1M57C

Structure of cytochrome c oxidase from rhodobacter sphaeroides (eq(i-286) mutant))
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
265
structure length
265
Chain Sequence
AHAKNHDYHILPPSIWPFMASVGAFVMLFGAVLWMHGSGPWMGLIGLVVVLYTMFGWWSDVVTESLEGDHTPVVRLGLRWGFILFIMSEVMFFSAWFWSFFKHALYPMGPESPIIDGIFPPEGIITFDPWHLPLINTLILLCSGCAATWAHHALVHENNRRDVAWGLALAIALGALFTVFQAYEYSHAAFGFAGNIYGANFFMATGFHGFHVIVGTIFLLVCLIRVQRGHFTPEKHVGFEAAIWYWHFVDVVWLFLFASIYIWGQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The X-ray crystal structures of wild-type and EQ(I-286) mutant cytochrome c oxidases from Rhodobacter sphaeroides.
pubmed doi rcsb
source organism Rhodobacter sphaeroides
molecule tags Oxidoreductase
molecule keywords CYTOCHROME C OXIDASE
total genus 97
structure length 265
sequence length 265
chains with identical sequence I
ec nomenclature
pdb deposition date 2002-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00510 COX3 Cytochrome c oxidase subunit III
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1m57C01
1.20.120.80 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 1m57C02
3RBZA 4MSWC 4R7CA 4PA6A 1OCOC 2DWEC 4GX2A 4X8AA 2DYRC 3T1CA 4MVSA 2WLMA 5IY5C 2EIJC 3KG2A 2R9RB 3EFFK 4QNHB 2EIKC 1OCCC 2ZXWC 4GX0A 3SPIA 4HZ3A 3SYAA 3SPGA 3WG7C 3OR7C 3R65A 2P7TC 3T4DA 3SJQC 4WFGA 3SYOA 3LDCA 4P2ZA 3ZRSA 1G4YB 4H33A 1ORQC 2K1EA 3STZC 3FB6C 1K4CC 3IFXA 4UUJC 3F7YC 3LDDA 3E8HA 4EKWA 3SPCA 3ZJZA 2AHYA 5B1AC 3ABLC 4R6ZA 1J95A 3JYCA 2KB1A 3RVYA 2WLLB 4J9YB 4MW8A 3ASOC 2JK5C 3K04A 2A0LA 2IH1C 1LNQA 4XDJA 1BL8A 2Q67A 4P9PA 2DYSC 4X89A 4P9OA 3LDEA 5KUMA 2ITCC 1K4DC 4LCUC 2HJFC 4LP8A 4XDLA 3FB7C 3E8FA 4LBEC 4MS2A 3TCUA 5CBHA 2DWDC 2EIMC 2Q69A 2ZD9A 3OGCC 4PA3A 2HVJC 2YEVA 3T4ZA 1OCRC 3E86A 3F5WC 3ABKC 4JTCB 2HVKC 4KFMA 5EC2C 1R3KC 5EC1C 4R8CA 1M57C 3HPLC 2EILC 5EBLC 2Q6AA 3AG4C 4GX5A 3STLC 3ASNC 5BZBA 4PDVA 4MVRA 2NLJC 4PDMA 4R50A 4JTAB 3E89A 2Y69C 3AG3C 4X88A 4MVMA 4BW5A 4MVOA 3AG1C 4XDKA 5CBGA 2W0FC 3OUFA 2WLJA 3PJSK 2ITDC 4MTOA 2WLKA 2WLIA 1XL4A 4F4LA 2X6AA 4PA4A 3RVZA 1KKDA 3F7VC 5E1AC 4QE7A 4WFFA 3RW0A 2WLIB 3X2QC 5KUKA 1P7BA 1R3JC 3K08A 3E8GA 1JVMA 3BEHA 3UM7A 3VOUA 3FB8C 3LNMB 4GX1A 4TWKA 5B1BC 3SPJA 1OCZC 3TETA 4WFHA 4H37A 4G28B 1R3IC 2HFEC 4CBCA 4PDLA 2X6CA 4PA7A 4MTGA 4PA9A 2EINC 2WLNA 1R3LC 4I9WA 5EK0A 3T2MA 2WLLA 1M56C 5J9PC 2IH3C 4P30A 5EBWC 3OR6C 2QTOA 2Q68A 4MTFA 3SYQA 1V55C 1S5HC 4MVUA 3GB7C 3E83A 2WLHA 4WFEA 4MVZA 3OUSA 4HYOA 4OXSA 1V54C 3E8BA 4RUEA 3SYPA 5CBFA 2BOCC 4RAIA 2A9HA 3SPHA 3UKMA 3SYCA 3K0GA 4PDRA 4MW3A 2A79B 3IGAC 5EBMC 3ABMC 2ATKC 1FFTC 1ZWIC 1QLEC 2H8PC 3FB5C 3LUTB 2HG5C 3AG2C 4G27B 4DXWA 4RO2A 4J9ZB 5B3SC 2OCCC 4RUFA 1XL6A 2BOBC 3K0DA 2QKSA 4QE9A 2AHZA 4MVQA 2X6BA 3K03A 4ZBMA 4JTDB 3K06A
chains in the Genus database with same CATH superfamily
2YDEA 4FESA 3FFQA 4EB6A 2FYUH 1OCOC 2DWEC 2G3VA 1XUQA 3K66A 1WPXA 4CX9A 4X8AA 3T1CA 4MVSA 3BPZA 5FNVB 4X66O 2EIJC 3FKSG 3EFFK 1TVKA 2H7BA 5TISZ 3G4XA 4GEHA 4DRJB 4JIOA 4LF4O 1AJQA 3G6EV 3P3PA 4LH6A 2PZSA 5A6AA 3S27A 2CTWA 2ZXRA 5BUOA 3EZHA 4B3TB 5IYZA 2B1IA 2CH7A 4X1IB 2DGJA 3CC4V 2IJIA 1NTMH 1SETA 3NDBB 4PR9A 5B1AC 3UMIA 4LLEA 1U0BB 1AJNA 3UMHA 2KB1A 2XAJA 2Y0PA 2YXLA 1FYJA 3ZS8C 1YJ9V 4I3MA 4JI4B 1H38A 4FLXA 2ITCC 1BHAA 2PFDA 2XUMA 5JP7A 4IT5A 4IJJA 3C8GA 2Y3HA 2B5UA 4L8JA 1H2SB 1PL0A 4DV2B 1L0NH 1M57C 1ZHZA 3K5NA 2NPUA 3K6BA 1QLEB 4MVRA 2R7TA 3H65A 1K73W 1K40A 4X1YA 4C7OA 4DK0A 4A4AA 5IJ0A 2XS8A 4AE4B 2V4DA 4Q7CA 1WB8A 2W4BA 2ETSA 1JRAA 1AEPA 1RXQA 3ZN1A 1Y74A 1HNWB 2B0JA 2QJ1A 2HV6A 1S72V 4ZI7B 3R2PA 4CBCA 4U9DA 5LXTA 4CIPA 5LP6A 2HHHB 5JLIA 3IHUA 1HW7A 2CCYA 4J7JA 5EBWC 2A1DD 1PKXA 3JARA 4MTFA 2Q68A 1PP9H 1GN3A 3EGXA 4J7ZA 2BE3A 3DM5A 1D1BA 2JS3A 4PJ0Z 2J9BA 1T6UA 2CE4A 2ZQMA 1JPXA 2A9HA 4PFOA 5LMUO 2JGDA 2IXNA 3C8ZA 1MSWD 1WTYA 4CDAA 1Z7Qc 2JJ2G 3K5MA 2WZGA 4LFAO 3LUTB 3AOUA 4E4EA 1DTOA 4G27B 2ZT9B 4RO2A 4CC6A 1OXKA 3THOA 5B3SC 2ZNIA 1XL6A 3K0DA 1DOVA 3KKYA 2UUBB 4DV0B 1KECA 2DQ0A 1NT2B 2MK3A 4E17A 2ZIOA 4X9QA 5AG2A 4ZBMA 4NQFA 2EIMB 2HKOA 2PI4A 2Y3GA 4R7CA 4PA6A 4XPWA 3W2VA 2G62A 4O4JA 3H1LH 3H9VA 2GA0A 3ZHTA 3P30A 5KMGA 4PV1B 1VQ5V 1RM1B 3DE9A 1Y67A 4E18A 1NVPB 2VASA 2DJVA 1X59A 1IXBA 1FAFA 4TQDA 4FLTA 4FVMA 3AQCA 5LGUA 5H9CA 2W6IG 2MHRA 1YTFB 4DR2O 5KYUB 2L6GA 3RF3A 1E86A 2VC9A 3EHMA 4D4XA 3E70C 4XDJA 5EZYA 4DRXA 3ITFA 2R9AA 1Z6AA 1RMVA 3KMIA 1GH6A 1GS9A 3KYIA 3CQZA 1VQOV 3N2GB 1ZW2A 1F23A 3E2EA 3OGCC 4EFEA 4MNDA 5JJEB 3G71V 2EZPA 4HFFB 1TUEB 4JI3O 3Q7GA 3RKOF 2J9UA 4H0LB 2LP4A 3TOMA 2A69F 1GM7A 1EI7A 1R3KC 4DV2O 4MQ9F 3ZHSA 4DR1O 5DQZA 3AK3A 4R50A 1BE3H 3JAWA 3APQA 2MW2B 1Z5VA 2Y69C 5B3SB 2ITDC 2Q7EA 1YVWA 4JURI 4PA4A 4DRHB 5L0CA 4BIZA 1VARA 2Q7GA 2WLIB 1FXKC 1DGSA 1APCA 1XHXA 5LMNO 5L0JA 1NZEA 2C04A 4PI0A 2R7UA 4YY3O 1V54B 3BRCA 1SQVH 2LW7A 2YL1A 1T5EA 1NZ6A 4UCTA 1M56C 5CMUA 1SQFA 2PTMA 4FFBB 4JYAB 1WNSA 4U5HA 3MLGA 1RKEA 3I56V 2UU9B 5JH7A 3T4RA 1AR5A 1WGWA 4RUEA 5CBFA 1Y66A 3E9VA 2YHSA 3K59A 2KG7B 3OFNG 4DV0O 2VQFB 1VTMP 4PI2A 3FB5C 4JI7O 1F4MA 1ORSC 3ZQVA 1YZAA 2Y4UA 4DV5B 5IY5B 2OCCC 4CH6A 3VQXA 4RUFA 4JI2B 1XNQO 2GSMB 1QLNA 1LIHA 1SR2A 2F4VB 2BTOA 4QE9A 2AHZA 3CMAV 2DB4A 2OU6A 2EPKX 4UVAA 1XNRO 4GX2A 4DYLA 3AJMA 5IY5C 2XAGA 5KX5A 3ETGA 2PBEA 3SYAA 1E79G 5FL7G 1ZHXA 1HR0B 2F95B 1TWCA 2HJMA 1N8RW 1ZL8A 3GWLA 3UT5A 1G4YB 1JJOA 5LOVA 1QBZA 3S29A 1K4CC 3L9DA 1TGOA 2LO1A 3JD4A 4DV4O 4LH7A 1CXZB 3W7SA 1L0LH 2WZFA 4W8KA 3ASOC 3SZRA 2EPNA 3TJ5A 3L8IA 4NC3A 2MYSA 1I5YA 1XWJA 1G6UA 3B40A 4W8PA 4XTKA 5A9GA 1MOFA 1HR0O 5KHJA 3JCUQ 4JV5O 3FB7C 2NR5A 1ZX3A 2L81A 3F46A 3ABUA 3JATA 3QO7A 1VQ7V 3DKAA 2HVJC 3N27A 2CGNA 1WJZA 3E86A 4Z9IA 1ORJA 2J9WA 1JR9A 4H4KC 3U0ZA 4J10A 3H01A 5EBLC 4UDVA 3ZRXA 3DGEA 1YDIA 2F22A 1Q0MA 2YL7A 4WBNB 2HV7A 2C03A 4ZI7A 2XNDG 4RBNA 2QWNB 2W0FC 3IQ5A 1ZUQA 1I5NA 4IIJB 3RVZA 5KHGA 1SKVA 4HNAA 3I4UA 5DVWA 3JARB 3O10A 3AEIA 2AU5A 2FAPB 1BR4A 2ZCEA 4YN0B 1HNZB 3CHXA 2QWQB 1OJHA 1SZIA 1HNXO 2YL3A 5TJ5E 1Z2GA 4EBKA 2XXAA 2L7AA 2YVKA 2WLLA 3F5TA 4BIUA 2M7WA 1Y76B 4LC1A 3OR6C 4PJLA 1BHBA 4F6RB 1V55C 3GB7C 3DM9B 4YHHB 3X2QB 4K7BA 2D4UA 5KYXB 3CCLV 4N21A 5E3CA 4DUZB 1YA9A 4DR7O 3B9QA 3NYMA 3O65A 2UXDO 4ABMA 1R6NA 4PELA 3JRTA 2XT9A 1GKFA 2EIKB 2HR3A 1AB3A 1Q5OA 2Q9BA 3L70H 1E85A 5FPRA 2N74A 2DYSB 1G8XA 3OW2U 3RQGA 1PNKA 1SA0B 1ZSPA 4I9QA 3J06A 3UCSC 5KHIA 4Z9JA 1LM3B 3U5SA 3NMKA 2D5RB 1COWG 5IJ9A 3U8VA 4RQFA 2M6YA 1JX9A 2R9RB 2QEXV 1G5ZA 4FAPB 2QNLA 4JI5O 5FNVA 3N2KB 5JCOA 5DLJA 1VIBA 3H1JH 2H7VC 3ZRSA 2R7QA 1ZHTA 3EZIA 3S84A 3CCUV 2J46A 3CC2V 2CGOA 3O39A 1FFTB 1J95A 3JYCA 4LDKA 2CTRA 1EZVH 4MW8A 3M8AA 3K04A 3W7UA 3SXZA 1RFYA 2A0LA 5C8YB 1DF4A 3JSEO 1LKXA 2CDYA 1UFBA 4UV9A 5KHHA 1ZLZA 2GUZA 5B1OA 4ZOLB 3TCUA 2BTQB 3CCEV 3KZIZ 2EPOA 3CJHB 4PA3A 3GORA 1L7CA 1OCRC 4IGGA 1M6TA 3N2GA 5EC1C 2P4VA 4QDLA 5JVDB 3U0CA 4FZ1A 2PGGA 3STLC 3DC6A 4CS8A 1FXHA 1HE9A 2H94A 1L8DA 3AG3C 2ZDIC 4D6TH 3RQEA 4CS7A 4MVOA 2KK1A 3FDQA 3HNKA 3PJSK 2OWOA 1D5AA 2WLKA 4LF6B 3B8NA 4UVCA 3L34A 1JQ0A 1XNQB 5E1AC 5GONA 4QE7A 2H3OA 1P7BA 3JCZA 5L3BA 3T6GB 1VF6C 2P6VA 3SEOA 5B1BC 4O6MA 2IM9A 1BQZA 1SQXH 2HMQA 1J5EO 3J81N 4YT5A 3G80A 2L6FA 5LGNA 1WB7A 1R3LC 2IXOA 3ZQYA 4YK5A 5LXTB 4K0DA 3C8GD 3ZMSA 1VQ9V 1H7IA 1Q0DA 3NYJA 3T6JA 3E83A 5LL6Y 2ZE8A 2XL8A 4FJCC 2BOCC 3K0GA 1MG1A 2UUAO 3IGAC 1VEWA 1K92A 2YICA 3H1IH 2XLDA 1FFTC 1ZL8B 3IC9A 3AK2A 4DR6O 1VMAA 3EHNA 1FFHA 2NUPB 2YXYA 3L0IA 3RYFA 4O2AB 2F43G 5ITZB 1XMOO 1VK5A 2DI3A 4OINF 3RYLA 4I0XB 5L3EA 5EIBD 2ASRA 3OTOB 2X7RB 4DR1B 1TAEA 3GM2A 4BAYA 4IL6Z 1B06A 3A11A 4CBEA 1Q6IA 2ZXWC 1DK1A 3SPIA 4K8XA 1H9GA 1H8EG 3OEEG 4LNUB 3HTKC 1LS1A 3QNEA 3RH3A 3C7JA 3SXYA 5BQIA 3FB6C 3P3NA 4O6NA 3B0PA 3F7YC 1MNGA 1WPBA 1ZTEA 2FMLA 3ZHRA 2VWJA 1IBLB 4CH4A 2PX0A 2YL0A 2XOKG 3JD0A 2KJGA 3JRMO 5CA3A 2WAMA 4LDQA 4DBQA 4IWBA 2V1DA 4OIPF 2G38A 3O55A 2P5OA 1HNWO 3BFRA 3BABA 3K33A 1TR2A 4AQYB 1ZYRF 3JAKB 2Q67A 4O4JB 4U3FH 1OW6A 1LI7A 2WA4A 2IBFA 3C63A 4XDLA 2GHYA 4Z2WA 2UXCB 2EPLX 5CBHA 3VF0A 4P9TA 4U7OA 2P4KA 1XMQO 5B5EZ 4DV7B 3HPLC 1AR1B 1I94B 1S77D 3LEVA 5LA6A 4LF5B 2EILB 3OD4A 3EHBB 4EB6B 2OCCB 2UXBB 2IJJA 1LI5A 2UUBO 1ST6A 3JD2A 5A6BA 5FPOA 4ER9A 1O9HA 3K57A 3OEHG 5F2VO 5JWPA 2NUTB 1OKKA 1MZFA 1OV9A 2JGUA 5J9PC 2XLEA 2VB6A 4B3TO 3EH2A 4MVUA 2KYHA 4X62O 3PDMP 3L72H 5GTIZ 1NU9C 4O4LB 1LUWA 4FZ0A 1V54C 2R7VA 2LIGA 1NBMG 2Q00A 3U2LA 5B66Z 1M2VB 5DS5A 4DR3O 3N2KA 1MA1A 4EBJA 1ZWIC 1IBKB 4B3RB 4JAUA 3RN4A 3DSQA 3DTUB 3ZMVA 2F1MA 4DXWA 1IBKO 4B3RO 1VQKV 2P06A 3CCVV 3K03A 2AVKA 2R9IA 3RBZA 3ETQA 4U3JA 4DBRA 1ZU4A 5BMVB 4FWVA 1VP7A 4O2BA 4I4TA 3K79A 2VS0A 4J42A 3LLKA 3LESA 1U6HA 1AJPA 1IBMO 4FFKA 3WG7C 1TFKB 1V4AA 1KD1W 2UXNA 5BXZA 4NY3A 2YLDA 3NMJA 1MMGA 3TXQA 5IJ9B 1ZVZA 4YHHO 3PN1A 3T1YB 2OQMA 2C2AA 1YDXA 2E76B 4C7UA 4KHPO 4TV8A 3SPCA 3B8MA 4DRIB 2OEXA 1FXKB 4CS9C 2YUAA 3VRCA 5EGYA 3MHHC 2PYJA 3ZHQA 3DI5A 1GRJA 1PM9A 2JPUA 2LQGA 1P4RA 1OQCA 1T5OA 4XPXA 1JPJA 1D0YA 4DV3B 3UO2A 1CGNA 