 3ABMB 4JVSA 1EFRG 2W45A 1Q82W 1IW7F 2PX3A 3B8MA 4KUMA 1Z5ZA 1DF5A 1SETA 5FL7G 3OW2U 2R7VA 3JD2A 1MNEA 5B1BC 3K0DA 3EGDA 2A0LA 1D0YA 2ZXWB 4MQ9F 2M4EA 1K4DC 2EZOA 4GX0A 4LBEC 1OCRB 1JOYA 1KD1W 4Z1MG 4PA6A 3E8BA 4CBCA 3W2VA 1JPNA 1K8AW 4ZBMA 3O6XA 1PD0A 3DXJF 4GX1A 2HKOA 1MG1A 3CCSV 1KKDA 4QI2A 4OXSA 4PDLA 4OINF 2DGJA 1VQ7V 4O7GA 2WLHA 2EIJB 3LUTB 3CCEV 3TK1A 2DYRC 5CN0A 2XAQA 4PFPA 3DJNB 1YITV 2D3OW 1H38A 2WPDG 3RVYA 2Q3TA 5BZBA 2IJHA 3IEEA 3OR6C 4OD4A 3CMAV 2XAJA 2P6JA 4CIHA 4U5BE 4J32B 2XNDG 4YT2A 4JTDB 3EG9B 5DVWA 1MABG 3LS1A 2QM8A 5B1OA 3CCRV 1AI6A 4OIRF 2NLJC 3T4RA 4R7CA 4YN0B 3ZVRA 3GANA 4IWBA 1VOMA 3ZMSA 2OCCC 3ZN0A 1QR9A 2X0LA 3B0UX 1JPJA 3VBBA 4W8KA 1W2WA 3K1HA 5KYUB 3LS0A 3X1OA 3CCVV 3T2MA 3N2ZB 2HR3A 1BR1A 1PNMA 1GO3F 3UMHA 3MLGA 3FB5C 1M57C 2MWQA 3SP1A 1I5XA 1WLEA 3SYAA 4PA9A 3DAGA 4ZLCA 5B1AC 3W7SA 3OEHG 4MVQA 3EH2A 2WVNA 4JTAB 3SPGA 1H8EG 1S0VA 2KNHA 3ECSA 4CS8C 3K79A 2F43G 2HG5C 2J9VA 1NR1A 3P30A 1CEZA 3CCJV 2HJFC 4BJ5C 3FAJA 3SYQA 3S29A 1JVMA 4BJ6A 2XOKG 3NRHA 4XLNF 2Y48A 3EPVA 4M63A 3NKEA 3AG1C 3KH2A 4G2KA 4FMTA 2YHSA 1OCCC 2Q67A 2Q9CA 4N21A 5KYYA 1MMNA 3FHDA 5LGUA 3K33A 4LC1A 4MT8A 3W7UA 2NUTA 1UJWB 3WODF 3SPJA 2ZPAA 3W7WA 4JZAA 2WVOA 1LKXA 1VK5A 3JD3A 2PFDA 4QIWF 2YSUB 3TD7A 5J9PC 4JF3A 4OD5A 3TETA 2GFHA 2EILC 3NKDA 1YHQV 3ABMC 2C04A 4Q4ZF 2HV7A 2WWWA 3OUFA 3DAFA 4XLPF 2P7VA 2W6IG 1QVFU 5KA6A 1MSWD 1S5HC 3CYOA 3IC7A 4GX2A 1BL8A 5E3CA 3FB7C 3RYLA 3ABTA 4FESA 1K4CC 3SZRA 2ZXWC 4FWVA 3ABKB 3EGDB 4YT8A 5BUOA 3T1CA 5IDJA 1N1CA 3UR3C 4L87A 2H7OA 2QEXV 3LLKA 3SPCA 2Z3YA 3HJCA 3OFNG 1RM1B 3DD7A 1KP3A 4IAOA 1RJ9A 4QPJA 4O6YA 1ORQC 2ZXRA 2Q68A 4EWCA 3Q6NA 1M1KW 2VB6A 5DS6A 4G7OF 2B1IA 4XBFA 2QTOA 4DOZA 1AI5A 4G7HF 4QE9A 1R6KA 2CNWA 2EIJC 2PI5A 3B9QA 3EGXA 4ZKIA 2ZXOA 5DQTA 3T4ZA 2Q9BA 4P30A 1N8RW 2ZDIC 3WG7C 5B1NA 2Z5UA 3EHMA 4FX5A 1NU9C 3LJBA 3ZIAG 4PDMA 3EJNA 4PJLA 1S3JA 3ABUA 2A9HA 1WPXA 1YTFD 3FYIB 1VQPV 1GM8A 1PCXA 4AK9A 2WZGA 3NG1A 3F47A 4X0RA 4H33A 1MMAA 1PNKA 3OR7C 3E70C 4RO2A 4WFEA 3CPWU 3K6BA 4DVYP 4KBLA 1JQ0A 3B8NA 3CSKA 3F46A 4HEAJ 5KYWA 2KQ9A 1K5QA 1OCZC 4YWQA 1FXHA 1LVKA 4MW8A 1ZHWA 1K9MW 5H6RA 2PF4E 3PJSK 1R3LC 4WF9V 3ZMZA 2NUPA 1ENVA 3UGPA 2B1GA 3A0RA 2A6HF 2EINB 3S27A 2A68F 2NNUA 3MD0A 2IH3C 2XXAA 2J0XA 3AQCA 1YTFB 1ZU5A 3FKSG 2P90A 1NZEA 3OMIB 4OIQF 3JD4A 3W2WA 1GKFA 4QPKA 3R65A 4LERA 2IXOA 5T1DB 4OIOF 3ASNB 4H37A 1SERA 3CCUV 5EGYA 1NVPD 3AQBA 4JYCA 3EFFK 3B0PA 3EZHA 3CD6V 2CK3G 3D3IA 1GMGA 1VQ5V 1ZHXA 3ZRXA 3PMRA 4BIZA 1QLNA 1KU2A 1SESA 2J9WA 1PD3A 2UXXA 4LACB 3OA1A 2XRHA 3CCMV 3QO8A 2JD3A 4JYBA 4U5EE 3SYCA 1ZU4A 1XL6A 2R7WA 2NUTB 3O39A 1JX9A 2IU3A 2NG1A 4G0HA 1PNLA 3CC4V 3JSZA 4ANJA 1SZTA 3ZRSA 2EZPA 5E2QA 1KQSU 5CBGA 1NVPB 4GCZA 1PL0A 4U7NA 3SYNA 3Q7LA 2J7PA 3EZIA 3E86A 1PD1A 4TSFG 4JASA 4EBBA 1OZ0A 2GHYA 4I1OB 1MOFA 5IYBO 3LDDA 3AEIA 3WFVA 3SPHA 2CNWD 4MSWC 5KYNA 1D1BA 4MVOA 2X51A 4AX2A 3JYHA 4WFBV 3ABKC 4UV9A 3AG2C 1S76D 1VQ9V 4GT1A 4PDRA 4R50A 4PDVA 3T6JA 3ZMUA 4N06A 3E89A 3I4UA 1OCOB 2JEUA 1FXVA 1QCEA 1VQ6V 3ZC4A 4ZLDA 2ZD9A 3RVZA 4RUEA 1V55B 1RJ9B 3OMNB 1VQMV 4MVUA 1ZWIC 1V54B 2K1EA 3W7XA 3ZIBA 5LHHA 4PA4A 4I3MA 4YJWA 1VYIA 4ASUG 1NBMG 4GYTA 3STZC 3ZCCA 3UGOA 2DYSC 2ATKC 2HLDG 2W4BA 5L3CA 5LHIA 1VQLV 3EGXB 4WCEV 1HWYA 1THZA 3DGEA 4GEHA 1FFTB 3RW0A 1FXKA 4MTOA 2WVQA 3FB8C 2HFEC 3E8FA 5EBWC 4RQFA 5E33A 4OIPF 1AJQA 3NYMA 4PJMA 3ETEA 1MMDA 2P67A 3ETDA 4I44A 1SMYF 4K7BA 3LEVA 1QLEC 1W2BU 1D0XA 1VQ8V 2IXMA 3I55V 3ABLB 4RAIA 2G3KA 3ITFA 2V26A 1O5HA 5DLJA 5HSWA 3JD1A 3L0IA 1BHAA 1Y66A 1M2VA 5L3DA 1JCHA 5KYWB 1FTSA 3K03A 4PA3A 2W0FC 3SYOA 4BJ1A 5B3SB 4FJCC 2KW3C 1S77D 2A1DD 4HFFB 1E79G 4HZ3A 3K3WA 1ZHYA 3OE7G 1P4RA 2NUPB 2ITCC 3GB7C 3NXSA 4F4BA 4J9YB 1VQ4V 3W8HA 3E2EA 5GW7A 5KUMA 2XXAB 2WLNA 3JCUQ 4F4LA 2GSMB 2QTVA 3ASNC 1NJIW 3NYJA 2JJ1G 4P9OA 4DBQA 4XDKA 3TCUA 2EBOA 1XL4A 5CA3A 3AG4C 3SNHA 2KJGA 3UNGC 2J7PD 2L81A 4PJJA 2IXPA 1E1RG 4O6MA 4BJ6C 3FB6C 2X6CA 1EZJA 5E3AA 5L3GA 2WSSG 3F7VC 1YI2V 2H7BA 2H7VC 4G7ZF 5L3FA 1Z23A 4G28B 1B6QA 4H4KC 4A2NB 3UKMA 1ZHZA 2IH1C 2M7WA 2O9XA 3EQLF 2VH3A 1LS1A 3LDEA 3QO5A 5T3TA 3GWOA 4JJFA 3ZRWA 2Y39A 3AG3B 1VQKV 4Q5SF 4J30B 1PKXA 4WFGA 5C93A 5D92A 5EK0A 2KB1A 5L3EA 3M1CB 4WFHA 4UUJC 1J95A 2OTLV 4EKWA 1AI7A 1M90W 1MNDA 3LNRA 2G62A 3Q7GA 4CBEA 1OCRC 2WZFA 4CS9A 1BHBA 3QO7A 1QVGU 1Z6AA 5LBQA 5CBHA 2R7OA 4C3BA 3ZMTA 1F23A 2EIKB 5L3BA 2MYSA 1Z63A 2WB7A 3RIPA 2CGEA 2XASA 1R3KC 1YJ9V 1Y4MA 4RBNA 4R6ZA 4E7SA 2A6EF 3V7OA 2OTJV 4JGSA 2CDQA 4CSAC 2W4MA 4YT5A 2Q9AA 3HB3B 4N23A 2J45A 1V55C 2R7RA 2IXNA 4UVCA 3CXCU 1Q81W 3K9AA 1FFHA 2HV6A 1DTOA 3CC7V 1V54C 3OAAG 3H01A 2X7RB 4KI2A 3I5PA 4C7OA 5LGNA 1O87A 3K04A 4X89A 5LHGA 2G3VA 1JJ2U 5HFMA 3OWTA 2WLLA 3W7TA 4X88A 4AE4A 3NYLA 2J46A 3SJQC 4JURI 3CZ6A 1FXKB 3Q6MA 3ZN1A 4HFKB 4U5FE 2XAFA 4MS2A 4K0DA 4RDAA 3HLZA 4RD9A 1RPOA 2Q69A 5IYDO 1TWAA 5CI9A 3FYEB 2EIMB 5KYXA 2Y3DA 2CW0F 3S0XA 3ABLC 1M57B 1TWHA 1KP2A 1F4MA 3MHHC 5DN6G 4BIUA 2EJRA 3E8HA 1NH2D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SYA A;  1R3I C;  2EIL C;  2HVJ C;  3F7V C;  4PA9 A;  3OUS A;  5E1A C;  5B1A C;  2WLH A;  3EFF K;  1G4Y B;  3LNM B;  3ABM C;  3LUT B;  4JTC B;  4G28 B;  1QLE C;  4PDM A;  4MVQ A;  3OUF A;  3RBZ A;  2Y69 C;  4QE7 A;  3ABK C;  2DYR C;  4JTA B;  5B3S C;  3ASO C;  3AG2 C;  3SPG A;  2A9H A;  2BOC C;  3AG3 C;  4RAI A;  4QNH B;  4LP8 A;  4MVS A;  1V55 C;  3IFX A;  4MTF A;  5EC1 C;  2X6B A;  2IH1 C;  1P7B A;  4PDR A;  3UKM A;  2HG5 C;  4KFM A;  4R50 A;  1S5H C;  2QKS A;  4PDV A;  2WLL B;  3TET A;  4X8A A;  2DWD C;  2HJF C;  4GX2 A;  3LDE A;  3RVY A;  1BL8 A;  4H33 A;  3FB7 C;  3VOU A;  3E89 A;  1V54 C;  3SYQ A;  5BZB A;  3OR7 C;  1LNQ A;  1K4C C;  3K03 A;  4PA7 A;  1JVM A;  2ZXW C;  2W0F C;  4PA3 A;  4G27 B;  4MW3 A;  4RO2 A;  4WFE A;  3SYO A;  3K04 A;  4X89 A;  3OR6 C;  1OCO C;  4BW5 A;  1R3J C;  2ZD9 A;  4R8C A;  3RVZ A;  4XDL A;  