1M57C

Structure of cytochrome c oxidase from rhodobacter sphaeroides (eq(i-286) mutant))
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
265
structure length
265
Chain Sequence
AHAKNHDYHILPPSIWPFMASVGAFVMLFGAVLWMHGSGPWMGLIGLVVVLYTMFGWWSDVVTESLEGDHTPVVRLGLRWGFILFIMSEVMFFSAWFWSFFKHALYPMGPESPIIDGIFPPEGIITFDPWHLPLINTLILLCSGCAATWAHHALVHENNRRDVAWGLALAIALGALFTVFQAYEYSHAAFGFAGNIYGANFFMATGFHGFHVIVGTIFLLVCLIRVQRGHFTPEKHVGFEAAIWYWHFVDVVWLFLFASIYIWGQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The X-ray crystal structures of wild-type and EQ(I-286) mutant cytochrome c oxidases from Rhodobacter sphaeroides.
pubmed doi rcsb
source organism Rhodobacter sphaeroides
molecule tags Oxidoreductase
molecule keywords CYTOCHROME C OXIDASE
total genus 97
structure length 265
sequence length 265
chains with identical sequence I
ec nomenclature
pdb deposition date 2002-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00510 COX3 Cytochrome c oxidase subunit III
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1m57C01
1.20.120.80 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 1m57C02
1LNQA 2ITCC 2WLNA 2WLIA 2Y69C 4R6ZA 5EC2C 5B3SC 4MTFA 3SYQA 5IY5C 2QTOA 3X2QC 2Q69A 4X8AA 4MVMA 5J9PC 3T4DA 4F4LA 3IFXA 2DYSC 2EIKC 3OR7C 2WLIB 1P7BA 2OCCC 3E8HA 2A79B 4LCUC 2K1EA 4UUJC 2NLJC 1R3JC 3E89A 1OCOC 5BZBA 4PA6A 4H33A 3E8BA 4QE7A 1OCCC 1XL4A 3AG1C 1R3IC 4MS2A 3WG7C 4EKWA 3LDCA 2Q67A 4X88A 4JTAB 4LP8A 2QKSA 2Q68A 3R65A 3ABKC 4MVZA 3FB7C 3JYCA 3RW0A 4PA9A 5EBWC 3RVZA 3ABMC 3FB5C 3LNMB 4MW3A 3VOUA 3ZRSA 4HYOA 3LDDA 1ZWIC 3EFFK 1KKDA 5EC1C 1V55C 3UM7A 3OUSA 4MSWC 1M56C 3T4ZA 4CBCA 5B1BC 2A9HA 5KUMA 5B1AC 3RBZA 3E8FA 4H37A 4MVUA 4RUEA 1K4CC 4MVOA 3SYAA 2WLJA 2WLLA 1ORQC 3E86A 3K03A 4JTDB 2IH3C 4P30A 3AG3C 1QLEC 4WFGA 3ASNC 5E1AC 3SPGA 3T1CA 3FB6C 1K4DC 4PA3A 2WLLB 4WFEA 2A0LA 4WFFA 3HPLC 3AG4C 4PDVA 3F7VC 3TCUA 2KB1A 3SPIA 2HG5C 4KFMA 3SPHA 4QNHB 2BOBC 3E83A 3SYOA 2Q6AA 4R50A 4XDKA 4MVQA 3STLC 3SYCA 2ATKC 3E8GA 4BW5A 3ZJZA 3K04A 3OGCC 4J9ZB 4TWKA 4PDRA 3F7YC 2JK5C 2W0FC 4GX2A 3LDEA 4MTGA 4PDLA 4QE9A 3TETA 1OCRC 2HJFC 3LUTB 3ASOC 2HFEC 3K0GA 2DWEC 4J9YB 4XDJA 3T2MA 4GX5A 2EIJC 2WLMA 4RAIA 4PA7A 3STZC 2ZD9A 1J95A 1JVMA 2HVKC 3SPCA 4OXSA 4MW8A 3PJSK 2HVJC 4PDMA 1BL8A 4JTCB 4LBEC 3KG2A 2WLKA 3SJQC 3SPJA 5CBHA 3FB8C 1FFTC 5EBMC 1R3LC 4G27B 3ABLC 4HZ3A 4I9WA 4XDLA 4PA4A 3BEHA 1V54C 2AHYA 3IGAC 2ITDC 3OR6C 4WFHA 5EBLC 1S5HC 5EK0A 5CBFA 3K08A 3K06A 1G4YB 4GX1A 4GX0A 4P9OA 1OCZC 4R7CA 4ZBMA 2H8PC 2AHZA 4MVSA 2ZXWC 3F5WC 4G28B 4P2ZA 3UKMA 3RVYA 2BOCC 2EIMC 2WLHA 4MVRA 4DXWA 4RUFA 2DWDC 2R9RB 5KUKA 1XL6A 2EILC 2X6AA 2IH1C 2X6CA 4X89A 1R3KC 2YEVA 4R8CA 3GB7C 2X6BA 4MTOA 3AG2C 2EINC 1M57C 2DYRC 2P7TC 3OUFA 3K0DA 4P9PA 4RO2A 5CBGA 3SYPA
chains in the Genus database with same CATH superfamily
3U3BA 1NTMH 5DLJA 2ITCC 3MDSA 2IM9A 3GORA 4UV8A 4MVMA 3N0TA 3T6GB 2KSFA 1HWYA 5KHHA 1RKEA 3ZHRA 1KNYA 1VK5A 2KGOA 2OJQA 3X2QB 1GKFA 1VB5A 3K5MA 1U0BB 2A69F 3KYJA 2Q67A 3HNIA 1GM8A 4DJ9A 3CPWU 2P6JA 1LVKA 2P61A 3JAWA 3THOA 3ZMZA 2Q9CA 1U89A 3OTFA 3EFOA 4XPYA 5BR8O 1IW7F 1H9GA 1YTFD 5L0HA 1SQPH 4I0XA 3VOUA 1J8MF 2JDIG 3E22B 4FZ1A 3ZIAG 5J2TB 1SQFA 3L34A 2Q7RA 3U9MA 1MQVA 1N33O 3FYIB 5E2QA 5B1BC 3OT7A 1WA8A 5IJ9B 3OW2U 3E8FA 1WOLA 3HKEB 4UCOA 2BC5A 1YYJA 5F5HA 2EPOA 1BR1A 3CCQV 5B1OA 3L74H 5FLXN 4JW1A 3L71H 3BRJA 1AJQA 4Q6GA 2GUZB 3C63A 2J9BA 1GK9A 1N4CA 3HKBB 4K1OA 3M1CB 4BIUA 1LKXA 4GKJB 3F7YC 3EH2A 3CRAA 1OCRC 2PI5A 4ER9A 2YXYA 2MW2B 2R05A 5A6KA 2NN4A 2HSQA 3C8GD 4H4KC 3BA8A 1SF8A 2H7VC 1GM9A 2VC9A 3J80N 5A6BA 5CN0A 4IIJB 3C8GA 4UDVA 5A2QN 3GANA 4PV1B 3Q7LA 5KHIA 3OEHG 3K33A 5DQZA 2LJ2A 5FL7G 1GS9A 1ZHZA 2BTQB 1CPRA 4DR7B 3DXRB 4D4NA 1M1KW 4XDLA 4Z2WA 3N2KB 2ITDC 4UB6Z 5EK0A 3WB1A 3SP1A 4LDKA 2VB6A 4GX0A 1QQ3A 3DE8A 2JS3A 4LLEA 4UB8Z 4U5CE 2HKOA 5BQGA 1QVXA 3O6XA 4NKGB 2X0CA 1COWG 2FKXA 2FFHA 3RGBA 1JPJA 1APCA 3TJ6A 5B5EZ 1ZL8A 4O7GA 1YJNV 2G62A 5GPGB 3CP1A 1IX9A 1M6TA 2J7PD 4R6ZA 3VQXA 1MNEA 2ZCEA 2YC0A 4F4LA 2OIEA 1XZQA 4KC9A 4OIPF 4DYLA 1PD1A 1TFOB 5KYXA 4LF5O 2ZQMA 2IOQA 3FXHA 5T3TA 1B6QA 3AG1C 5BXZA 5LGUA 4CH5A 4PJJA 2B5UA 3SJCC 1I5NA 3JRMO 3T4RA 3VRCA 2XM4A 3P30A 1H2SB 4ZI7B 1CPQA 4DR6B 1NVPB 2GAQA 5L0JA 3RVZA 1WN7A 3DTUB 3S0XA 2RMKB 2R03A 1IZMA 3AGTA 4QJFB 3GWOA 4DUZB 1OXBA 2OTLV 4JCHA 5L0GA 5EC1C 2YLIA 1Q0DA 2ASRA 2Z3YA 1AI6A 1Z7Qc 1DTOA 3ZVRA 3S9OA 3RH3A 3K9AA 1YIJV 2Q8VA 4B3TO 3T6BA 1K4CC 1XDCA 2DW4A 4X1IA 2Z15A 3L8IA 4G7OF 1OJHA 1TGOA 3LLIA 2M6YA 1AEPA 4YWQA 1D5AA 1JMWA 2GHYA 2GV9A 3W7WA 1O87A 5JJEB 2OT5A 4KFMA 3IAYA 1L3PA 3CRCA 4R50A 3M15A 5KA6A 4BWAA 2ATKC 1X4TA 2V26A 4ZOLA 2CCYA 1LS1A 3EHNA 4FM0A 5EGYA 1VQ9V 3M4CA 4XDJA 5GTIZ 3FHDA 2E87A 3JSNA 1J95A 1ST6A 3JCZA 4DRXB 4MW8A 4G2KA 1BS3A 3B0VC 3EZIA 1H8HG 1DLBA 2M7WA 3JATA 3ZHUA 3AOUA 3SYNA 4OX9O 2AZ0A 2YIDA 4FJCC 5ITZA 5KYYA 2PP4A 1W2WA 2AWYA 4JAUA 2YKZA 5EZYA 4I50A 1KC8W 3KH2A 5HV9A 3KZIZ 1UJWB 1PCXA 3QZCA 2ZXWC 2R02A 1O9HA 4JC7A 1HW2A 1XL6A 5B1BB 2L6FA 4BPMA 4ASUG 2QWPB 3DJUB 2ADPA 2DOSA 3AG4B 4JVSA 3UNGC 1K97A 2O9XA 1BGYH 1JCHA 1XMQB 4R32A 3US6A 1LIHA 4K8XA 2Q9LA 3K0DA 4PDVA 5CBGA 1RKEB 2P1AA 4L87A 1XMOO 1VQNV 5JCOC 5BMVB 2QTOA 2VQEO 3D36A 1QU7A 2OQMA 5JVDA 4HAMA 2PX3A 1F4MA 3RF3A 2OCCC 1BR4A 1G6UA 2EIKB 1Q0KA 1QSPA 3JAWB 2AZ2A 4XBFA 4PJNA 3CMAV 4LF9O 3B09A 5KHKA 1NKDA 1MMMA 4ZI7A 4U5EE 3G6BA 4O2BA 3T9OA 3HKDB 1ROPA 3CE2A 2EBOA 1L0LH 1HNZB 3KKYA 2ZE5A 3ABLB 2HJ3A 2OG2A 3FOOA 1B04A 1WLEA 2QE9A 2XUMA 1GQAA 4YT2A 2VCCA 4YJ2A 3ZRSA 1K73W 2PGGA 5KYWA 1AJPA 3WU2Z 3X1OA 1PV0A 1XREA 2MWQA 5KUMA 1EN5A 2OCCB 5LXTA 1Y6XA 5JH7A 1SQBH 3JD3A 3M99B 3T1CA 2KKWA 2Y4TA 5B3IA 3AG2B 2WLLB 1VTMP 1L7CA 2MHRA 4WFFA 3HPLC 4EIYA 3CCEV 3SPHA 2Q6AA 5CA0B 5LMNB 1QLNA 3QF7A 1BDJB 4P6IC 3STLC 1E79G 1AR1B 3K04A 4WFEA 1HNZO 4LFCB 2W0FC 2EILB 3RYHA 3EXAA 3QTHA 2Q7EA 4B3SO 2F93B 3STZC 1CGNA 3O65A 1FFTB 4ICGA 3ITFA 2A0UA 3SZRA 3KG2A 1JR8A 2RDCA 3SPJA 5CBHA 4YT5A 5DS5A 4KP4A 3UT5B 2XL8A 2A6EF 3ABLC 1NH2D 3CEIA 2F95B 3RT3C 2E3CA 3CCLV 4AHCA 