2DWDC 5J2TB 2R25A 1VOMA 3FAPB 2DW4A 2ZXOA 1NBBA 4LF8O 2GUZB 2ZM6B 1YYJA 3B71A 5AGFA 3FVYA 1ZZPA 1I7FA 5E33A 4Q4ZF 2OT5A 4LF8B 1PPJH 3ABMB 1JMKC 4X1KB 4NKGB 4PJNA 2Q5ZA 5HFLA 2XLOA 3CZ6A 2IBZH 5F28E 4DK1A 4C3EA 4MTOA 4TOIA 2AXTZ 2R05A 2J0WA 3F7VC 4DR2B 1O5HA 3HKEA 1I4YA 1V55B 3SPJA 2M4EA 1S0VA 4N6HA 4HAMA 4I55A 1QU7A 1Q7YW 1JAFA 5DM6V 4DUYO 1X4TA 2XM0A 4UCRA 1EZJA 2WLNA 2Q7RA 1H2KA 4LF4B 1IDSA 2D2CB 5L0HA 1R5ID 4FLVA 1EQ1A 5KYNA 4TV8B 4KNWA 3S9OA 3NKEA 2VRZA 3CRQA 3SYPA 3RYIB 2X0LA 4XEKA 2DE0X 4IIJA 2AZ2A 3WU2Z 4B7KA 4YJ2B 5KA5A 1QCEA 3EG9B 5JSLA 1GTOA 4MT8A 5T3TA 2ZXWB 3MAQA 4IRUA 4BJ5C 4LFCO 1QSPA 4DR4O 1RPRA 2DYRB 3JT1A 5EIBC 3IAYA 1BS3A 1N32O 4YIOA 5EYPB 3Q6MA 4RDAA 5J2TA 3W8IA 1K04A 1VQLV 3LSSA 3JASA 5L0GA 3HKCB 1LVKA 4FM1A 1HDJA 3T1HO 3UGPA 3HKDB 1NH2B 2CNWD 2P0NA 4YJ3B 1RJ9A 1WN7A 5JJJB 1A7VA 3QW0A 2B0HA 3JAKA 1XQ8A 2D3OW 4UV8A 2N05A 1G1XB 4OIQF 1FMWA 2QM8A 4KI2A 4CJOA 3OR7C 3TULA 5L0IA 2QM4A 5L0FA 2QWRB 2HHHO 1HE1A 3HR0A 5LBQA 4GKJB 1LS4A 3B29A 1PNMA 4BPMA 3WAQA 4XEVA 1VQ8V 1K05A 2EIJB 1MMDA 3VBBA 1N34B 4HEAJ 3DZAA 3EGXB 3ZEDA 5B1BB 5B1AB 1XZQA 3V7OA 3A2FA 1BL8A 2DOSA 2L6HA 2WWWA 1FR0A 4UFZA 4ANJA 3SGIA 2OYQA 2M64A 3I5QA 4TV9A 1GMGA 1WA8A 4GUNA 5KAFZ 1GAXA 1FPOA 4LBEC 3FD9A 1NU1H 2E3CA 3ICXA 3OTOO 3CMEV 4U5BE 3S0XA 2AWYA 5IDJA 4D4NA 1R73A 4XBFA 1E2XA 4LF9B 1P84F 2JJ1G 4EUKB 2G3KA 3ZSUA 3L73H 1W59A 1HW1A 4E7SA 3NYLA 4BW5A 1PD0A 1KTMA 3H1KH 2WLJA 4H44B 2Q9LA 2VQEO 1GO3F 4K35A 1AP6A 3HKCA 1Q86W 1KKDA 3W4YA 3HKBB 2ZDIA 3TETA 4ASUG 3VOUA 4TWKA 4HE8D 4CS8C 1CPQA 3OEOA 3IC7A 2Q0AA 5KYYB 3U9JA 5H6QA 4WF9V 4DR3B 1RSOB 3DE8A 4FPPA 4X65O 1IVSA 4XQ1A 1YA7O 3AG1B 2FB5A 3K5LA 4BJ6A 4JKVA 2WLHA 1UG7A 3SNHA 1FMVA 3OUSA 4RWUA 1J5EB 1PD1A 1NR1A 4WFBV 1H2GA 2L6LA 1SF9A 2A68F 3GANA 2A79B 5EBMC 3CSXA 4NXNB 3EPVA 1H9TA 3D36A 3EH1A 2YI9A 4LF6O 3NRHA 2HJDA 1PD3A 1VQNV 3WG7B 1KP3A 5KLVH 2CTPA 3DC5A 3ABTA 4E0HA 1TWAA 2O9XA 4HFKB 2QKCA 4PK4A 1S5JA 1N0NA 4FM0A 3TJ6A 3Q4HB 3MBGA 3CAXA 1MQVA 5L3CA 3EFOB 4DUZO 4X64O 1Q0KA 4DW1A 5K1XA 2WLMA 1OCRB 1HMDA 1FXVA 1FAPB 2EIKC 5LMUB 1MMAA 3HLZA 2V7QG 1S76D 2XHBA 1XMQB 2CTQA 4GT1A 3UQ8A 1IW7F 4WABA 1K34A 3ETEA 3SR2C 2IJHA 2ZNJA 3STZC 5JH7B 3IJ4A 4YIPA 4YL3A 3CEIA 1EFRG 3JSNA 3AQBA 4JI6O 5ITZA 3BA9A 1N34O 4I0XA 4DV4B 1KQSU 1YZBA 4FLYA 2EPMX 2LFRA 2WLLB 4J9YB 4CH5A 1V9PA 4K0KO 3A8TA 1M57B 3ZMTA 1G4WR 1I5XA 5D92A 1AILA 3LDEA 1IBLO 2KG7A 4LP8A 1THZA 3E8FA 1TWHA 1ZW3A 5KYWA 4B3SO 3F5WC 2RCVA 1NTZH 1XDCA 4FFBA 4GQHA 2KQXA 3QTHA 1XI1A 4LF9O 4IARA 3S28A 2R70A 3C90A 4B6IA 2VCAA 3NG1A 4JTAB 3DAGA 1K97A 5H5NA 2HMZA 2HSBA 4IYIA 1S3JA 3OUFA 4OPHA 5CBGA 4GYTA 1XL4A 4DV1B 1SC5B 4JAVA 3RYIA 1XMOB 3NMIA 4O6YA 1D1CA 5KUKA 3TK1A 3QVNA 1M5IA 1B68A 1NU7D 3E8GA 3GEHA 3BEHA 3IPMO 4H54A 4DR6B 3IEEA 4G28B 1R6TA 1RCPA 4YT4A 4DR5O 5F5HA 4GCZA 3EG9A 3DMDA 1QQCA 2KSDA 2QTSA 1HW2A 2P90A 2XAHA 4JZGA 1YLMA 4CIHA 2LQTA 4O4HB 3ZWIA 1ZU5A 3RT3C 4GKJO 4OX9B 1XREA 3G4SV 2HP8A 2ZPAA 3RGBA 2HLDG 1H2MA 2EJ7A 2ZXPA 4MTXA 1QLEC 1W0JG 3KKBA 2O57A 3JYYA 2XS1A 3RFRA 4X64B 3AG2C 2KSFA 2AZ0A 2R7RA 3MYFA 1CGOA 4JPRA 4NR1A 2ZKOA 1YITV 3JALB 4C3DA 4YWQA 3I5DA 5KYWB 4Z1VA 2QDOA 4MSWC 2P6JA 3ZDLA 1NTKH 3LAYA 1Q90D 3TD7A 4I50B 3KG2A 2FTKA 3ABKB 4FIPC 1AI5A 4LR3A 2KC3A 4FLWA 2CDQA 3FYEB 3LNNA 4N23A 1AROP 4CS9A 2H7OA 1U97A 3F47A 2W9YA 2QE9A 4U7NA 2YS8A 4JE9A 5LHIA 5H6RA 3E8HA 2YRFA 3CC7V 1Z63A 1C03A 3V5XA 1VF5B 3SJAC 1VMGA 1AI4A 4DO2A 3EJNA 5LHHA 4JI4O 1H8HG 4DV1O 3MFNA 3ZRWB 2HS5A 1HNXB 1I4ZA 4N4WA 3AK1A 3JCUZ 4JF3A 1QVXA 4U5CE 1VLTA 3ZMZA 1US6A 4UB6Z 2YIBA 4TSFG 5KUMA 3L74H 1PNLA 1Q81W 4JYYA 1ZAUA 2GWWA 4UXNA 4N6CA 5IJ0B 4JI3B 2GFHA 2NSGA 1D0XA 2A0BA 1EKYA 4CC5A 4R8CA 3VQWA 3EQLF 1H6GA 1ZHWA 5CIVA 4X66B 2F66C 2XM4A 3ZIBA 1QHTA 2BL2A 3APOA 4PDMA 1C02A 3C62A 1OKKD 2CGEA 1M56B 3O9OA 2P7VA 2QY9A 2X6AA 4WFFA 1C17M 2Y4TA 1FFXB 4JI8B 4YXWG 3ASOB 2XLHA 4DR4B 2XAQA 3FB8C 3TOLA 4H37A 4LNUA 3GM3A 4IAQA 1Z5WA 3OT7A 4K8ZA 4I55B 1VQ6V 3T2MA 2QA4V 4DR7B 2DN9A 5KHKA 4JEAA 1YJGA 5H2FZ 1LR1A 3M1CB 1KMIZ 4LWSA 4MVZA 2KW3C 1M90W 1YIJV 3QMKA 3DXRB 4Z9HA 2IM8A 2NN4A 4RAIA 4EFBA 4BG0A 1NS1A 1PV3A 1TA8A 2QM7A 4PDRA 2WVNA 4D7TA 2ETNA 3CB2A 4ZOLA 2ATKC 4BR6A 4A5UB 4PD4F 1XNRB 1Q82W 5IT9N 1P49A 4JI1B 2YC0A 1KYOF 2RN9A 1OXBA 2UUCO 4J32B 3TXSA 1A32A 2KKWA 4Z1MG 4NXNO 1FFXA 2UUAB 4MVQA 4NTYA 5CI8A 2X6BA 1BR1A 4N06A 2OIGA 5EYPA 2PNOA 2XLMA 4YT8A 2YIAA 4I7ZB 3UT5B 3S3XA 3GEIA 4E2LA 5A6KA 1NR7A 4QNHB 4PACA 1QR9A 2GDSA 2BSKA 3CCMV 1FJGO 2GAQA 3T4DA 3SJQC 4BEJA 4X20A 4WFGA 4AK9A 3SYOA 3LDCA 5C93A 4UB8Z 3D8CA 3N2ZB 4E7ZA 4UUJC 2CH7B 4X1IA 3AGUA 1W2BU 1G4US 3B4SA 2CUGA 1XHZA 5HV9A 1GM8A 3G6BA 2JK5C 1N4CA 4B3MB 3V5YA 4IYHA 1N33O 4RD9A 2Y0IA 2HJFC 3RIPA 4KHPB 3GWKC 3DXRA 2R02A 4F6RA 3T4ZA 4JTCB 2HVKC 5D91A 1FD9A 1ROPA 1IBMB 1ZHYA 1NKDA 1N36O 4KUMA 1KP2A 3AG4C 2LSEA 2XL6A 2NLJC 3E35A 5DEDA 1WP8A 4G7ZF 3SXKA 4UCVA 3AG7A 3FX7A 3U3BA 3E22A 1UFIA 4JVSA 4W4KA 1N32B 1J8MF 1HWYA 5AC4A 4JGSA 3X2QC 2DQ3A 1R3JC 1Y76A 3UM7A 4BW9A 1E1RG 1OCZC 4G7HF 2X51A 3POVA 3SJBC 1MSDA 5BR8O 5EHHA 5EK0A 2Q8VA 1CPYA 3CRMA 3D3QA 3JSLA 3J80N 1Y74B 2XAFA 2ILMA 1SS3A 3SP1A 4Q6GA 3E8BA 2GTAA 2QKAA 3SPHA 3JALA 1EN6A 4O4IA 4BJ6C 3LNRA 3PMRA 1VLSA 3OA1A 4X1YB 3M99B 1Z23A 3ZX6A 1WASA 3ASNB 1MNEA 3R66A 3AG4B 2R03A 4GZRB 4JI0B 1Y4CA 2A6HF 4J9ZB 1YCIA 4PJMA 1NJIW 4JEBA 2JEXA 1OW8A 3VM6A 3HJCA 4ULVA 5L3VA 2YIDA 4DV5O 3IQ6A 5LOVB 4FM2A 2Q3TA 3JYHA 4I1OB 3RQFA 1NH2D 1BT8A 2IW5A 1WATA 1OCCC 2CAZC 5A2QN 4KP4A 5E79Z 1SZXA 2WSSG 3LSUA 1XOUA 3J7AU 4NCQA 4H33A 1YF2A 1WOLA 3HKEB 3CD6V 4QIWF 2WL8A 3IQCA 2JGDB 1B3QA 1IX9A 4O4LA 1AR4A 4OGQB 3ZBHA 2W4MA 4XEFA 3K3WA 3EGDB 5JJNB 4KC9A 4YL1A 4M63A 1FTSA 4G78A 3RVYA 1MZEA 2BC5A 4BEMJ 1GGQA 2EINB 5C8YA 4H13B 2DMXA 5IWAB 1JR8A 1O3UA 1E1QG 4NTFA 4JI6B 2R7OA 2LFDA 1NQTA 2Q4PA 4ZHQA 1A7DA 5DN6G 4LFBO 2A0UA 5JS5A 1KBHA 2HEPA 3D3IA 1D1AA 3W7WA 2YEVA 4HBNA 3RWRD 1Q6HA 5JCOC 2Y3BA 4TQFA 3OAAG 5EC2C 3W7XA 1GM5A 3QF7A 3T9OA 4DV3O 3ASNC 2YQYA 2WA3A 2ZE7A 4NVPA 3LS0A 1EM1A 4X88A 3WFVA 1AVMA 4MVMA 4I4TB 1S7ZA 1FS0G 2QWPB 4ICGA 3EGDA 3QW1A 2VH3A 3BA8A 1LPEA 2AWCA 2JDIG 1TFOB 1SMYF 3CS5A 2QR4A 3DAFA 5JUAA 3US6A 3PHF2 2V3CC 1R3IC 2Q7HA 4QJFB 3T1YO 2E87A 4PDLA 4G2KA 4TUYA 3RYCA 2EINC 2YI8A 1YJWV 4O79A 4EIYA 1K33A 5KA6A 3UNGC 2UUHA 3M79A 2Q73A 2YEVB 1M4UA 4AI8A 3U11A 3OMNB 1D0ZA 1AP5A 1Q8IA 3UKMA 1SQBH 1BZ4A 2XTAA 2HSQA 1WN0A 4JI8O 5DS4A 3JAWB 3QZCA 2LCHA 2F4VO 2BSKB 3VQYA 3UMKA 1VYIA 1BCCH 4X20B 5CA0A 4X1KA 1RSOA 3CYOA 4GKKO 1VQMV 5IYBO 1D5NA 1KC8W 1T9KA 1JFFB 3SDLA 2B1GA 1V74B 2OCHA 4JYBA 2J9VA 3SYCA 1SQQH 2E5LB 2XLWA 4C3BA 2Y3DA 4I1MA 4O4HA 2OKUA 2XSEA 2OG2A 5IYDO 2IYLD 2XL4A 1TKNA 2N04A 4CS4A 4I44A 1EN4A 2HUJA 5KX5B 4JRZA 4AL0A 3SPGA 1JOGA 3DWWA 1MABG 1BQ0A 3K9AA 1XZPA 3ZTMA 4ZLDA 1N33B 2L9JA 3HKKA 1QVGU 3LLIA 2AP3A 1WLEA 3B0UX 5BY1A 3NXSA 2Y39A 3FOPA 5GW7A 3Q4HA 2BTQA 3ZJZA 5COFA 2ADPA 2J7PD 4IB4A 1OCCB 4OD5A 3A0RA 5LP6C 1LNQA 3KCXA 3LJBA 2TMVP 1A0BA 1K7DA 1FKAO 2OIEA 2AGAA 5L3QA 2NUTA 1K8AW 4YJ2A 3CE2A 5AC5A 4MS2A 1B04A 4ONSA 1VF7A 2UXXA 2YXHA 1GQAA 3BRJA 3RFYA 5JRAA 1KKCA 3OMIB 1PV0A 3LS1A 1E83A 3ZRVA 2PX3A 3L8JA 1DOWA 5CA0B 2EILC 3NKDA 1NLXA 2Q6AA 1K9MW 2KNHA 3FOOA 4UCSA 2R7XA 4PDVA 2OEVA 3CCSV 3TJTA 4JI2O 2UUCB 5L0DA 1SF8A 4K0KB 4DOZA 1GK9A 4O7GA 4F4LA 2NG1A 1HP8A 2XASA 4HNAB 4JYCA 2ZIMA 4EHPA 4GX1A 1LE2A 3OE7G 4WFHA 4K1OA 3OM3B 5LGTA 2QUPA 4XLNF 3EXAA 1GN4A 3LSQA 5KMGB 1NFOA 2UUIA 1NFNA 1M2VA 1JMWA 3VQVA 4CH3A 1W0KG 3TK0A 5GONB 3C3SA 4NXMB 2V26A 4YY3B 4J41A 2LGQA 4WFAV 2E75B 1F7YA 4DVZA 4OXSA 3ZTZA 1FJGB 4LWSB 3GODA 2OOCA 3CCRV 1FNTc 1OZ0A 2RNBA 4LERA 4WBNA 4FLZA 3ABMC 4CZZA 1IZMA 4OPAA 1N1CA 3Q7LA 4F4BA 2YIBD 2H8PC 1E84A 2Z3YA 5BQHA 5EZYB 4DRXB 4J11A 4JAAA 3N24A 2PY5A 1SESA 3EVKA 3QG5A 1YEWA 2VCCA 3UR3C 2QKSA 2VQEB 1SA0A 3WB0A 4U3JB 4LFCB 2W0XA 3K5OA 4JTDB 5FZTA 2WVQA 2P67A 2FFHA 1RP3B 2DYRC 3OMAB 1NSGB 4JASA 4WGZA 4BIOA 2WB7A 5DQTA 4IAOA 3ZIAG 3R65A 3ZCCA 4X65B 3KH2A 2LD6A 2Q4FA 3U10A 1XEQA 2CNWA 4P2ZA 1ORYA 2QLAA 4JJFA 1U96A 3DXJF 1IXMA 4CSAA 1S05A 4EKWA 3BVOA 1VF6A 2YKZA 3KPHA 4NB5A 4NTBA 2PP4A 4CS3A 256BA 2RMKB 4B3MO 2GTSA 3N0TA 4U5FE 3ML0A 2JVDA 3R7CA 3M7MX 3WB2A 2R72A 4P9PA 2GDCA 2YLGA 4P9OA 2I15A 5A69A 5KYYA 4AE4A 2ARHA 2Q69A 3EFOA 3H2UA 1EN5A 3ECSA 2Q0OC 1PCXA 4AL1A 4D7SA 4KNVA 3G50A 5LHGA 4KFMA 4JW1A 4I5SA 1R4TA 1YAUO 5LP6B 3JAMN 2YSUB 3ZVRA 5CI9A 2LGWA 3T1HB 4GKKB 3RYHB 2A3QA 3TQOA 2J0XA 4GYCB 3RW0A 5K1PA 4BJTA 5BQGA 3E22B 4KL1A 5DECA 4JI1O 4ZLCA 2P61A 2Y48A 1Y4MA 3ZMUA 1W2WA 3A0BZ 4L6RA 4IHJB 2HFEC 3OGIB 2H8AA 3WODF 4PA7A 1GM9A 4MTGA 1WP7A 4JCHA 3FXHA 3BHPA 1RKCA 3CP1A 4DJ9A 1R1BA 4K3AA 2UU9O 1Q0FA 2IU0A 2OTLV 5IE9A 4WFEA 3GWNA 2OJQA 4FLUA 1T6QA 1SRYA 4DR5B 1VQPV 1LUVA 4J7TA 5CA1A 4TT3G 2P22C 4DUYB 4UCUA 2NSFA 4ZKIA 1HY5A 1SZTA 1T01A 2E5LO 4JZ2A 3L1MA 1Q6UA 2RJZA 4QI0A 5D5QA 3D36C 4U5EE 2UXBO 1OHHG 3JASB 4F6EA 3SYNA 3I5PA 1BMFG 1J8YF 3MX3A 4YJWA 1BR2A 1Y6DA 2OJED 1JPNA 5JT4A 2VWKA 3M15A 1JFFA 4LF7B 3QVZA 4WGYA 3RYFB 4UCOA 