2H8P C;  4RUE A;  2WLL A;  4MVM A;  4J9Z B;  3E83 A;  2WLI B;  3T1C A;  4HZ3 A;  2X6A A;  4JTD B;  2WLK A;  3AG1 C;  4WFG A;  4MVU A;  1ZWI C;  4X88 A;  5EK0 A;  2Q6A A;  2KB1 A;  3K0G A;  5B1B C;  3OGC C;  2ITC C;  3GB7 C;  1FFT C;  3T4D A;  3SYC A;  1OCZ C;  3SPC A;  1XL6 A;  3K0D A;  1OCC C;  4I9W A;  2A0L A;  2EIK C;  2K1E A;  4WFH A;  4J9Y B;  4UUJ C;  1J95 A;  2Q67 A;  1K4D C;  4PA4 A;  3SJQ C;  4GX0 A;  2NLJ C;  2AHZ A;  4EKW A;  3BEH A;  4MW8 A;  4LBE C;  4R7C A;  2DWE C;  2WLI A;  3SYP A;  2EIM C;  3K08 A;  3K06 A;  2A79 B;  4MVR A;  1ORQ C;  4PA6 A;  3STZ C;  3F7Y C;  1OCR C;  4P9P A;  5KUM A;  3PJS K;  2AHY A;  1R3L C;  2WLN A;  2DYS C;  2Q68 A;  2OCC C;  3E8B A;  3LDC A;  2ATK C;  3IGA C;  4MTG A;  3UM7 A;  3ZRS A;  4MS2 A;  4CBC A;  4F4L A;  5EC2 C;  4LCU C;  2ITD C;  5CBG A;  2HVK C;  3KG2 A;  5CBH A;  3ASN C;  3RW0 A;  3STL C;  4ZBM A;  4RUF A;  4MTO A;  2QTO A;  2Q69 A;  5EBM C;  4HYO A;  5KUK A;  2YEV A;  2EIN C;  3HPL C;  4GX5 A;  4XDJ A;  3X2Q C;  2IH3 C;  3E86 A;  3ZJZ A;  3FB8 C;  5EBL C;  3SPJ A;  4P9O A;  3SPI A;  4GX1 A;  3JYC A;  4XDK A;  3TCU A;  4QE9 A;  1M56 C;  1XL4 A;  2EIJ C;  2HFE C;  3E8F A;  1KKD A;  3T2M A;  2R9R B;  3AG4 C;  4TWK A;  2JK5 C;  1R3K C;  4OXS A;  4DXW A;  5EBW C;  3T4Z A;  3F5W C;  3ABL C;  3R65 A;  2P7T C;  4PDL A;  4R6Z A;  2WLM A;  2WLJ A;  3LDD A;  3E8G A;  5J9P C;  4H37 A;  4P30 A;  3FB6 C;  3FB5 C;  3SPH A;  5CBF A;  1M57 C;  2X6C A;  2BOB C;  4MVZ A;  4WFF A;  3E8H A;  4MSW C;  4P2Z A;  3WG7 C;  5IY5 C;  4MVO A; 
#chains in the Genus database with same CATH topology
 2IW5 A;  1IBL B;  4DRJ B;  1VQO V;  1M2V B;  1NR7 A;  2KGO A;  3C3S A;  2XL4 A;  3QW1 A;  1WA8 A;  2ZR2 A;  4XEF A;  4B08 A;  4U5C E;  2IBF A;  5B3S C;  2NR5 A;  1SA0 A;  4JAV A;  2VC9 A;  3G50 A;  3LAY A;  3LSS A;  2BTO A;  4QNH B;  4BAY A;  3RF3 A;  2L6H A;  2LP4 A;  4E7Z A;  1WP8 A;  4TV8 B;  1ZLZ A;  3POV A;  1TFK B;  3J7A U;  1J8Y F;  2W9Y A;  5HFL A;  3A11 A;  3C8G D;  3FDQ A;  1R6T A;  2GA0 A;  1HNX B;  1LNQ A;  2UU9 B;  3P32 A;  1XMO B;  3K7D A;  3N24 A;  5A6A A;  1FS0 G;  3OTO O;  4LFA B;  5JJN B;  3H65 A;  3QTH A;  3BY6 A;  3S28 A;  4R8C A;  2EPN A;  4X20 A;  4DW1 A;  1EN5 A;  1NI8 A;  4J9Z B;  1ZHT A;  2EUL A;  3MHS C;  4U9E A;  2D5R B;  4LDQ A;  2WLK A;  1FKA O;  1I5N A;  2Q0O C;  2OEX A;  3MDS A;  4AL0 A;  3ETG A;  3KMI A;  4UCU A;  2QY9 A;  4FVM A;  2R7X A;  4LF8 B;  2FL4 A;  4YXW G;  2P4K A;  1YIJ V;  2DWE C;  2WLI A;  4YJ2 B;  3K08 A;  2HZ8 A;  3K06 A;  4JZ2 A;  4JCH A;  5DM6 V;  3ZMV A;  4HNA A;  5TIS Z;  2DOS A;  1DLB A;  1ORJ A;  3KL4 A;  4G78 A;  1Z5W A;  1S72 V;  1F7Y A;  3G6E V;  4UCT A;  4O2A B;  4D7S A;  1A7V A;  1NH2 B;  5HV9 A;  1DGS A;  1K73 W;  3CME V;  3STL C;  3ZQY A;  4BIO A;  4BJT A;  2ZR3 A;  1Y74 B;  4U7O A;  3OEE G;  2YEV A;  5H9C A;  5JCO C;  4IJJ A;  4NXM O;  1P84 F;  4D6T H;  1Q7Y W;  3SPI A;  3GOR A;  2AW9 A;  3HNK A;  4Q7C A;  2R7Q A;  3C3T A;  3ZG1 A;  4CX9 A;  3JAM N;  5IYZ B;  2KSF A;  3D36 A;  5CA1 A;  1CP9 A;  5JS5 A;  4NY3 A;  3ETQ A;  3C8G B;  1XMQ O;  3B09 A;  4O2B A;  2XM4 A;  4WFF A;  2WAM A;  2EIL B;  1VLS A;  2IOQ A;  4A4A A;  4OGQ B;  5FPR A;  1KC8 W;  3IQ5 A;  4HAM A;  2CH7 A;  1IBK O;  2HVJ C;  1YA7 O;  1M2O A;  1KEC A;  1K97 A;  4NXN B;  4GUN A;  4KP4 A;  4IYI A;  4PHZ A;  4K0K B;  1AIL A;  3RBZ A;  3K5N A;  4QE7 A;  2JEX A;  3NDB B;  2LFR A;  2CUG A;  3VAY A;  4DR2 O;  3AG3 C;  3SXY A;  5EC1 C;  3E22 A;  3M99 B;  1Q0G A;  4U3J B;  2OU6 A;  3SEO A;  1RKC A;  2JDI G;  3ZRW B;  1FJG O;  2R7T A;  3CEI A;  4WBN B;  4UVB A;  3VYW A;  4JYY A;  3RYC B;  1XWJ A;  3L34 A;  2Y3G A;  4N6C A;  2R9I A;  4TUY A;  1B68 A;  3GM2 A;  2Q7G A;  3JD0 A;  5JQG B;  1YJW V;  3JAL A;  1YAU O;  1H2M A;  1ORS C;  4JI2 O;  1TUE B;  2NSF A;  4LFC O;  3BFR A;  4MW3 A;  4YT4 A;  1L1F A;  3L70 H;  2EPM X;  5IWA O;  1XHX A;  1TVK A;  1GM7 A;  4XDL A;  2YL3 A;  3E83 A;  1E86 A;  1DF4 A;  2R9A A;  1Q90 D;  2LJ2 A;  4LFB B;  1D1C A;  1ARO P;  2LQT A;  3EFO A;  3RFY A;  5LGT A;  4RWU A;  1APC A;  1I7F A;  2BCC H;  3DZA A;  3K0G A;  3GWN A;  5J2U B;  4O79 A;  3OGC C;  4WJ0 A;  1K40 A;  4I9W A;  4NTY A;  2EIK C;  1TR2 A;  2IYL D;  2KK1 A;  4XPY A;  2OKU A;  3FAV A;  3N0T A;  4ULW A;  2YZS A;  1RM1 C;  2XT9 A;  2AHZ A;  4BG0 A;  2OG2 A;  2B5U A;  1G1X B;  4MVR A;  1WAZ A;  3B40 A;  1VF7 A;  2BSK A;  4I9Q A;  4DVZ A;  2J8W A;  3G6B A;  1AJP A;  1Z2G A;  3MX3 A;  3JAK B;  3KG2 A;  1Z5V A;  2UUA O;  2UUC B;  4NTF A;  1K3E A;  3K66 A;  1BR4 A;  3CRR A;  4HYO A;  3DTU B;  4XDJ A;  2PGG A;  3OEO A;  3J81 N;  5IJ9 A;  2QSA A;  1D1A A;  3L75 H;  4P6I C;  2XAG A;  3T6B A;  4J80 A;  3G4Z A;  2GUZ B;  5AGF A;  1SF9 A;  1NS1 A;  1JA8 A;  2JK5 C;  1OXK A;  2HS5 A;  4DXW A;  4TT3 G;  4LLC A;  4X62 B;  4K8Z A;  2FFH A;  2R7S A;  5KA5 A;  4MTX A;  4JRZ A;  1RSO A;  4O4J A;  4OPH A;  4UXN A;  3WG7 B;  1BBH A;  1JOG A;  2E87 A;  2YDE A;  4X9Q A;  2QM7 A;  2BOB C;  4UCS A;  2PBE A;  5KHJ A;  3CC2 V;  2LIG A;  2QDO A;  1AUE A;  1SQG A;  2W6J G;  1WN0 A;  3HNI A;  1Y67 A;  2V1D A;  3E9V A;  2ZE5 A;  2M6Y A;  4QJF B;  1VMA A;  4J7Z A;  4NCQ A;  1Q5O A;  4FAP B;  3OD4 A;  3JCZ A;  4I5S A;  3BRC A;  4EFB A;  4C7O B;  1YZA A;  2ZCE A;  3HKB A;  4K8X A;  2PI4 A;  4UVA A;  4LP8 A;  1P7B A;  1YCI A;  4KFM A;  2OOC A;  1Q43 A;  4DRX A;  3AJM A;  2WLL B;  3WB1 A;  1TKN A;  2V3C C;  1G8M A;  5JWP A;  1V4A A;  3QTC A;  5BQH A;  4JZG A;  3DJU B;  4UDV A;  2KYH A;  3ZHS A;  4PA7 A;  1TWG A;  2Z15 A;  1K92 A;  5IYC O;  2QA4 V;  4AE4 B;  4FZ1 A;  2Y69 B;  1EN6 A;  4JI6 B;  1T01 A;  1PP9 H;  2C2A A;  4BW5 A;  2A3Q A;  1FXK C;  4CZZ A;  2RDC A;  4E2L A;  2JGD B;  4ZIB A;  4LF7 O;  1Y6X A;  2B0J A;  2XLM A;  4QDL A;  1SRY A;  4MVM A;  1SQQ H;  3CCQ V;  3L8J A;  4LDR A;  3RKO F;  1AP5 A;  3BA8 A;  1BR2 A;  4YHH O;  