4MQ9F 5IE9A 4GYCB 3ZBHA 4J7TA 4U3JB 3SR2C 4NTXA 1S76D 4DXWA 3QO7A 5LOVB 4RUFA 2DYSB 5CA1B 4U5GA 4A4AA 2OOCA 1AB3A 4R8CA 2AW9A 4MTOA 1H7IA 1WB8A 5LP6A 3ZSUA 2WVNA 3JSLA 1SQGA 4X62B 1GMGA 4I4TA 5IT9N 1ZHYA 2A1DD 2XSEA 2ZNIA 2D3OW 3OE7G 2R7SA 1NQTA 1J8YF 3IHUA 1XQ8A 3EGXA 3NKEA 4NC3A 1NS1A 3A2FA 3C90A 1SMYF 1R3JC 1NVPD 1DF4A 1KKCA 3F47A 4PA6A 1LUWA 1SQQH 2VQFO 3FX7A 4U5DE 3A0HZ 2UU9B 2DYRB 1P7GA 1QQCA 3OD4A 4O2AB 3RYCB 1A7EA 4X64O 5FPOA 1JOYA 4PD4F 2BL2A 1GM7A 1H2LA 3CRQA 3D36C 5LBQA 2BE5F 1HMOA 1KKDA 2HSBA 3UT5A 5JRAA 1K5QA 1GN2A 1WATA 5B1AC 1OV9A 4YIPA 4O4JA 2XLVA 2ODMA 5KHGA 5JJNB 4LFAO 4YHHB 4JURI 3SYAA 4E0HA 2WLLA 1ORQC 4YT4A 4IWBA 5GONA 2B0JA 2NR5A 5LOVA 3S90A 1PKXA 2GWWA 4PA3A 4HNAB 4CJOA 1EBOA 1XNRB 3EH1A 3V5YA 3ZRWB 1N32B 3F5TA 2F43G 5CB4A 1LM3B 1RMVA 4FIPC 4JAAA 1Z5ZA 3ABTA 3EHBB 3CCUV 1K5SA 4HE8D 2F23A 2N04A 1TUEB 4CSAC 4J7YA 3B40A 4PDRA 3TXQA 1WASA 3M8AA 4DBQA 3LUTB 5JSLA 1Q6HA 4G0HA 1Q90D 2HHHO 4LDQA 4NTWA 3LJBA 2J0XA 2IBFA 1BSMA 5H9CA 4LF8B 2LGQA 3PJSK 1XMQO 2HVJC 3JASB 3SNHA 4FWVA 4B7EA 3HLZA 2WLKA 2RCVA 4FM2A 1NU7D 3DKAA 1R3LC 4RD9A 1NBMG 3R2PA 4LFBO 2O57A 3CQZA 1KMIZ 2GFHA 5K0IA 2XL6A 1T6QA 3BEHA 2I15A 3ZHSA 2XL4A 3K06A 2XM0A 4PJLA 4ULVA 4OIRF 1MABG 5FCLA 1HNWO 1AJNA 2NG1A 2ZM6B 2JRIA 5LA6B 2AGAA 3A0RA 4DVYP 1FJGO 2YQYA 2CGOA 5A6BD 2IXOA 4DVZA 4F6EA 4FLWA 2J9WA 2CNWD 4JI0B 4NXMB 2Q73A 5IY5C 1WP7A 1OR2A 3P32A 2Q4FA 3EGXB 4NQFA 5J9PC 4X8AA 1F7YA 3H2UA 1Y66A 3T4DA 5COFA 5L0IA 1Z5WA 4DV1O 4W8KA 3JARB 2EIMB 2HFIA 2NSFA 3E8HA 1K3EA 1YA7O 2ZINA 4DV0B 4BJ1A 3G71V 5BZBA 5AG2A 4X9QA 4LF4O 2A68F 2HJDA 2ZDIC 4MS2A 4WGYA 2WB7A 1TUBB 5L3QA 5AC5A 3SJBC 3LNNA 4Q7CA 4MVZA 1AI7A 4AQYB 4PK4A 4YL0A 3OMNB 1S5LZ 1SETA 4J80A 4PA9A 1N32O 1Q81W 1SR2A 1IBLB 1BE3H 2HV7A 1KU9A 2HMQA 2AXTZ 2FL4A 2LQTA 1ORJA 2F4VO 5KYUB 3U8VA 2P22C 4H44B 2YVKA 2DQ3A 5IWAB 3PHF2 1B06A 1YARO 4FFBB 4ZHQA 1SQXH 1S7ZA 3K03A 2WA4A 1XILA 4JTDB 4NXMO 3ASNC 4JI4O 2CDYA 3A9CA 2GDCA 3T1YO 4ZKIA 2CE4A 3OTOO 5IYBO 3B4SA 3L0IA 1NFNA 3TCUA 4YJWA 4H13B 3W4YA 4CJGA 4JKVA 4KNWA 3ZDLA 3E83A 1A7DA 3TK0A 3W7TA 3IPMO 2GUZA 1V9PA 4J9ZB 4FPPA 3HB3B 1SZTA 1XHZA 2VASA 4O6NA 1LI5A 3QO8A 2DMXA 4J9YB 4A5UB 4TUYA 4DW0A 2EIJC 2JIZG 4LDRA 3JAKB 1SA0B 3CAXA 4K0KO 1YSCA 3PN1A 4CS8A 4TSFG 2QKAA 3BVOA 4IYIA 3JZ0A 4DV4O 3HKEA 4PFOA 2EX3A 4JI0O 5KX5A 1GGQA 4OIOF 4BJTA 4C7OA 4I9WA 3G4ZA 3OA1A 2R7XA 4OPAA 4JCZA 3BY6A 4CSAA 1MMNA 2QR4A 1PPJH 2C04A 2R7VA 4XEFA 1KYOF 4J32B 4MVSA 4ANJA 3RKOF 3RVYA 1GAXA 1X59A 2DWDC 2ZR2A 2VQEB 1Q43A 4FFBA 4UCSA 1I7FA 3FAVA 2EJRA 2JGUA 5IJ9A 4ZHQB 1R5ID 4B08A 1R6TA 5CI8A 4JIOA 2ZE7A 5L3GA 2HKVA 1FAFA 2QNLA 2FAPB 4JI7B 2OTJV 3DSQA 5L3BA 3JARA 5D92A 4JI1B 1K9MW 1E2XA 1Q0GA 4N06A 2Y69B 2UXDB 4CS3A 5DQTA 1FXHA 1E83A 2YICA 4LCUC 4U5HA 2K1EA 2LFSA 2XAQA 4MTXA 3E89A 1ZW3A 4OINF 2EPNA 2V7QG 2UXBO 1BT8A 2HS5A 1Q7YW 3ZG1A 3OTOB 1N8RW 1H9TA 4E7SA 4GKKB 1Q0MA 1B3QA 2CUGA 2WPDG 3OFNG 4LERA 1A41A 1US6A 5B1NA 1UG7A 3ZMVA 1DOWA 3OUSA 2YL7A 4PHZA 1T5EA 2NUPA 1LR1A 3RBZA 1M5IA 1IXBA 1Q0FA 4C3BA 3CCJV 1FTSA 3C8ZA 3K1HA 4OD4A 3WB0A 3AG3C 4EWCA 5E1AC 1VQKV 2Z5UA 2JD3A 5JQGB 5IJ0B 2W4MA 1LI7A 1RP3B 2DGJA 4KUMA 1ZTEA 1JR9A 2CTQA 2BTOA 2DB4A 4QI0A 3IEEA 1JPNA 4BW5A 2R7UA 1TWCA 1RM1B 2BSKA 2KYHA 3CC7V 5EIBD 1Q8IA 1SA0A 2XASA 2HFEC 4I3MA 3UMKA 1HNXB 5C93A 2DWEC 3ZMTA 1VEWA 3DGEA 4Q20A 4TQFA 1A32A 3EZHA 5AC4A 2RQ6A 2W4BA 2OYQA 5CI9A 2ZIOA 4JZGA 4LBEC 4TV9B 3SJQC 5E33A 5FNVA 2LSEA 1FFXB 4DR4O 2L9JA 4L6RA 4EFEA 3E22A 5J2TA 3EHMA 3CCSV 1FFHA 2V1DA 3CCVV 3NG1A 3TQOA 3RYIB 4BIZA 3TOMA 2R9RB 4CH6A 2Q9BA 1YVWA 1AP6A 4O4LA 4O4IB 2FYUH 2IJIA 2UUCO 4K0KB 1G1XB 3AGUA 1Z2GA 1MNGA 1VYIA 2YIBA 2RN9A 3B8NA 4K3AA 4WBNA 2LP4A 4YN0B 1C02A 3CCMV 4DK1A 3QVZA 2XAFA 4MTFA 1HNXO 3CS5A 1Y4CA 4EUKB 4Z9IA 2G3VA 4L8JA 4U7OA 1ZZPA 3E70C 1EN6A 3NMIA 4M63A 1M56B 1YZCA 5HFMA 2PZSA 1N33B 2IYLD 1JAFA 1NLXA 3D8CA 4X88A 2B1GA 4LP8A 3J06A 2GA0A 3R65A 5FZTA 3ABKC 5D91A 1QHTA 5JLIA 5H5NA 5EBWC 4AE4A 2LW1A 1JA8A 5H6QA 4EBBA 2OJED 2BTQA 1H8EG 3AK2A 1M56C 2A9HA 4JI4B 5ITZB 5KMGA 1JOGA 4RWUA 2ZIMA 3RYFB 1NFOA 2Q3TA 1EFRG 3UR3C 1OCZB 2E76B 4LWSA 5IJ0A 2AWCA 1KB9F 1Q3EA 2KJGA 1QLEC 1V74B 3G4SV 1H2KA 3RYIA 3DE9A 3KL4A 3GEIA 1YJGA 3WFVA 2A0LA 2Q9AA 1C03A 4X20A 3RN4A 5TISZ 3I4UA 1BCCH 1ORYA 4BEMJ 3K79A 3SYOA 2VQFB 2R7RA 2Y3HA 3FAJA 2ZT9B 1VQ6V 4RBNA 4MVQA 2HR3A 1L1FA 3MFNA 1THZA 5DVWA 3W2VA 4RDAA 4OIQF 3O55A 4YK5A 2A6HF 3QVNA 1GO3F 3N2GA 1EN4A 2UUCB 2UUBO 1CGOA 4WGZA 1FXVA 1MZFA 2XLEA 3K1IC 4JTCB 3NMKA 3VM6A 3NMJA 1Q5OA 1Q6UA 4P9FA 1YXBA 3HNKA 3UO3A 2JVDA 4LC1A 3U5SA 2WZFA 3J81N 3H1HH 3OR6C 5DS6A 3B77A 3L70H 1W0KG 1FJGB 1EI7A 5L3CA 2YL3A 4B3RB 1MSDA 4LF7B 2X7RB 5FPRA 1JMKC 3U0ZA 1YTFB 2K9PA 3IQ5A 4MVRA 4IAOA 4ZIBA 2X6CA 4X89A 2YWAA 4LFCO 5KYXB 1YJWV 1HDJA 3CZ6A 1VLSA 3DMDA 4KHPB 5D5QA 3K6BA 4JI2B 2IU3A 1YZBA 1R4TA 2EZPA 5C8YB 1OCOB 4FLUA 1D0YA 1SZIA 1TFKB 5B66Z 1HNWB 1VOMA 2QLAA 2ZXRA 3Q6MA 4JV5B 4JYCA 5IY5B 1JJ2U 4JEAA 4QE7A 4DR2B 1P4RA 1IBKO 1Z3IX 1BQZA 4PFPA 4DR4B 3JD2A 4DR1B 4Q4ZF 2LO1A 2Q7GA 3JYCA 1ZHXA 3K1IA 1XZPA 2E74B 1UFBA 4I9QA 1ZSPA 4U5BE 4I0XB 3C3SA 2JS5A 3DXRA 3E2EA 2LFDA 3EQLF 2H7OA 3MD0A 1VQ4V 3DWWA 1AI4A 4CZZA 3VF0A 3DM9B 4YJ3B 1IURA 1DGSA 4W4KA 1RM1C 3L9DA 3MHHC 3LLKA 4LF6O 1CP9A 1WNSA 4O6MA 5BQIA 4X62O 1RJ9B 3BA9A 4JI2O 4G7ZF 2CTWA 3B2EE 3Q7GA 4K7BA 1CGME 4F6RB 1SRYA 1HY5A 3C18A 3GEEA 1VARA 2IJJA 4XLPF 2YDEA 1XNRO 1H2MA 3F7VC 1RXQA 3JALB 2XAJA 4NYKA 3RQEA 5IYZB 3AEIA 2JEXA 4Z1VA 4XDKA 2NSGA 3P3NA 1VQ8V 4DR1O 4B3RO 2QJ1A 2AVKA 4GX2A 2JK5C 4PDLA 1KP2A 1S05A 4X1KA 2QUPA 2HJFC 3LSQA 2KK1A 4TV9A 2L35A 2GSMB 4I55A 3I5DA 1MMGA 1PL4A 4RAIA 4DR3O 2PX0A 1ZAUA 5A6AA 2V4DA 4FLTA 4O4JB 5CIVA 4Z9JA 1PP9H 1OW6A 2QWOB 4IJJA 1O9GA 3KYIA 4BW9A 1L0NH 1TWGA 4DV1B 1S72V 1T6IA 3IGAC 1ZVZA 1H2NA 1VP7A 3U3FA 1SESA 2CTRA 3AG1B 2R7TA 1EZJA 3ZRWA 1DOVA 3O9OA 1G4YB 1NH2B 2QTVA 4GCZA 3CXCU 4P9OA 1Y76A 1OCZC 3JAMN 5A9GA 4XWJA 2WLHA 5KLVH 4LR3A 4X1IB 2PI4A 2QY9A 5JH7B 3NYLA 1YZAA 1R3KC 2W6IG 1YA9A 2VCAA 3JTLO 2ZE6A 4DUYO 4JYYA 2L81A 3HNLA 3D3QA 2EINC 2DYRC 4RO2A 