1Q3EA 1NVPD 1M1KW 1F4NA 4QGPA 1UJWB 2L35A 2ZM6O 5HSWA 4UVBA 2P7TC 3H1HH 5A6BD 5JVEA 1KB9F 3G67A 3HNJA 5L3DA 4KXRA 2XLVA 4XPYA 1H2NA 2EZOA 3X1OA 1F51A 4J7KA 3L71H 3QO8A 3LDDA 2GBOA 3A0HZ 2IJKA 1RKEB 5J2UB 3CCQV 1OR2A 1WA8B 4TV9B 1IURA 4BJ1A 5KAIZ 5LYJA 2NUPA 4ZIBA 3WB1A 3L75H 1QNMA 2EJRA 4AILC 3T6BA 1I0HA 2QWOB 3W7TA 1AI7A 4BJ5A 3QVYA 1KU2A 1SQGA 1K4DC 4WJ0A 5L3GA 1XILA 2ZD9A 2ZR2A 3ZHUA 4AHCA 4YL0A 5KYXA 1G8MA 3M4CA 5D5PA 3CXCU 4ZHQB 4GLXA 3DD7A 5A6JA 1S5LZ 2AW9A 3CXHF 4BWAA 4J30B 3SJCC 1JJ2U 2JD3A 3U2MA 4DV7O 2IOQA 4R32A 3CRCA 2Q9CA 4GX5A 1F1MA 1A41A 4CS2A 2WVOA 1Q43A 2E74B 4LFBB 3JD1A 5GPGB 4XDKA 1CEZA 4Q20A 1M9NA 2ODMA 3FAVB 3NR7A 1M2OA 1CP9A 2J45A 3K58A 3BAAA 3MHSC 1MMMA 5IWAO 3PCVA 2ZE5A 3KCYA 5LA6B 4DVYP 3H2VA 1OW7A 4XLPF 3GWOA 2VQFO 4B7EA 2HZ8A 3S90A 4NXMO 3JTLO 4PA9A 1QVFU 1NG1A 5B1NA 4I9WA 5CB4A 4TUYB 3RYCB 1BBHA 4P9FA 3GVMA 3BY6A 2B9ZA 1LE4A 3ZRWA 3SYQA 2QE7G 1S5HC 1URFA 3TGUH 4X62B 1QZXA 4RQEA 3U9MA 3WHNA 1QPUA 2JEUA 5JQGB 2ZE6A 4JYAO 1YXBA 2PI5A 1OCZB 2RSEB 4MW3A 3K9SA 2LFSA 2Y69B 1L3PA 3ZG1A 2Z0AA 4JCZA 5E2QA 1KNYA 1YVIA 4J80A 1R6KA 4OD4A 3HB3B 1YHQV 1VYKA 2IXMA 4XWJA 4CSAC 1YSCA 4JI0O 1DF5A 3K06A 1H2LA 3M4BA 4NYKA 4LFAB 1BSMA 3W2WA 2BE5F 4NTWA 5K0IA 2R7WA 2PF4E 1I94O 1VB5A 5CN0A 3K1IA 4LDRA 3AG2B 2RD9A 1WAZA 2P1AA 2YWAA 5T3WA 3B0VC 3JD3A 5JVDA 3FYIB 1TWGA 3MYIA 2LK4A 5BMVA 3DJNB 3OWTA 4LLCA 4O2BB 2K1EA 5JQGA 3W8HA 3HKDA 2UXCO 3JATB 4P6IC 4DW0A 4OIRF 2AHYA 1SQPH 2LW1A 4R6ZA 4O2AA 5FCLA 4CDVA 5CB4B 4CDYA 4QI2A 2NNUA 3B09A 4QPJA 3Q6NA 3CPWU 4LCUC 1FXKA 1ENVA 2A7WA 2CK3G 4O4IB 2QGNA 2A06H 3U8PA 2EIMC 1DLBA 2GV9A 2ADQB 5GTHZ 4FK5C 1KU9A 4B3SB 3ABKC 2MWQA 1JCHA 1N36B 1O9GA 1MMNA 5FLXN 3ATPA 3QO5A 3VAYA 2XXAB 3P32A 1BDJB 2FGYA 4PFPA 3FMSA 2JS5A 3LEOA 1YARO 3E89A 2Q9AA 5HFMA 2QSAA 1PL4A 3C8GB 3JZ0A 4B08A 4JV5B 2WLIA 2LJ2A 4KBLA 4PJJA 2F23A 3CWBH 5IYCO 2ICWG 3K08A 3UO3A 1JVMA 5L3FA 3LNMB 3QTCA 2A6EF 3ZHVA 3ZC4A 2PUSA 3RYHA 4OX9O 3A9CA 1MNDA 2WZLA 4FMTA 4C7OB 4EEQA 3MDSA 4DV6B 1U89A 2CYDA 1WWPA 1AI6A 4P30A 1NI8A 4IHJA 1YZCA 3G4ZA 4DV6O 3V5ZA 3B77A 2JIZG 3KL4A 2Z5UA 3HKBA 3C3TA 1Z5ZA 2Z15A 4A2NB 3C18A 4FX5A 3ETDA 1QR8A 5BR8B 4U5GA 1OCOB 1VQ4V 5E3AA 4W4LA 1OR3A 4LF7O 3SXMA 3CEXA 3K7DA 1HNZO 5COGA 1O87A 2LFFA 4PHZA 4LF5O 2BCCH 4JI7B 1CGME 5CA1B 1YYXA 2VCBA 4JC7A 3UGOA 4CJGA 2BOBC 3CRAA 4LACB 5J2UA 2IXPA 1D2DA 1XBLA 4G7OF 1EA8A 3AGTA 1YTFD 2IU3A 4GX0A 3MD0A 1RPOA 4HZ3A 2KQ9A 4J7YA 5B3IA 5LYJB 1JA8A 4L87A 1YJNV 1ORQC 4YJ3A 4AQYO 1RJ9B 2ZR3A 2W6JG 3CSKA 5KYUA 4YT2A 1P7GA 3CJHA 3IFXA 2FKXA 4NTXA 3GM1A 2YZSA 1TUBA 1K5SA 3FAJA 3ABLC 2RDCA 3CX5F 1Z3IX 1B6QA 3I55V 1QKRA 4JZAA 2OTJV 2IH1C 4Q5SF 4G0HA 2HKVA 1K3EA 1BGYH 2DYSC 3KYJA 2X0CA 5DS6A 4X89A 1AVOB 1QQ3A 1T6IA 1N0JA 2K9PA 3DJUB 4ULWA 1GN2A 2HFIA 2HJ3A 3FAVA 3JSZA 3U3FA 4JI5B 1YI2V 1IZ3A 1M93A 3K1IC 3HNLA 1JOYA 3HNIA 1HMOA 1SERA 5BZBA 1AUEA 2EX3A 3S3WA 1K5QA 4AX2A 3AG1C 3VYWA 4EBBA 1BZKA 2R7SA 1TUBB 2JX0A 2XRHA 5T1DB 1A7EA 2QTVA 5COMA 3CCJV 2PYLA 1KUQA 2X6CA 1SYQA 2KGOA 2ZINA 3IQTA 1Y6XA 2UXDB 2CW0F 4JJGA 1TVKB 4U9EA 2IH3C 3B2EE 2QTOA 2J8WA 4E0IA 3ZN0A 1TQGA 3GEEA 3K1HA 3O6XA 4HYOA 2F93B 4U5DE 2FL4A 2RQ6A 5F5FA 3FHDA 5IYZB 1GN6A 4QPKA 2EULA 2EBOA 2W45A 3OTFA 4WCEV 3ABLB 3AG3B 4X0RA 1I08A 1CPRA 2WPDG 5LMNB 1RM1C 2HG5C 4I50A 1EBOA 3BCCH 4OIOF 1UPGA 2J7PA 1L1FA 2JRIA 2LP7A 3CRRA 4EWCA 2I8BA 4NTAA 2YLIA 1Q0GA
chains in the Genus database with same CATH topology
4MSWC 4FESA 2P6JA 3LAYA 2WVQA 2P67A 2FFHA 1OCOC 2DWEC 2G3VA 3K66A 1WPXA 3OMAB 2DYRC 2X7RB 4X8AA 4MVSA 3T1CA 3TD7A 4BAYA 2EIJC 3FKSG 3EFFK 2FTKA 3ABKB 3KG2A 4FIPC 2ZXWC 4JASA 1AI5A 2WB7A 3SPIA 4GEHA 4IAOA 5DQTA 3ZIAG 3R65A 1AJQA 1H8EG 3ZCCA 3OEEG 2CDQA 3HTKC 3FYEB 3G6EV 1LS1A 3KH2A 3QNEA 4N23A 3RH3A 2CNWA 4P2ZA 1AROP 4CS9A 2H7OA 3F47A 4JJFA 2W9YA 3S27A 3DXJF 4CSAA 1IXMA 4U7NA 2ZXRA 5BUOA 3FB6C 3EZHA 4O6NA 2B1IA 3F7YC 2DGJA 5LHIA 5H6RA 3E8HA 4EKWA 2IJIA 3CC7V 3CC4V 2PX0A 1Z63A 1SETA 3NDBB 1AI4A 5B1AC 2XOKG 4DO2A 3JD0A 2KJGA 5LHHA 2PP4A 1AJNA 2WAMA 5CA3A 3EJNA 2KB1A 1H8HG 4IWBA 3UMHA 2V1DA 2XAJA 3ZRWB 3N0TA 4U5FE 4OIPF 3ML0A 4JF3A 3K33A 4U5CE 1TR2A 1ZYRF 1YJ9V 3ZMZA 2Q67A 4P9PA 4I3MA 1H38A 4P9OA 4TSFG 5KUMA 3B0VC 2ITCC 1PNLA 1Q81W 4XDLA 2GHYA 5KYYA 1BHAA 5CBHA 4AE4A 2PFDA 2Q69A 3EFOA 3ECSA 4U7OA 4UXNA 1PCXA 4IJJA 4KNVA 2GFHA 2Y3HA 5LHGA 2B5UA 4KFMA 1D0XA 3EQLF 4R8CA 4JW1A 1PL0A 4I5SA 1ZHWA 1M57C 1ZHZA 3HPLC 1AR1B 3ZIBA 2YSUB 3K6BA 3ZVRA 1QLEB 4MVRA 4PDMA 1S77D 5CI9A 3H65A 2R7TA 3LEVA 1K73W 1OKKD 2EILB 2CGEA 4C7OA 1M56B 3EHBB 2OCCB 2P7VA 2IJJA 2QY9A 2X6AA 1ST6A 3JD2A 4Q7CA 2J0XA 4AE4B 4WFFA 3RW0A 2W4BA 4BJTA 4YXWG 3ASOB 2XAQA 3FB8C 4ZLCA 3ZN1A 2B0JA 2Y48A 1Y4MA 3OEHG 4H37A 3ZMUA 1S72V 1W2WA 2HV6A 2HFEC 3WODF 4CBCA 2NUTB 1OKKA 4PA7A 1GM9A 4MTGA 1VQ6V 4JCHA 3T2MA 2QA4V 5J9PC 2VB6A 3CP1A 5EBWC 2A1DD 3EH2A 1PKXA 4MTFA 2Q68A 4MVUA 3EGXA 2IU0A 2OTLV 3DM5A 4WFEA 1D1BA 2KW3C 4MVZA 3M1CB 1M90W 3SYNA 1NU9C 1YIJV 3QMKA 1V54C 2ZQMA 1JPXA 2R7VA 4RAIA 4BG0A 2A9HA 4PFOA 1NBMG 2QM7A 1SRYA 4PDRA 2WVNA 1VQPV 2IXNA 1M2VB 4TT3G 1MSWD 4CS8C 2ATKC 5DS5A 2JJ2G 2WZGA 1ZWIC 4ZKIA 1Q82W 4JAUA 3LUTB 1SZTA 1DTOA 3DTUB 4G27B 3ZMVA 4DXWA 4RO2A 5B3SC 4QI0A 1XL6A 3K0DA 4J32B 1KECA 2DQ0A 2MK3A 4Z1MG 4U5EE 1OHHG 4MVQA 1VQKV 5CI8A 3CCVV 2X6BA 3K03A 1BMFG 4ZBMA 1BR1A 3I5PA 1J8YF 4N06A 2R9IA 2EIMB 3RBZA 3MX3A 1BR2A 4YJWA 2HKOA 2PI4A 1ZU4A 4DBRA 4YT8A 2Y3GA 4R7CA 4PA6A 1JPNA 3LLIA 4FWVA 3W2VA 4E2LA 2G62A 3K79A 3LLKA 1NR7A 3LESA 4QNHB 1AJPA 3P30A 1NVPD 1VQ5V 1RM1B 1M1KW 1F4NA 1QR9A 3WG7C 1UJWB 5HSWA 3CCMV 4UVBA 2P7TC 3T4DA 3SJQC 2UXNA 1NVPB 1KD1W 4FX5A 4NY3A 4BEJA 1MMGA 2VASA 5L3DA 4WFGA 4AK9A 3SYOA 3LDCA 2EZOA 3X1OA 1F51A 5C93A 2C2AA 3N2ZB 3AQCA 4UUJC 5LGUA 4E7ZA 3QO8A 3LDDA 5H9CA 2W6IG 3SPCA 3B8MA 1W2BU 2IJKA 3CCQV 1YTFB 1FXKB 4BJ1A 4CS9C 5KYUB 5EGYA 1GM8A 3MHHC 2JK5C 2NUPA 3EHMA 4E7SA 3E70C 4XDJA 2EJRA 3ITFA 1Z6AA 3KMIA 3T6BA 3W7TA 1AI7A 1P4RA 4BJ5A 1JPJA 4RD9A 1D0YA 3CQZA 1KU2A 1VQOV 4WJ0A 1K4DC 2HJFC 5L3GA 3RIPA 1F23A 2DWDC 3E2EA 3OGCC 2ZD9A 2ZR2A 4MNDA 5KYXA 3G71V 1VOMA 1G8MA 2DW4A 2EZPA 1TUEB 3CXCU 2ZXOA 3DD7A 3Q7GA 3T4ZA 4HFFB 2J9UA 3RKOF 4JTCB 2HVKC 2A69F 4J30B 1GM7A 1JJ2U 2JD3A 5D91A 1R3KC 3FVYA 5KYXB 2IOQA 1ROPA 1ZHYA 4MQ9F 5E33A 4Q4ZF 1NKDA 2Q9CA 4KUMA 1KP2A 3AG4C 2OT5A 4GX5A 5DQZA 4PJNA 3ABMB 2LSEA 2NLJC 4R50A 3E35A 2WVOA 2Y69C 5HFLA 3CZ6A 3JD1A 4G7ZF 4XDKA 5B3SB 1CEZA 4C3EA 2ITDC 4MTOA 4Q20A 1M9NA 1M2OA 4JURI 4PA4A 1CP9A 2J0WA 2J45A 4JVSA 1J8MF 3F7VC 4BIZA 1HWYA 1O5HA 2WLIB 4JGSA 3MHSC 2DQ3A 3X2QC 1R3JC 3UM7A 1E1RG 1FXKC 1V55B 3SPJA 2M4EA 4LLEA 1OCZC 1S0VA 4DVYP 4G7HF 1NZEA 2C04A 4HAMA 3GWOA 4XLPF 1Q7YW 2X51A 2R7UA 5DM6V 3POVA 1V54B 4PA9A 1EZJA 1QVFU 2WLNA 1NG1A 4I9WA 5B1NA 5EK0A 5EHHA 1M56C 5CMUA 1CPYA 3BY6A 4U5HA 3ZRWA 3SYQA 2QE7G 1S5HC 2XAFA 3MLGA 1QZXA 4RQEA 3I56V 5KYNA 4KNWA 2JEUA 3PHF2 3SP1A 3T4RA 3NKEA 1WGWA 3E8BA 4RUEA 3SYPA 5CBFA 1Y66A 4DBQA 3SPHA 2X0LA 2PI5A 1OCZB 3E9VA 2YHSA 4MW3A 3LNRA 3PMRA 4BJ6C 5KA5A 3OFNG 1QCEA 3EG9B 3OA1A 2LFSA 3M99B 1Z23A 2Y69B 1GTOA 3ASNB 4MT8A 2ZXWB 3FB5C 1MNEA 4IRUA 5T3TA 1F4MA 3ZG1A 3AG4B 5E2QA 4BJ5C 1RPRA 2DYRB 2A6HF 4J9ZB 3JT1A 5IY5B 4PJMA 1R6KA 2OCCC 4OD4A 4RUFA 1NJIW 3HB3B 2GSMB 1YHQV 1QLNA 2JEXA 1VYKA 2IXMA 3Q6MA 4RDAA 3HJCA 4QE9A 1VQLV 2AHZA 4XWJA 3W8IA 3LSSA 3CMAV 5L3VA 4CSAC 1YSCA 1DF5A 3K06A 1LVKA 4UVAA 3UGPA 2Q3TA 1NH2B 2CNWD 3JYHA 4I1OB 3W2WA 2BE5F 1RJ9A 4GX2A 2R7WA 2PF4E 1NH2D 5CN0A 5IY5C 3AG2B 2XAGA 2D3OW 4UV8A 2IW5A 3ETGA 1OCCC 5T3WA 3SYAA 1FMWA 1E79G 2QM8A 5FL7G 3JD3A 1ZHXA 3OR7C 4KI2A 4KP4A 1TWCA 3FYIB 1TWGA 2WSSG 1N8RW 5LBQA 3DJNB 3OWTA 4LLCA 1G4YB 4H33A 1PNMA 2K1EA 3CD6V 4QIWF 1QBZA 2WL8A 3W8HA 3S29A 1VQ8V 1K4CC 2W4MA 4P6IC 2EIJB 3K3WA 3EGDB 4OIRF 3JD4A 1MMDA 3VBBA 2AHYA 4KC9A 4R6ZA 4HEAJ 4M63A 1FTSA 3DZAA 3RVYA 3EGXB 2WZFA 3W7SA 5B1BB 4W8KA 3ASOC 5FCLA 3SZRA 5B1AB 2EINB 2MYSA 3V7OA 1BL8A 1I5YA 4QI2A 2NNUA 4QPJA 4XTKA 1E1QG 2WWWA 3Q6NA 3CPWU 4ANJA 1MOFA 3I5QA 4LCUC 1FXKA 1GMGA 3JCUQ 1ENVA 2R7OA 3FB7C 1NQTA 2CK3G 4LBEC 2L81A 5DN6G 3F46A 2EIMC 1DLBA 3ABUA 3QO7A 1VQ7V 3D3IA 1D1AA 2HVJC 4FK5C 2YEVA 3W7WA 2Y3BA 3E86A 3ABKC 3CMEV 1JCHA 2MWQA 4U5BE 3S0XA 5IDJA 5EC2C 3OAAG 1MMNA 2J9WA 1R73A 4XBFA 4H4KC 3W7XA 3H01A 5EBLC 3QO5A 3VAYA 2XXAB 2JJ1G 3P32A 3ZRXA 2FGYA 3ASNC 4PFPA 3DGEA 2G3KA 3ZSUA 3LS0A 2HV7A 3E89A 2C03A 2XNDG 4X88A 3WFVA 2Q9AA 4MVMA 4BW5A 3NYLA 4RBNA 5HFMA 1PD0A 2W0FC 1S7ZA 2WLJA 1FS0G 1GO3F 2WLIA 4KBLA 4PJJA 3SNHA 3EGDA 3RVZA 5IYCO 2VH3A 1Q86W 1KKDA 3I4UA 4OIQF 2JDIG 1SMYF 5DVWA 3K08A 2ZDIA 3AEIA 1JVMA 5L3FA 3TETA 3VOUA 3LNMB 4TWKA 4ASUG 1BR4A 1SZIA 2A6EF 3DAFA 4HE8D 4YN0B 3ZC4A 1MNDA 3OEOA 3IC7A 5KYYB 2WZLA 1R3IC 4FMTA 4QJFB 2V3CC 2E87A 4C7OB 5H6QA 4PDLA 4G2KA 4WF9V 2XXAA 4FPPA 2EINC 2WLLA 1YJWV 4O79A 4BIUA 3AG1B 1AI6A 2M7WA 1K33A 4P30A 4CBEA 4LC1A 3OR6C 4PJLA 1BHBA 4BJ6A 5KA6A 1V55C 3UNGC 3GB7C 3B77A 3DM9B 2WLHA 2JIZG 3X2QB 3KL4A 2Z5UA 2YEVB 4K7BA 3CCLV 4N21A 3OUSA 1FMVA 5E3CA 1Z5ZA 2Z15A 1PD1A 3OMNB 1D0ZA 1NR1A 