1IBL O;  1T5E A;  2OT5 A;  2LFF A;  2Y3H A;  3JRT A;  1BMF G;  4DBR A;  4CS7 A;  2R70 A;  1OCZ B;  3EHN A;  4X1K B;  1KB9 F;  2XAH A;  4IHJ B;  1JPX A;  2E74 B;  2AWC A;  2GV9 A;  3M7M X;  1S7Z A;  2XLV A;  2A0U A;  4O4L A;  1L3P A;  4CS8 A;  2L9J A;  2EIM C;  1AR1 B;  4X66 B;  1YDX A;  2A79 B;  1ROP A;  5F5F A;  2J0W A;  2RMK B;  5EIB D;  4PEL A;  4AI8 A;  3CP1 A;  4BEJ A;  1QZX A;  2AHY A;  3LDC A;  3UM7 A;  3U9M A;  4BJ5 A;  3CCL V;  4GKJ B;  4JEA A;  1HNX O;  5KYX B;  2UU9 O;  4JI8 B;  3HKK A;  1XMO O;  1K34 A;  4I0X A;  1GH6 A;  1L8D A;  4LFA O;  4WFA V;  1VYK A;  1BQ0 A;  4I4T A;  4GX5 A;  2EIN C;  4DRH B;  3ZJZ A;  3ZDL A;  4LLE A;  1V9P A;  2DW4 A;  3TXS A;  3OMA B;  2YVK A;  2XL8 A;  2R9R B;  4KHP B;  3S90 A;  5LMN O;  4QI0 A;  1SZI A;  3AGU A;  1WA8 B;  3QZC A;  1I94 B;  4LF8 O;  3KKB A;  3E8G A;  3SXZ A;  1SA0 B;  3L72 H;  4KNV A;  5JUA A;  3R7C A;  3AG7 A;  3TUL A;  3X2Q B;  3FAP B;  5C8Y A;  3JAS A;  4NKG B;  4DR3 B;  3OUS A;  3WAQ A;  1M56 B;  3C62 A;  4OX9 B;  5COM A;  2Y3B A;  2E5L B;  1R5I D;  2XLD A;  5KHH A;  1F4N A;  2VAS A;  4JJG A;  4CDV A;  3E35 A;  3IFX A;  5JRA A;  2RN9 A;  1QQC A;  2WZL A;  4X20 B;  3TOM A;  2EX3 A;  2QE7 G;  2E3C A;  2QWP B;  4F6R A;  2OQM A;  3U10 A;  5ITZ A;  1QHT A;  5IY5 B;  4U5H A;  2ZQM A;  3NMI A;  5DQZ A;  2WL8 A;  1Y6D A;  1MMG A;  3RH3 A;  1GTO A;  3L8I A;  3ATP A;  4B7E A;  1HDJ A;  2ZIN A;  2VCC A;  2HJ3 A;  4IAQ A;  3ASO B;  4MND A;  3ZSU A;  3P3P A;  4Z2W A;  1L0L H;  4KNW A;  1BGY H;  1G4W R;  2DN9 A;  2CTR A;  4TQF A;  2WLI B;  4GKK O;  4I1M A;  5LYJ A;  5JJE B;  4HNA B;  2Q5Z A;  2PZS A;  3DSQ A;  3T4D A;  3CE2 A;  1NU7 D;  2DQ3 A;  5JJJ B;  4DV2 B;  1OHH G;  5FNV A;  2IJI A;  3JZ0 A;  2LFS A;  2CTP A;  2JS3 A;  4C3D A;  2JJ2 G;  3B0V C;  3QNE A;  1E2X A;  2YEV B;  1RMV A;  2P6V A;  2GAQ A;  3F7Y C;  1N33 O;  1ORY A;  2GWW A;  4DO2 A;  4TV9 A;  3H9V A;  4DV7 B;  4MTG A;  4HE8 D;  3IGA C;  256B A;  3FVY A;  4LCU C;  2ITD C;  3LLI A;  2VQF O;  3J80 N;  1EKY A;  1YVI A;  5B1B B;  2QWQ B;  2P06 A;  3SJC C;  1US6 A;  5H5N A;  3W4Y A;  5CA1 B;  3CRM A;  1R6N A;  2TMV P;  4O2B B;  5EBL C;  1Y4C A;  3UMK A;  1NTM H;  5JH7 A;  4LFB O;  4B3T B;  4O6N A;  2BTQ A;  4JV5 B;  1MZE A;  1TWC A;  2FYU H;  4FLX A;  5EZY A;  4Q20 A;  3V5Y A;  1H2G A;  1SF8 A;  1W0J G;  4YL3 A;  5F5H A;  4BPM A;  2J9U A;  3E22 B;  2ZXP A;  4J42 A;  2AZ0 A;  5CI8 A;  3Q4H A;  2UXN A;  2IJJ A;  5L3V A;  1K33 A;  4TUY B;  1YZB A;  4XWJ A;  3AG2 B;  3JAL B;  2UUC O;  4B7K A;  1OKK A;  3D3Q A;  1VLT A;  4U5G A;  5KLV H;  4MTF A;  2J9B A;  1NFN A;  3GWK C;  2BE3 A;  3EHB B;  1QKR A;  5H6Q A;  4KC9 A;  1TVK B;  1M9N A;  2QKS A;  2A69 F;  3CQZ A;  4CSA A;  1QU7 A;  5A9G A;  4D4X A;  4CS9 C;  2H94 A;  2HJM A;  5F2V O;  1EI7 A;  1RXQ A;  3OM3 B;  3EFO B;  3VQV A;  1K7D A;  4X62 O;  4B6I A;  2C03 A;  2AXT Z;  2MW2 B;  1OCO C;  2DYR B;  1ZYR F;  1BE3 H;  3FAV B;  2HSQ A;  3DC6 A;  4OPA A;  5B66 Z;  2H8P C;  3DM9 B;  2ZDI A;  1WAS A;  1WGW A;  2UXD O;  3EVK A;  3K5L A;  2ZE7 A;  5D91 A;  2X6A A;  1XRE A;  1NU1 H;  2BSK B;  3RT3 C;  3I5Q A;  3HKE A;  2V4D A;  3TJT A;  4NR1 A;  2ODM A;  2KC3 A;  4RQE A;  2XHB A;  4DUY B;  1N0N A;  2DQ0 A;  3ML0 A;  4UV8 A;  3I56 V;  2QKA A;  3SYP A;  3LSQ A;  5DS4 A;  1Q6H A;  2DYS B;  3FD9 A;  4H44 B;  3EG9 A;  2QJ1 A;  4LF6 O;  5IJ0 A;  4U5D E;  5IJ9 B;  1U89 A;  4E17 A;  1D0Z A;  2F4V B;  5EC2 C;  3HR0 A;  1A7E A;  3RN4 A;  2OIE A;  2IU0 A;  3TXQ A;  4PJ0 Z;  3NMK A;  4FLZ A;  4RUF A;  2I8B A;  1I4Y A;  3HKD A;  3QMK A;  1RSO B;  2VWK A;  2YIB A;  4O4J B;  2MK3 A;  5EBM C;  1FFT C;  1KNY A;  3K1I C;  5DS5 A;  2Y0I A;  3JYC A;  2H8A A;  3DE9 A;  1HW1 A;  5L0I A;  4DR4 B;  4PFO A;  4JCZ A;  4PV1 B;  3PN1 A;  3L9D A;  2V7Q G;  2OCC B;  3VQW A;  5J2T A;  1NKD A;  2LSE A;  1PV3 A;  1YJN V;  3DMD A;  3F5W C;  1Z3I X;  1GM5 A;  2P7T C;  3EH1 A;  2WLM A;  4IHJ A;  1QVX A;  3B71 A;  3HKB B;  5KYU A;  1YSC A;  4MVZ A;  4X66 O;  3UMI A;  3U8V A;  3DM5 A;  4JPR A;  4CJO A;  1N32 B;  2VQE B;  3K58 A;  4DRX B;  1JMW A;  4FLW A;  3LES A;  5E1A C;  1QLE B;  4LF5 B;  4GKJ O;  1G4Y B;  3LNM B;  4JI8 O;  1FMW A;  4JTC B;  1YEW A;  3ZWI A;  2Y69 C;  4B3M O;  3GM1 A;  2JRI A;  1URF A;  1Q86 W;  4ULV A;  2XLO A;  4XEV A;  1QSP A;  1H8H G;  4JAU A;  1W0K G;  3WHN A;  3MAQ A;  3N2K A;  4NTX A;  4CH6 A;  1M93 A;  5B1A B;  2ZM6 B;  3ZHQ A;  1I4Z A;  2FTK A;  3RGB A;  3C18 A;  1I94 O;  1K5S A;  4G27 B;  4LH6 A;  5KX5 A;  4D7T A;  3IQT A;  1TGO A;  2R7U A;  1R3J C;  5EYP A;  1FMV A;  3OT7 A;  2PX0 A;  3AK3 A;  4O4L B;  1RPR A;  3CWB H;  4DR3 O;  1VP7 A;  5D5P A;  5K0I A;  4JKV A;  5A6B A;  1NG1 A;  2Q6A A;  1I5Y A;  3HTK C;  4ER9 A;  2E5L O;  1R1B A;  2IJK A;  3PHF 2;  5FCL A;  2QWR B;  2YUA A;  1COW G;  2ASR A;  1C03 A;  3UO2 A;  4I0X B;  5JVE A;  3RFR A;  3BEH A;  2FGY A;  3S3W A;  2P0N A;  1N34 B;  1VQN V;  2Q4F A;  4I4T B;  5CMU A;  4J7Y A;  2JIZ G;  2Y4U A;  5JSL A;  4P9P A;  1ZL8 A;  2PP4 A;  3B77 A;  1EN4 A;  3O9O A;  4DUZ B;  2ZKO A;  1ZZP A;  5T3W A;  5L3Q A;  3AG1 B;  4FPP A;  1AJN A;  3GOD A;  4C3E A;  2HVK C;  1GGQ A;  2R03 A;  3W8I A;  1WNS A;  4FIP C;  3ZRV A;  2LP7 A;  4CS2 A;  1OCC B;  1E1Q G;  2G38 A;  1SZX A;  2GTA A;  5KUK A;  3X2Q C;  1IXM A;  3HPL C;  4JW1 A;  1XNR B;  3KYI A;  1FR0 A;  3CHX A;  3JAW A;  4FM1 A;  4EFE A;  3AG4 B;  1S05 A;  5C8Y B;  1M56 C;  1IZM A;  1ST6 A;  3JAS B;  1G8X A;  1F51 A;  4TWK A;  1BSM A;  2RD9 A;  2BE5 F;  4EB6 A;  4DV2 O;  2JS5 A;  2PYJ A;  5JCO A;  1QR8 A;  2WLJ A;  4FK5 C;  4PK4 A;  5CBF A;  5EHH A;  3LNN A;  1DK1 A;  4P2Z A;  1NQT A;  3CXH F;  5IY5 C;  3G71 V;  1LS4 A;  1GM9 A;  1R3I C;  4PJN A;  4F6R B;  4DV7 O;  4FFB A;  5ITZ B;  1M4U A;  3G4S V;  1D2D A;  3K59 A;  1J8M F;  5EIB C;  1FYJ A;  3O65 A;  4IRU A;  2UXC B;  5KYY B;  3ASO