4P9PA 2JGDA 2CNWA 4NB5A 4UCRA 2QTSA 4Z1MG 2HHHB 1U96A 3FMSA 3Q4HB 2FMLA 1BMFG 2GBOA 3IFXA 3B0PA 2EINB 3U11A 4J10A 1PNKA 2VCBA 3MX3A 1Q86W 4I1OB 1WB7A 4G7HF 2ZPAA 4XEVA 5KYNA 1OCCC 2B9ZA 2IJHA 1H2GA 2P4KA 3CC2V 3B0UX 1N34B 5E3AA 5BQHA 1W59A 1ZUQA 5HFLA 4AQYO 3PDMP 1G5ZA 3CJHB 5IDJA 4JI5O 3EG9A 2ETSA 2XS8A 1M2VB 3I56V 4YHHO 3ATPA 1V55C 4FX5A 4X0RA 3WAQA 1K33A 3T4ZA 3V5ZA 2ILMA 1D1CA 5LMUB 4NTAA 5CMUA 2PYJA 3JCUZ 2BCCH 3OM3B 2YXHA 4FLZA 1KQSU 2UUHA 2W9YA 3SXYA 5KHJA 5LMNO 4F6RA 5L0FA 1MMAA 3AG3B 2WA3A 2VRZA 3EGDA 4EEQA 3U2LA 1GN6A 1TVKB 2E75B 5LGNA 5JT4A 2XAHA 4DW1A 1Q82W 2FGYA 3ASOB 2CH7B 3T1HO 2H8AA 5GW7A 3ZMSA 3I5PA 3WHNA 3N24A 4CS8C 3U0CA 1Y74A 1SQVH 1CXZB 3OMIB 4QPKA 4CIPA 3T2MA 3RFYA 1QVFU 4GYTA 2AP3A 3ZCCA 1XBLA 1HW7A 2AU5A 2XHBA 4DRJB 1F51A 2W6JG 5DN6G 1OZ0A 5IYCO 2KW3C 4FM1A 5EBMC 3OEEG 4LH7A 4CH4A 1YVIA 1M4UA 5COGA 4QDLA 1G4WR 3EG9B 2M4EA 1M2VA 1BHAA 5JQGA 5LP6B 2E5LO 3U8PA 3CB2A 4JPRA 4P2ZA 4GZRB 1KD1W 1ZHWA 3DI5A 2EIMC 2QM7A 4J30B 2HJMA 2IBZH 4JI8B 2EILC 1SZXA 2IH1C 3MYFA 3H1LH 4IYHA 2Y4UA 1M57C 3SJAC 3M4BA 1AR5A 3ZHVA 5EC2C 2Q69A 4U5FE 4XTKA 5BMVA 2EIKC 2Q4PA 1URFA 3GWNA 4LLCA 1XNQB 2ZNJA 2GTAA 1LE2A 1YDIA 3JRTA 1XL4A 2W0XA 5DEDA 1K92A 3MLGA 3LESA 3QW0A 1I5YA 2HUJA 3TULA 2G38A 1VQOV 1YHQV 1E85A 4DR6O 1Z6AA 3W7SA 4Q5SF 3ABMC 4JEBA 4E7ZA 3B29A 1Y67A 4GQHA 4YJ2B 3EFFK 3HKKA 3ZWIA 2FB5A 2Y39A 1VYKA 1S3JA 2G3KA 1QCEA 3GODA 4O4LB 1PNMA 2F4VB 5DECA 1FXKC 4JI3B 5CB4B 3H1IH 5IWAO 2XXAA 3EJNA 2LIGA 2RD9A 3NYMA 5JCOA 2QE7G 3GEHA 4JI1O 4E2LA 1TKNA 3K5OA 2NNUA 5LL6Y 4AX2A 1AILA 3M79A 3K57A 2ETNA 4DV6B 1W2BU 4QIWF 2XLOA 4CDAA 3O39A 2DQ0A 1VF6C 3HKBA 2YLGA 1TQGA 2D5RB 1QR8A 4EBKA 4WABA 4JI6O 4DV2O 3TJTA 3TXSA 1E1RG 5CA0A 4ULWA 2IM8A 4MTGA 2PFDA 4O79A 1QLEB 4PJMA 4AE4B 4PACA 3S28A 3RYHB 2WLMA 1NT2B 2JJ2G 3RFRA 3IC7A 2YI8A 3APOA 3VYWA 3J7AU 1IBMB 2J7PA 4QI2A 4AK9A 3G6EV 5LYJB 1FKAO 1FFTC 3RQGA 3LSSA 2LQGA 4N4WA 1I4ZA 3H1JH 1WTYA 4D7SA 2VH3A 1FPOA 3B9QA 1S5HC 3S84A 4BJ5A 1R73A 1TA8A 2HP8A 3H1KH 3FDQA 2QKCA 3GM1A 4NY3A 4JASA 3SXMA 4R7CA 3ZRXA 3CC4V 4DRIB 4XLNF 4BEJA 2P0NA 2PNOA 2F1MA 5LHHA 3SXZA 1FMWA 5KA5A 3Q6NA 2MK3A 4D6TH 1D0ZA 3AG2C 2EPKX 3T1YB 4UVAA 3VAYA 1N0JA 3K5NA 4PI2A 5JVDB 1WJZA 4CDVA 4D4XA 2DYSC 4I4TB 4AL0A 3ZHTA 1IZ3A 1N1CA 4DRHB 2FTKA 1FXKA 5B3SB 1EZVH 3DC6A 4O2BB 2XLDA 3LNRA 4LF8O 4JI5B 3SGIA 3W8HA 2QWNB 4DV6O 3K59A 3OMAB 3KCYA 4TUYB 1QKRA 2XTAA 5E79Z 3ABKB 1GM5A 2VWKA 3MBGA 4HYOA 1P49A 2ZKOA 2YLDA 1EKYA 3ZIBA 3ABMB 4DV2B 2RJZA 2I8BA 1I0HA 4CBCA 4IARA 1K34A 2HZ8A 4J7JA 4E0IA 4C7OB 4CS4A 4JRZA 5FNVB 4B3TB 1BR2A 2QA4V 4H54A 4BJ6C 4IHJA 3W2WA 3KPHA 4BAYA 4N23A 4DV5B 1LS4A 4DV3B 4CS9C 1VQPV 1GTOA 1YI2V 3CD6V 2PTMA 4TQDA 3TGUH 3AG4C 2EIJB 1Y74B 4EBJA 1BHBA 4WF9V 2HG5C 4HEAJ 2ZXPA 2D2CB 4JI7O 4DR2O 4B7KA 3ZEDA 2HMZA 5L3FA 3E8GA 2L7AA 3OGCC 1ZYRF 5KYWB 3ZN1A 2XT9A 5CA1A 4LF5B 2XS1A 4KI2A 4CC6A 2ADQB 2QM8A 1VIBA 1AROP 1OQCA 1RSOB 2VS0A 5EIBC 2HVKC 2ZE8A 3UO2A 1G8MA 1MSWD 3U2MA 2IW5A 2HEPA 3L72H 3FFQA 4U3FH 3N2GB 4RQEA 1WN0A 4JGSA 2OEVA 3UGOA 1ZU5A 4TV8A 2ZM6O 3TK1A 1JRAA 4BIOA 2LK4A 3ZQVA 5KYYB 3CSXA 2QGNA 3RWRD 3K58A 1PM9A 3R7CA 4JI8O 4X66B 4X1YA 4XPWA 5H2FZ 2UUIA 1GN3A 2EPMX 4ZLCA 2LW7A 5L3DA 2A7WA 1DK1A 2AHZA 4G28B 1LE4A 4JZAA 5KUKA 1HW1A 3PCVA 4BJ6A 1RFYA 2OU6A 1AR4A 2CYDA 2Y3DA 1JX9A 4AI8A 4IHJB 5KMGB 3ML0A 1OKKA 2B0HA 3UQ8A 4LWSB 1BQ0A 1KP3A 1HR0B 2IXNA 3OUFA 3HKCA 1A0BA 1D1AA 4JAVA 1MZEA 1LNQA 2WLNA 4DO2A 5L3VA 4FFKA 4CDYA 4CBEA 3E35A 2DN9A 3T6JA 3WB2A 3X2QC 4X66O 1WWPA 1NR7A 1H6GA 4O4HB 2WSSG 4EB6B 1K40A 4JI3O 2ZXWB 4YIOA 2PYLA 1WPBA 3DJNB 1VF7A 1LPEA 1WPXA 2XLWA 1JFFA 2R9IA 1UFIA 4RQFA 3O10A 3LDCA 1YJ9V 3I5QA 4NTBA 3LEVA 2YL0A 5LMUO 1O5HA 1RSOA 4DOZA 3LS0A 4LF6B 2PY5A 3QTCA 3LDDA 2C2AA 4WFBV 1D5NA 1YCIA 3UM7A 5HSWA 1Q6IA 1YF2A 4PR9A 2OEXA 1CPYA 3HKDA 4JF3A 3H01A 2X0LA 1N34O 3TOLA 3JASA 4NXNO 4QPJA 3VQVA 2IH3C 4N21A 4TT3G 1NZEA 4EHPA 5J2UA 2WWWA 1K4DC 1AVMA 1H38A 1VQ7V 3K66A 2KC3A 3G4XA 4KL1A 2R9AA 4X65O 1JQ0A 1XMOB 3ZQYA 1F1MA 3C62A 5E3CA 3UMHA 1HMDA 3JYYA 2YIAA 4DV0O 3TD7A 1I5XA 5JJJB 4DBRA 2Q00A 2WZLA 4DV7O 4XQ1A 2QM4A 4B3MB 3CMEV 3W7XA 5F2VO 2Q0AA 4GX5A 4IB4A 4UV9A 1D1BA 2LD6A 2JEUA 4GLXA 4I1MA 1QVGU 1Y6DA 3AK3A 3QNEA 3OEOA 5L0CA 1EQ1A 3GVMA 3S3XA 4G27B 2PBEA 1WA8B 2CW0F 5KX5B 2YSUB 2P7VA 2KQXA 1V54C 2XRHA 3IQ6A 2R7WA 3UCSC 4FVMA 1PD0A 4J42A 1BBHA 3N2ZB 1VQ5V 2ZR3A 4P9TA 3JD1A 3A0BZ 4I44A 2A0BA 1FAPB 4KBLA 4QGPA 4YJ3A 3RYFA 4WJ0A 4CS7A 3KCXA 3VBBA 1OKKD 1IBMO 1TR2A 2IXMA 1UPGA 3GB7C 1U6HA 4YY3O 5D5PA 4K8ZA 5EHHA 3FKSG 3IJ4A 5JUAA 2W45A 4J7ZA 2KG7A 4O4HA 4U3JA 3GWLA 3HNJA 3R66A 4BR6A 4X20B 3PMRA 3A8TA 2F66C 3OR7C 2WLIB 1NBBA 3MYIA 4YXWG 1K05A 5COMA 2B1IA 2P90A 3G80A 4LNUB 3DM5A 1OCOC 4H33A 1ZX3A 4WFAV 2LGWA 3RYCA 4UVCA 3EFOB 4EKWA 3UGPA 1FYJA 2ZXOA 4CS9A 2QKSA 4Z9HA 5B1AB 1MNDA 3ETGA 3CRRA 4FLXA 5K1XA 1M93A 3CRMA 1YYXA 1PD3A 3RW0A 4AL1A 3AG7A 3FB5C 4MW3A 1V54B 4OPHA 2KSDA 3L1MA 1I94O 2UUAO 3JT1A 1N0NA 1QNMA 4E17A 1IDSA 1QR9A 4MSWC 1TWHA 4FLVA 3DXJF 3HJCA 2JGDB 3HTKC 1BZKA 3APQA 4A2NB 2Q5ZA 1VF6A 3M7MX 2OWOA 3JSEO 1XHXA 3T1HB 2L6LA 3CWBH 2C03A 2CK3G 3K9SA 1XI1A 1G8XA 3SXKA 3GM2A 4XEKA 2LCHA 1F4NA 1I94B 2WVQA 2KB1A 3G50A 1MOFA 3DAFA 2UXCO 3RYLA 4E4EA 4QNHB 4FLYA 1WAZA 4HBNA 3H2VA 4U9EA 5A6JA 3AK1A 3H65A 3CYOA 1HP8A 3BPZA 2ARHA 3ABUA 5KAFZ 1K04A 1D0XA 3K0GA 5CA3A 4HFFB 3SPCA 4H0LB 1F23A 3JAKA 2UUAB 2RSEB 3S29A 1GH6A 1SKVA 256BA 3KKBA 1HR0O 1BL8A 3QVYA 2BE3A 3DC5A 3FB8C 5F28E 3UMIA 4HZ3A 5EYPB 4UFZA 4MNDA 5DM6V 2Y0IA 3ETEA 4WFHA 1A7VA 1J5EO 2TMVP 3K08A 3EGDB 1SC5B 3NKDA 1GN4A 4N6HA 4UVBA 1E86A 3SDLA 1TVKA 4JJGA 3EVKA 4DR5B 3CX5F 2H8PC 1SS3A 4NTYA 1CEZA 2F22A 3JCUQ 1I08A 2BOCC 3ASNB 5GONB 4XPXA 1O3UA 1K7DA 2X51A 2Y3BA 4LACB 2X6BA 2P6VA 2A06H 4EB6A 2EJ7A 3LSUA 1S0VA 3SYPA 4B3MO 4J41A 2WLIA 3NR7A 5B3SC 4W8PA 2LFRA 4IT5A 1Z5VA 3ZMUA 5L0DA 4I5SA 1P7BA 3CCRV 4UUJC 3ZS8C 2WAMA 4CX9A 3QMKA 1ENVA 1YEWA 1NTZH 3VQWA 2WVOA 3ZTZA 1TUBA 4J7KA 3WG7C 1R3IC 3K5LA 3AQCA 1AI5A 3JYHA 3ZC4A 2UUBB 1OCCB 2GTSA 4E18A 1ZHTA 2J8WA 4GKKO 2PUSA 4NVPA 