4WFBV 1H2GA 3UKMA 4A2NB 2A68F 2H7BA 3B9QA 3GANA 3ETDA 1QR8A 3NYMA 2A79B 1OCOB 1R6NA 1VQ4V 3QZCA 5EBMC 5E3AA 3EPVA 5DS4A 4PELA 3D36A 3EH1A 3UMKA 1VYIA 3JRTA 1GKFA 2EIKB 1PD3A 3K7DA 1VQNV 3CYOA 3NRHA 3WG7B 2HR3A 1KP3A 1O87A 1VQMV 5IYBO 2Q9BA 1KC8W 3ABTA 3UGOA 1TWAA 2O9XA 2BOBC 4HFKB 2DYSB 1G8XA 3OW2U 2B1GA 4LACB 4PK4A 4JYBA 1PNKA 2J9VA 2IXPA 3SYCA 4C3BA 5L3CA 3EFOB 2Y3DA 4I1MA 2XSEA 4G7OF 2OG2A 5IYDO 2IYLD 2XL4A 2D5RB 1TKNA 1COWG 2WLMA 1OCRB 4RQFA 1YTFD 2R9RB 1JX9A 2QEXV 1FXVA 2IU3A 2EIKC 4GX0A 4I44A 3MD0A 1RPOA 4HZ3A 1MMAA 3SPGA 2V7QG 3HLZA 1S76D 2KQ9A 5DLJA 1MABG 3K9AA 2H7VC 4GT1A 4ZLDA 2L9JA 1IW7F 1QVGU 1K34A 3ETEA 4L87A 3ZRSA 1YJNV 1ZHTA 1ORQC 1RJ9B 2R7QA 3CSKA 2ZR3A 1WLEA 2IJHA 2W6JG 3EZIA 5KYUA 3STZC 3B0UX 3NXSA 2Y39A 3IFXA 3CCUV 2J46A 1EFRG 5GW7A 2YZSA 3AQBA 3CC2V 1K5SA 3FAJA 3ZJZA 3O39A 1FFTB 3ABLC 4YT2A 1J95A 3JYCA 1KQSU 2J7PD 1Z3IX 2LFRA 2WLLB 4J9YB 4MW8A 1B6QA 3K04A 3I55V 3W7UA 1OCCB 2OTJV 3A0RA 4JZAA 4OD5A 2A0LA 2IH1C 1LNQA 3LJBA 4G0HA 4Q5SF 1DF4A 1K3EA 1M57B 1K7DA 3ZMTA 1LKXA 2DYSC 5DS6A 1I5XA 4UV9A 4X89A 5D92A 5L3QA 3LDEA 1K8AW 2NUTA 5B1OA 4LP8A 1THZA 3E8FA 4MS2A 3TCUA 3CCEV 2UXXA 3RFYA 1TWHA 4PA3A 3OMIB 5KYWA 3DJUB 4ULWA 1OCRC 3F5WC 3JSZA 3LS1A 5EC1C 4QDLA 3ZRVA 1YI2V 2PX3A 3K1IC 2EILC 3NKDA 2Q6AA 1K9MW 1JOYA 2KNHA 3S28A 1SERA 3STLC 5BZBA 4B6IA 4PDVA 2R7XA 3CCSV 1K5QA 1FXHA 3NG1A 4CS8A 2H94A 4JTAB 4AX2A 3AG3C 2ZDIC 3DAGA 1K97A 4CS7A 1SF8A 4MVOA 3AG1C 5CBGA 1S3JA 3OUFA 3VYWA 3PJSK 4EBBA 4GYTA 3FDQA 4DOZA 1GK9A 2WLKA 3B0PA 1XL4A 4F4LA 3B8NA 4UVCA 2NG1A 4JAVA 4O7GA 2R7SA 3L34A 1JQ0A 2XASA 5E1AC 4QE7A 1D1CA 2XRHA 5KUKA 3TK1A 4O6YA 5T1DB 1P7BA 3JCZA 4JYCA 3E8GA 5L3BA 3BEHA 1NU7D 2P6VA 3UMIA 4GX1A 2QTVA 5B1BC 4O6MA 3OE7G 3CCJV 3SEOA 4WFHA 3IEEA 3OM3B 4G28B 5LGTA 4YT5A 4XLNF 2X6CA 2KGOA 4YT4A 5LGNA 3LSQA 2CW0F 2IXOA 1R3LC 4JJGA 5F5HA 4GCZA 3EG9A 2IH3C 1M2VA 3DMDA 4K0DA 3ZMSA 2QTOA 2P90A 2XAHA 1W0KG 1VQ9V 3NYJA 3T6JA 4CIHA 3E83A 3ZN0A 1ZU5A 2V26A 3K1HA 3O6XA 4WFAV 4HYOA 4DVZA 4OXSA 4U5DE 3GODA 4FJCC 3G4SV 3FHDA 2BOCC 3CCRV 5F5FA 2ZPAA 3K0GA 4QPKA 1OZ0A 1MG1A 2HLDG 4LERA 2EBOA 2W45A 3IGAC 1K92A 3ABMC 4CZZA 4MTXA 1IZMA 2ZXPA 4WCEV 3ABLB 3AG3B 1FFTC 1N1CA 1QLEC 1W0JG 3KKBA 3Q7LA 4X0RA 4F4BA 2H8PC 2WPDG 1RM1C 2Z3YA 2HG5C 3AG2C 1EBOA 4OIOF 2R7RA 2J7PA 1L1FA 1VMAA 3EHNA 1FFHA 2NUPB 3N24A 1SESA 2LP7A 3L0IA 4JPRA 2F43G 1YITV 1VK5A 2QKSA 4OINF 2I8BA 3RYLA 3UR3C 4U5GA 5L3EA 4EWCA 4C3DA 4YWQA 5KYWB 4JTDB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RBZ A;  4MSW C;  4R7C A;  4PA6 A;  1OCO C;  2DWE C;  4GX2 A;  4X8A A;  2DYR C;  3T1C A;  4MVS A;  2WLM A;  5IY5 C;  2EIJ C;  3KG2 A;  2R9R B;  3EFF K;  4QNH B;  2EIK C;  1OCC C;  2ZXW C;  4GX0 A;  3SPI A;  4HZ3 A;  3SYA A;  3SPG A;  3WG7 C;  3OR7 C;  3R65 A;  2P7T C;  3T4D A;  3SJQ C;  4WFG A;  3SYO A;  3LDC A;  4P2Z A;  3ZRS A;  1G4Y B;  4H33 A;  1ORQ C;  2K1E A;  3STZ C;  3FB6 C;  1K4C C;  3IFX A;  4UUJ C;  3F7Y C;  3LDD A;  3E8H A;  4EKW A;  3SPC A;  3ZJZ A;  2AHY A;  5B1A C;  3ABL C;  4R6Z A;  1J95 A;  3JYC A;  2KB1 A;  3RVY A;  2WLL B;  4J9Y B;  4MW8 A;  3ASO C;  2JK5 C;  3K04 A;  2A0L A;  2IH1 C;  1LNQ A;  4XDJ A;  1BL8 A;  2Q67 A;  4P9P A;  2DYS C;  4X89 A;  4P9O A;  3LDE A;  5KUM A;  2ITC C;  1K4D C;  4LCU C;  2HJF C;  4LP8 A;  4XDL A;  3FB7 C;  3E8F A;  4LBE C;  4MS2 A;  3TCU A;  5CBH A;  2DWD C;  2EIM C;  2Q69 A;  2ZD9 A;  3OGC C;  4PA3 A;  2HVJ C;  2YEV A;  3T4Z A;  1OCR C;  3E86 A;  3F5W C;  3ABK C;  4JTC B;  2HVK C;  4KFM A;  5EC2 C;  1R3K C;  5EC1 C;  4R8C A;  1M57 C;  3HPL C;  2EIL C;  5EBL C;  2Q6A A;  3AG4 C;  4GX5 A;  3STL C;  3ASN C;  5BZB A;  4PDV A;  4MVR A;  2NLJ C;  4PDM A;  4R50 A;  4JTA B;  3E89 A;  2Y69 C;  3AG3 C;  4X88 A;  4MVM A;  4BW5 A;  4MVO A;  3AG1 C;  4XDK A;  5CBG A;  2W0F C;  3OUF A;  2WLJ A;  3PJS K;  2ITD C;  4MTO A;  2WLK A;  2WLI A;  1XL4 A;  4F4L A;  2X6A A;  4PA4 A;  3RVZ A;  1KKD A;  3F7V C;  5E1A C;  4QE7 A;  4WFF A;  3RW0 A;  2WLI B;  3X2Q C;  5KUK A;  1P7B A;  1R3J C;  3K08 A;  3E8G A;  1JVM A;  3BEH A;  3UM7 A;  3VOU A;  3FB8 C;  3LNM B;  4GX1 A;  4TWK A;  5B1B C;  3SPJ A;  1OCZ C;  3TET A;  4WFH A;  4H37 A;  4G28 B;  1R3I C;  2HFE C;  4CBC A;  4PDL A;  2X6C A;  4PA7 A;  4MTG A;  4PA9 A;  2EIN C;  2WLN A;  1R3L C;  4I9W A;  5EK0 A;  3T2M A;  2WLL A;  1M56 C;  5J9P C;  2IH3 C;  4P30 A;  5EBW C;  3OR6 C;  2QTO A;  2Q68 A;  4MTF A;  3SYQ A;  1V55 C;  1S5H C;  4MVU A;  3GB7 C;  3E83 A;  2WLH A;  4WFE A;  4MVZ A;  3OUS A;  4HYO A;  4OXS A;  1V54 C;  3E8B A;  4RUE A;  3SYP A;  5CBF A;  2BOC C;  4RAI A;  2A9H A;  3SPH A;  3UKM A;  3SYC A;  3K0G A;  4PDR A;  4MW3 A;  2A79 B;  3IGA C;  5EBM C;  3ABM C;  2ATK C;  1FFT C;  1ZWI C;  1QLE C;  2H8P C;  3FB5 C;  3LUT B;  2HG5 C;  3AG2 C;  4G27 B;  4DXW A;  4RO2 A;  4J9Z B;  5B3S C;  2OCC C;  4RUF A;  1XL6 A;  2BOB C;  3K0D A;  2QKS A;  4QE9 A;  2AHZ A;  4MVQ A;  2X6B A;  3K03 A;  4ZBM A;  4JTD B;  3K06 A; 
#chains in the Genus database with same CATH topology
 2YDE A;  4FES A;  3FFQ A;  4EB6 A;  2FYU H;  1OCO C;  2DWE C;  2G3V A;  1XUQ A;  3K66 A;  1WPX A;  4CX9 A;  4X8A A;  3T1C A;  4MVS A;  3BPZ A;  5FNV B;  4X66 O;  2EIJ C;  3FKS G;  3EFF K;  1TVK A;  2H7B A;  5TIS Z;  3G4X A;  4GEH A;  4DRJ B;  4JIO A;  4LF4 O;  1AJQ A;  3G6E V;  3P3P A;  4LH6 A;  2PZS A;  5A6A A;  3S27 A;  2CTW A;  2ZXR A;  5BUO A;  3EZH A;  4B3T B;  5IYZ A;  2B1I A;  2CH7 A;  4X1I B;  2DGJ A;  3CC4 V;  2IJI A;  1NTM H;  1SET A;  3NDB B;  4PR9 A;  5B1A C;  3UMI A;  4LLE A;  1U0B B;  1AJN A;  3UMH A;  2KB1 A;  2XAJ A;  2Y0P A;  2YXL A;  1FYJ A;  3ZS8 C;  1YJ9 V;  4I3M A;  4JI4 B;  1H38 A;  4FLX A;  2ITC C;  1BHA A;  2PFD A;  2XUM A;  5JP7 A;  4IT5 A;  4IJJ A;  3C8G A;  2Y3H A;  2B5U A;  4L8J A;  1H2S B;  1PL0 A;  4DV2 B;  1L0N H;  1M57 C;  1ZHZ A;  3K5N A;  2NPU A;  3K6B A;  1QLE B;  4MVR A;  2R7T A;  3H65 A;  1K73 W;  1K40 A;  4X1Y A;  4C7O A;  4DK0 A;  4A4A A;  5IJ0 A;  2XS8 A;  4AE4 B;  2V4D A;  4Q7C A;  1WB8 A;  2W4B A;  2ETS A;  1JRA A;  1AEP A;  1RXQ A;  3ZN1 A;  1Y74 A;  1HNW B;  2B0J A;  2QJ1 A;  2HV6 A;  1S72 V;  4ZI7 B;  3R2P A;  4CBC A;  4U9D A;  5LXT A;  4CIP A;  5LP6 A;  2HHH B;  5JLI A;  3IHU A;  1HW7 A;  2CCY A;  4J7J A;  5EBW C;  2A1D D;  1PKX A;  3JAR A;  4MTF A;  2Q68 A;  1PP9 H;  1GN3 A;  3EGX A;  4J7Z A;  2BE3 A;  3DM5 A;  1D1B A;  2JS3 A;  4PJ0 Z;  2J9B A;  1T6U A;  2CE4 A;  2ZQM A;  1JPX A;  2A9H A;  4PFO A;  5LMU O;  2JGD A;  2IXN A;  3C8Z A;  1MSW D;  1WTY A;  4CDA A;  1Z7Q c;  2JJ2 G;  3K5M A;  2WZG A;  4LFA O;  3LUT B;  3AOU A;  4E4E A;  1DTO A;  4G27 B;  2ZT9 B;  4RO2 A;  4CC6 A;  1OXK A;  3THO A;  5B3S C;  2ZNI A;  1XL6 A;  3K0D A;  1DOV A;  3KKY A;  2UUB B;  4DV0 B;  1KEC A;  2DQ0 A;  1NT2 B;  2MK3 A;  4E17 A;  2ZIO A;  4X9Q A;  5AG2 A;  4ZBM A;  4NQF A;  2EIM B;  2HKO A;  2PI4 A;  2Y3G A;  4R7C A;  4PA6 A;  4XPW A;  3W2V A;  2G62 A;  4O4J A;  3H1L H;  3H9V A;  2GA0 A;  3ZHT A;  3P30 A;  5KMG A;  4PV1 B;  1VQ5 V;  1RM1 B;  3DE9 A;  1Y67 A;  4E18 A;  1NVP B;  2VAS A;  2DJV A;  1X59 A;  1IXB A;  1FAF A;  4TQD A;  4FLT A;  4FVM A;  3AQC A;  5LGU A;  5H9C A;  2W6I G;  2MHR A;  1YTF B;  4DR2 O;  5KYU B;  2L6G A;  3RF3 A;  1E86 A;  2VC9 A;  3EHM A;  4D4X A;  3E70 C;  4XDJ A;  5EZY A;  4DRX A;  3ITF A;  2R9A A;  1Z6A A;  1RMV A;  3KMI A;  1GH6 A;  1GS9 A;  3KYI A;  3CQZ A;  1VQO V;  3N2G B;  1ZW2 A;  1F23 A;  3E2E A;  3OGC C;  4EFE A;  4MND A;  5JJE B;  3G71 V;  2EZP A;  4HFF B;  1TUE B;  4JI3 O;  3Q7G A;  3RKO F;  2J9U A;  4H0L B;  2LP4 A;  3TOM A;  2A69 F;  1GM7 A;  1EI7 A;  1R3K C;  4DV2 O;  4MQ9 F;  3ZHS A;  4DR1 O;  5DQZ A;  3AK3 A;  4R50 A;  1BE3 H;  3JAW A;  3APQ A;  2MW2 B;  1Z5V A;  2Y69 C;  5B3S B;  2ITD C;  2Q7E A;  1YVW A;  4JUR I;  4PA4 A;  4DRH B;  5L0C A;  4BIZ A;  1VAR A;  2Q7G A;  2WLI B;  1FXK C;  1DGS A;  1APC A;  1XHX A;  5LMN O;  5L0J A;  1NZE A;  2C04 A;  4PI0 A;  2R7U A;  4YY3 O;  1V54 B;  3BRC A;  1SQV H;  2LW7 A;  2YL1 A;  1T5E A;  1NZ6 A;  4UCT A;  1M56 C;  5CMU A;  1SQF A;  2PTM A;  4FFB B;  4JYA B;  1WNS A;  4U5H A;  3MLG A;  1RKE A;  3I56 V;  2UU9 B;  5JH7 A;  3T4R A;  1AR5 A;  1WGW A;  4RUE A;  5CBF A;  1Y66 A;  3E9V A;  2YHS A;  3K59 A;  2KG7 B;  3OFN G;  4DV0 O;  2VQF B;  1VTM P;  4PI2 A;  3FB5 C;  4JI7 O;  1F4M A;  1ORS C;  3ZQV A;  1YZA A;  2Y4U A;  4DV5 B;  5IY5 B;  2OCC C;  4CH6 A;  3VQX A;  4RUF A;  4JI2 B;  1XNQ O;  2GSM B;  1QLN A;  1LIH A;  1SR2 A;  2F4V B;  2BTO A;  4QE9 A;  2AHZ A;  3CMA V;  2DB4 A;  2OU6 A;  2EPK X;  4UVA A;  1XNR O;  4GX2 A;  4DYL A;  3AJM A;  5IY5 C;  2XAG A;  5KX5 A;  3ETG A;  2PBE A;  3SYA A;  1E79 G;  5FL7 G;  1ZHX A;  1HR0 B;  2F95 B;  1TWC A;  2HJM A;  1N8R W;  1ZL8 A;  3GWL A;  3UT5 A;  1G4Y B;  1JJO A;  5LOV A;  1QBZ A;  3S29 A;  1K4C C;  3L9D A;  1TGO A;  2LO1 A;  3JD4 A;  4DV4 O;  4LH7 A;  1CXZ B;  3W7S A;  1L0L H;  2WZF A;  4W8K A;  3ASO C;  3SZR A;  