C;  2JX0 A;  2XSE A;  2BOC C;  1QBZ A;  1R73 A;  1CPY A;  4MVS A;  5A6J A;  1A32 A;  1EBO A;  1VIB A;  2X6B A;  4Q6G A;  2LFD A;  2XLH A;  3JT1 A;  3QG5 A;  1SYQ A;  1GK9 A;  3RQG A;  3U3B A;  4AHC A;  4Z9H A;  4XTK A;  4X8A A;  2DWD C;  1OJH A;  4JV5 O;  1OKK D;  3VOU A;  1MMM A;  5LYJ B;  1AI4 A;  3ABM B;  1EA8 A;  3DWW A;  4JVS A;  4J7J A;  4DR5 O;  1EFR G;  1WN7 A;  2CGN A;  4AL1 A;  1WAT A;  5FNV B;  4J11 A;  1Q3E A;  2KKW A;  2W45 A;  1Q82 W;  1IW7 F;  2PX3 A;  4CDA A;  3B8M A;  3BPZ A;  4KUM A;  1Z5Z A;  1DF5 A;  2CYD A;  1SET A;  1B06 A;  5FL7 G;  1AEP A;  5BMV A;  3GEH A;  5AG2 A;  3OW2 U;  3QW0 A;  3PDM P;  2R7V A;  4J41 A;  2QTS A;  1FFX A;  3JD2 A;  1NSG B;  2W0X A;  4TV9 B;  2AU5 A;  1MNE A;  4JAA A;  5B1B C;  2YL0 A;  3N27 A;  3D36 C;  2IM8 A;  3K0D A;  3EGD A;  2A0L A;  1D0Y A;  1GAX A;  2ZXW B;  4MQ9 F;  2M4E A;  1K4D C;  2Z0A A;  2EZO A;  4GX0 A;  4X64 B;  1VAR A;  4LBE C;  2HSB A;  2MHR A;  1OCR B;  1JOY A;  1KD1 W;  4Z1M G;  3M4B A;  4PA6 A;  5LXT A;  1YYJ A;  5FLX N;  4FLT A;  2YS8 A;  5JH7 B;  3E8B A;  4CBC A;  3FX7 A;  3U9J A;  2BTQ B;  3W2V A;  5KHI A;  1JPN A;  4JYA B;  4YJ3 A;  5EZY B;  2HKV A;  3IPM O;  4BEM J;  1K8A W;  2Y4T A;  4O4H A;  4PAC A;  5FPO A;  4ZBM A;  4FM2 A;  5A6K A;  3O6X A;  3MBG A;  2YRF A;  1PD0 A;  1IDS A;  3DXJ F;  3ZX6 A;  3JYY A;  4GX1 A;  2HKO A;  3SXK A;  1UPG A;  1IBM B;  1MG1 A;  4E18 A;  3CCS V;  3Q4H B;  1KKD A;  4QI2 A;  1EQ1 A;  4EUK B;  2DJV A;  2YI9 A;  4OXS A;  1D5N A;  1LE4 A;  2PNO A;  2YIB D;  2B9Z A;  3JSN A;  4DUY O;  4GLX A;  2A0B A;  4PDL A;  2YWA A;  4OIN F;  1WB7 A;  4I55 A;  1XQ8 A;  2DGJ A;  3ZTM A;  3U11 A;  1VQ7 V;  3JCU Z;  3TK0 A;  4O7G A;  1A41 A;  2WLH A;  2F4V O;  2EIJ B;  3LUT B;  1LE2 A;  1LUW A;  3CCE V;  3TK1 A;  1YF2 A;  2DYR C;  5CN0 A;  4JI4 B;  2VCA A;  3H1J H;  1SKV A;  2XAQ A;  3DKA A;  4PFP A;  3DJN B;  3MYI A;  1YIT V;  1IXB A;  1L0N H;  3CAX A;  3U2L A;  2D3O W;  1H38 A;  4B3R O;  1T9K A;  2WPD G;  2GDS A;  2D4U A;  3RVY A;  1RFY A;  5LP6 A;  4CC5 A;  2Q3T A;  2BL2 A;  5BZB A;  3RYH A;  1BCC H;  5L0G A;  1TFO B;  1XZP A;  2IJH A;  3HKE B;  3EXA A;  3IEE A;  1FNT c;  3OR6 C;  4OD4 A;  3CMA V;  4XEK A;  1QNM A;  2XAJ A;  1D5A A;  2P6J A;  1E83 A;  4CIH A;  5B5E Z;  1N32 O;  2VQE O;  3CRC A;  1RP3 B;  2HHH O;  1NT2 B;  3ICX A;  4ICG A;  4J32 B;  4U5B E;  2XND G;  4YT2 A;  4JTD B;  4LF5 O;  3EG9 B;  2F23 A;  5DVW A;  5IJ0 B;  1NBB A;  2YI8 A;  1T5O A;  2LW1 A;  1MAB G;  3LS1 A;  4DW0 A;  2QNL A;  2QM8 A;  3RQE A;  5B1O A;  1YA9 A;  3CCR V;  1AI6 A;  4FLV A;  2L7A A;  4OIR F;  2QWO B;  2NLJ C;  3T4R A;  1XIL A;  4R7C A;  2IM9 A;  1HW2 A;  4YN0 B;  3HKD B;  5A6B D;  3ZVR A;  3GAN A;  4IWB A;  1VOM A;  4BWA A;  3ZMS A;  2HMZ A;  2YXY A;  4DV6 B;  2OCC C;  3ZN0 A;  1QR9 A;  2X0L A;  2ZM6 O;  3B0U X;  1U97 A;  3VQY A;  3FMS A;  1JPJ A;  3VBB A;  3G4X A;  4W8K A;  2YXH A;  2Q8V A;  5J2T B;  1W2W A;  5GON A;  2JPU A;  4I50 A;  3ZQV A;  3K1H A;  1L7C A;  5KYU B;  3LS0 A;  1G4U S;  1GN6 A;  3X1O A;  4PI2 A;  2L6L A;  2YIA A;  3FOO A;  3H1L H;  4DYL A;  3CCV V;  3T2M A;  2QGN A;  3N2Z B;  4FLU A;  3ZHV A;  3QVN A;  2JGU A;  5COG A;  1YZC A;  2HR3 A;  1BR1 A;  1PNM A;  2QUP A;  4GYC B;  1GO3 F;  3MLG A;  3UMH A;  1AR4 A;  4PI0 A;  3FB5 C;  3ZS8 C;  1M57 C;  1N34 O;  2MWQ A;  3SP1 A;  4GQH A;  1XUQ A;  3T6G B;  4UCV A;  3SJB C;  1I5X A;  1WLE A;  3SYA A;  1HY5 A;  1BQZ A;  5KHG A;  4JI0 B;  4PA9 A;  1UFB A;  3DAG A;  4ZLC A;  4DUZ O;  5B1A C;  1BT8 A;  4XQ1 A;  3N2K B;  1WOL A;  3W7S A;  3OEH G;  4MVQ A;  2F66 C;  3EH2 A;  2WVN A;  4JTA B;  3SPG A;  1H8E G;  3NR7 A;  4X1I A;  5KX5 B;  1S0V A;  2KNH A;  5LOV A;  3ECS A;  3C63 A;  3T9O A;  5EYP B;  3K79 A;  1SS3 A;  4CS8 C;  2F43 G;  2HG5 C;  1JMK C;  1XNR O;  4R32 A;  2J9V A;  1NR1 A;  3P30 A;  2Y0P A;  1CEZ A;  2XM0 A;  3CCJ V;  3CRQ A;  2HJF C;  3O10 A;  4BJ5 C;  3FAJ A;  4IIJ A;  3SYQ A;  1S5L Z;  2HEP A;  5LA6 A;  3S29 A;  1JVM A;  4IT5 A;  4DR7 B;  2EJ7 A;  4BJ6 A;  3BA9 A;  1Q0F A;  2XOK G;  3NRH A;  1PPJ H;  4XLN F;  2Y48 A;  5BQI A;  4DV3 B;  1UFI A;  1Q0D A;  4CH4 A;  3EPV A;  4U3F H;  4LR3 A;  4JIO A;  2VS0 A;  1F1M A;  3NKE A;  3SDL A;  4M63 A;  4NVP A;  3AG1 C;  3C7J A;  3KH2 A;  1ZL8 B;  4G2K A;  2CCY A;  5CIV A;  1XI1 A;  4FMT A;  2UXC O;  2YHS A;  1OCC C;  2Q67 A;  1H7I A;  2KG7 A;  1TUB A;  2Q9C A;  4JI5 B;  4N21 A;  4Z1V A;  5KYY A;  1MMN A;  2R02 A;  3FHD A;  1FD9 A;  5LGU A;  1DOV A;  1R4T A;  1HR0 B;  5LMU B;  3JAW B;  4IGG A;  1H6G A;  4JE9 A;  3K33 A;  1GN3 A;  4LC1 A;  4W4L A;  4FM0 A;  4MT8 A;  4NXN O;  2CGO A;  3W7U A;  1A7D A;  4EB6 B;  2DB4 A;  4O4I A;  4K0K O;  2NUT A;  1UJW B;  2Q4P A;  3WOD F;  1PL4 A;  4PD4 F;  4L8J A;  3H1I H;  2F22 A;  1VF6 A;  5K1X A;  2VWJ A;  3KZI Z;  3SPJ A;  5BR8 B;  3MYF A;  2ZPA A;  1HE9 A;  3W7W A;  4JZA A;  2WVO A;  1YDI A;  3D8C A;  1LKX A;  1VK5 A;  3H2U A;  4FFB B;  3JD3 A;  3N2G A;  2PFD A;  3HKC A;  2DI3 A;  4QIW F;  1M5I A;  2YSU B;  3TD7 A;  1JRA A;  3UQ8 A;  5J9P C;  4X64 O;  4JF3 A;  5CA0 A;  4OD5 A;  1SR2 A;  3TET A;  2DE0 X;  2GFH A;  2EIL C;  3NKD A;  1YHQ V;  2OIG A;  3ABM C;  1J5E B;  4BR6 A;  2C04 A;  4Q4Z F;  2HV7 A;  2WWW A;  3OUF A;  1H2S B;  3DAF A;  1S5J A;  2XUM A;  1N36 B;  1ZX3 A;  4XLP F;  2P7V A;  2W6I G;  3UT5 A;  3IJ4 A;  1QVF U;  5A2Q N;  5KA6 A;  5JP7 A;  4TOI A;  1MSW D;  1S5H C;  5JT4 A;  4DK0 A;  1G6U A;  3CYO A;  1OR3 A;  3QVY A;  1IBM O;  5L0C A;  5IE9 A;  3IC7 A;  1HE1 A;  4GX2 A;  4K35 A;  2P61 A;  1BL8 A;  5BMV B;  3FB7 C;  5E3C A;  3RYL A;  3ABT A;  3MFN A;  4FES A;  1Z7Q c;  1FFX B;  3KCX A;  4ONS A;  1K4C C;  3SZR A;  2ZXW C;  4AQY B;  4IYH A;  1H9T A;  4FWV A;  3ABK B;  3EGD B;  4P9F A;  3M8A A;  4YT8 A;  1GN4 A;  4UB8 Z;  2P5O A;  3M4C A;  5BUO A;  3T1C A;  4EEQ A;  2ETS A;  4CIP A;  