5LHGA 1QBZA 4C3DA 2IXPA 3H9VA 3KMIA 2UXNA 4X65B 2A3QA 5EZYB 4ZLDA 2JPUA 1VQLV 3RQFA 3GWKC 2UU9O 2HLDG 3QG5A 1RCPA 1L8DA 1KECA 3IC9A 5EYPA 3W7UA 2Q7HA 5BR8B 1TWAA 4DV7B 5GTHZ 2WL8A 2NUTA 4H37A 4K35A 5LP6C 3DAGA 2UXDO 4JI6B 2WLJA 1IBLO 1S77D 1XWJA 4B6IA 1MMDA 3FB6C 1AUEA 1DF5A 3L73H 4I55B 5TJ5E 1AVOB 3POVA 1XUQA 3BRCA 3SPIA 1LUVA 3B8MA 4CC5A 4ZOLB 4J11A 3IQTA 4KNVA 4NR1A 1KUQA 3SYCA 2R7OA 3ZJZA 5IYDO 4TOIA 2IJKA 3U9JA 4YT8A 4HNAA 3TETA 4LF4B 4DRXA 1FD9A 1IBKB 3JSZA 1PNLA 4IIJA 3C8GB 2QWRB 2H94A 4PA7A 2LFFA 1GRJA 5KAIZ 1YDXA 1M2OA 2NPUA 4HFKB 3N2KA 4LF9B 2J9VA 2N74A 5JVEA 1V4AA 1VMGA 2E5LB 4NCQA 2IU0A 2D4UA 4PA4A 5EBLC 2QSAA 3CEXA 2KNHA 3HR0A 1SERA 3SEOA 2XNDG 2HV6A 1VLTA 3FAPB 2J0WA 2YXLA 4IL6Z 1EA8A 2M64A 4I7ZB 4LH6A 1ZL8B 4LF7O 4FMTA 1KBHA 2NUTB 3IQCA 2H7BA 2XLMA 3ECSA 1AP5A 4EFBA 4JYAB 1RPOA 3NYJA 1T01A 1Y4MA 4ZBMA 5DS4A 1RKCA 3F46A 3AQBA 5JP7A 4UCVA 2P4VA 2Y0PA 3FYEB 3JALA 4U9DA 4KXRA 3HKCB 1KU2A 2L6HA 4FK5C 1SYQA 4GUNA 2P67A 2A79B 1FFXA 2CDQA 3V5XA 3E8BA 2QDOA 2YRFA 1HE9A 2EULA 2XOKG 3EPVA 1M57B 4JTAB 1FXKB 4NTFA 1NI8A 3FB7C 2Z0AA 4OD5A 5A69A 1XOUA 4X1YB 4ABMA 4C7UA 3MHSC 3C7JA 5LHIA 4DV3O 3V7OA 3WODF 2N05A 3LNMB 2OKUA 1OW8A 2OIGA 1ZWIC 4NXNB 1U97A 4F4BA 1NG1A 4UXNA 1ZLZA 3MAQA 4B3SB 2QWQB 4WBNB 5LYJA 2CAZC 3JATB 1R1BA 3BFRA 5F5FA 1M90W 4GKJO 4MVUA 4RUEA 4MVOA 5LA6A 3L8JA 1JJOA 1VMAA 4P30A 4WFGA 1OHHG 4I50B 4PELA 1XNQO 1ZU4A 3I55V 4PJ0Z 4U7NA 3NRHA 4G78A 4LFAB 2J45A 3D3IA 2LP7A 3JD0A 3L75H 2BOBC 3BHPA 1FS0G 1T6UA 4DK0A 1MA1A 5IYZA 2QEXV 3DZAA 1PL0A 4TWKA 1JPXA 3LDEA 1ZW2A 1I4YA 3RIPA 1S5JA 3ETDA 3ASOC 3OGIB 2CGEA 1WP8A 3BCCH 1E84A 1Y76B 1JVMA 2UXBB 4GEHA 3QO5A 4OXSA 1M9NA 4JYAO 3TJ5A 4PDMA 2VWJA 3CHXA 1J5EB 3CSKA 1KTMA 4JV5O 5KYUA 1SF9A 2P5OA 2DJVA 2YS8A 4DUYB 5K1PA 4DV4B 1VF5B 1NZ6A 2XAGA 5BUOA 3Q4HA 5AGFA 3BABA 5J2UB 1Z23A 4GX1A 3W8IA 1R6NA 1V55B 1FMVA 1B68A 2WZGA 2UXXA 3ETQA 3F5WC 3U10A 3UKMA 4OX9B 3K7DA 5T1DB 1OCRB 2YZSA 3WG7B 4O4IA 4OGQB 1T9KA 2X6AA 3K3WA 1NSGB 5LXTB 2R70A 1IVSA 5H6RA 2J9UA 3VQYA 2Q0OC 3G67A 5C8YA 2Y69C 3SYQA 4K0DA 1HE1A 4UCUA 4IGGA 1NR1A 1OXKA 3CJHA 2Y3GA 2KG7B 2NLJC 3P3PA 4O2AA 1RJ9A 1NU1H 4D7TA 3NXSA 4JYBA 1IXMA 4W4LA 3ICXA 2MYSA 3B71A 2YUAA 1YLMA 4LNUA 2ICWG 2XLHA 2R72A 2Q68A 2GDSA 3ZTMA 1JFFB 3DD7A 5BY1A 3ZN0A 3AJMA 2DI3A 1QZXA 2H3OA 5JWPA 2R7QA 1ORSC 1N36B 4WCEV 3C3TA 2YL1A 3OWTA 4JE9A 4DV5O 3S27A 2J46A 1W0JG 2ZDIA 1NJIW 4PI0A 3S3WA 1VQMV 4TV8B 2KQ9A 5L3EA 3LEOA 1Z63A 2YI9A 2Y48A 4FZ0A 1NU9C 3FAVB 4DUZO 1T5OA 2L6GA 1K8AW 1NTKH 4GT1A 2YEVB 1RPRA 2R25A 3E86A 1OW7A 3SPGA 2CGNA 1FNTc 1P84F 4FESA 4BJ5C 4X64B 4JZ2A 3JD4A 2P06A 3ZX6A 2PF4E 2YHSA 3LAYA 1N36O 2V3CC 5JS5A 3LS1A 3CXHF 1QPUA 4IAQA 2OCHA 2EPLX 2DE0X 2CH7A 1E1QG 4CH3A 3BAAA 4QE9A 3FOPA 3ZHQA 2JJ1G 1C17M 1R6KA 1D2DA 1EM1A 4KHPO 3N27A 1G4US 1WGWA 4YL1A 2ZD9A 1OR3A 4MT8A 4CIHA 1PV3A 4YY3B 1YAUO 3FVYA 1BZ4A 4FAPB 3OAAG 4C3EA 2JX0A 1TAEA 1XEQA 2BSKB 4ONSA 2YIBD 4N6CA 2CTPA 4DR5O 4IRUA 3GM3A 2NUPB 1MG1A 5CBFA 2AHYA 5T3WA 1YITV 5LGTA 2RNBA 3NDBB 3E9VA 2XXAB 4LFBB 3FD9A 4X1KB 4AILC 2UXCB 1FR0A 4BG0A 2EZOA 2YEVA 4CS2A 4UCTA 4JJFA 4YL3A 3ZRVA 4O6YA 3QW1A 2P7TC 3A11A 4DR7O 4DR3B
chains in the Genus database with same CATH topology
4Z1MG 2W45A 2ITCC 5DLJA 5IY5C 3EGXB 4UV8A 3P32A 1BMFG 4X8AA 4MVMA 5J9PC 1Y66A 3T4DA 3N0TA 3IFXA 3PMRA 4W8KA 3OR7C 2WLIB 2EIMB 2EINB 1HWYA 4YXWG 1PNKA 3E8HA 3B0PA 2B1IA 1K3EA 2P90A 3MX3A 1Q86W 1VK5A 4I1OB 4G7HF 2KGOA 2ZPAA 3DM5A 4BJ1A 1OCOC 3X2QB 1GKFA 5BZBA 3G71V 4H33A 2A68F 4WFAV 5KYNA 1OCCC 2IJHA 1H2GA 2ZDIC 4MS2A 4UVCA 2A69F 3CC2V 3EFOB 2WB7A 4EKWA 3B0UX 2Q67A 5L3QA 3UGPA 1GM8A 2ZXOA 5E3AA 2QKSA 4CS9A 5B1AB 3CPWU 3ETGA 1MNDA 2P6JA 4Q7CA 1LVKA 4MVZA 3ZMZA 2Q9CA 1AI7A 3EFOA 4PK4A 3OMNB 1IW7F 5KYWB 1PD3A 1SETA 4PA9A 3RW0A 1YTFD 5HFLA 3FB5C 4MW3A 3VOUA 1Q81W 1V54B 2JDIG 1J8MF 2HV7A 5IDJA 3EG9A 3ZIAG 3L34A 1M2VB 3I56V 3JT1A 1V55C 4FX5A 4X0RA 3FYIB 1QR9A 4MSWC 5E2QA 1TWHA 1K33A 3T4ZA 5B1BC 5KYUB 3HJCA 1D1CA 3DXJF 3HTKC 2DQ3A 5CMUA 3PHF2 4A2NB 3OW2U 3E8FA 3OM3B 1KQSU 2W9YA 1S7ZA 2C03A 5F5HA 2CK3G 3K03A 4JTDB 1BR1A 1G8XA 1MMAA 3CCQV 3ASNC 5B1OA 3AG3B 4ZKIA 4JW1A 5IYBO 3EGDA 1F4NA 3L0IA 1AJQA 3TCUA 2KB1A 5LGNA 2WVQA 1MOFA 4YJWA 4ANJA 2XAHA 3DAFA 1Q82W 2FGYA 4KNWA 1GK9A 3ASOB 4QNHB 3E83A 3RYLA 3W7TA 5GW7A 3ZMSA 3I5PA 3H65A 3M1CB 3CYOA 4BIUA 3N24A 4J9ZB 1LKXA 4CS8C 4FPPA 3F7YC 3EH2A 3HB3B 1SZTA 3ABUA 3OMIB 2VASA 1OCRC 2PI5A 4O6NA 4QPKA 3QO8A 1D0XA 3K0GA 3B0VC 5CA3A 4J9YB 3T2MA 3RFYA 1QVFU 4GYTA 2EIJC 2JIZG 4H4KC 4HFFB 4BJ5C 3SPCA 3ZCCA 1F23A 1YSCA 1SF8A 2H7VC 3S29A 1GM9A 4TSFG 3KKBA 4CS8A 1BL8A 5CN0A 1F51A 2W6JG 5DN6G 1OZ0A 5IYCO 3GANA 2KW3C 3Q7LA 5DQZA 3FB8C 3OEHG 5EBMC 3K33A 4PFOA 5FL7G 3OEEG 1ZHZA 3UMIA 4OIOF 4HZ3A 4BJTA 4C7OA 4I9WA 1M1KW 3OA1A 4MNDA 4XDLA 2R7XA 5DM6V 5EHHA 3DZAA 3ETEA 2ITDC 3BY6A 4WFHA 5EK0A 1MMNA 4QDLA 4CSAA 3EG9B 3SP1A 3K08A 2M4EA 2VB6A 3EGDB 1M2VA 3NKDA 2C04A 4UVBA 1BHAA 2R7VA 4JJGA 4GX0A 4J32B 2H8PC 4JPRA 4MVSA 4P2ZA 1CEZA 1KD1W 1ZHWA 3JCUQ 3RVYA 2BOCC 2EIMC 2QM7A 4J30B 4LLEA 3RKOF 2DWDC 2ZR2A 4U5CE 2HKOA 3ASNB 3O6XA 1COWG 1K7DA 2EILC 2IH1C 2FFHA 2X51A 2EJRA 2Y3BA 1JPJA 4LACB 2X6BA 5CI8A 2P6VA 4O7GA 1YJNV 1M57C 5L3GA 2G62A 1S0VA 3CP1A 2OTJV 3SYPA 5L3BA 2WLIA 5D92A 2J7PD 4R6ZA 5EC2C 5B3SC 2LFRA 1K9MW 2Y69B 1MNEA 4N06A 2Q69A 4U5FE 4F4LA 4XTKA 5DQTA 1FXHA 2EIKC 3ZMUA 4I5SA 1P7BA 3CCRV 4KC9A 4OIPF 4LCUC 4U5HA 2K1EA 2LFSA 2XAQA 4MTXA 4UUJC 1PD1A 2WAMA 2ZQMA 3E89A 4LLCA 5KYXA 3QMKA 1ENVA 2IOQA 2WVOA 4OINF 5T3TA 1B6QA 3JRTA 1XL4A 3AG1C 1R3IC 3WG7C 5LGUA 4PJJA 2B5UA 1AI5A 1K92A 3AQCA 3JYHA 3MLGA 3ZC4A 3LESA 2V7QG 1I5YA 3T4RA 3P30A 1Q7YW 3ZG1A 1OCCB 1N8RW 1VQOV 1YHQV 1ZHTA 4E7SA 5LHGA 1QBZA 4C3DA 1NVPB 2IXPA 1Z6AA 3RVZA 3KMIA 3W7SA 4Q5SF 2UXNA 3ABMC 2WPDG 3DTUB 3OFNG 4LERA 4E7ZA 3S0XA 1IZMA 4QJFB 3GWOA 4ZLDA 2OTLV 4JCHA 1VQLV 3EFFK 5EC1C 5B1NA 2HLDG 3ZMVA 2Y39A 3OUSA 1KECA 2Z3YA 1AI6A 1VYKA 1S3JA 3W7UA 1TWAA 2G3KA 1DTOA 2NUPA 1QCEA 3GODA 3ZVRA 1PNMA 3RBZA 2WL8A 1FXKC 3RH3A 3K9AA 1YIJV 2NUTA 4H37A 4C3BA 3CCJV 3T6BA 1K4CC 