2EPN A;  3TJ5 A;  3L8I A;  4NC3 A;  2MYS A;  1I5Y A;  1XWJ A;  1G6U A;  3B40 A;  4W8P A;  4XTK A;  5A9G A;  1MOF A;  1HR0 O;  5KHJ A;  3JCU Q;  4JV5 O;  3FB7 C;  2NR5 A;  1ZX3 A;  2L81 A;  3F46 A;  3ABU A;  3JAT A;  3QO7 A;  1VQ7 V;  3DKA A;  2HVJ C;  3N27 A;  2CGN A;  1WJZ A;  3E86 A;  4Z9I A;  1ORJ A;  2J9W A;  1JR9 A;  4H4K C;  3U0Z A;  4J10 A;  3H01 A;  5EBL C;  4UDV A;  3ZRX A;  3DGE A;  1YDI A;  2F22 A;  1Q0M A;  2YL7 A;  4WBN B;  2HV7 A;  2C03 A;  4ZI7 A;  2XND G;  4RBN A;  2QWN B;  2W0F C;  3IQ5 A;  1ZUQ A;  1I5N A;  4IIJ B;  3RVZ A;  5KHG A;  1SKV A;  4HNA A;  3I4U A;  5DVW A;  3JAR B;  3O10 A;  3AEI A;  2AU5 A;  2FAP B;  1BR4 A;  2ZCE A;  4YN0 B;  1HNZ B;  3CHX A;  2QWQ B;  1OJH A;  1SZI A;  1HNX O;  2YL3 A;  5TJ5 E;  1Z2G A;  4EBK A;  2XXA A;  2L7A A;  2YVK A;  2WLL A;  3F5T A;  4BIU A;  2M7W A;  1Y76 B;  4LC1 A;  3OR6 C;  4PJL A;  1BHB A;  4F6R B;  1V55 C;  3GB7 C;  3DM9 B;  4YHH B;  3X2Q B;  4K7B A;  2D4U A;  5KYX B;  3CCL V;  4N21 A;  5E3C A;  4DUZ B;  1YA9 A;  4DR7 O;  3B9Q A;  3NYM A;  3O65 A;  2UXD O;  4ABM A;  1R6N A;  4PEL A;  3JRT A;  2XT9 A;  1GKF A;  2EIK B;  2HR3 A;  1AB3 A;  1Q5O A;  2Q9B A;  3L70 H;  1E85 A;  5FPR A;  2N74 A;  2DYS B;  1G8X A;  3OW2 U;  3RQG A;  1PNK A;  1SA0 B;  1ZSP A;  4I9Q A;  3J06 A;  3UCS C;  5KHI A;  4Z9J A;  1LM3 B;  3U5S A;  3NMK A;  2D5R B;  1COW G;  5IJ9 A;  3U8V A;  4RQF A;  2M6Y A;  1JX9 A;  2R9R B;  2QEX V;  1G5Z A;  4FAP B;  2QNL A;  4JI5 O;  5FNV A;  3N2K B;  5JCO A;  5DLJ A;  1VIB A;  3H1J H;  2H7V C;  3ZRS A;  2R7Q A;  1ZHT A;  3EZI A;  3S84 A;  3CCU V;  2J46 A;  3CC2 V;  2CGO A;  3O39 A;  1FFT B;  1J95 A;  3JYC A;  4LDK A;  2CTR A;  1EZV H;  4MW8 A;  3M8A A;  3K04 A;  3W7U A;  3SXZ A;  1RFY A;  2A0L A;  5C8Y B;  1DF4 A;  3JSE O;  1LKX A;  2CDY A;  1UFB A;  4UV9 A;  5KHH A;  1ZLZ A;  2GUZ A;  5B1O A;  4ZOL B;  3TCU A;  2BTQ B;  3CCE V;  3KZI Z;  2EPO A;  3CJH B;  4PA3 A;  3GOR A;  1L7C A;  1OCR C;  4IGG A;  1M6T A;  3N2G A;  5EC1 C;  2P4V A;  4QDL A;  5JVD B;  3U0C A;  4FZ1 A;  2PGG A;  3STL C;  3DC6 A;  4CS8 A;  1FXH A;  1HE9 A;  2H94 A;  1L8D A;  3AG3 C;  2ZDI C;  4D6T H;  3RQE A;  4CS7 A;  4MVO A;  2KK1 A;  3FDQ A;  3HNK A;  3PJS K;  2OWO A;  1D5A A;  2WLK A;  4LF6 B;  3B8N A;  4UVC A;  3L34 A;  1JQ0 A;  1XNQ B;  5E1A C;  5GON A;  4QE7 A;  2H3O A;  1P7B A;  3JCZ A;  5L3B A;  3T6G B;  1VF6 C;  2P6V A;  3SEO A;  5B1B C;  4O6M A;  2IM9 A;  1BQZ A;  1SQX H;  2HMQ A;  1J5E O;  3J81 N;  4YT5 A;  3G80 A;  2L6F A;  5LGN A;  1WB7 A;  1R3L C;  2IXO A;  3ZQY A;  4YK5 A;  5LXT B;  4K0D A;  3C8G D;  3ZMS A;  1VQ9 V;  1H7I A;  1Q0D A;  3NYJ A;  3T6J A;  3E83 A;  5LL6 Y;  2ZE8 A;  2XL8 A;  4FJC C;  2BOC C;  3K0G A;  1MG1 A;  2UUA O;  3IGA C;  1VEW A;  1K92 A;  2YIC A;  3H1I H;  2XLD A;  1FFT C;  1ZL8 B;  3IC9 A;  3AK2 A;  4DR6 O;  1VMA A;  3EHN A;  1FFH A;  2NUP B;  2YXY A;  3L0I A;  3RYF A;  4O2A B;  2F43 G;  5ITZ B;  1XMO O;  1VK5 A;  2DI3 A;  4OIN F;  3RYL A;  4I0X B;  5L3E A;  5EIB D;  2ASR A;  3OTO B;  2X7R B;  4DR1 B;  1TAE A;  3GM2 A;  4BAY A;  4IL6 Z;  1B06 A;  3A11 A;  4CBE A;  1Q6I A;  2ZXW C;  1DK1 A;  3SPI A;  4K8X A;  1H9G A;  1H8E G;  3OEE G;  4LNU B;  3HTK C;  1LS1 A;  3QNE A;  3RH3 A;  3C7J A;  3SXY A;  5BQI A;  3FB6 C;  3P3N A;  4O6N A;  3B0P A;  3F7Y C;  1MNG A;  1WPB A;  1ZTE A;  2FML A;  3ZHR A;  2VWJ A;  1IBL B;  4CH4 A;  2PX0 A;  2YL0 A;  2XOK G;  3JD0 A;  2KJG A;  3JRM O;  5CA3 A;  2WAM A;  4LDQ A;  4DBQ A;  4IWB A;  2V1D A;  4OIP F;  2G38 A;  3O55 A;  2P5O A;  1HNW O;  3BFR A;  3BAB A;  3K33 A;  1TR2 A;  4AQY B;  1ZYR F;  3JAK B;  2Q67 A;  4O4J B;  4U3F H;  1OW6 A;  1LI7 A;  2WA4 A;  2IBF A;  3C63 A;  4XDL A;  2GHY A;  4Z2W A;  2UXC B;  2EPL X;  5CBH A;  3VF0 A;  4P9T A;  4U7O A;  2P4K A;  1XMQ O;  5B5E Z;  4DV7 B;  3HPL C;  1AR1 B;  1I94 B;  1S77 D;  3LEV A;  5LA6 A;  4LF5 B;  2EIL B;  3OD4 A;  3EHB B;  4EB6 B;  2OCC B;  2UXB B;  2IJJ A;  1LI5 A;  2UUB O;  1ST6 A;  3JD2 A;  5A6B A;  5FPO A;  4ER9 A;  1O9H A;  3K57 A;  3OEH G;  5F2V O;  5JWP A;  2NUT B;  1OKK A;  1MZF A;  1OV9 A;  2JGU A;  5J9P C;  2XLE A;  2VB6 A;  4B3T O;  3EH2 A;  4MVU A;  2KYH A;  4X62 O;  3PDM P;  3L72 H;  5GTI Z;  1NU9 C;  4O4L B;  1LUW A;  4FZ0 A;  1V54 C;  2R7V A;  2LIG A;  1NBM G;  2Q00 A;  3U2L A;  5B66 Z;  1M2V B;  5DS5 A;  4DR3 O;  3N2K A;  1MA1 A;  4EBJ A;  1ZWI C;  1IBK B;  4B3R B;  4JAU A;  3RN4 A;  3DSQ A;  3DTU B;  3ZMV A;  2F1M A;  4DXW A;  1IBK O;  4B3R O;  1VQK V;  2P06 A;  3CCV V;  3K03 A;  2AVK A;  2R9I A;  3RBZ A;  3ETQ A;  4U3J A;  4DBR A;  1ZU4 A;  5BMV B;  4FWV A;  1VP7 A;  4O2B A;  4I4T A;  3K79 A;  2VS0 A;  4J42 A;  3LLK A;  3LES A;  1U6H A;  1AJP A;  1IBM O;  4FFK A;  3WG7 C;  1TFK B;  1V4A A;  1KD1 W;  2UXN A;  5BXZ A;  4NY3 A;  2YLD A;  3NMJ A;  1MMG A;  3TXQ A;  5IJ9 B;  1ZVZ A;  4YHH O;  3PN1 A;  3T1Y B;  2OQM A;  2C2A A;  1YDX A;  2E76 B;  4C7U A;  4KHP O;  4TV8 A;  3SPC A;  3B8M A;  4DRI B;  2OEX A;  1FXK B;  4CS9 C;  2YUA A;  3VRC A;  5EGY A;  3MHH C;  2PYJ A;  3ZHQ A;  3DI5 A;  1GRJ A;  1PM9 A;  2JPU A;  2LQG A;  1P4R A;  1OQC A;  1T5O A;  4XPX A;  1JPJ A;  1D0Y A;  4DV3 B;  3UO2 A;  1CGN A;  2DWD C;  5J2T B;  2R25 A;  1VOM A;  3FAP B;  2DW4 A;  2ZXO A;  1NBB A;  4LF8 O;  2GUZ B;  2ZM6 B;  1YYJ A;  3B71 A;  5AGF A;  3FVY A;  1ZZP A;  1I7F A;  5E33 A;  4Q4Z F;  2OT5 A;  4LF8 B;  1PPJ H;  3ABM B;  1JMK C;  4X1K B;  4NKG B;  4PJN A;  2Q5Z A;  5HFL A;  2XLO A;  3CZ6 A;  2IBZ H;  5F28 E;  4DK1 A;  4C3E A;  4MTO A;  4TOI A;  2AXT Z;  2R05 A;  2J0W A;  3F7V C;  4DR2 B;  1O5H A;  3HKE A;  1I4Y A;  1V55 B;  3SPJ A;  2M4E A;  1S0V A;  4N6H A;  4HAM A;  4I55 A;  1QU7 A;  1Q7Y W;  1JAF A;  5DM6 V;  4DUY O;  1X4T A;  2XM0 A;  4UCR A;  1EZJ A;  2WLN A;  2Q7R A;  1H2K A;  4LF4 B;  1IDS A;  2D2C B;  5L0H A;  1R5I D;  4FLV A;  1EQ1 A;  5KYN A;  4TV8 B;  4KNW A;  3S9O A;  3NKE A;  2VRZ A;  3CRQ A;  3SYP A;  3RYI B;  2X0L A;  4XEK A;  2DE0 X;  4IIJ A;  2AZ2 A;  3WU2 Z;  4B7K A;  4YJ2 B;  5KA5 A;  1QCE A;  3EG9 B;  5JSL A;  1GTO A;  4MT8 A;  5T3T A;  2ZXW B;  3MAQ A;  4IRU A;  4BJ5 C;  4LFC O;  1QSP A;  4DR4 O;  1RPR A;  2DYR B;  3JT1 A;  5EIB C;  3IAY A;  1BS3 A;  1N32 O;  4YIO A;  5EYP B;  3Q6M A;  4RDA A;  5J2T A;  3W8I A;  1K04 A;  1VQL V;  3LSS A;  3JAS A;  5L0G A;  3HKC B;  1LVK A;  4FM1 A;  1HDJ A;  3T1H O;  3UGP A;  3HKD B;  1NH2 B;  2CNW D;  2P0N A;  4YJ3 B;  1RJ9 A;  1WN7 A;  5JJJ B;  1A7V A;  3QW0 A;  2B0H A;  3JAK A;  1XQ8 A;  2D3O W;  4UV8 A;  2N05 A;  1G1X B;  4OIQ F;  1FMW A;  2QM8 A;  4KI2 A;  4CJO A;  3OR7 C;  3TUL A;  5L0I A;  2QM4 A;  5L0F A;  2QWR B;  2HHH O;  1HE1 A;  3HR0 A;  5LBQ A;  4GKJ B;  1LS4 A;  3B29 A;  1PNM A;  4BPM A;  3WAQ A;  4XEV A;  1VQ8 V;  1K05 A;  2EIJ B;  1MMD A;  3VBB A;  1N34 B;  4HEA J;  3DZA A;  3EGX B;  3ZED A;  5B1B B;  5B1A B;  1XZQ A;  3V7O A;  3A2F A;  1BL8 A;  2DOS A;  2L6H A;  2WWW A;  1FR0 A;  4UFZ A;  4ANJ A;  3SGI A;  2OYQ A;  2M64 A;  3I5Q A;  4TV9 A;  1GMG A;  1WA8 A;  4GUN A;  5KAF Z;  1GAX A;  1FPO A;  4LBE C;  3FD9 A;  1NU1 H;  2E3C A;  3ICX A;  3OTO O;  3CME V;  4U5B E;  3S0X A;  2AWY A;  5IDJ A;  4D4N A;  1R73 A;  4XBF A;  1E2X A;  4LF9 B;  1P84 F;  2JJ1 G;  4EUK B;  2G3K A;  3ZSU A;  3L73 H;  1W59 A;  1HW1 A;  4E7S A;  3NYL A;  4BW5 A;  1PD0 A;  1KTM A;  3H1K H;  2WLJ A;  4H44 B;  2Q9L A;  2VQE O;  1GO3 F;  4K35 A;  1AP6 A;  3HKC A;  1Q86 W;  1KKD A;  3W4Y A;  3HKB B;  2ZDI A;  3TET A;  4ASU G;  3VOU A;  4TWK A;  4HE8 D;  4CS8 C;  1CPQ A;  3OEO A;  3IC7 A;  2Q0A A;  5KYY B;  3U9J A;  5H6Q A;  4WF9 V;  4DR3 B;  1RSO B;  3DE8 A;  4FPP A;  4X65 O;  1IVS A;  4XQ1 A;  1YA7 O;  3AG1 B;  2FB5 A;  3K5L A;  4BJ6 A;  4JKV A;  2WLH A;  1UG7 A;  3SNH A;  1FMV A;  3OUS A;  4RWU A;  1J5E B;  1PD1 A;  1NR1 A;  4WFB V;  1H2G A;  2L6L A;  1SF9 A;  2A68 F;  3GAN A;  2A79 B;  5EBM C;  3CSX A;  4NXN B;  3EPV A;  1H9T A;  3D36 A;  3EH1 A;  2YI9 A;  4LF6 O;  3NRH A;  2HJD A;  1PD3 A;  1VQN V;  3WG7 B;  1KP3 A;  5KLV H;  2CTP A;  3DC5 A;  3ABT A;  4E0H A;  1TWA A;  2O9X A;  4HFK B;  2QKC A;  4PK4 A;  1S5J A;  1N0N A;  4FM0 A;  3TJ6 A;  3Q4H B;  3MBG A;  3CAX A;  1MQV A;  5L3C A;  3EFO B;  4DUZ O;  4X64 O;  1Q0K A;  4DW1 A;  5K1X A;  2WLM A;  1OCR B;  1HMD A;  1FXV A;  1FAP B;  2EIK C;  5LMU B;  1MMA A;  3HLZ A;  2V7Q G;  1S76 D;  2XHB A;  1XMQ B;  2CTQ A;  4GT1 A;  3UQ8 A;  1IW7 F;  4WAB A;  1K34 A;  3ETE A;  3SR2 C;  2IJH A;  2ZNJ A;  3STZ C;  5JH7 B;  3IJ4 A;  4YIP A;  4YL3 A;  3CEI A;  1EFR G;  3JSN A;  3AQB A;  4JI6 O;  5ITZ A;  3BA9 A;  1N34 O;  4I0X A;  4DV4 B;  1KQS U;  1YZB A;  4FLY A;  2EPM X;  2LFR A;  2WLL B;  4J9Y B;  4CH5 A;  1V9P A;  4K0K O;  3A8T A;  1M57 B;  3ZMT A;  1G4W R;  1I5X A;  5D92 A;  1AIL A;  3LDE A;  1IBL O;  2KG7 A;  4LP8 A;  1THZ A;  3E8F A;  1TWH A;  1ZW3 A;  5KYW A;  4B3S O;  3F5W C;  2RCV A;  1NTZ H;  1XDC A;  4FFB A;  