1SQF A;  2NSG A;  5IDJ A;  5LXT B;  1N1C A;  3KYJ A;  3UR3 C;  4L87 A;  1XHZ A;  5IT9 N;  3L74 H;  2H7O A;  2QEX V;  2CTW A;  1OV9 A;  2RCV A;  3LLK A;  3SPC A;  4JI4 O;  2Z3Y A;  1DOW A;  3HJC A;  3OFN G;  1RM1 B;  3DD7 A;  4YJ3 B;  1FJG B;  4O4H B;  2HJD A;  1KP3 A;  2YXL A;  4IAO A;  5CB4 A;  1KKC A;  1RJ9 A;  4QPJ A;  1LM3 B;  4O6Y A;  2RQ6 A;  1BS3 A;  1ORQ C;  3NMJ A;  2ZXR A;  4WGZ A;  2Q7R A;  1PV0 A;  2Q68 A;  4JEB A;  4EWC A;  3Q6N A;  2YLI A;  1M1K W;  1Q6U A;  2VB6 A;  3GWL A;  1VF5 B;  5DS6 A;  4NYK A;  4G7O F;  2B1I A;  3J06 A;  4XBF A;  2QTO A;  3WB0 A;  3O55 A;  4DOZ A;  4I55 B;  1AI5 A;  3CEX A;  5K1P A;  4G7H F;  4QE9 A;  3BAA A;  3DXR A;  1R6K A;  2CNW A;  2EIJ C;  4ZHQ A;  4LF4 B;  4LWS A;  2PI5 A;  3B9Q A;  3EGX A;  3BCC H;  3JTL O;  4ZKI A;  2D2C B;  2ZXO A;  5DQT A;  4UB6 Z;  3T4Z A;  2YL1 A;  2RJZ A;  2Q9B A;  3LSU A;  1U6H A;  1ZW2 A;  4P30 A;  1N8R W;  3L1M A;  2AWY A;  2ZDI C;  3RYF A;  3WG7 C;  4JI6 O;  2Q7H A;  4K3A A;  1QPU A;  5B1N A;  3C8Z A;  2Z5U A;  3EHM A;  3K5M A;  4DV6 O;  4FX5 A;  3VRC A;  4X65 B;  1SQP H;  2ZE8 A;  2UUA B;  1NU9 C;  3LJB A;  5LP6 B;  3ZIA G;  4PDM A;  3ZTZ A;  3RYH B;  4JC7 A;  1CXZ B;  3EJN A;  4PJL A;  1S3J A;  3ABU A;  4DR6 B;  2A9H A;  1WPX A;  1BZ4 A;  3IAY A;  1YTF D;  3FYI B;  3S3X A;  3APQ A;  1VQP V;  1GM8 A;  1PCX A;  2EPO A;  4AK9 A;  2WZG A;  2YKZ A;  4XPX A;  2RNB A;  3A0B Z;  1FAP B;  3NG1 A;  2P22 C;  2GTS A;  3F47 A;  4X0R A;  4H33 A;  1MMA A;  1PNK A;  3OR7 C;  3CJH A;  3E70 C;  4RO2 A;  1AB3 A;  4WFE A;  5DEC A;  3CPW U;  3K6B A;  4DVY P;  2L35 A;  1QQ3 A;  4KBL A;  4EHP A;  4DV4 B;  1JQ0 A;  3B8N A;  2E76 B;  4LF9 B;  3LEO A;  1VB5 A;  1Y76 A;  3CSK A;  5BXZ A;  4JI0 O;  4BW9 A;  4B3S B;  3VQX A;  3F46 A;  4HEA J;  5KYW A;  2KQ9 A;  2ICW G;  2QR4 A;  4UFZ A;  2N04 A;  1K5Q A;  1OCZ C;  4KHP O;  4YWQ A;  4ZOL A;  4IB4 A;  4J7K A;  5GON B;  1FXH A;  2QKC A;  1LVK A;  4I50 B;  3K5O A;  1WB8 A;  4MW8 A;  1ZHW A;  4DV5 B;  1GRJ A;  1K9M W;  2XL6 A;  2XS1 A;  4YY3 B;  1ZVZ A;  5H6R A;  1C02 A;  2PF4 E;  3PJS K;  2ZNJ A;  2IBZ H;  1R3L C;  4WF9 V;  3ZMZ A;  2NUP A;  1ZW3 A;  1YLM A;  1ENV A;  3UGP A;  1XDC A;  2B1G A;  3A0R A;  1MNG A;  4OX9 O;  4DR7 O;  1NLX A;  3V5Z A;  2A6H F;  2EIN B;  1FPO A;  3FOP A;  3S27 A;  4YHH B;  2A68 F;  2NNU A;  4DV3 O;  3MD0 A;  3R66 A;  1O9H A;  2IH3 C;  2UUB B;  1AP6 A;  1YAR O;  2P4V A;  2PTM A;  3KPH A;  4JI7 B;  2GDC A;  2J0X A;  2R25 A;  2XXA A;  1OQC A;  3A9C A;  4DK1 A;  1SQX H;  3SJA C;  3P3N A;  3AQC A;  1YTF B;  1AR5 A;  1ZU5 A;  2PYL A;  3FKS G;  2P90 A;  1NZE A;  3OMI B;  3B4S A;  4OIQ F;  3JD4 A;  3W2W A;  3L73 H;  1GKF A;  4QPK A;  2ETN A;  4C7U A;  3R65 A;  2H3O A;  4LER A;  2IXO A;  4X1Y A;  5T1D B;  4JI5 O;  4OIO F;  3ASN B;  4H37 A;  1LI7 A;  1SER A;  4F6E A;  4X1I B;  3CCU V;  5EGY A;  5LOV B;  1IUR A;  1HR0 O;  5LMU O;  1NVP D;  1B04 A;  3ZED A;  2F1M A;  3AQB A;  4D4N A;  4H0L B;  4JYC A;  5JLI A;  1JJO A;  4ZI7 A;  3EFF K;  2L6F A;  3B0P A;  3EZH A;  1AVM A;  4FLY A;  3CD6 V;  4IIJ B;  2CK3 G;  1HNZ B;  3D3I A;  1GMG A;  5LA6 B;  5AC5 A;  1VQ5 V;  1ZHX A;  3C90 A;  3H1K H;  3U0C A;  2WA4 A;  4YK5 A;  5JVD A;  4JI3 B;  5AC4 A;  5BR8 O;  3G67 A;  1UG7 A;  1CPR A;  3ZHT A;  3ZRX A;  5LMN B;  2KQX A;  3RWR D;  2YLG A;  3PMR A;  1E84 A;  3UCS C;  3FFQ A;  4BIZ A;  1QLN A;  1KU2 A;  4CS3 A;  1JFF A;  1SES A;  1Q6I A;  1OW7 A;  1V74 B;  4NTW A;  3SR2 C;  4HBN A;  2J9W A;  2EPL X;  2ZIO A;  1PD3 A;  2UXX A;  4DV0 B;  5BY1 A;  2KG7 B;  3L71 H;  1TUB B;  4LAC B;  3OA1 A;  1LI5 A;  2X0C A;  2XRH A;  3CCM V;  2LK4 A;  1LPE A;  2A06 H;  3QO8 A;  1J5E O;  2YLD A;  2JD3 A;  4B3T O;  1NZ6 A;  3QF7 A;  4JYB A;  4DR1 B;  4U5E E;  4KL1 A;  3SYC A;  1N36 O;  1ZU4 A;  2XTA A;  1XL6 A;  3T1H B;  2R7W A;  2UUI A;  1HMO A;  4O4I B;  2NUT B;  2FAP B;  3AGT A;  4CH3 A;  1JX9 A;  2IU3 A;  3OGI B;  2NG1 A;  3O39 A;  4G0H A;  4YL0 A;  4W8P A;  1PNL A;  3CC4 V;  1U96 A;  3JRM O;  3JSZ A;  1CGN A;  4ANJ A;  1KMI Z;  1E85 A;  1SZT A;  1MQV A;  2YC0 A;  3ZRS A;  2Q9L A;  2EZP A;  3JAR A;  5E2Q A;  1KQS U;  4AQY O;  3N2G B;  4YIO A;  5CBG A;  3HKC B;  1NVP B;  4GCZ A;  4TQD A;  1PL0 A;  1TAE A;  4U7N A;  3SYN A;  3THO A;  5B3I A;  3Q7L A;  3RYI A;  2J7P A;  3EZI A;  1LIH A;  4GKK B;  1CPQ A;  5CA0 B;  3E86 A;  2YID A;  1PD1 A;  4TSF G;  2CDY A;  3APO A;  1MZF A;  4JAS A;  4EBB A;  1OZ0 A;  2GHY A;  2OEV A;  2YL7 A;  2L6G A;  2Q73 A;  4XPW A;  3IC9 A;  3ZHR A;  3IQ6 A;  5KAF Z;  4LNU A;  4I1O B;  1MOF A;  5IYB O;  3T1Y B;  2LQG A;  3LDD A;  3AEI A;  4JI1 B;  3WFV A;  3SPH A;  3UT5 B;  1N33 B;  3JAT A;  4E4E A;  2CNW D;  4MSW C;  5KYN A;  2UXB B;  1D1B A;  4MVO A;  2X51 A;  3U2M A;  4DV1 B;  4YIP A;  4AX2 A;  2VQF B;  3JYH A;  4P9T A;  3JSL A;  3BRJ A;  1Q0M A;  4WFB V;  3BHP A;  1GQA A;  3ABK C;  4UV9 A;  1SQV H;  3AG2 C;  1JR8 A;  1S76 D;  2F93 B;  4K1O A;  5D5Q A;  1VQ9 V;  4GT1 A;  4PDR A;  1HMD A;  3A2F A;  1LUV A;  4R50 A;  4PDV A;  1IX9 A;  2WA3 A;  3T6J A;  3ZMU A;  4N06 A;  4CDY A;  3K57 A;  3CB2 A;  1TA8 A;  1HNW B;  4LF4 O;  2ZNI A;  2P1A A;  4N4W A;  2XLW A;  3E89 A;  3IQC A;  2OJQ A;  3I4U A;  1KYO F;  1OCO B;  2JEU A;  1FXV A;  1QCE A;  4CS4 A;  1VQ6 V;  3ZC4 A;  4ZLD A;  2ZD9 A;  4Z9I A;  3RVZ A;  5E79 Z;  4RUE A;  1V55 B;  1RKE A;  2R72 A;  1SQB H;  3B2E E;  5CB4 B;  1RJ9 B;  1WWP A;  2OJE D;  1ZSP A;  1K04 A;  2AP3 A;  4CC6 A;  3OMN B;  1VQM V;  4X65 O;  1C17 M;  4MVU A;  5KMG A;  1ZWI C;  2K9P A;  4DR4 O;  1V54 B;  4Z9J A;  1KU9 A;  5F28 E;  2K1E A;  3W7X A;  4DR6 O;  3ZIB A;  5LHH A;  4PA4 A;  3DE8 A;  1WP7 A;  2N05 A;  4I3M A;  2LD6 A;  4YJW A;  4W4K A;  1ZAU A;  4ASU G;  1VYI A;  1NBM G;  2ADQ B;  1HP8 A;  4GYT A;  3HNL A;  3STZ C;  5FZT A;  3ZCC A;  3UGO A;  2VRZ A;  3VM6 A;  2DYS C;  3DXR B;  2ATK C;  