2XXAA 2DW4A 1FTSA 3DAGA 3EJNA 2Z15A 3K1HA 3NYMA 4G7OF 2WLJA 4OD4A 2QE7G 1S77D 3LLIA 4B6IA 3AG3C 4E2LA 1TKNA 5E1AC 2NNUA 1VQKV 2Z5UA 1MMDA 3FB6C 4AX2A 2JD3A 2GHYA 3W7WA 1W2BU 1DF5A 4QIWF 1O87A 2W4MA 3POVA 3O39A 2DQ0A 2DGJA 4KUMA 3SPIA 3B8MA 2OT5A 4KFMA 2D5RB 1QR8A 4QI0A 3IEEA 4R50A 4KNVA 1JPNA 3SYCA 1E1RG 2ATKC 4BW5A 5KA6A 2R7OA 3ZJZA 4ULWA 5IYDO 2V26A 2IJKA 4YT8A 1TWCA 1RM1B 4MTGA 2PFDA 3TETA 3CC7V 2XASA 4O79A 1LS1A 3EHNA 5EGYA 2HFEC 1VQ9V 3JSZA 4I3MA 1PNLA 1QLEB 4PJMA 5C93A 2DWEC 4XDJA 3ZMTA 3UMKA 3FHDA 3S28A 3DGEA 2H94A 2E87A 2WLMA 2JJ2G 4PA7A 1J95A 1ST6A 3JCZA 4MW8A 4Q20A 3IC7A 4G2KA 1M2OA 3EZHA 2W4BA 3VYWA 4HFKB 3EZIA 1H8HG 4LBEC 5CI9A 1DLBA 3SJQC 2M7WA 2J7PA 4AK9A 4QI2A 3SYNA 3G6EV 1FFTC 2J9VA 5E33A 3LSSA 4FJCC 2LSEA 5KYYA 2IU0A 2L9JA 2PP4A 1W2WA 4PA4A 5EBLC 2VH3A 4JAUA 1S5HC 2KNHA 3B9QA 1SERA 3SEOA 4BJ5A 1R73A 2XNDG 2HV6A 3FDQA 3EHMA 4NY3A 4JASA 1KC8W 3CCSV 3KH2A 2J0WA 4R7CA 1UJWB 1FFHA 1PCXA 3QZCA 2V1DA 3ZRXA 2ZXWC 3CCVV 3CC4V 3NG1A 4BIZA 4XLNF 2R9RB 4FMTA 1XL6A 2Q9BA 4BEJA 2NUTB 5B1BB 2H7BA 4ASUG 3ECSA 3DJUB 4AE4B 5LHHA 1FMWA 3AG4B 5KA5A 3Q6NA 2IJIA 2MK3A 1K97A 4JVSA 3UNGC 1RPOA 1D0ZA 2O9XA 3NYJA 1JCHA 3AG2C 1Y4MA 1VYIA 3B8NA 3K0DA 4PDVA 4ZBMA 5CBGA 4UVAA 4YN0B 4L87A 3F46A 3VAYA 3CCMV 1VQNV 5DS4A 3AQBA 2XAFA 4CS7A 3FYEB 4MTFA 2QTOA 3D36A 2G3VA 4U7OA 2DYSC 4HAMA 1F4MA 1KU2A 2PX3A 4FK5C 2OCCC 1BR4A 2P67A 2A79B 2EIKB 2CDQA 1N1CA 3E70C 2FTKA 1FXKA 4YWQA 4M63A 1M56B 4XBFA 4PJNA 3CMAV 3E8BA 5B3SB 5HFMA 1NKDA 2XOKG 4U5EE 3LNRA 2IYLD 4X88A 1M57B 4JTAB 3EPVA 1FXKB 1ROPA 2B1GA 2EBOA 4LP8A 3W8HA 3R65A 3ABKC 3ABLB 2OG2A 5D91A 3FB7C 1WLEA 3OMAB 4OD5A 3V7OA 5EBWC 4AE4A 3MHSC 3ABKB 5LHIA 3WODF 4EWCA 4YT2A 3LNMB 3ZRSA 4HYOA 5H6QA 1K73W 1ZWIC 4F4BA 4EBBA 1NG1A 3ZIBA 5KYWA 4UXNA 3ABMB 1H8EG 1AJPA 3X1OA 2I8BA 1M56C 4CBCA 2MWQA 1K34A 2A9HA 5KUMA 4C7OB 2OCCB 5F5FA 1M90W 3JD3A 1BR2A 2QA4V 2Q3TA 4MVUA 4BJ6C 1EFRG 4RUEA 3UR3C 1OCZB 3M99B 4MVOA 4N23A 4BAYA 3W2WA 4CS9C 1VQPV 1VMAA 1GTOA 2KJGA 1YI2V 4P30A 1QLEC 1OHHG 4WFGA 3T1CA 3G4SV 3CD6V 4PELA 1ZU4A 3KL4A 3I55V 3AG2B 2WLLB 4U7NA 3NRHA 3WFVA 2A0LA 2Q9AA 4WFFA 3HPLC 3AG4C 2J45A 2EIJB 3I4UA 3D3IA 4WF9V 3CCEV 1BHBA 2HG5C 2R7UA 2LP7A 3JD0A 3SPHA 3K79A 2ZXPA 2BOBC 3SYOA 4HEAJ 1FS0G 2Q6AA 2R7RA 1QLNA 2Y3HA 3FAJA 2QEXV 1VQ6V 4P6IC 4RBNA 4MVQA 3STLC 5L3FA 1E79G 3E8GA 2HR3A 1L1FA 1PL0A 3K04A 1JPXA 3OGCC 4TWKA 4WFEA 1AR1B 2W0FC 3ZN1A 1ZYRF 1THZA 2EILB 3LDEA 4RDAA 5DVWA 3RIPA 3W2VA 4OIQF 3ETDA 3ASOC 2A6HF 2CGEA 4KI2A 1GO3F 2QM8A 1AROP 3STZC 1JVMA 2HVKC 4GEHA 3QO5A 4OXSA 1G8MA 1M9NA 1MSWD 2IW5A 1FFTB 4RQEA 1FXVA 4PDMA 3K1IC 3ITFA 4JTCB 4JGSA 3UGOA 3SZRA 3KG2A 3CSKA 1ZU5A 3SPJA 5CBHA 4YT5A 3TK1A 5DS5A 5KYYB 4KP4A 2A6EF 3ABLC 4LC1A 1NH2D 5KYUA 3CCLV 2WZFA 4MQ9F 3OR6C 5DS6A 3B77A 1W0KG 2XAGA 5BUOA 5L3CA 1Z23A 4GX1A 3W8IA 1R6NA 4ZLCA 5L3DA 1V55B 1FMVA 2X7RB 2WZGA 2AHZA 2UXXA 4G28B 3F5WC 3UKMA 4DXWA 1YTFB 5KUKA 1S76D 3QO7A 4MVRA 3K7DA 4IAOA 4RUFA 2DYSB 4JZAA 2Y3DA 5T1DB 1OCRB 2YZSA 3WG7B 4BJ6A 1JX9A 4U5GA 2X6AA 2X6CA 3K3WA 4X89A 3ML0A 1OKKA 4R8CA 5KYXB 1YJWV 4MTOA 1KP3A 3CZ6A 2IXNA 3DMDA 3OUFA 5H6RA 2J9UA 1D1AA 4JAVA 3K6BA 3ZSUA 2WVNA 5L3VA 1LNQA 2WLNA 2Y69C 2IU3A 4DO2A 4CBEA 2EZPA 1GMGA 3E35A 3SYQA 1ZHYA 4K0DA 1OCOB 3X2QC 2A1DD 3T6JA 2XSEA 2R7SA 2D3OW 3OE7G 1NQTA 1NR7A 1NR1A 2WSSG 1J8YF 1D0YA 1SZIA 2ZXWB 2Y3GA 3DJNB 1VOMA 3EGXA 2ZXRA 3NKEA 1SMYF 3Q6MA 2NLJC 1R3JC 4JYCA 1NVPD 1DF4A 1RJ9A 3F47A 4PA6A 5IY5B 1WPXA 1JJ2U 4QE7A 1P4RA 2R9IA 3NXSA 4JYBA 1IXMA 4RQFA 1Z3IX 4U5DE 3LDCA 4PFPA 2DYRB 1YJ9V 2MYSA 3I5QA 3JD2A 3LEVA 2Q68A 4Q4ZF 1JOYA 1O5HA 3DD7A 3JYCA 3ZN0A 1ZHXA 4DOZA 3LS0A 1QZXA 1GM7A 3LDDA 4U5BE 2R7QA 2BE5F 2C2AA 5LBQA 4WCEV 4WFBV 3OWTA 1KKDA 3S27A 3E2EA 1W0JG 2ZDIA 3UM7A 1NJIW 2J46A 3EQLF 1K5QA 3MD0A 2H7OA 1VQMV 1VQ4V 2KQ9A 5HSWA 1AI4A 4CZZA 5L3EA 1Z63A 5B1AC 2Y48A 3DM9B 1NU9C 1CPYA 4JF3A 3H01A 1RM1C 1K8AW 2X0LA 4JURI 3MHHC 3LLKA 4GT1A 3SYAA 2YEVB 1RPRA 1CP9A 2WLLA 1ORQC 3E86A 4QPJA 4IWBA 4O6MA 2IH3C 4N21A 1RJ9B 4TT3G 4YT4A 1NZEA 3SPGA 2B0JA 4G7ZF 4FESA 4K7BA 3Q7GA 1PKXA 2WWWA 1K4DC 3JD4A 4PA3A 1EBOA 1SRYA 1H38A 1VQ7V 2PF4E 3EH1A 3ZRWB 2IJJA 2YHSA 3K66A 3LAYA 4XLPF 3F7VC 2F43G 2V3CC 2XAJA 3LS1A 1JQ0A 4FIPC 3AEIA 2JEXA 1Z5ZA 3ABTA 3EHBB 3UMHA 5E3CA 3CCUV 1K5SA 4XDKA 4HE8D 1VQ8V 3TD7A 1E1QG 1I5XA 1TUEB 4DBRA 4CSAC 4PDRA 4GX2A 2JK5C 4PDLA 4QE9A 1KP2A 2WZLA 2JJ1G 2HJFC 3LSQA 3LUTB 4DBQA 1R6KA 3CMEV 2GSMB 3W7XA 1WGWA 1MMGA 4GX5A 4G0HA 4UV9A 4RAIA 2ZD9A 1D1BA 4MT8A 4CIHA 3LJBA 2PX0A 2JEUA 2J0XA 5H9CA 4I1MA 1QVGU 3SNHA 3PJSK 2HVJC 3QNEA 3OEOA 4FWVA 3FVYA 3OAAG 4C3EA 3HLZA 2WLKA 4IJJA 1NU7D 1R3LC 4RD9A 1NBMG 3CQZA 4G27B 4IRUA 2CW0F 2GFHA 2YSUB 2P7VA 1TWGA 2NUPB 1S72V 1MG1A 3BEHA 1V54C 2AHYA 3IGAC 5CBFA 2XL4A 2XRHA 5T3WA 2R7WA 1SESA 3AG1B 3K06A 2R7TA 1EZJA 3ZRWA 1YITV 1PD0A 4PJLA 1G4YB 1NH2B 3N2ZB 4OIRF 5LGTA 4GCZA 3CXCU 4P9OA 1MABG 1VQ5V 1OCZC 2ZR3A 2QTVA 5FCLA 3JD1A 4I44A 1AJNA 2NG1A 4XWJA 2WLHA 3NDBB 4KBLA 3E9VA 2XXAB 2PI4A 2QY9A 3NYLA 3A0RA 4DVYP 4BG0A 4WJ0A 1R3KC 2EZOA 2W6IG 2YEVA 3VBBA 1OKKD 1TR2A 2IXOA 2IXMA 3GB7C 4JJFA 4DVZA 2L81A 3ZRVA 4O6YA 2J9WA 2EINC 2DYRC 2P7TC 4P9PA 4RO2A 2CNWA 2CNWD 3FKSG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LNQ A;  2ITC C;  2WLN A;  2WLI A;  2Y69 C;  4R6Z A;  5EC2 C;  5B3S C;  4MTF A;  3SYQ A;  5IY5 C;  2QTO A;  3X2Q C;  2Q69 A;  4X8A A;  4MVM A;  5J9P C;  3T4D A;  4F4L A;  3IFX A;  2DYS C;  2EIK C;  3OR7 C;  2WLI B;  1P7B A;  2OCC C;  3E8H A;  2A79 B;  4LCU C;  2K1E A;  4UUJ C;  2NLJ C;  1R3J C;  3E89 A;  1OCO C;  5BZB A;  4PA6 A;  4H33 A;  3E8B A;  4QE7 A;  1OCC C;  1XL4 A;  3AG1 C;  1R3I C;  4MS2 A;  3WG7 C;  4EKW A;  3LDC A;  2Q67 A;  4X88 A;  4JTA B;  4LP8 A;  2QKS A;  2Q68 A;  3R65 A;  3ABK C;  4MVZ A;  3FB7 C;  3JYC A;  3RW0 A;  4PA9 A;  5EBW C;  3RVZ A;  3ABM C;  3FB5 C;  3LNM B;  4MW3 A;  3VOU A;  3ZRS A;  4HYO A;  3LDD A;  1ZWI C;  3EFF K;  1KKD A;  5EC1 C;  1V55 C;  3UM7 A;  3OUS A;  4MSW C;  1M56 C;  3T4Z A;  4CBC A;  5B1B C;  2A9H A;  5KUM A;  5B1A C;  3RBZ A;  