4GQH A;  2KQX A;  3QTH A;  1XI1 A;  4LF9 O;  4IAR A;  3S28 A;  2R70 A;  3C90 A;  4B6I A;  2VCA A;  3NG1 A;  4JTA B;  3DAG A;  1K97 A;  5H5N A;  2HMZ A;  2HSB A;  4IYI A;  1S3J A;  3OUF A;  4OPH A;  5CBG A;  4GYT A;  1XL4 A;  4DV1 B;  1SC5 B;  4JAV A;  3RYI A;  1XMO B;  3NMI A;  4O6Y A;  1D1C A;  5KUK A;  3TK1 A;  3QVN A;  1M5I A;  1B68 A;  1NU7 D;  3E8G A;  3GEH A;  3BEH A;  3IPM O;  4H54 A;  4DR6 B;  3IEE A;  4G28 B;  1R6T A;  1RCP A;  4YT4 A;  4DR5 O;  5F5H A;  4GCZ A;  3EG9 A;  3DMD A;  1QQC A;  2KSD A;  2QTS A;  1HW2 A;  2P90 A;  2XAH A;  4JZG A;  1YLM A;  4CIH A;  2LQT A;  4O4H B;  3ZWI A;  1ZU5 A;  3RT3 C;  4GKJ O;  4OX9 B;  1XRE A;  3G4S V;  2HP8 A;  2ZPA A;  3RGB A;  2HLD G;  1H2M A;  2EJ7 A;  2ZXP A;  4MTX A;  1QLE C;  1W0J G;  3KKB A;  2O57 A;  3JYY A;  2XS1 A;  3RFR A;  4X64 B;  3AG2 C;  2KSF A;  2AZ0 A;  2R7R A;  3MYF A;  1CGO A;  4JPR A;  4NR1 A;  2ZKO A;  1YIT V;  3JAL B;  4C3D A;  4YWQ A;  3I5D A;  5KYW B;  4Z1V A;  2QDO A;  4MSW C;  2P6J A;  3ZDL A;  1NTK H;  3LAY A;  1Q90 D;  3TD7 A;  4I50 B;  3KG2 A;  2FTK A;  3ABK B;  4FIP C;  1AI5 A;  4LR3 A;  2KC3 A;  4FLW A;  2CDQ A;  3FYE B;  3LNN A;  4N23 A;  1ARO P;  4CS9 A;  2H7O A;  1U97 A;  3F47 A;  2W9Y A;  2QE9 A;  4U7N A;  2YS8 A;  4JE9 A;  5LHI A;  5H6R A;  3E8H A;  2YRF A;  3CC7 V;  1Z63 A;  1C03 A;  3V5X A;  1VF5 B;  3SJA C;  1VMG A;  1AI4 A;  4DO2 A;  3EJN A;  5LHH A;  4JI4 O;  1H8H G;  4DV1 O;  3MFN A;  3ZRW B;  2HS5 A;  1HNX B;  1I4Z A;  4N4W A;  3AK1 A;  3JCU Z;  4JF3 A;  1QVX A;  4U5C E;  1VLT A;  3ZMZ A;  1US6 A;  4UB6 Z;  2YIB A;  4TSF G;  5KUM A;  3L74 H;  1PNL A;  1Q81 W;  4JYY A;  1ZAU A;  2GWW A;  4UXN A;  4N6C A;  5IJ0 B;  4JI3 B;  2GFH A;  2NSG A;  1D0X A;  2A0B A;  1EKY A;  4CC5 A;  4R8C A;  3VQW A;  3EQL F;  1H6G A;  1ZHW A;  5CIV A;  4X66 B;  2F66 C;  2XM4 A;  3ZIB A;  1QHT A;  2BL2 A;  3APO A;  4PDM A;  1C02 A;  3C62 A;  1OKK D;  2CGE A;  1M56 B;  3O9O A;  2P7V A;  2QY9 A;  2X6A A;  4WFF A;  1C17 M;  2Y4T A;  1FFX B;  4JI8 B;  4YXW G;  3ASO B;  2XLH A;  4DR4 B;  2XAQ A;  3FB8 C;  3TOL A;  4H37 A;  4LNU A;  3GM3 A;  4IAQ A;  1Z5W A;  3OT7 A;  4K8Z A;  4I55 B;  1VQ6 V;  3T2M A;  2QA4 V;  4DR7 B;  2DN9 A;  5KHK A;  4JEA A;  1YJG A;  5H2F Z;  1LR1 A;  3M1C B;  1KMI Z;  4LWS A;  4MVZ A;  2KW3 C;  1M90 W;  1YIJ V;  3QMK A;  3DXR B;  4Z9H A;  2IM8 A;  2NN4 A;  4RAI A;  4EFB A;  4BG0 A;  1NS1 A;  1PV3 A;  1TA8 A;  2QM7 A;  4PDR A;  2WVN A;  4D7T A;  2ETN A;  3CB2 A;  4ZOL A;  2ATK C;  4BR6 A;  4A5U B;  4PD4 F;  1XNR B;  1Q82 W;  5IT9 N;  1P49 A;  4JI1 B;  2YC0 A;  1KYO F;  2RN9 A;  1OXB A;  2UUC O;  4J32 B;  3TXS A;  1A32 A;  2KKW A;  4Z1M G;  4NXN O;  1FFX A;  2UUA B;  4MVQ A;  4NTY A;  5CI8 A;  2X6B A;  1BR1 A;  4N06 A;  2OIG A;  5EYP A;  2PNO A;  2XLM A;  4YT8 A;  2YIA A;  4I7Z B;  3UT5 B;  3S3X A;  3GEI A;  4E2L A;  5A6K A;  1NR7 A;  4QNH B;  4PAC A;  1QR9 A;  2GDS A;  2BSK A;  3CCM V;  1FJG O;  2GAQ A;  3T4D A;  3SJQ C;  4BEJ A;  4X20 A;  4WFG A;  4AK9 A;  3SYO A;  3LDC A;  5C93 A;  4UB8 Z;  3D8C A;  3N2Z B;  4E7Z A;  4UUJ C;  2CH7 B;  4X1I A;  3AGU A;  1W2B U;  1G4U S;  3B4S A;  2CUG A;  1XHZ A;  5HV9 A;  1GM8 A;  3G6B A;  2JK5 C;  1N4C A;  4B3M B;  3V5Y A;  4IYH A;  1N33 O;  4RD9 A;  2Y0I A;  2HJF C;  3RIP A;  4KHP B;  3GWK C;  3DXR A;  2R02 A;  4F6R A;  3T4Z A;  4JTC B;  2HVK C;  5D91 A;  1FD9 A;  1ROP A;  1IBM B;  1ZHY A;  1NKD A;  1N36 O;  4KUM A;  1KP2 A;  3AG4 C;  2LSE A;  2XL6 A;  2NLJ C;  3E35 A;  5DED A;  1WP8 A;  4G7Z F;  3SXK A;  4UCV A;  3AG7 A;  3FX7 A;  3U3B A;  3E22 A;  1UFI A;  4JVS A;  4W4K A;  1N32 B;  1J8M F;  1HWY A;  5AC4 A;  4JGS A;  3X2Q C;  2DQ3 A;  1R3J C;  1Y76 A;  3UM7 A;  4BW9 A;  1E1R G;  1OCZ C;  4G7H F;  2X51 A;  3POV A;  3SJB C;  1MSD A;  5BR8 O;  5EHH A;  5EK0 A;  2Q8V A;  1CPY A;  3CRM A;  3D3Q A;  3JSL A;  3J80 N;  1Y74 B;  2XAF A;  2ILM A;  1SS3 A;  3SP1 A;  4Q6G A;  3E8B A;  2GTA A;  2QKA A;  3SPH A;  3JAL A;  1EN6 A;  4O4I A;  4BJ6 C;  3LNR A;  3PMR A;  1VLS A;  3OA1 A;  4X1Y B;  3M99 B;  1Z23 A;  3ZX6 A;  1WAS A;  3ASN B;  1MNE A;  3R66 A;  3AG4 B;  2R03 A;  4GZR B;  4JI0 B;  1Y4C A;  2A6H F;  4J9Z B;  1YCI A;  4PJM A;  1NJI W;  4JEB A;  2JEX A;  1OW8 A;  3VM6 A;  3HJC A;  4ULV A;  5L3V A;  2YID A;  4DV5 O;  3IQ6 A;  5LOV B;  4FM2 A;  2Q3T A;  3JYH A;  4I1O B;  3RQF A;  1NH2 D;  1BT8 A;  2IW5 A;  1WAT A;  1OCC C;  2CAZ C;  5A2Q N;  4KP4 A;  5E79 Z;  1SZX A;  2WSS G;  3LSU A;  1XOU A;  3J7A U;  4NCQ A;  4H33 A;  1YF2 A;  1WOL A;  3HKE B;  3CD6 V;  4QIW F;  2WL8 A;  3IQC A;  2JGD B;  1B3Q A;  1IX9 A;  4O4L A;  1AR4 A;  4OGQ B;  3ZBH A;  2W4M A;  4XEF A;  3K3W A;  3EGD B;  5JJN B;  4KC9 A;  4YL1 A;  4M63 A;  1FTS A;  4G78 A;  3RVY A;  1MZE A;  2BC5 A;  4BEM J;  1GGQ A;  2EIN B;  5C8Y A;  4H13 B;  2DMX A;  5IWA B;  1JR8 A;  1O3U A;  1E1Q G;  4NTF A;  4JI6 B;  2R7O A;  2LFD A;  1NQT A;  2Q4P A;  4ZHQ A;  1A7D A;  5DN6 G;  4LFB O;  2A0U A;  5JS5 A;  1KBH A;  2HEP A;  3D3I A;  1D1A A;  3W7W A;  2YEV A;  4HBN A;  3RWR D;  1Q6H A;  5JCO C;  2Y3B A;  4TQF A;  3OAA G;  5EC2 C;  3W7X A;  1GM5 A;  3QF7 A;  3T9O A;  4DV3 O;  3ASN C;  2YQY A;  2WA3 A;  2ZE7 A;  4NVP A;  3LS0 A;  1EM1 A;  4X88 A;  3WFV A;  1AVM A;  4MVM A;  4I4T B;  1S7Z A;  1FS0 G;  2QWP B;  4ICG A;  3EGD A;  3QW1 A;  2VH3 A;  3BA8 A;  1LPE A;  2AWC A;  2JDI G;  1TFO B;  1SMY F;  3CS5 A;  2QR4 A;  3DAF A;  5JUA A;  3US6 A;  3PHF 2;  2V3C C;  1R3I C;  2Q7H A;  4QJF B;  3T1Y O;  2E87 A;  4PDL A;  4G2K A;  4TUY A;  3RYC A;  2EIN C;  2YI8 A;  1YJW V;  4O79 A;  4EIY A;  1K33 A;  5KA6 A;  3UNG C;  2UUH A;  3M79 A;  2Q73 A;  2YEV B;  1M4U A;  4AI8 A;  3U11 A;  3OMN B;  1D0Z A;  1AP5 A;  1Q8I A;  3UKM A;  1SQB H;  1BZ4 A;  2XTA A;  2HSQ A;  1WN0 A;  4JI8 O;  5DS4 A;  3JAW B;  3QZC A;  2LCH A;  2F4V O;  2BSK B;  3VQY A;  3UMK A;  1VYI A;  1BCC H;  4X20 B;  5CA0 A;  4X1K A;  1RSO A;  3CYO A;  4GKK O;  1VQM V;  5IYB O;  1D5N A;  1KC8 W;  1T9K A;  1JFF B;  3SDL A;  2B1G A;  1V74 B;  2OCH A;  4JYB A;  2J9V A;  3SYC A;  1SQQ H;  2E5L B;  2XLW A;  4C3B A;  2Y3D A;  4I1M A;  4O4H A;  2OKU A;  2XSE A;  2OG2 A;  5IYD O;  2IYL D;  2XL4 A;  1TKN A;  2N04 A;  4CS4 A;  4I44 A;  1EN4 A;  2HUJ A;  5KX5 B;  4JRZ A;  4AL0 A;  3SPG A;  1JOG A;  3DWW A;  1MAB G;  1BQ0 A;  3K9A A;  1XZP A;  3ZTM A;  4ZLD A;  1N33 B;  2L9J A;  3HKK A;  1QVG U;  3LLI A;  2AP3 A;  1WLE A;  3B0U X;  5BY1 A;  3NXS A;  2Y39 A;  3FOP A;  5GW7 A;  3Q4H A;  2BTQ A;  3ZJZ A;  5COF A;  2ADP A;  2J7P D;  4IB4 A;  1OCC B;  4OD5 A;  3A0R A;  5LP6 C;  1LNQ A;  3KCX A;  3LJB A;  2TMV P;  1A0B A;  1K7D A;  1FKA O;  2OIE A;  2AGA A;  5L3Q A;  2NUT A;  1K8A W;  4YJ2 A;  3CE2 A;  5AC5 A;  4MS2 A;  1B04 A;  4ONS A;  1VF7 A;  2UXX A;  2YXH A;  1GQA A;  3BRJ A;  3RFY A;  5JRA A;  1KKC A;  3OMI B;  1PV0 A;  3LS1 A;  1E83 A;  3ZRV A;  2PX3 A;  3L8J A;  1DOW A;  5CA0 B;  2EIL C;  3NKD A;  1NLX A;  2Q6A A;  1K9M W;  2KNH A;  3FOO A;  4UCS A;  2R7X A;  4PDV A;  2OEV A;  3CCS V;  3TJT A;  4JI2 O;  2UUC B;  5L0D A;  1SF8 A;  4K0K B;  4DOZ A;  1GK9 A;  4O7G A;  4F4L A;  2NG1 A;  1HP8 A;  2XAS A;  4HNA B;  4JYC A;  2ZIM A;  4EHP A;  4GX1 A;  1LE2 A;  3OE7 G;  4WFH A;  4K1O A;  3OM3 B;  5LGT A;  2QUP A;  4XLN F;  3EXA A;  1GN4 A;  3LSQ A;  5KMG B;  1NFO A;  2UUI A;  1NFN A;  1M2V A;  1JMW A;  3VQV A;  4CH3 A;  1W0K G;  3TK0 A;  5GON B;  3C3S A;  4NXM B;  2V26 A;  4YY3 B;  4J41 A;  2LGQ A;  4WFA V;  2E75 B;  1F7Y A;  4DVZ A;  4OXS A;  3ZTZ A;  1FJG B;  4LWS B;  3GOD A;  2OOC A;  3CCR V;  1FNT c;  1OZ0 A;  2RNB A;  4LER A;  4WBN A;  4FLZ A;  3ABM C;  4CZZ A;  1IZM A;  4OPA A;  1N1C A;  3Q7L A;  4F4B A;  2YIB D;  2H8P C;  1E84 A;  2Z3Y A;  5BQH A;  5EZY B;  4DRX B;  4J11 A;  4JAA A;  3N24 A;  2PY5 A;  1SES A;  3EVK A;  3QG5 A;  1YEW A;  2VCC A;  3UR3 C;  2QKS A;  2VQE B;  1SA0 A;  3WB0 A;  4U3J B;  4LFC B;  2W0X A;  3K5O A;  4JTD B;  5FZT A;  2WVQ A;  2P67 A;  2FFH A;  1RP3 B;  2DYR C;  3OMA B;  1NSG B;  4JAS A;  4WGZ A;  4BIO A;  2WB7 A;  5DQT A;  4IAO A;  3ZIA G;  3R65 A;  3ZCC A;  4X65 B;  3KH2 A;  2LD6 A;  2Q4F A;  3U10 A;  1XEQ A;  2CNW A;  4P2Z A;  1ORY A;  2QLA A;  4JJF A;  1U96 A;  3DXJ F;  1IXM A;  4CSA A;  1S05 A;  4EKW A;  3BVO A;  1VF6 A;  2YKZ A;  3KPH A;  4NB5 A;  4NTB A;  2PP4 A;  4CS3 A;  256B A;  2RMK B;  4B3M O;  2GTS A;  3N0T A;  4U5F E;  3ML0 A;  2JVD A;  3R7C A;  3M7M X;  3WB2 A;  2R72 A;  4P9P A;  2GDC A;  2YLG A;  4P9O A;  2I15 A;  5A69 A;  5KYY A;  4AE4 A;  2ARH A;  2Q69 A;  3EFO A;  3H2U A;  1EN5 A;  3ECS A;  2Q0O C;  1PCX A;  4AL1 A;  4D7S A;  4KNV A;  3G50 A;  5LHG A;  4KFM A;  4JW1 A;  4I5S A;  1R4T A;  1YAU O;  5LP6 B;  3JAM N;  2YSU B;  3ZVR A;  5CI9 A;  2LGW A;  3T1H B;  4GKK B;  3RYH B;  2A3Q A;  3TQO A;  2J0X A;  4GYC B;  3RW0 A;  5K1P A;  4BJT A;  5BQG A;  3E22 B;  4KL1 A;  5DEC A;  4JI1 O;  4ZLC A;  2P61 A;  2Y48 A;  