2HLD G;  2W4B A;  4ZHQ B;  4NC3 A;  4LWS B;  5L3C A;  5LHI A;  2AVK A;  1VQL V;  3EGX B;  1U0B B;  1X59 A;  3S84 A;  4WCE V;  1HWY A;  1T6Q A;  1THZ A;  3DGE A;  4DV4 O;  4GEH A;  1FFT B;  3RW0 A;  1FXK A;  4MTO A;  1XNQ B;  2UXD B;  4LF9 O;  5L0D A;  2WVQ A;  1X4T A;  3FB8 C;  1EM1 A;  2NN4 A;  3RYF B;  4B3S O;  2Q00 A;  2BC5 A;  2AGA A;  3BAB A;  2HFE C;  3E8F A;  5LP6 C;  1I0H A;  5EBW C;  2QM4 A;  5KAI Z;  4RQF A;  5E33 A;  4OIP F;  1AJQ A;  4PR9 A;  4DV5 O;  3NYM A;  3G80 A;  1NTK H;  4LF6 B;  4PJM A;  3ETE A;  1MMD A;  2ADP A;  4YY3 O;  2P67 A;  3ETD A;  4I44 A;  3WB2 A;  3QVZ A;  2FKX A;  1SMY F;  4K7B A;  3LEV A;  3GEE A;  5LL6 Y;  1QLE C;  1W2B U;  1D0X A;  1VQ8 V;  1GS9 A;  2IXM A;  3I55 V;  3CJH B;  2NPU A;  2XLE A;  5GTI Z;  1AVO B;  2CTQ A;  4E0H A;  3ABL B;  4RAI A;  2G3K A;  3ITF A;  2V26 A;  1O5H A;  5DLJ A;  2UUB O;  5HSW A;  4JI7 O;  3TGU H;  2F95 B;  4QGP A;  3JD1 A;  3L0I A;  4N6H A;  1BHA A;  1Y76 B;  1Y66 A;  1M2V A;  1BZK A;  5L3D A;  1JCH A;  5KYW B;  1FTS A;  3K03 A;  4PA3 A;  2W0F C;  3SYO A;  1Q0K A;  4UCO A;  3HNJ A;  4BJ1 A;  3SXM A;  2M64 A;  5B3S B;  4ZOL B;  4FJC C;  1I08 A;  2KW3 C;  2ZT9 B;  4TV8 A;  1S77 D;  1VTM P;  2A1D D;  3PCV A;  4HFF B;  1E79 G;  4HZ3 A;  3K3W A;  2QWN B;  4B3M B;  1ZHY A;  3OE7 G;  4AIL C;  1P4R A;  2Q7E A;  1HNZ O;  2NUP B;  2ITC C;  3GB7 C;  2I15 A;  3UO3 A;  3NXS A;  4F4B A;  4J9Y B;  1VQ4 V;  4L6R A;  3W8H A;  4JI3 O;  2OWO A;  4KXR A;  1P49 A;  3AK1 A;  3E2E A;  4IAR A;  4U9D A;  5GW7 A;  5KUM A;  2XXA B;  1YXB A;  2JVD A;  3F5T A;  2WLN A;  4FFK A;  3JCU Q;  4F4L A;  2GSM B;  1H2L A;  4NQF A;  1T6I A;  2QTV A;  3V5X A;  2E75 B;  3ASN C;  1NJI W;  5BQG A;  4YJ2 A;  4DV0 O;  4X1Y B;  4J10 A;  2LW7 A;  1CGO A;  4A5U B;  3NYJ A;  2JJ1 G;  5L0H A;  2DMX A;  4P9O A;  4DBQ A;  4XDK A;  2HFI A;  3TCU A;  1H2K A;  3U3F A;  1KTM A;  3DI5 A;  2EBO A;  1XL4 A;  2RSE B;  1WPB A;  4I7Z B;  5CA3 A;  3CSX A;  3AG4 C;  3SNH A;  4O2A A;  2N74 A;  4ZI7 B;  4DR1 O;  2KJG A;  4H13 B;  3UNG C;  2J7P D;  1FAF A;  3T1H O;  2L81 A;  4PJJ A;  2IXP A;  5H2F Z;  1E1R G;  1MA1 A;  1SC5 B;  4O6M A;  1Y74 A;  2EPK X;  5GPG B;  4BJ6 C;  2GBO A;  4EBK A;  3FB6 C;  3OTO B;  3OTF A;  4IL6 Z;  2X6C A;  5JVD B;  4WAB A;  4UCR A;  1EZJ A;  5E3A A;  3H1H H;  5L3G A;  3AOU A;  2WSS G;  3F7V C;  4CH5 A;  1YJG A;  1YI2 V;  2H7B A;  2H7V C;  1IZ3 A;  4G7Z F;  5IYZ A;  3R2P A;  1VEW A;  5L3F A;  1Z23 A;  1OW8 A;  3M79 A;  4G28 B;  1KUQ A;  4EBJ A;  1NFO A;  3C8G A;  1B6Q A;  1JFF B;  2UUH A;  3M15 A;  3JSE O;  4H4K C;  4A2N B;  3UKM A;  2QLA A;  1ZHZ A;  2IH1 C;  2M7W A;  2O9X A;  1B3Q A;  3EQL F;  1XBL A;  2VH3 A;  2CAZ C;  3S9O A;  1LS1 A;  2R05 A;  3LDE A;  3QO5 A;  1H2N A;  5T3T A;  2B0H A;  2FB5 A;  3ZBH A;  1WJZ A;  4YL1 A;  3T1Y O;  2O57 A;  4JI1 O;  4U3J A;  3GWO A;  4JYA O;  4JJF A;  3ZRW A;  2Y39 A;  4WBN A;  3AG3 B;  1VQK V;  1VF6 C;  4Q5S F;  2UXB O;  3RYC A;  4J30 B;  3CRA A;  4NXM B;  4DV1 O;  1LR1 A;  1PKX A;  5JQG A;  1K05 A;  4WFG A;  5C93 A;  1ZTE A;  5D92 A;  2LO1 A;  3US6 A;  1CGM E;  5EK0 A;  1TQG A;  2KB1 A;  3K9S A;  4H54 A;  5L3E A;  3U0Z A;  3JAR B;  1H9G A;  3M1C B;  1YVW A;  4WFH A;  4UUJ C;  2FML A;  2ILM A;  1J95 A;  2OTL V;  4J7T A;  3GVM A;  1ZUQ A;  4EKW A;  4DRI B;  1AI7 A;  3WU2 Z;  1XMQ B;  1M90 W;  5GTH Z;  2QE9 A;  2CH7 B;  3RYI B;  2A7W A;  1MND A;  3LNR A;  3VF0 A;  2G62 A;  3Q7G A;  3U8P A;  1O9G A;  4CBE A;  1OCR C;  1HNW O;  2WZF A;  4CS9 A;  3ZHU A;  1IBK B;  1BHB A;  3QO7 A;  5J2U A;  1G5Z A;  1N0J A;  4DR5 B;  1WTY A;  1QVG U;  1P7G A;  1Z6A A;  4FZ0 A;  2AZ2 A;  5LBQ A;  5CBH A;  2R7O A;  3IHU A;  1XOU A;  3BVO A;  4C3B A;  3ZMT A;  4LNU B;  1F23 A;  2EIK B;  4DR2 B;  3GM3 A;  4ABM A;  5L3B A;  1W59 A;  4CJG A;  3JAT B;  3A8T A;  2MYS A;  4LH7 A;  1Z63 A;  2WB7 A;  2LCH A;  3RIP A;  1EZV H;  1IVS A;  1OW6 A;  2CGE A;  2XAS A;  1R3K C;  3JAK A;  1YJ9 V;  5KHK A;  4JI2 B;  2Q0A A;  1O3U A;  4LFC B;  1Y4M A;  5L0F A;  4RBN A;  4R6Z A;  2YQY A;  4E7S A;  2A6E F;  3V7O A;  1N4C A;  3A0H Z;  5IWA B;  2HMQ A;  1JR9 A;  2OTJ V;  4JGS A;  2ZIM A;  5TJ5 E;  2GUZ A;  1KBH A;  3AK2 A;  5COF A;  1XZQ A;  4WGY A;  2CDQ A;  4GZR B;  4CSA C;  2W4M A;  2XS8 A;  1M6T A;  4YT5 A;  2Q9A A;  3HB3 B;  3TJ6 A;  2LGW A;  4N23 A;  1XNQ O;  2J45 A;  1HW7 A;  1V55 C;  1A0B A;  3K1I A;  2R7R A;  2IXN A;  2ARH A;  4UVC A;  1RKE B;  3CXC U;  1JAF A;  1Q81 W;  3K9A A;  5L0J A;  1FFH A;  2HV6 A;  1DTO A;  2PUS A;  3CC7 V;  1V54 C;  3OAA G;  3H01 A;  2X7R B;  4KI2 A;  3TJ5 A;  3I5P A;  2ZE6 A;  5KMG B;  3CS5 A;  4C7O A;  5LGN A;  4DJ9 A;  4EIY A;  1O87 A;  3K04 A;  4X89 A;  5LHG A;  2G3V A;  2OCH A;  2YIC A;  1JJ2 U;  5HFM A;  3OWT A;  2WLL A;  2KSD A;  3KCY A;  1YYX A;  3FXH A;  3SGI A;  1VMG A;  3W7T A;  1NTZ H;  4X88 A;  2CE4 A;  4AE4 A;  5DED A;  3NYL A;  2J46 A;  4NTA A;  3TQO A;  2JGD A;  3DC5 A;  1Q8I A;  3SJQ C;  3GEI A;  2HP8 A;  4B3R B;  4JUR I;  3CZ6 A;  1GN2 A;  1FXK B;  3Q6M A;  3ZN1 A;  4HFK B;  4U5F E;  2PY5 A;  5A69 A;  2XAF A;  1BDJ B;  4X1K A;  4MS2 A;  4K0D A;  3I5D A;  4RDA A;  3HLZ A;  2LGQ A;  2VCB A;  4RD9 A;  4NB5 A;  3H2V A;  1RPO A;  3RQF A;  1OXB A;  2HHH B;  2Q69 A;  1T6U A;  5IYD O;  1TWA A;  4E0I A;  5CI9 A;  3KKY A;  1OR2 A;  3FYE B;  2EIM B;  2OYQ A;  5KYX A;  3B29 A;  2Y3D A;  3U5S A;  4NTB A;  1PM9 A;  4LDK A;  1MSD A;  2CW0 F;  3S0X A;  3ABL C;  1M57 B;  1TWH A;  1RCP A;  1KP2 A;  1F4M A;  3MHH C;  5DN6 G;  3TOL A;  1XEQ A;  4BIU A;  3CX5 F;  2HUJ A;  2EJR A;  4LF7 B;  3E8H A;  1NH2 D; 
#chains in the Genus database with same CATH homology