3E8F A;  4H37 A;  4MVU A;  4RUE A;  1K4C C;  4MVO A;  3SYA A;  2WLJ A;  2WLL A;  1ORQ C;  3E86 A;  3K03 A;  4JTD B;  2IH3 C;  4P30 A;  3AG3 C;  1QLE C;  4WFG A;  3ASN C;  5E1A C;  3SPG A;  3T1C A;  3FB6 C;  1K4D C;  4PA3 A;  2WLL B;  4WFE A;  2A0L A;  4WFF A;  3HPL C;  3AG4 C;  4PDV A;  3F7V C;  3TCU A;  2KB1 A;  3SPI A;  2HG5 C;  4KFM A;  3SPH A;  4QNH B;  2BOB C;  3E83 A;  3SYO A;  2Q6A A;  4R50 A;  4XDK A;  4MVQ A;  3STL C;  3SYC A;  2ATK C;  3E8G A;  4BW5 A;  3ZJZ A;  3K04 A;  3OGC C;  4J9Z B;  4TWK A;  4PDR A;  3F7Y C;  2JK5 C;  2W0F C;  4GX2 A;  3LDE A;  4MTG A;  4PDL A;  4QE9 A;  3TET A;  1OCR C;  2HJF C;  3LUT B;  3ASO C;  2HFE C;  3K0G A;  2DWE C;  4J9Y B;  4XDJ A;  3T2M A;  4GX5 A;  2EIJ C;  2WLM A;  4RAI A;  4PA7 A;  3STZ C;  2ZD9 A;  1J95 A;  1JVM A;  2HVK C;  3SPC A;  4OXS A;  4MW8 A;  3PJS K;  2HVJ C;  4PDM A;  1BL8 A;  4JTC B;  4LBE C;  3KG2 A;  2WLK A;  3SJQ C;  3SPJ A;  5CBH A;  3FB8 C;  1FFT C;  5EBM C;  1R3L C;  4G27 B;  3ABL C;  4HZ3 A;  4I9W A;  4XDL A;  4PA4 A;  3BEH A;  1V54 C;  2AHY A;  3IGA C;  2ITD C;  3OR6 C;  4WFH A;  5EBL C;  1S5H C;  5EK0 A;  5CBF A;  3K08 A;  3K06 A;  1G4Y B;  4GX1 A;  4GX0 A;  4P9O A;  1OCZ C;  4R7C A;  4ZBM A;  2H8P C;  2AHZ A;  4MVS A;  2ZXW C;  3F5W C;  4G28 B;  4P2Z A;  3UKM A;  3RVY A;  2BOC C;  2EIM C;  2WLH A;  4MVR A;  4DXW A;  4RUF A;  2DWD C;  2R9R B;  5KUK A;  1XL6 A;  2EIL C;  2X6A A;  2IH1 C;  2X6C A;  4X89 A;  1R3K C;  2YEV A;  4R8C A;  3GB7 C;  2X6B A;  4MTO A;  3AG2 C;  2EIN C;  1M57 C;  2DYR C;  2P7T C;  3OUF A;  3K0D A;  4P9P A;  4RO2 A;  5CBG A;  3SYP A; 
#chains in the Genus database with same CATH topology
 3U3B A;  1NTM H;  5DLJ A;  2ITC C;  3MDS A;  2IM9 A;  3GOR A;  4UV8 A;  4MVM A;  3N0T A;  3T6G B;  2KSF A;  1HWY A;  5KHH A;  1RKE A;  3ZHR A;  1KNY A;  1VK5 A;  2KGO A;  2OJQ A;  3X2Q B;  1GKF A;  1VB5 A;  3K5M A;  1U0B B;  2A69 F;  3KYJ A;  2Q67 A;  3HNI A;  1GM8 A;  4DJ9 A;  3CPW U;  2P6J A;  1LVK A;  2P61 A;  3JAW A;  3THO A;  3ZMZ A;  2Q9C A;  1U89 A;  3OTF A;  3EFO A;  4XPY A;  5BR8 O;  1IW7 F;  1H9G A;  1YTF D;  5L0H A;  1SQP H;  4I0X A;  3VOU A;  1J8M F;  2JDI G;  3E22 B;  4FZ1 A;  3ZIA G;  5J2T B;  1SQF A;  3L34 A;  2Q7R A;  3U9M A;  1MQV A;  1N33 O;  3FYI B;  5E2Q A;  5B1B C;  3OT7 A;  1WA8 A;  5IJ9 B;  3OW2 U;  3E8F A;  1WOL A;  3HKE B;  4UCO A;  2BC5 A;  1YYJ A;  5F5H A;  2EPO A;  1BR1 A;  3CCQ V;  5B1O A;  3L74 H;  5FLX N;  4JW1 A;  3L71 H;  3BRJ A;  1AJQ A;  4Q6G A;  2GUZ B;  3C63 A;  2J9B A;  1GK9 A;  1N4C A;  3HKB B;  4K1O A;  3M1C B;  4BIU A;  1LKX A;  4GKJ B;  3F7Y C;  3EH2 A;  3CRA A;  1OCR C;  2PI5 A;  4ER9 A;  2YXY A;  2MW2 B;  2R05 A;  5A6K A;  2NN4 A;  2HSQ A;  3C8G D;  4H4K C;  3BA8 A;  1SF8 A;  2H7V C;  1GM9 A;  2VC9 A;  3J80 N;  5A6B A;  5CN0 A;  4IIJ B;  3C8G A;  4UDV A;  5A2Q N;  3GAN A;  4PV1 B;  3Q7L A;  5KHI A;  3OEH G;  3K33 A;  5DQZ A;  2LJ2 A;  5FL7 G;  1GS9 A;  1ZHZ A;  2BTQ B;  1CPR A;  4DR7 B;  3DXR B;  4D4N A;  1M1K W;  4XDL A;  4Z2W A;  3N2K B;  2ITD C;  4UB6 Z;  5EK0 A;  3WB1 A;  3SP1 A;  4LDK A;  2VB6 A;  4GX0 A;  1QQ3 A;  3DE8 A;  2JS3 A;  4LLE A;  4UB8 Z;  4U5C E;  2HKO A;  5BQG A;  1QVX A;  3O6X A;  4NKG B;  2X0C A;  1COW G;  2FKX A;  2FFH A;  3RGB A;  1JPJ A;  1APC A;  3TJ6 A;  5B5E Z;  1ZL8 A;  4O7G A;  1YJN V;  2G62 A;  5GPG B;  3CP1 A;  1IX9 A;  1M6T A;  2J7P D;  4R6Z A;  3VQX A;  1MNE A;  2ZCE A;  2YC0 A;  4F4L A;  2OIE A;  1XZQ A;  4KC9 A;  4OIP F;  4DYL A;  1PD1 A;  1TFO B;  5KYX A;  4LF5 O;  2ZQM A;  2IOQ A;  3FXH A;  5T3T A;  1B6Q A;  3AG1 C;  5BXZ A;  5LGU A;  4CH5 A;  4PJJ A;  2B5U A;  3SJC C;  1I5N A;  3JRM O;  3T4R A;  3VRC A;  2XM4 A;  3P30 A;  1H2S B;  4ZI7 B;  1CPQ A;  4DR6 B;  1NVP B;  2GAQ A;  5L0J A;  3RVZ A;  1WN7 A;  3DTU B;  3S0X A;  2RMK B;  2R03 A;  1IZM A;  3AGT A;  4QJF B;  3GWO A;  4DUZ B;  1OXB A;  2OTL V;  4JCH A;  5L0G A;  5EC1 C;  2YLI A;  1Q0D A;  2ASR A;  2Z3Y A;  1AI6 A;  1Z7Q c;  1DTO A;  3ZVR A;  3S9O A;  3RH3 A;  3K9A A;  1YIJ V;  2Q8V A;  4B3T O;  3T6B A;  1K4C C;  1XDC A;  2DW4 A;  4X1I A;  2Z15 A;  3L8I A;  4G7O F;  1OJH A;  1TGO A;  3LLI A;  2M6Y A;  1AEP A;  4YWQ A;  1D5A A;  1JMW A;  2GHY A;  2GV9 A;  3W7W A;  1O87 A;  5JJE B;  2OT5 A;  4KFM A;  3IAY A;  1L3P A;  3CRC A;  4R50 A;  3M15 A;  5KA6 A;  4BWA A;  2ATK C;  1X4T A;  2V26 A;  4ZOL A;  2CCY A;  1LS1 A;  3EHN A;  4FM0 A;  5EGY A;  1VQ9 V;  3M4C A;  4XDJ A;  5GTI Z;  3FHD A;  2E87 A;  3JSN A;  1J95 A;  1ST6 A;  3JCZ A;  4DRX B;  4MW8 A;  4G2K A;  1BS3 A;  3B0V C;  3EZI A;  1H8H G;  1DLB A;  2M7W A;  3JAT A;  3ZHU A;  3AOU A;  3SYN A;  4OX9 O;  2AZ0 A;  2YID A;  4FJC C;  5ITZ A;  5KYY A;  2PP4 A;  1W2W A;  2AWY A;  4JAU A;  2YKZ A;  5EZY A;  4I50 A;  1KC8 W;  3KH2 A;  5HV9 A;  3KZI Z;  1UJW B;  1PCX A;  3QZC A;  2ZXW C;  2R02 A;  1O9H A;  4JC7 A;  1HW2 A;  1XL6 A;  5B1B B;  2L6F A;  4BPM A;  4ASU G;  2QWP B;  3DJU B;  2ADP A;  2DOS A;  3AG4 B;  4JVS A;  3UNG C;  1K97 A;  2O9X A;  1BGY H;  1JCH A;  1XMQ B;  4R32 A;  3US6 A;  1LIH A;  4K8X A;  2Q9L A;  3K0D A;  4PDV A;  5CBG A;  1RKE B;  2P1A A;  4L87 A;  1XMO O;  1VQN V;  5JCO C;  5BMV B;  2QTO A;  2VQE O;  3D36 A;  1QU7 A;  2OQM A;  5JVD A;  4HAM A;  2PX3 A;  1F4M A;  3RF3 A;  2OCC C;  1BR4 A;  1G6U A;  2EIK B;  1Q0K A;  1QSP A;  3JAW B;  2AZ2 A;  4XBF A;  4PJN A;  3CMA V;  4LF9 O;  3B09 A;  5KHK A;  1NKD A;  1MMM A;  4ZI7 A;  4U5E E;  3G6B A;  4O2B A;  3T9O A;  3HKD B;  1ROP A;  3CE2 A;  2EBO A;  1L0L H;  1HNZ B;  3KKY A;  2ZE5 A;  3ABL B;  2HJ3 A;  2OG2 A;  3FOO A;  1B04 A;  1WLE A;  2QE9 A;  2XUM A;  1GQA A;  4YT2 A;  2VCC A;  4YJ2 A;  3ZRS A;  1K73 W;  2PGG A;  5KYW A;  1AJP A;  3WU2 Z;  3X1O A;  1PV0 A;  1XRE A;  2MWQ A;  5KUM A;  1EN5 A;  2OCC B;  5LXT A;  1Y6X A;  5JH7 A;  1SQB H;  3JD3 A;  3M99 B;  3T1C A;  2KKW A;  2Y4T A;  5B3I A;  3AG2 B;  2WLL B;  1VTM P;  1L7C A;  2MHR A;  4WFF A;  3HPL C;  4EIY A;  3CCE V;  3SPH A;  2Q6A A;  5CA0 B;  5LMN B;  1QLN A;  3QF7 