1Y4M A;  3ZMU A;  1W2W A;  3A0B Z;  4L6R A;  4IHJ B;  2HFE C;  3OGI B;  2H8A A;  3WOD F;  4PA7 A;  1GM9 A;  4MTG A;  1WP7 A;  4JCH A;  3FXH A;  3BHP A;  1RKC A;  3CP1 A;  4DJ9 A;  1R1B A;  4K3A A;  2UU9 O;  1Q0F A;  2IU0 A;  2OTL V;  5IE9 A;  4WFE A;  3GWN A;  2OJQ A;  4FLU A;  1T6Q A;  1SRY A;  4DR5 B;  1VQP V;  1LUV A;  4J7T A;  5CA1 A;  4TT3 G;  2P22 C;  4DUY B;  4UCU A;  2NSF A;  4ZKI A;  1HY5 A;  1SZT A;  1T01 A;  2E5L O;  4JZ2 A;  3L1M A;  1Q6U A;  2RJZ A;  4QI0 A;  5D5Q A;  3D36 C;  4U5E E;  2UXB O;  1OHH G;  3JAS B;  4F6E A;  3SYN A;  3I5P A;  1BMF G;  1J8Y F;  3MX3 A;  4YJW A;  1BR2 A;  1Y6D A;  2OJE D;  1JPN A;  5JT4 A;  2VWK A;  3M15 A;  1JFF A;  4LF7 B;  3QVZ A;  4WGY A;  3RYF B;  4UCO A;  1Q3E A;  1NVP D;  1M1K W;  1F4N A;  4QGP A;  1UJW B;  2L35 A;  2ZM6 O;  5HSW A;  4UVB A;  2P7T C;  3H1H H;  5A6B D;  5JVE A;  1KB9 F;  3G67 A;  3HNJ A;  5L3D A;  4KXR A;  2XLV A;  4XPY A;  1H2N A;  2EZO A;  3X1O A;  1F51 A;  4J7K A;  3L71 H;  3QO8 A;  3LDD A;  2GBO A;  3A0H Z;  2IJK A;  1RKE B;  5J2U B;  3CCQ V;  1OR2 A;  1WA8 B;  4TV9 B;  1IUR A;  4BJ1 A;  5KAI Z;  5LYJ A;  2NUP A;  4ZIB A;  3WB1 A;  3L75 H;  1QNM A;  2EJR A;  4AIL C;  3T6B A;  1I0H A;  2QWO B;  3W7T A;  1AI7 A;  4BJ5 A;  3QVY A;  1KU2 A;  1SQG A;  1K4D C;  4WJ0 A;  5L3G A;  1XIL A;  2ZD9 A;  2ZR2 A;  3ZHU A;  4AHC A;  4YL0 A;  5KYX A;  1G8M A;  3M4C A;  5D5P A;  3CXC U;  4ZHQ B;  4GLX A;  3DD7 A;  5A6J A;  1S5L Z;  2AW9 A;  3CXH F;  4BWA A;  4J30 B;  3SJC C;  1JJ2 U;  2JD3 A;  3U2M A;  4DV7 O;  2IOQ A;  4R32 A;  3CRC A;  2Q9C A;  4GX5 A;  1F1M A;  1A41 A;  4CS2 A;  2WVO A;  1Q43 A;  2E74 B;  4LFB B;  3JD1 A;  5GPG B;  4XDK A;  1CEZ A;  4Q20 A;  1M9N A;  2ODM A;  3FAV B;  3NR7 A;  1M2O A;  1CP9 A;  2J45 A;  3K58 A;  3BAA A;  3MHS C;  1MMM A;  5IWA O;  3PCV A;  2ZE5 A;  3KCY A;  5LA6 B;  4DVY P;  3H2V A;  1OW7 A;  4XLP F;  3GWO A;  2VQF O;  4B7E A;  2HZ8 A;  3S90 A;  4NXM O;  3JTL O;  4PA9 A;  1QVF U;  1NG1 A;  5B1N A;  4I9W A;  5CB4 A;  4TUY B;  3RYC B;  1BBH A;  4P9F A;  3GVM A;  3BY6 A;  2B9Z A;  1LE4 A;  3ZRW A;  3SYQ A;  2QE7 G;  1S5H C;  1URF A;  3TGU H;  4X62 B;  1QZX A;  4RQE A;  3U9M A;  3WHN A;  1QPU A;  2JEU A;  5JQG B;  2ZE6 A;  4JYA O;  1YXB A;  2PI5 A;  1OCZ B;  2RSE B;  4MW3 A;  3K9S A;  2LFS A;  2Y69 B;  1L3P A;  3ZG1 A;  2Z0A A;  4JCZ A;  5E2Q A;  1KNY A;  1YVI A;  4J80 A;  1R6K A;  4OD4 A;  3HB3 B;  1YHQ V;  1VYK A;  2IXM A;  4XWJ A;  4CSA C;  1YSC A;  4JI0 O;  1DF5 A;  3K06 A;  1H2L A;  3M4B A;  4NYK A;  4LFA B;  1BSM A;  3W2W A;  2BE5 F;  4NTW A;  5K0I A;  2R7W A;  2PF4 E;  1I94 O;  1VB5 A;  5CN0 A;  3K1I A;  4LDR A;  3AG2 B;  2RD9 A;  1WAZ A;  2P1A A;  2YWA A;  5T3W A;  3B0V C;  3JD3 A;  5JVD A;  3FYI B;  1TWG A;  3MYI A;  2LK4 A;  5BMV A;  3DJN B;  3OWT A;  4LLC A;  4O2B B;  2K1E A;  5JQG A;  3W8H A;  3HKD A;  2UXC O;  3JAT B;  4P6I C;  4DW0 A;  4OIR F;  2AHY A;  1SQP H;  2LW1 A;  4R6Z A;  4O2A A;  5FCL A;  4CDV A;  5CB4 B;  4CDY A;  4QI2 A;  2NNU A;  3B09 A;  4QPJ A;  3Q6N A;  3CPW U;  4LCU C;  1FXK A;  1ENV A;  2A7W A;  2CK3 G;  4O4I B;  2QGN A;  2A06 H;  3U8P A;  2EIM C;  1DLB A;  2GV9 A;  2ADQ B;  5GTH Z;  4FK5 C;  1KU9 A;  4B3S B;  3ABK C;  2MWQ A;  1JCH A;  1N36 B;  1O9G A;  1MMN A;  5FLX N;  3ATP A;  3QO5 A;  3VAY A;  2XXA B;  3P32 A;  1BDJ B;  2FGY A;  4PFP A;  3FMS A;  2JS5 A;  3LEO A;  1YAR O;  3E89 A;  2Q9A A;  5HFM A;  2QSA A;  1PL4 A;  3C8G B;  3JZ0 A;  4B08 A;  4JV5 B;  2WLI A;  2LJ2 A;  4KBL A;  4PJJ A;  2F23 A;  3CWB H;  5IYC O;  2ICW G;  3K08 A;  3UO3 A;  1JVM A;  5L3F A;  3LNM B;  3QTC A;  2A6E F;  3ZHV A;  3ZC4 A;  2PUS A;  3RYH A;  4OX9 O;  3A9C A;  1MND A;  2WZL A;  4FMT A;  4C7O B;  4EEQ A;  3MDS A;  4DV6 B;  1U89 A;  2CYD A;  1WWP A;  1AI6 A;  4P30 A;  1NI8 A;  4IHJ A;  1YZC A;  3G4Z A;  4DV6 O;  3V5Z A;  3B77 A;  2JIZ G;  3KL4 A;  2Z5U A;  3HKB A;  3C3T A;  1Z5Z A;  2Z15 A;  4A2N B;  3C18 A;  4FX5 A;  3ETD A;  1QR8 A;  5BR8 B;  4U5G A;  1OCO B;  1VQ4 V;  5E3A A;  4W4L A;  1OR3 A;  4LF7 O;  3SXM A;  3CEX A;  3K7D A;  1HNZ O;  5COG A;  1O87 A;  2LFF A;  4PHZ A;  4LF5 O;  2BCC H;  4JI7 B;  1CGM E;  5CA1 B;  1YYX A;  2VCB A;  4JC7 A;  3UGO A;  4CJG A;  2BOB C;  3CRA A;  4LAC B;  5J2U A;  2IXP A;  1D2D A;  1XBL A;  4G7O F;  1EA8 A;  3AGT A;  1YTF D;  2IU3 A;  4GX0 A;  3MD0 A;  1RPO A;  4HZ3 A;  2KQ9 A;  4J7Y A;  5B3I A;  5LYJ B;  1JA8 A;  4L87 A;  1YJN V;  1ORQ C;  4YJ3 A;  4AQY O;  1RJ9 B;  2ZR3 A;  2W6J G;  3CSK A;  5KYU A;  4YT2 A;  1P7G A;  3CJH A;  3IFX A;  2FKX A;  4NTX A;  3GM1 A;  2YZS A;  1TUB A;  1K5S A;  3FAJ A;  3ABL C;  2RDC A;  3CX5 F;  1Z3I X;  1B6Q A;  3I55 V;  1QKR A;  4JZA A;  2OTJ V;  2IH1 C;  4Q5S F;  4G0H A;  2HKV A;  1K3E A;  1BGY H;  2DYS C;  3KYJ A;  2X0C A;  5DS6 A;  4X89 A;  1AVO B;  1QQ3 A;  1T6I A;  1N0J A;  2K9P A;  3DJU B;  4ULW A;  1GN2 A;  2HFI A;  2HJ3 A;  3FAV A;  3JSZ A;  3U3F A;  4JI5 B;  1YI2 V;  1IZ3 A;  1M93 A;  3K1I C;  3HNL A;  1JOY A;  3HNI A;  1HMO A;  1SER A;  5BZB A;  1AUE A;  2EX3 A;  3S3W A;  1K5Q A;  4AX2 A;  3AG1 C;  3VYW A;  4EBB A;  1BZK A;  2R7S A;  1TUB B;  2JX0 A;  2XRH A;  5T1D B;  1A7E A;  2QTV A;  5COM A;  3CCJ V;  2PYL A;  1KUQ A;  2X6C A;  1SYQ A;  2KGO A;  2ZIN A;  3IQT A;  1Y6X A;  2UXD B;  2CW0 F;  4JJG A;  1TVK B;  4U9E A;  2IH3 C;  3B2E E;  2QTO A;  2J8W A;  4E0I A;  3ZN0 A;  1TQG A;  3GEE A;  3K1H A;  3O6X A;  4HYO A;  2F93 B;  4U5D E;  2FL4 A;  2RQ6 A;  5F5F A;  3FHD A;  5IYZ B;  1GN6 A;  4QPK A;  2EUL A;  2EBO A;  2W45 A;  3OTF A;  4WCE V;  3ABL B;  3AG3 B;  4X0R A;  1I08 A;  1CPR A;  2WPD G;  5LMN B;  1RM1 C;  2HG5 C;  4I50 A;  1EBO A;  3BCC H;  4OIO F;  1UPG A;  2J7P A;  1L1F A;  2JRI A;  2LP7 A;  3CRR A;  4EWC A;  2I8B A;  4NTA A;  2YLI A;  1Q0G A; 
#chains in the Genus database with same CATH homology
 4MSW C;  4FES A;  2P6J A;  3LAY A;  2WVQ A;  2P67 A;  2FFH A;  1OCO C;  2DWE C;  2G3V A;  3K66 A;  1WPX A;  3OMA B;  2DYR C;  2X7R B;  4X8A A;  4MVS A;  3T1C A;  3TD7 A;  4BAY A;  2EIJ C;  3FKS G;  3EFF K;  2FTK A;  3ABK B;  3KG2 A;  4FIP C;  2ZXW C;  4JAS A;  1AI5 A;  2WB7 A;  3SPI A;  4GEH A;  4IAO A;  5DQT A;  3ZIA G;  3R65 A;  1AJQ A;  1H8E G;  3ZCC A;  3OEE G;  2CDQ A;  3HTK C;  3FYE B;  3G6E V;  1LS1 A;  3KH2 A;  3QNE A;  4N23 A;  3RH3 A;  2CNW A;  4P2Z A;  1ARO P;  4CS9 A;  2H7O A;  3F47 A;  4JJF A;  2W9Y A;  3S27 A;  3DXJ F;  4CSA A;  1IXM A;  4U7N A;  2ZXR A;  5BUO A;  3FB6 C;  3EZH A;  4O6N A;  2B1I A;  3F7Y C;  2DGJ A;  5LHI A;  5H6R A;  3E8H A;  4EKW A;  2IJI A;  3CC7 V;  3CC4 V;  2PX0 A;  1Z63 A;  1SET A;  3NDB B;  1AI4 A;  5B1A C;  2XOK G;  4DO2 A;  3JD0 A;  2KJG A;  5LHH A;  2PP4 A;  1AJN A;  2WAM A;  5CA3 A;  3EJN A;  2KB1 A;  1H8H G;  4IWB A;  3UMH A;  2V1D A;  2XAJ A;  3ZRW B;  3N0T A;  4U5F E;  4OIP F;  3ML0 A;  4JF3 A;  3K33 A;  4U5C E;  1TR2 A;  1ZYR F;  1YJ9 V;  3ZMZ A;  2Q67 A;  4P9P A;  4I3M A;  1H38 A;  4P9O A;  4TSF G;  5KUM A;  3B0V C;  2ITC C;  1PNL A;  1Q81 W;  4XDL A;  2GHY A;  5KYY A;  1BHA A;  5CBH A;  4AE4 A;  2PFD A;  2Q69 A;  3EFO A;  3ECS A;  4U7O A;  4UXN A;  1PCX A;  4IJJ A;  4KNV A;  2GFH A;  2Y3H A;  5LHG A;  2B5U A;  4KFM A;  1D0X A;  3EQL F;  4R8C A;  4JW1 A;  1PL0 A;  4I5S A;  1ZHW A;  1M57 C;  1ZHZ A;  3HPL C;  1AR1 B;  3ZIB A;  2YSU B;  3K6B A;  3ZVR A;  1QLE B;  4MVR A;  4PDM A;  1S77 D;  5CI9 A;  3H65 A;  2R7T A;  3LEV A;  1K73 W;  1OKK D;  2EIL B;  2CGE A;  4C7O A;  1M56 B;  3EHB B;  2OCC B;  2P7V A;  2IJJ A;  2QY9 A;  2X6A A;  1ST6 A;  3JD2 A;  4Q7C A;  2J0X A;  4AE4 B;  4WFF A;  3RW0 A;  2W4B A;  4BJT A;  4YXW G;  3ASO B;  2XAQ A;  3FB8 C;  4ZLC A;  3ZN1 A;  2B0J A;  2Y48 A;  1Y4M A;  3OEH G;  4H37 A;  3ZMU A;  1S72 V;  1W2W A;  2HV6 A;  2HFE C;  3WOD F;  4CBC A;  2NUT B;  1OKK A;  4PA7 A;  1GM9 A;  4MTG A;  1VQ6 V;  4JCH A;  3T2M A;  2QA4 V;  5J9P C;  2VB6 A;  3CP1 A;  5EBW C;  2A1D D;  3EH2 A;  1PKX A;  4MTF A;  2Q68 A;  4MVU A;  3EGX A;  2IU0 A;  2OTL V;  3DM5 A;  4WFE A;  1D1B A;  2KW3 C;  4MVZ A;  3M1C B;  1M90 W;  3SYN A;  1NU9 C;  1YIJ V;  3QMK A;  1V54 C;  2ZQM A;  1JPX A;  2R7V A;  4RAI A;  4BG0 A;  2A9H A;  4PFO A;  1NBM G;  2QM7 A;  1SRY A;  4PDR A;  2WVN A;  1VQP V;  2IXN A;  1M2V B;  4TT3 G;  1MSW D;  4CS8 C;  2ATK C;  5DS5 A;  2JJ2 G;  2WZG A;  1ZWI C;  4ZKI A;  1Q82 W;  4JAU A;  3LUT B;  1SZT A;  1DTO A;  3DTU B;  4G27 B;  3ZMV A;  4DXW A;  4RO2 A;  5B3S C;  4QI0 A;  1XL6 A;  3K0D A;  4J32 B;  1KEC A;  2DQ0 A;  2MK3 A;  4Z1M G;  4U5E E;  1OHH G;  4MVQ A;  1VQK V;  5CI8 A;  3CCV V;  2X6B A;  3K03 A;  1BMF G;  4ZBM A;  1BR1 A;  3I5P A;  1J8Y F;  4N06 A;  2R9I A;  2EIM B;  3RBZ A;  3MX3 A;  1BR2 A;  4YJW A;  2HKO A;  2PI4 A;  1ZU4 A;  4DBR A;  4YT8 A;  2Y3G A;  4R7C A;  4PA6 A;  1JPN A;  3LLI A;  4FWV A;  3W2V A;  4E2L A;  2G62 A;  3K79 A;  3LLK A;  1NR7 A;  3LES A;  4QNH B;  1AJP A;  3P30 A;  1NVP D;  1VQ5 V;  