 2IW5 A;  1VQO V;  1M2V B;  1NR7 A;  2KGO A;  2XL4 A;  2ZR2 A;  4U5C E;  5B3S C;  4JAV A;  3LAY A;  3LSS A;  4QNH B;  4BAY A;  4E7Z A;  3POV A;  1J8Y F;  2W9Y A;  5HFL A;  3FDQ A;  1LNQ A;  3P32 A;  3N24 A;  3K7D A;  1FS0 G;  3H65 A;  3BY6 A;  3S28 A;  4R8C A;  4J9Z B;  1ZHT A;  3MHS C;  2D5R B;  2WLK A;  3ETG A;  3KMI A;  2QY9 A;  2R7X A;  4YXW G;  1YIJ V;  2DWE C;  2WLI A;  3K08 A;  3K06 A;  4JCH A;  5DM6 V;  3ZMV A;  1DLB A;  3KL4 A;  1S72 V;  3G6E V;  1NH2 B;  1K73 W;  3CME V;  3STL C;  4BJT A;  2ZR3 A;  4U7O A;  3OEE G;  2YEV A;  5H9C A;  4IJJ A;  1Q7Y W;  3SPI A;  4Q7C A;  2R7Q A;  3ZG1 A;  3D36 A;  1CP9 A;  4NY3 A;  4WFF A;  2WAM A;  2EIL B;  2IOQ A;  1KC8 W;  4HAM A;  2HVJ C;  1M2O A;  1KEC A;  1K97 A;  4KP4 A;  3RBZ A;  4QE7 A;  2JEX A;  3NDB B;  2LFR A;  3VAY A;  3AG3 C;  5EC1 C;  3M99 B;  3SEO A;  2JDI G;  3ZRW B;  2R7T A;  4UVB A;  3VYW A;  3L34 A;  2Y3G A;  2R9I A;  3JD0 A;  1YJW V;  1TUE B;  4MW3 A;  4YT4 A;  1L1F A;  1GM7 A;  4XDL A;  3E83 A;  1DF4 A;  1D1C A;  1ARO P;  3EFO A;  3RFY A;  5LGT A;  3DZA A;  3K0G A;  4O79 A;  3OGC C;  4WJ0 A;  4I9W A;  2EIK C;  1TR2 A;  2IYL D;  3N0T A;  4ULW A;  2YZS A;  1RM1 C;  2AHZ A;  4BG0 A;  2OG2 A;  2B5U A;  4MVR A;  4DVZ A;  1AJP A;  3MX3 A;  3KG2 A;  1K3E A;  3K66 A;  1BR4 A;  4HYO A;  3DTU B;  4XDJ A;  3OEO A;  1D1A A;  4P6I C;  3T6B A;  2XAG A;  2JK5 C;  4DXW A;  4TT3 G;  4LLC A;  2FFH A;  2R7S A;  5KA5 A;  4MTX A;  4UXN A;  3WG7 B;  2E87 A;  2QM7 A;  2BOB C;  3CC2 V;  2W6J G;  2V1D A;  3E9V A;  4QJF B;  1VMA A;  3JCZ A;  4I5S A;  4C7O B;  2PI4 A;  4UVA A;  4LP8 A;  1P7B A;  4KFM A;  2WLL B;  1TKN A;  2V3C C;  1G8M A;  3DJU B;  4PA7 A;  1TWG A;  2Z15 A;  1K92 A;  5IYC O;  2QA4 V;  4AE4 B;  2Y69 B;  2C2A A;  4BW5 A;  4CZZ A;  1FXK C;  4E2L A;  2B0J A;  4QDL A;  1SRY A;  4MVM A;  3CCQ V;  3RKO F;  1BR2 A;  2OT5 A;  2Y3H A;  3JRT A;  1BMF G;  4DBR A;  4CS7 A;  1OCZ B;  3EHN A;  2XAH A;  1JPX A;  1S7Z A;  4CS8 A;  2L9J A;  2EIM C;  1AR1 B;  2A79 B;  1ROP A;  5F5F A;  2J0W A;  4PEL A;  3CP1 A;  4BEJ A;  1QZX A;  2AHY A;  3LDC A;  3UM7 A;  4BJ5 A;  3CCL V;  5KYX B;  1K34 A;  4WFA V;  1VYK A;  4GX5 A;  2EIN C;  3ZJZ A;  4LLE A;  2DW4 A;  3OMA B;  2R9R B;  4QI0 A;  1SZI A;  3QZC A;  3KKB A;  3E8G A;  4KNV A;  3X2Q B;  3OUS A;  1M56 B;  2Y3B A;  1F4N A;  2VAS A;  4JJG A;  3E35 A;  3IFX A;  2WZL A;  2QE7 G;  5IY5 B;  4U5H A;  2ZQM A;  5DQZ A;  2WL8 A;  1MMG A;  3RH3 A;  1GTO A;  4MND A;  3ASO B;  3ZSU A;  4KNW A;  2WLI B;  4I1M A;  3T4D A;  1NU7 D;  2DQ3 A;  1OHH G;  2IJI A;  2LFS A;  4C3D A;  2JJ2 G;  3B0V C;  3QNE A;  2YEV B;  2P6V A;  3F7Y C;  4DO2 A;  4MTG A;  4HE8 D;  3IGA C;  3FVY A;  4LCU C;  2ITD C;  3LLI A;  5B1B B;  1R6N A;  5EBL C;  3UMK A;  4O6N A;  1TWC A;  4Q20 A;  1H2G A;  1SF8 A;  1W0J G;  5F5H A;  2J9U A;  2ZXP A;  5CI8 A;  2UXN A;  2IJJ A;  5L3V A;  1K33 A;  4XWJ A;  3AG2 B;  1OKK A;  4U5G A;  4MTF A;  3EHB B;  5H6Q A;  4KC9 A;  1M9N A;  2QKS A;  2A69 F;  3CQZ A;  4CSA A;  4CS9 C;  2H94 A;  3OM3 B;  3EFO B;  1K7D A;  4B6I A;  2C03 A;  1OCO C;  2DYR B;  1ZYR F;  2H8P C;  3DM9 B;  2ZDI A;  1WGW A;  5D91 A;  2X6A A;  3I5Q A;  4RQE A;  2DQ0 A;  3ML0 A;  4UV8 A;  3I56 V;  3SYP A;  3LSQ A;  5DS4 A;  2DYS B;  3EG9 A;  4U5D E;  1D0Z A;  5EC2 C;  2IU0 A;  4RUF A;  2I8B A;  3QMK A;  5EBM C;  3K1I C;  2MK3 A;  1FFT C;  5DS5 A;  3JYC A;  4PFO A;  2V7Q G;  2OCC B;  1NKD A;  2LSE A;  3DMD A;  1YJN V;  3F5W C;  1Z3I X;  2P7T C;  3EH1 A;  2WLM A;  5KYU A;  1YSC A;  4MVZ A;  3UMI A;  3DM5 A;  4JPR A;  3LES A;  5E1A C;  1QLE B;  1G4Y B;  3LNM B;  1FMW A;  4JTC B;  2Y69 C;  1Q86 W;  1H8H G;  4JAU A;  1W0K G;  5B1A B;  2FTK A;  1K5S A;  4G27 B;  2R7U A;  1R3J C;  1FMV A;  2PX0 A;  1RPR A;  1NG1 A;  2Q6A A;  1I5Y A;  3HTK C;  2IJK A;  3PHF 2;  5FCL A;  1COW G;  2FGY A;  3BEH A;  1VQN V;  5CMU A;  2JIZ G;  4P9P A;  2PP4 A;  3B77 A;  5T3W A;  5L3Q A;  3AG1 B;  4FPP A;  1AJN A;  3GOD A;  4C3E A;  2HVK C;  3W8I A;  4FIP C;  3ZRV A;  2LP7 A;  1OCC B;  1E1Q G;  5KUK A;  3X2Q C;  1IXM A;  3HPL C;  4JW1 A;  3AG4 B;  1M56 C;  1IZM A;  1ST6 A;  1G8X A;  1F51 A;  4TWK A;  2BE5 F;  1QR8 A;  2WLJ A;  4FK5 C;  4PK4 A;  5CBF A;  5EHH A;  4P2Z A;  1NQT A;  5IY5 C;  3G71 V;  1GM9 A;  1R3I C;  4PJN A;  3G4S V;  1J8M F;  4IRU A;  5KYY B;  3ASO C;  2XSE A;  2BOC C;  1QBZ A;  1R73 A;  1CPY A;  4MVS A;  1EBO A;  2X6B A;  3JT1 A;  1GK9 A;  4XTK A;  4X8A A;  2DWD C;  1OKK D;  3VOU A;  1AI4 A;  3ABM B;  4JVS A;  1EFR G;  2W45 A;  1Q82 W;  1IW7 F;  2PX3 A;  3B8M A;  4KUM A;  1Z5Z A;  1DF5 A;  1SET A;  5FL7 G;  3OW2 U;  2R7V A;  3JD2 A;  1MNE A;  5B1B C;  3K0D A;  3EGD A;  2A0L A;  1D0Y A;  2ZXW B;  4MQ9 F;  2M4E A;  1K4D C;  2EZO A;  4GX0 A;  4LBE C;  1OCR B;  1JOY A;  1KD1 W;  4Z1M G;  4PA6 A;  3E8B A;  4CBC A;  3W2V A;  1JPN A;  1K8A W;  4ZBM A;  3O6X A;  1PD0 A;  3DXJ F;  4GX1 A;  2HKO A;  1MG1 A;  3CCS V;  1KKD A;  4QI2 A;  4OXS A;  4PDL A;  4OIN F;  2DGJ A;  1VQ7 V;  4O7G A;  2WLH A;  2EIJ B;  3LUT B;  3CCE V;  3TK1 A;  2DYR C;  5CN0 A;  2XAQ A;  4PFP A;  3DJN B;  1YIT V;  2D3O W;  1H38 A;  2WPD G;  3RVY A;  2Q3T A;  5BZB A;  2IJH A;  3IEE A;  3OR6 C;  4OD4 A;  3CMA V;  2XAJ A;  2P6J A;  4CIH A;  4U5B E;  4J32 B;  2XND G;  4YT2 A;  4JTD B;  3EG9 B;  5DVW A;  1MAB G;  3LS1 A;  2QM8 A;  5B1O A;  3CCR V;  1AI6 A;  4OIR F;  2NLJ C;  3T4R A;  4R7C A;  4YN0 B;  3ZVR A;  3GAN A;  4IWB A;  1VOM A;  3ZMS A;  2OCC C;  3ZN0 A;  1QR9 A;  2X0L A;  3B0U X;  1JPJ A;  3VBB A;  4W8K A;  1W2W A;  3K1H A;  5KYU B;  3LS0 A;  3X1O A;  3CCV V;  3T2M A;  3N2Z B;  2HR3 A;  1BR1 A;  1PNM A;  1GO3 F;  3UMH A;  3MLG A;  3FB5 C;  1M57 C;  2MWQ A;  3SP1 A;  1I5X A;  1WLE A;  3SYA A;  4PA9 A;  3DAG A;  4ZLC A;  5B1A C;  3W7S A;  3OEH G;  4MVQ A;  3EH2 A;  2WVN A;  4JTA B;  3SPG A;  1H8E G;  1S0V A;  2KNH A;  3ECS A;  4CS8 C;  3K79 A;  2F43 G;  2HG5 C;  2J9V A;  1NR1 A;  3P30 A;  1CEZ A;  3CCJ V;  2HJF C;  4BJ5 C;  3FAJ A;  3SYQ A;  3S29 A;  1JVM A;  4BJ6 A;  2XOK G;  3NRH A;  4XLN F;  2Y48 A;  3EPV A;  4M63 A;  