A;  1BDJ B;  4P6I C;  3STL C;  1E79 G;  1AR1 B;  3K04 A;  4WFE A;  1HNZ O;  4LFC B;  2W0F C;  2EIL B;  3RYH A;  3EXA A;  3QTH A;  2Q7E A;  4B3S O;  2F93 B;  3STZ C;  1CGN A;  3O65 A;  1FFT B;  4ICG A;  3ITF A;  2A0U A;  3SZR A;  3KG2 A;  1JR8 A;  2RDC A;  3SPJ A;  5CBH A;  4YT5 A;  5DS5 A;  4KP4 A;  3UT5 B;  2XL8 A;  2A6E F;  3ABL C;  1NH2 D;  3CEI A;  2F95 B;  3RT3 C;  2E3C A;  3CCL V;  4AHC A;  4MQ9 F;  5IE9 A;  4GYC B;  3ZBH A;  4J7T A;  4U3J B;  3SR2 C;  4NTX A;  1S76 D;  4DXW A;  3QO7 A;  5LOV B;  4RUF A;  2DYS B;  5CA1 B;  4U5G A;  4A4A A;  2OOC A;  1AB3 A;  4R8C A;  2AW9 A;  4MTO A;  1H7I A;  1WB8 A;  5LP6 A;  3ZSU A;  2WVN A;  3JSL A;  1SQG A;  4X62 B;  1GMG A;  4I4T A;  5IT9 N;  1ZHY A;  2A1D D;  2XSE A;  2ZNI A;  2D3O W;  3OE7 G;  2R7S A;  1NQT A;  1J8Y F;  3IHU A;  1XQ8 A;  3EGX A;  3NKE A;  4NC3 A;  1NS1 A;  3A2F A;  3C90 A;  1SMY F;  1R3J C;  1NVP D;  1DF4 A;  1KKC A;  3F47 A;  4PA6 A;  1LUW A;  1SQQ H;  2VQF O;  3FX7 A;  4U5D E;  3A0H Z;  2UU9 B;  2DYR B;  1P7G A;  1QQC A;  3OD4 A;  4O2A B;  3RYC B;  1A7E A;  4X64 O;  5FPO A;  1JOY A;  4PD4 F;  2BL2 A;  1GM7 A;  1H2L A;  3CRQ A;  3D36 C;  5LBQ A;  2BE5 F;  1HMO A;  1KKD A;  2HSB A;  3UT5 A;  5JRA A;  1K5Q A;  1GN2 A;  1WAT A;  5B1A C;  1OV9 A;  4YIP A;  4O4J A;  2XLV A;  2ODM A;  5KHG A;  5JJN B;  4LFA O;  4YHH B;  4JUR I;  3SYA A;  4E0H A;  2WLL A;  1ORQ C;  4YT4 A;  4IWB A;  5GON A;  2B0J A;  2NR5 A;  5LOV A;  3S90 A;  1PKX A;  2GWW A;  4PA3 A;  4HNA B;  4CJO A;  1EBO A;  1XNR B;  3EH1 A;  3V5Y A;  3ZRW B;  1N32 B;  3F5T A;  2F43 G;  5CB4 A;  1LM3 B;  1RMV A;  4FIP C;  4JAA A;  1Z5Z A;  3ABT A;  3EHB B;  3CCU V;  1K5S A;  4HE8 D;  2F23 A;  2N04 A;  1TUE B;  4CSA C;  4J7Y A;  3B40 A;  4PDR A;  3TXQ A;  1WAS A;  3M8A A;  4DBQ A;  3LUT B;  5JSL A;  1Q6H A;  4G0H A;  1Q90 D;  2HHH O;  4LDQ A;  4NTW A;  3LJB A;  2J0X A;  2IBF A;  1BSM A;  5H9C A;  4LF8 B;  2LGQ A;  3PJS K;  1XMQ O;  2HVJ C;  3JAS B;  3SNH A;  4FWV A;  4B7E A;  3HLZ A;  2WLK A;  2RCV A;  4FM2 A;  1NU7 D;  3DKA A;  1R3L C;  4RD9 A;  1NBM G;  3R2P A;  4LFB O;  2O57 A;  3CQZ A;  1KMI Z;  2GFH A;  5K0I A;  2XL6 A;  1T6Q A;  3BEH A;  2I15 A;  3ZHS A;  2XL4 A;  3K06 A;  2XM0 A;  4PJL A;  4ULV A;  4OIR F;  1MAB G;  5FCL A;  1HNW O;  1AJN A;  2NG1 A;  2ZM6 B;  2JRI A;  5LA6 B;  2AGA A;  3A0R A;  4DVY P;  1FJG O;  2YQY A;  2CGO A;  5A6B D;  2IXO A;  4DVZ A;  4F6E A;  4FLW A;  2J9W A;  2CNW D;  4JI0 B;  4NXM B;  2Q73 A;  5IY5 C;  1WP7 A;  1OR2 A;  3P32 A;  2Q4F A;  3EGX B;  4NQF A;  5J9P C;  4X8A A;  1F7Y A;  3H2U A;  1Y66 A;  3T4D A;  5COF A;  5L0I A;  1Z5W A;  4DV1 O;  4W8K A;  3JAR B;  2EIM B;  2HFI A;  2NSF A;  3E8H A;  1K3E A;  1YA7 O;  2ZIN A;  4DV0 B;  4BJ1 A;  3G71 V;  5BZB A;  5AG2 A;  4X9Q A;  4LF4 O;  2A68 F;  2HJD A;  2ZDI C;  4MS2 A;  4WGY A;  2WB7 A;  1TUB B;  5L3Q A;  5AC5 A;  3SJB C;  3LNN A;  4Q7C A;  4MVZ A;  1AI7 A;  4AQY B;  4PK4 A;  4YL0 A;  3OMN B;  1S5L Z;  1SET A;  4J80 A;  4PA9 A;  1N32 O;  1Q81 W;  1SR2 A;  1IBL B;  1BE3 H;  2HV7 A;  1KU9 A;  2HMQ A;  2AXT Z;  2FL4 A;  2LQT A;  1ORJ A;  2F4V O;  5KYU B;  3U8V A;  2P22 C;  4H44 B;  2YVK A;  2DQ3 A;  5IWA B;  3PHF 2;  1B06 A;  1YAR O;  4FFB B;  4ZHQ A;  1SQX H;  1S7Z A;  3K03 A;  2WA4 A;  1XIL A;  4JTD B;  4NXM O;  3ASN C;  4JI4 O;  2CDY A;  3A9C A;  2GDC A;  3T1Y O;  4ZKI A;  2CE4 A;  3OTO O;  5IYB O;  3B4S A;  3L0I A;  1NFN A;  3TCU A;  4YJW A;  4H13 B;  3W4Y A;  4CJG A;  4JKV A;  4KNW A;  3ZDL A;  3E83 A;  1A7D A;  3TK0 A;  3W7T A;  3IPM O;  2GUZ A;  1V9P A;  4J9Z B;  4FPP A;  3HB3 B;  1SZT A;  1XHZ A;  2VAS A;  4O6N A;  1LI5 A;  3QO8 A;  2DMX A;  4J9Y B;  4A5U B;  4TUY A;  4DW0 A;  2EIJ C;  2JIZ G;  4LDR A;  3JAK B;  1SA0 B;  3CAX A;  4K0K O;  1YSC A;  3PN1 A;  4CS8 A;  4TSF G;  2QKA A;  3BVO A;  4IYI A;  3JZ0 A;  4DV4 O;  3HKE A;  4PFO A;  2EX3 A;  4JI0 O;  5KX5 A;  1GGQ A;  4OIO F;  4BJT A;  4C7O A;  4I9W A;  3G4Z A;  3OA1 A;  2R7X A;  4OPA A;  4JCZ A;  3BY6 A;  4CSA A;  1MMN A;  2QR4 A;  1PPJ H;  2C04 A;  2R7V A;  4XEF A;  1KYO F;  4J32 B;  4MVS A;  4ANJ A;  3RKO F;  3RVY A;  1GAX A;  1X59 A;  2DWD C;  2ZR2 A;  2VQE B;  1Q43 A;  4FFB A;  4UCS A;  1I7F A;  3FAV A;  2EJR A;  2JGU A;  5IJ9 A;  4ZHQ B;  1R5I D;  4B08 A;  1R6T A;  5CI8 A;  4JIO A;  2ZE7 A;  5L3G A;  2HKV A;  1FAF A;  2QNL A;  2FAP B;  4JI7 B;  2OTJ V;  3DSQ A;  5L3B A;  3JAR A;  5D92 A;  4JI1 B;  1K9M W;  1E2X A;  1Q0G A;  4N06 A;  2Y69 B;  2UXD B;  4CS3 A;  5DQT A;  1FXH A;  1E83 A;  2YIC A;  4LCU C;  4U5H A;  2K1E A;  2LFS A;  2XAQ A;  4MTX A;  3E89 A;  1ZW3 A;  4OIN F;  2EPN A;  2V7Q G;  2UXB O;  1BT8 A;  2HS5 A;  1Q7Y W;  3ZG1 A;  3OTO B;  1N8R W;  1H9T A;  4E7S A;  4GKK B;  1Q0M A;  1B3Q A;  2CUG A;  2WPD G;  3OFN G;  4LER A;  1A41 A;  1US6 A;  5B1N A;  1UG7 A;  3ZMV A;  1DOW A;  3OUS A;  2YL7 A;  4PHZ A;  1T5E A;  2NUP A;  1LR1 A;  3RBZ A;  1M5I A;  1IXB A;  1Q0F A;  4C3B A;  3CCJ V;  1FTS A;  3C8Z A;  3K1H A;  4OD4 A;  3WB0 A;  3AG3 C;  4EWC A;  5E1A C;  1VQK V;  2Z5U A;  2JD3 A;  5JQG B;  5IJ0 B;  2W4M A;  1LI7 A;  1RP3 B;  2DGJ A;  4KUM A;  1ZTE A;  1JR9 A;  2CTQ A;  2BTO A;  2DB4 A;  4QI0 A;  3IEE A;  1JPN A;  4BW5 A;  2R7U A;  1TWC A;  1RM1 B;  2BSK A;  2KYH A;  3CC7 V;  5EIB D;  1Q8I A;  1SA0 A;  2XAS A;  2HFE C;  4I3M A;  3UMK A;  1HNX B;  5C93 A;  2DWE C;  3ZMT A;  1VEW A;  3DGE A;  4Q20 A;  4TQF A;  1A32 A;  3EZH A;  5AC4 A;  2RQ6 A;  2W4B A;  2OYQ A;  5CI9 A;  2ZIO A;  4JZG A;  4LBE C;  4TV9 B;  3SJQ C;  5E33 A;  5FNV A;  2LSE A;  1FFX B;  4DR4 O;  2L9J A;  4L6R A;  4EFE A;  3E22 A;  5J2T A;  3EHM A;  3CCS V;  1FFH A;  2V1D A;  3CCV V;  3NG1 A;  3TQO A;  3RYI B;  4BIZ A;  3TOM A;  2R9R B;  4CH6 A;  2Q9B A;  1YVW A;  1AP6 A;  4O4L A;  4O4I B;  2FYU H;  2IJI A;  2UUC O;  4K0K B;  1G1X B;  3AGU A;  1Z2G A;  1MNG A;  1VYI A;  2YIB A;  2RN9 A;  3B8N A;  4K3A A;  4WBN A;  2LP4 A;  4YN0 B;  1C02 A;  3CCM V;  4DK1 A;  3QVZ A;  2XAF A;  4MTF A;  1HNX O;  3CS5 A;  