1RM1 B;  1M1K W;  1F4N A;  1QR9 A;  3WG7 C;  1UJW B;  5HSW A;  3CCM V;  4UVB A;  2P7T C;  3T4D A;  3SJQ C;  2UXN A;  1NVP B;  1KD1 W;  4FX5 A;  4NY3 A;  4BEJ A;  1MMG A;  2VAS A;  5L3D A;  4WFG A;  4AK9 A;  3SYO A;  3LDC A;  2EZO A;  3X1O A;  1F51 A;  5C93 A;  2C2A A;  3N2Z B;  3AQC A;  4UUJ C;  5LGU A;  4E7Z A;  3QO8 A;  3LDD A;  5H9C A;  2W6I G;  3SPC A;  3B8M A;  1W2B U;  2IJK A;  3CCQ V;  1YTF B;  1FXK B;  4BJ1 A;  4CS9 C;  5KYU B;  5EGY A;  1GM8 A;  3MHH C;  2JK5 C;  2NUP A;  3EHM A;  4E7S A;  3E70 C;  4XDJ A;  2EJR A;  3ITF A;  1Z6A A;  3KMI A;  3T6B A;  3W7T A;  1AI7 A;  1P4R A;  4BJ5 A;  1JPJ A;  4RD9 A;  1D0Y A;  3CQZ A;  1KU2 A;  1VQO V;  4WJ0 A;  1K4D C;  2HJF C;  5L3G A;  3RIP A;  1F23 A;  2DWD C;  3E2E A;  3OGC C;  2ZD9 A;  2ZR2 A;  4MND A;  5KYX A;  3G71 V;  1VOM A;  1G8M A;  2DW4 A;  2EZP A;  1TUE B;  3CXC U;  2ZXO A;  3DD7 A;  3Q7G A;  3T4Z A;  4HFF B;  2J9U A;  3RKO F;  4JTC B;  2HVK C;  2A69 F;  4J30 B;  1GM7 A;  1JJ2 U;  2JD3 A;  5D91 A;  1R3K C;  3FVY A;  5KYX B;  2IOQ A;  1ROP A;  1ZHY A;  4MQ9 F;  5E33 A;  4Q4Z F;  1NKD A;  2Q9C A;  4KUM A;  1KP2 A;  3AG4 C;  2OT5 A;  4GX5 A;  5DQZ A;  4PJN A;  3ABM B;  2LSE A;  2NLJ C;  4R50 A;  3E35 A;  2WVO A;  2Y69 C;  5HFL A;  3CZ6 A;  3JD1 A;  4G7Z F;  4XDK A;  5B3S B;  1CEZ A;  4C3E A;  2ITD C;  4MTO A;  4Q20 A;  1M9N A;  1M2O A;  4JUR I;  4PA4 A;  1CP9 A;  2J0W A;  2J45 A;  4JVS A;  1J8M F;  3F7V C;  4BIZ A;  1HWY A;  1O5H A;  2WLI B;  4JGS A;  3MHS C;  2DQ3 A;  3X2Q C;  1R3J C;  3UM7 A;  1E1R G;  1FXK C;  1V55 B;  3SPJ A;  2M4E A;  4LLE A;  1OCZ C;  1S0V A;  4DVY P;  4G7H F;  1NZE A;  2C04 A;  4HAM A;  3GWO A;  4XLP F;  1Q7Y W;  2X51 A;  2R7U A;  5DM6 V;  3POV A;  1V54 B;  4PA9 A;  1EZJ A;  1QVF U;  2WLN A;  1NG1 A;  4I9W A;  5B1N A;  5EK0 A;  5EHH A;  1M56 C;  5CMU A;  1CPY A;  3BY6 A;  4U5H A;  3ZRW A;  3SYQ A;  2QE7 G;  1S5H C;  2XAF A;  3MLG A;  1QZX A;  4RQE A;  3I56 V;  5KYN A;  4KNW A;  2JEU A;  3PHF 2;  3SP1 A;  3T4R A;  3NKE A;  1WGW A;  3E8B A;  4RUE A;  3SYP A;  5CBF A;  1Y66 A;  4DBQ A;  3SPH A;  2X0L A;  2PI5 A;  1OCZ B;  3E9V A;  2YHS A;  4MW3 A;  3LNR A;  3PMR A;  4BJ6 C;  5KA5 A;  3OFN G;  1QCE A;  3EG9 B;  3OA1 A;  2LFS A;  3M99 B;  1Z23 A;  2Y69 B;  1GTO A;  3ASN B;  4MT8 A;  2ZXW B;  3FB5 C;  1MNE A;  4IRU A;  5T3T A;  1F4M A;  3ZG1 A;  3AG4 B;  5E2Q A;  4BJ5 C;  1RPR A;  2DYR B;  2A6H F;  4J9Z B;  3JT1 A;  5IY5 B;  4PJM A;  1R6K A;  2OCC C;  4OD4 A;  4RUF A;  1NJI W;  3HB3 B;  2GSM B;  1YHQ V;  1QLN A;  2JEX A;  1VYK A;  2IXM A;  3Q6M A;  4RDA A;  3HJC A;  4QE9 A;  1VQL V;  2AHZ A;  4XWJ A;  3W8I A;  3LSS A;  3CMA V;  5L3V A;  4CSA C;  1YSC A;  1DF5 A;  3K06 A;  1LVK A;  4UVA A;  3UGP A;  2Q3T A;  1NH2 B;  2CNW D;  3JYH A;  4I1O B;  3W2W A;  2BE5 F;  1RJ9 A;  4GX2 A;  2R7W A;  2PF4 E;  1NH2 D;  5CN0 A;  5IY5 C;  3AG2 B;  2XAG A;  2D3O W;  4UV8 A;  2IW5 A;  3ETG A;  1OCC C;  5T3W A;  3SYA A;  1FMW A;  1E79 G;  2QM8 A;  5FL7 G;  3JD3 A;  1ZHX A;  3OR7 C;  4KI2 A;  4KP4 A;  1TWC A;  3FYI B;  1TWG A;  2WSS G;  1N8R W;  5LBQ A;  3DJN B;  3OWT A;  4LLC A;  1G4Y B;  4H33 A;  1PNM A;  2K1E A;  3CD6 V;  4QIW F;  1QBZ A;  2WL8 A;  3W8H A;  3S29 A;  1VQ8 V;  1K4C C;  2W4M A;  4P6I C;  2EIJ B;  3K3W A;  3EGD B;  4OIR F;  3JD4 A;  1MMD A;  3VBB A;  2AHY A;  4KC9 A;  4R6Z A;  4HEA J;  4M63 A;  1FTS A;  3DZA A;  3RVY A;  3EGX B;  2WZF A;  3W7S A;  5B1B B;  4W8K A;  3ASO C;  5FCL A;  3SZR A;  5B1A B;  2EIN B;  2MYS A;  3V7O A;  1BL8 A;  1I5Y A;  4QI2 A;  2NNU A;  4QPJ A;  4XTK A;  1E1Q G;  2WWW A;  3Q6N A;  3CPW U;  4ANJ A;  1MOF A;  3I5Q A;  4LCU C;  1FXK A;  1GMG A;  3JCU Q;  1ENV A;  2R7O A;  3FB7 C;  1NQT A;  2CK3 G;  4LBE C;  2L81 A;  5DN6 G;  3F46 A;  2EIM C;  1DLB A;  3ABU A;  3QO7 A;  1VQ7 V;  3D3I A;  1D1A A;  2HVJ C;  4FK5 C;  2YEV A;  3W7W A;  2Y3B A;  3E86 A;  3ABK C;  3CME V;  1JCH A;  2MWQ A;  4U5B E;  3S0X A;  5IDJ A;  5EC2 C;  3OAA G;  1MMN A;  2J9W A;  1R73 A;  4XBF A;  4H4K C;  3W7X A;  3H01 A;  5EBL C;  3QO5 A;  3VAY A;  2XXA B;  2JJ1 G;  3P32 A;  3ZRX A;  2FGY A;  3ASN C;  4PFP A;  3DGE A;  2G3K A;  3ZSU A;  3LS0 A;  2HV7 A;  3E89 A;  2C03 A;  2XND G;  4X88 A;  3WFV A;  2Q9A A;  4MVM A;  4BW5 A;  3NYL A;  4RBN A;  5HFM A;  1PD0 A;  2W0F C;  1S7Z A;  2WLJ A;  1FS0 G;  1GO3 F;  2WLI A;  4KBL A;  4PJJ A;  3SNH A;  3EGD A;  3RVZ A;  5IYC O;  2VH3 A;  1Q86 W;  1KKD A;  3I4U A;  4OIQ F;  2JDI G;  1SMY F;  5DVW A;  3K08 A;  2ZDI A;  3AEI A;  1JVM A;  5L3F A;  3TET A;  3VOU A;  3LNM B;  4TWK A;  4ASU G;  1BR4 A;  1SZI A;  2A6E F;  3DAF A;  4HE8 D;  4YN0 B;  3ZC4 A;  1MND A;  3OEO A;  3IC7 A;  5KYY B;  2WZL A;  1R3I C;  4FMT A;  4QJF B;  2V3C C;  2E87 A;  4C7O B;  5H6Q A;  4PDL A;  4G2K A;  4WF9 V;  2XXA A;  4FPP A;  2EIN C;  2WLL A;  1YJW V;  4O79 A;  4BIU A;  3AG1 B;  1AI6 A;  2M7W A;  1K33 A;  4P30 A;  4CBE A;  4LC1 A;  3OR6 C;  4PJL A;  1BHB A;  4BJ6 A;  5KA6 A;  1V55 C;  3UNG C;  3GB7 C;  3B77 A;  3DM9 B;  2WLH A;  2JIZ G;  3X2Q B;  3KL4 A;  2Z5U A;  2YEV B;  4K7B A;  3CCL V;  4N21 A;  3OUS A;  1FMV A;  5E3C A;  1Z5Z A;  2Z15 A;  1PD1 A;  3OMN B;  1D0Z A;  1NR1 A;  4WFB V;  1H2G A;  3UKM A;  4A2N B;  2A68 F;  2H7B A;  3B9Q A;  3GAN A;  3ETD A;  1QR8 A;  3NYM A;  2A79 B;  1OCO B;  1R6N A;  1VQ4 V;  3QZC A;  5EBM C;  5E3A A;  3EPV A;  5DS4 A;  4PEL A;  3D36 A;  3EH1 A;  3UMK A;  1VYI A;  3JRT A;  1GKF A;  2EIK B;  1PD3 A;  3K7D A;  1VQN V;  3CYO A;  3NRH A;  3WG7 B;  2HR3 A;  1KP3 A;  1O87 A;  1VQM V;  5IYB O;  2Q9B A;  1KC8 W;  3ABT A;  3UGO A;  1TWA A;  2O9X A;  2BOB C;  4HFK B;  2DYS B;  1G8X A;  3OW2 U;  2B1G A;  4LAC B;  4PK4 A;  4JYB A;  1PNK A;  2J9V A;  2IXP A;  3SYC A;  4C3B A;  5L3C A;  3EFO B;  2Y3D A;  4I1M A;  2XSE A;  4G7O F;  2OG2 A;  5IYD O;  2IYL D;  2XL4 A;  2D5R B;  1TKN A;  1COW G;  2WLM A;  1OCR B;  4RQF A;  1YTF D;  2R9R B;  1JX9 A;  2QEX V;  1FXV A;  2IU3 A;  2EIK C;  4GX0 A;  4I44 A;  3MD0 A;  1RPO A;  4HZ3 A;  1MMA A;  3SPG A;  2V7Q G;  3HLZ A;  1S76 D;  2KQ9 A;  5DLJ A;  1MAB G;  3K9A A;  2H7V C;  4GT1 A;  4ZLD A;  2L9J A;  1IW7 F;  1QVG U;  1K34 A;  3ETE A;  4L87 A;  3ZRS A;  1YJN V;  1ZHT A;  1ORQ C;  1RJ9 B;  2R7Q A;  3CSK A;  2ZR3 A;  1WLE A;  2IJH A;  2W6J G;  3EZI A;  5KYU A;  3STZ C;  3B0U X;  3NXS A;  2Y39 A;  3IFX A;  3CCU V;  2J46 A;  1EFR G;  5GW7 A;  2YZS A;  3AQB A;  3CC2 V;  1K5S A;  3FAJ A;  3ZJZ A;  3O39 A;  1FFT B;  3ABL C;  4YT2 A;  1J95 A;  3JYC A;  1KQS U;  2J7P D;  1Z3I X;  2LFR A;  2WLL B;  4J9Y B;  4MW8 A;  1B6Q A;  3K04 A;  3I55 V;  3W7U A;  1OCC B;  2OTJ V;  3A0R A;  4JZA A;  4OD5 A;  2A0L A;  2IH1 C;  1LNQ A;  3LJB A;  4G0H A;  4Q5S F;  1DF4 A;  1K3E A;  1M57 B;  1K7D A;  3ZMT A;  1LKX A;  2DYS C;  5DS6 A;  1I5X A;  4UV9 A;  4X89 A;  5D92 A;  5L3Q A;  3LDE A;  1K8A W;  2NUT A;  5B1O A;  4LP8 A;  1THZ A;  3E8F A;  4MS2 A;  3TCU A;  3CCE V;  2UXX A;  3RFY A;  1TWH A;  4PA3 A;  3OMI B;  5KYW A;  3DJU B;  4ULW A;  1OCR C;  3F5W C;  3JSZ A;  3LS1 A;  5EC1 C;  4QDL A;  3ZRV A;  1YI2 V;  2PX3 A;  3K1I C;  2EIL C;  3NKD A;  2Q6A A;  1K9M W;  1JOY A;  2KNH A;  3S28 A;  1SER A;  3STL C;  5BZB A;  4B6I A;  4PDV A;  2R7X A;  3CCS V;  1K5Q A;  1FXH A;  3NG1 A;  4CS8 A;  2H94 A;  4JTA B;  4AX2 A;  3AG3 C;  2ZDI C;  3DAG A;  1K97 A;  4CS7 A;  1SF8 A;  4MVO A;  3AG1 C;  5CBG A;  1S3J A;  3OUF A;  3VYW A;  3PJS K;  4EBB A;  4GYT A;  3FDQ A;  4DOZ A;  1GK9 A;  2WLK A;  3B0P A;  1XL4 A;  4F4L A;  3B8N A;  4UVC A;  2NG1 A;  4JAV A;  4O7G A;  2R7S A;  3L34 A;  1JQ0 A;  2XAS A;  5E1A C;  4QE7 A;  1D1C A;  2XRH A;  5KUK A;  3TK1 A;  4O6Y A;  5T1D B;  1P7B A;  3JCZ A;  4JYC A;  3E8G A;  5L3B A;  3BEH A;  1NU7 D;  2P6V A;  3UMI A;  4GX1 A;  2QTV A;  5B1B C;  4O6M A;  3OE7 G;  3CCJ V;  3SEO A;  4WFH A;  3IEE A;  3OM3 B;  4G28 B;  5LGT A;  4YT5 A;  4XLN F;  2X6C A;  2KGO A;  4YT4 A;  5LGN A;  3LSQ A;  2CW0 F;  2IXO A;  1R3L C;  4JJG A;  5F5H A;  4GCZ A;  3EG9 A;  2IH3 C;  1M2V A;  3DMD A;  4K0D A;  3ZMS A;  2QTO A;  2P90 A;  2XAH A;  1W0K G;  1VQ9 V;  3NYJ A;  3T6J A;  4CIH A;  3E83 A;  3ZN0 A;  1ZU5 A;  2V26 A;  3K1H A;  3O6X A;  4WFA V;  4HYO A;  4DVZ A;  4OXS A;  4U5D E;  3GOD A;  4FJC C;  3G4S V;  3FHD A;  2BOC C;  3CCR V;  5F5F A;  2ZPA A;  3K0G A;  4QPK A;  1OZ0 A;  1MG1 A;  2HLD G;  4LER A;  2EBO A;  2W45 A;  3IGA C;  1K92 A;  3ABM C;  4CZZ A;  4MTX A;  1IZM A;  2ZXP A;  4WCE V;  3ABL B;  3AG3 B;  1FFT C;  1N1C A;  1QLE C;  1W0J G;  3KKB A;  3Q7L A;  4X0R A;  4F4B A;  2H8P C;  2WPD G;  1RM1 C;  2Z3Y A;  2HG5 C;  3AG2 C;  1EBO A;  4OIO F;  2R7R A;  2J7P A;  1L1F A;  1VMA A;  3EHN A;  1FFH A;  2NUP B;  3N24 A;  1SES A;  2LP7 A;  3L0I A;  4JPR A;  2F43 G;  1YIT V;  1VK5 A;  2QKS A;  4OIN F;  2I8B A;  3RYL A;  3UR3 C;  4U5G A;  5L3E A;  4EWC A;  4C3D A;  4YWQ A;  5KYW B;  4JTD B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...