3NKE A;  3AG1 C;  3KH2 A;  4G2K A;  4FMT A;  2YHS A;  1OCC C;  2Q67 A;  2Q9C A;  4N21 A;  5KYY A;  1MMN A;  3FHD A;  5LGU A;  3K33 A;  4LC1 A;  4MT8 A;  3W7U A;  2NUT A;  1UJW B;  3WOD F;  3SPJ A;  2ZPA A;  3W7W A;  4JZA A;  2WVO A;  1LKX A;  1VK5 A;  3JD3 A;  2PFD A;  4QIW F;  2YSU B;  3TD7 A;  5J9P C;  4JF3 A;  4OD5 A;  3TET A;  2GFH A;  2EIL C;  3NKD A;  1YHQ V;  3ABM C;  2C04 A;  4Q4Z F;  2HV7 A;  2WWW A;  3OUF A;  3DAF A;  4XLP F;  2P7V A;  2W6I G;  1QVF U;  5KA6 A;  1MSW D;  1S5H C;  3CYO A;  3IC7 A;  4GX2 A;  1BL8 A;  5E3C A;  3FB7 C;  3RYL A;  3ABT A;  4FES A;  1K4C C;  3SZR A;  2ZXW C;  4FWV A;  3ABK B;  3EGD B;  4YT8 A;  5BUO A;  3T1C A;  5IDJ A;  1N1C A;  3UR3 C;  4L87 A;  2H7O A;  2QEX V;  3LLK A;  3SPC A;  2Z3Y A;  3HJC A;  3OFN G;  1RM1 B;  3DD7 A;  1KP3 A;  4IAO A;  1RJ9 A;  4QPJ A;  4O6Y A;  1ORQ C;  2ZXR A;  2Q68 A;  4EWC A;  3Q6N A;  1M1K W;  2VB6 A;  5DS6 A;  4G7O F;  2B1I A;  4XBF A;  2QTO A;  4DOZ A;  1AI5 A;  4G7H F;  4QE9 A;  1R6K A;  2CNW A;  2EIJ C;  2PI5 A;  3B9Q A;  3EGX A;  4ZKI A;  2ZXO A;  5DQT A;  3T4Z A;  2Q9B A;  4P30 A;  1N8R W;  2ZDI C;  3WG7 C;  5B1N A;  2Z5U A;  3EHM A;  4FX5 A;  1NU9 C;  3LJB A;  3ZIA G;  4PDM A;  3EJN A;  4PJL A;  1S3J A;  3ABU A;  2A9H A;  1WPX A;  1YTF D;  3FYI B;  1VQP V;  1GM8 A;  1PCX A;  4AK9 A;  2WZG A;  3NG1 A;  3F47 A;  4X0R A;  4H33 A;  1MMA A;  1PNK A;  3OR7 C;  3E70 C;  4RO2 A;  4WFE A;  3CPW U;  3K6B A;  4DVY P;  4KBL A;  1JQ0 A;  3B8N A;  3CSK A;  3F46 A;  4HEA J;  5KYW A;  2KQ9 A;  1K5Q A;  1OCZ C;  4YWQ A;  1FXH A;  1LVK A;  4MW8 A;  1ZHW A;  1K9M W;  5H6R A;  2PF4 E;  3PJS K;  1R3L C;  4WF9 V;  3ZMZ A;  2NUP A;  1ENV A;  3UGP A;  2B1G A;  3A0R A;  2A6H F;  2EIN B;  3S27 A;  2A68 F;  2NNU A;  3MD0 A;  2IH3 C;  2XXA A;  2J0X A;  3AQC A;  1YTF B;  1ZU5 A;  3FKS G;  2P90 A;  1NZE A;  3OMI B;  4OIQ F;  3JD4 A;  3W2W A;  1GKF A;  4QPK A;  3R65 A;  4LER A;  2IXO A;  5T1D B;  4OIO F;  3ASN B;  4H37 A;  1SER A;  3CCU V;  5EGY A;  1NVP D;  3AQB A;  4JYC A;  3EFF K;  3B0P A;  3EZH A;  3CD6 V;  2CK3 G;  3D3I A;  1GMG A;  1VQ5 V;  1ZHX A;  3ZRX A;  3PMR A;  4BIZ A;  1QLN A;  1KU2 A;  1SES A;  2J9W A;  1PD3 A;  2UXX A;  4LAC B;  3OA1 A;  2XRH A;  3CCM V;  3QO8 A;  2JD3 A;  4JYB A;  4U5E E;  3SYC A;  1ZU4 A;  1XL6 A;  2R7W A;  2NUT B;  3O39 A;  1JX9 A;  2IU3 A;  2NG1 A;  4G0H A;  1PNL A;  3CC4 V;  3JSZ A;  4ANJ A;  1SZT A;  3ZRS A;  2EZP A;  5E2Q A;  1KQS U;  5CBG A;  1NVP B;  4GCZ A;  1PL0 A;  4U7N A;  3SYN A;  3Q7L A;  2J7P A;  3EZI A;  3E86 A;  1PD1 A;  4TSF G;  4JAS A;  4EBB A;  1OZ0 A;  2GHY A;  4I1O B;  1MOF A;  5IYB O;  3LDD A;  3AEI A;  3WFV A;  3SPH A;  2CNW D;  4MSW C;  5KYN A;  1D1B A;  4MVO A;  2X51 A;  4AX2 A;  3JYH A;  4WFB V;  3ABK C;  4UV9 A;  3AG2 C;  1S76 D;  1VQ9 V;  4GT1 A;  4PDR A;  4R50 A;  4PDV A;  3T6J A;  3ZMU A;  4N06 A;  3E89 A;  3I4U A;  1OCO B;  2JEU A;  1FXV A;  1QCE A;  1VQ6 V;  3ZC4 A;  4ZLD A;  2ZD9 A;  3RVZ A;  4RUE A;  1V55 B;  1RJ9 B;  3OMN B;  1VQM V;  4MVU A;  1ZWI C;  1V54 B;  2K1E A;  3W7X A;  3ZIB A;  5LHH A;  4PA4 A;  4I3M A;  4YJW A;  1VYI A;  4ASU G;  1NBM G;  4GYT A;  3STZ C;  3ZCC A;  3UGO A;  2DYS C;  2ATK C;  2HLD G;  2W4B A;  5L3C A;  5LHI A;  1VQL V;  3EGX B;  4WCE V;  1HWY A;  1THZ A;  3DGE A;  4GEH A;  1FFT B;  3RW0 A;  1FXK A;  4MTO A;  2WVQ A;  3FB8 C;  2HFE C;  3E8F A;  5EBW C;  4RQF A;  5E33 A;  4OIP F;  1AJQ A;  3NYM A;  4PJM A;  3ETE A;  1MMD A;  2P67 A;  3ETD A;  4I44 A;  1SMY F;  4K7B A;  3LEV A;  1QLE C;  1W2B U;  1D0X A;  1VQ8 V;  2IXM A;  3I55 V;  3ABL B;  4RAI A;  2G3K A;  3ITF A;  2V26 A;  1O5H A;  5DLJ A;  5HSW A;  3JD1 A;  3L0I A;  1BHA A;  1Y66 A;  1M2V A;  5L3D A;  1JCH A;  5KYW B;  1FTS A;  3K03 A;  4PA3 A;  2W0F C;  3SYO A;  4BJ1 A;  5B3S B;  4FJC C;  2KW3 C;  1S77 D;  2A1D D;  4HFF B;  1E79 G;  4HZ3 A;  3K3W A;  1ZHY A;  3OE7 G;  1P4R A;  2NUP B;  2ITC C;  3GB7 C;  3NXS A;  4F4B A;  4J9Y B;  1VQ4 V;  3W8H A;  3E2E A;  5GW7 A;  5KUM A;  2XXA B;  2WLN A;  3JCU Q;  4F4L A;  2GSM B;  2QTV A;  3ASN C;  1NJI W;  3NYJ A;  2JJ1 G;  4P9O A;  4DBQ A;  4XDK A;  3TCU A;  2EBO A;  1XL4 A;  5CA3 A;  3AG4 C;  3SNH A;  2KJG A;  3UNG C;  2J7P D;  2L81 A;  4PJJ A;  2IXP A;  1E1R G;  4O6M A;  4BJ6 C;  3FB6 C;  2X6C A;  1EZJ A;  5E3A A;  5L3G A;  2WSS G;  3F7V C;  1YI2 V;  2H7B A;  2H7V C;  4G7Z F;  5L3F A;  1Z23 A;  4G28 B;  1B6Q A;  4H4K C;  4A2N B;  3UKM A;  1ZHZ A;  2IH1 C;  2M7W A;  2O9X A;  3EQL F;  2VH3 A;  1LS1 A;  3LDE A;  3QO5 A;  5T3T A;  3GWO A;  4JJF A;  3ZRW A;  2Y39 A;  3AG3 B;  1VQK V;  4Q5S F;  4J30 B;  1PKX A;  4WFG A;  5C93 A;  5D92 A;  5EK0 A;  2KB1 A;  5L3E A;  3M1C B;  4WFH A;  4UUJ C;  1J95 A;  2OTL V;  4EKW A;  1AI7 A;  1M90 W;  1MND A;  3LNR A;  2G62 A;  3Q7G A;  4CBE A;  1OCR C;  2WZF A;  4CS9 A;  1BHB A;  3QO7 A;  1QVG U;  1Z6A A;  5LBQ A;  5CBH A;  2R7O A;  4C3B A;  3ZMT A;  1F23 A;  2EIK B;  5L3B A;  2MYS A;  1Z63 A;  2WB7 A;  3RIP A;  2CGE A;  2XAS A;  1R3K C;  1YJ9 V;  1Y4M A;  4RBN A;  4R6Z A;  4E7S A;  2A6E F;  3V7O A;  2OTJ V;  4JGS A;  2CDQ A;  4CSA C;  2W4M A;  4YT5 A;  2Q9A A;  3HB3 B;  4N23 A;  2J45 A;  1V55 C;  2R7R A;  2IXN A;  4UVC A;  3CXC U;  1Q81 W;  3K9A A;  1FFH A;  2HV6 A;  1DTO A;  3CC7 V;  1V54 C;  3OAA G;  3H01 A;  2X7R B;  4KI2 A;  3I5P A;  4C7O A;  5LGN A;  1O87 A;  3K04 A;  4X89 A;  5LHG A;  2G3V A;  1JJ2 U;  5HFM A;  3OWT A;  2WLL A;  3W7T A;  4X88 A;  4AE4 A;  3NYL A;  2J46 A;  3SJQ C;  4JUR I;  3CZ6 A;  1FXK B;  3Q6M A;  3ZN1 A;  4HFK B;  4U5F E;  2XAF A;  4MS2 A;  4K0D A;  4RDA A;  3HLZ A;  4RD9 A;  1RPO A;  2Q69 A;  5IYD O;  1TWA A;  5CI9 A;  3FYE B;  2EIM B;  5KYX A;  2Y3D A;  2CW0 F;  3S0X A;  3ABL C;  1M57 B;  1TWH A;  1KP2 A;  1F4M A;  3MHH C;  5DN6 G;  4BIU A;  2EJR A;  3E8H A;  1NH2 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...