1Y4C A;  4EUK B;  4Z9I A;  2G3V A;  4L8J A;  4U7O A;  1ZZP A;  3E70 C;  1EN6 A;  3NMI A;  4M63 A;  1M56 B;  1YZC A;  5HFM A;  2PZS A;  1N33 B;  2IYL D;  1JAF A;  1NLX A;  3D8C A;  4X88 A;  2B1G A;  4LP8 A;  3J06 A;  2GA0 A;  3R65 A;  5FZT A;  3ABK C;  5D91 A;  1QHT A;  5JLI A;  5H5N A;  5EBW C;  4AE4 A;  2LW1 A;  1JA8 A;  5H6Q A;  4EBB A;  2OJE D;  2BTQ A;  1H8E G;  3AK2 A;  1M56 C;  2A9H A;  4JI4 B;  5ITZ B;  5KMG A;  1JOG A;  4RWU A;  2ZIM A;  3RYF B;  1NFO A;  2Q3T A;  1EFR G;  3UR3 C;  1OCZ B;  2E76 B;  4LWS A;  5IJ0 A;  2AWC A;  1KB9 F;  1Q3E A;  2KJG A;  1QLE C;  1V74 B;  3G4S V;  1H2K A;  3RYI A;  3DE9 A;  3KL4 A;  3GEI A;  1YJG A;  3WFV A;  2A0L A;  2Q9A A;  1C03 A;  4X20 A;  3RN4 A;  5TIS Z;  3I4U A;  1BCC H;  1ORY A;  4BEM J;  3K79 A;  3SYO A;  2VQF B;  2R7R A;  2Y3H A;  3FAJ A;  2ZT9 B;  1VQ6 V;  4RBN A;  4MVQ A;  2HR3 A;  1L1F A;  3MFN A;  1THZ A;  5DVW A;  3W2V A;  4RDA A;  4OIQ F;  3O55 A;  4YK5 A;  2A6H F;  3QVN A;  1GO3 F;  3N2G A;  1EN4 A;  2UUC B;  2UUB O;  1CGO A;  4WGZ A;  1FXV A;  1MZF A;  2XLE A;  3K1I C;  4JTC B;  3NMK A;  3VM6 A;  3NMJ A;  1Q5O A;  1Q6U A;  4P9F A;  1YXB A;  3HNK A;  3UO3 A;  2JVD A;  4LC1 A;  3U5S A;  2WZF A;  3J81 N;  3H1H H;  3OR6 C;  5DS6 A;  3B77 A;  3L70 H;  1W0K G;  1FJG B;  1EI7 A;  5L3C A;  2YL3 A;  4B3R B;  1MSD A;  4LF7 B;  2X7R B;  5FPR A;  1JMK C;  3U0Z A;  1YTF B;  2K9P A;  3IQ5 A;  4MVR A;  4IAO A;  4ZIB A;  2X6C A;  4X89 A;  2YWA A;  4LFC O;  5KYX B;  1YJW V;  1HDJ A;  3CZ6 A;  1VLS A;  3DMD A;  4KHP B;  5D5Q A;  3K6B A;  4JI2 B;  2IU3 A;  1YZB A;  1R4T A;  2EZP A;  5C8Y B;  1OCO B;  4FLU A;  1D0Y A;  1SZI A;  1TFK B;  5B66 Z;  1HNW B;  1VOM A;  2QLA A;  2ZXR A;  3Q6M A;  4JV5 B;  4JYC A;  5IY5 B;  1JJ2 U;  4JEA A;  4QE7 A;  4DR2 B;  1P4R A;  1IBK O;  1Z3I X;  1BQZ A;  4PFP A;  4DR4 B;  3JD2 A;  4DR1 B;  4Q4Z F;  2LO1 A;  2Q7G A;  3JYC A;  1ZHX A;  3K1I A;  1XZP A;  2E74 B;  1UFB A;  4I9Q A;  1ZSP A;  4U5B E;  4I0X B;  3C3S A;  2JS5 A;  3DXR A;  3E2E A;  2LFD A;  3EQL F;  2H7O A;  3MD0 A;  1VQ4 V;  3DWW A;  1AI4 A;  4CZZ A;  3VF0 A;  3DM9 B;  4YJ3 B;  1IUR A;  1DGS A;  4W4K A;  1RM1 C;  3L9D A;  3MHH C;  3LLK A;  4LF6 O;  1CP9 A;  1WNS A;  4O6M A;  5BQI A;  4X62 O;  1RJ9 B;  3BA9 A;  4JI2 O;  4G7Z F;  2CTW A;  3B2E E;  3Q7G A;  4K7B A;  1CGM E;  4F6R B;  1SRY A;  1HY5 A;  3C18 A;  3GEE A;  1VAR A;  2IJJ A;  4XLP F;  2YDE A;  1XNR O;  1H2M A;  3F7V C;  1RXQ A;  3JAL B;  2XAJ A;  4NYK A;  3RQE A;  5IYZ B;  3AEI A;  2JEX A;  4Z1V A;  4XDK A;  2NSG A;  3P3N A;  1VQ8 V;  4DR1 O;  4B3R O;  2QJ1 A;  2AVK A;  4GX2 A;  2JK5 C;  4PDL A;  1KP2 A;  1S05 A;  4X1K A;  2QUP A;  2HJF C;  3LSQ A;  2KK1 A;  4TV9 A;  2L35 A;  2GSM B;  4I55 A;  3I5D A;  1MMG A;  1PL4 A;  4RAI A;  4DR3 O;  2PX0 A;  1ZAU A;  5A6A A;  2V4D A;  4FLT A;  4O4J B;  5CIV A;  4Z9J A;  1PP9 H;  1OW6 A;  2QWO B;  4IJJ A;  1O9G A;  3KYI A;  4BW9 A;  1L0N H;  1TWG A;  4DV1 B;  1S72 V;  1T6I A;  3IGA C;  1ZVZ A;  1H2N A;  1VP7 A;  3U3F A;  1SES A;  2CTR A;  3AG1 B;  2R7T A;  1EZJ A;  3ZRW A;  1DOV A;  3O9O A;  1G4Y B;  1NH2 B;  2QTV A;  4GCZ A;  3CXC U;  4P9O A;  1Y76 A;  1OCZ C;  3JAM N;  5A9G A;  4XWJ A;  2WLH A;  5KLV H;  4LR3 A;  4X1I B;  2PI4 A;  2QY9 A;  5JH7 B;  3NYL A;  1YZA A;  1R3K C;  2W6I G;  1YA9 A;  2VCA A;  3JTL O;  2ZE6 A;  4DUY O;  4JYY A;  2L81 A;  3HNL A;  3D3Q A;  2EIN C;  2DYR C;  4RO2 A;  4P9P A;  2JGD A;  2CNW A;  4NB5 A;  4UCR A;  2QTS A;  4Z1M G;  2HHH B;  1U96 A;  3FMS A;  3Q4H B;  2FML A;  1BMF G;  2GBO A;  3IFX A;  3B0P A;  2EIN B;  3U11 A;  4J10 A;  1PNK A;  2VCB A;  3MX3 A;  1Q86 W;  4I1O B;  1WB7 A;  4G7H F;  2ZPA A;  4XEV A;  5KYN A;  1OCC C;  2B9Z A;  2IJH A;  1H2G A;  2P4K A;  3CC2 V;  3B0U X;  1N34 B;  5E3A A;  5BQH A;  1W59 A;  1ZUQ A;  5HFL A;  4AQY O;  3PDM P;  1G5Z A;  3CJH B;  5IDJ A;  4JI5 O;  3EG9 A;  2ETS A;  2XS8 A;  1M2V B;  3I56 V;  4YHH O;  3ATP A;  1V55 C;  4FX5 A;  4X0R A;  3WAQ A;  1K33 A;  3T4Z A;  3V5Z A;  2ILM A;  1D1C A;  5LMU B;  4NTA A;  5CMU A;  2PYJ A;  3JCU Z;  2BCC H;  3OM3 B;  2YXH A;  4FLZ A;  1KQS U;  2UUH A;  2W9Y A;  3SXY A;  5KHJ A;  5LMN O;  4F6R A;  5L0F A;  1MMA A;  3AG3 B;  2WA3 A;  2VRZ A;  3EGD A;  4EEQ A;  3U2L A;  1GN6 A;  1TVK B;  2E75 B;  5LGN A;  5JT4 A;  2XAH A;  4DW1 A;  1Q82 W;  2FGY A;  3ASO B;  2CH7 B;  3T1H O;  2H8A A;  5GW7 A;  3ZMS A;  3I5P A;  3WHN A;  3N24 A;  4CS8 C;  3U0C A;  1Y74 A;  1SQV H;  1CXZ B;  3OMI B;  4QPK A;  4CIP A;  3T2M A;  3RFY A;  1QVF U;  4GYT A;  2AP3 A;  3ZCC A;  1XBL A;  1HW7 A;  2AU5 A;  2XHB A;  4DRJ B;  1F51 A;  2W6J G;  5DN6 G;  1OZ0 A;  5IYC O;  2KW3 C;  4FM1 A;  5EBM C;  3OEE G;  4LH7 A;  4CH4 A;  1YVI A;  1M4U A;  5COG A;  4QDL A;  1G4W R;  3EG9 B;  2M4E A;  1M2V A;  1BHA A;  5JQG A;  5LP6 B;  2E5L O;  3U8P A;  3CB2 A;  4JPR A;  4P2Z A;  4GZR B;  1KD1 W;  1ZHW A;  3DI5 A;  2EIM C;  2QM7 A;  4J30 B;  2HJM A;  2IBZ H;  4JI8 B;  2EIL C;  1SZX A;  2IH1 C;  3MYF A;  3H1L H;  4IYH A;  2Y4U A;  1M57 C;  3SJA C;  3M4B A;  1AR5 A;  3ZHV A;  5EC2 C;  2Q69 A;  4U5F E;  4XTK A;  5BMV A;  2EIK C;  2Q4P A;  1URF A;  3GWN A;  4LLC A;  1XNQ B;  2ZNJ A;  2GTA A;  1LE2 A;  1YDI A;  3JRT A;  1XL4 A;  2W0X A;  5DED A;  1K92 A;  3MLG A;  3LES A;  3QW0 A;  1I5Y A;  2HUJ A;  3TUL A;  2G38 A;  1VQO V;  1YHQ V;  1E85 A;  4DR6 O;  1Z6A A;  3W7S A;  4Q5S F;  3ABM C;  4JEB A;  4E7Z A;  3B29 A;  1Y67 A;  4GQH A;  4YJ2 B;  3EFF K;  3HKK A;  3ZWI A;  2FB5 A;  2Y39 A;  1VYK A;  1S3J A;  2G3K A;  1QCE A;  3GOD A;  4O4L B;  1PNM A;  2F4V B;  5DEC A;  1FXK C;  4JI3 B;  5CB4 B;  3H1I H;  5IWA O;  2XXA A;  3EJN A;  2LIG A;  2RD9 A;  3NYM A;  5JCO A;  2QE7 G;  3GEH A;  4JI1 O;  4E2L A;  1TKN A;  3K5O A;  2NNU A;  5LL6 Y;  4AX2 A;  1AIL A;  3M79 A;  3K57 A;  2ETN A;  4DV6 B;  1W2B U;  4QIW F;  2XLO A;  4CDA A;  3O39 A;  2DQ0 A;  1VF6 C;  3HKB A;  2YLG A;  1TQG A;  2D5R B;  1QR8 A;  4EBK A;  4WAB A;  4JI6 O;  4DV2 O;  3TJT A;  3TXS A;  1E1R G;  5CA0 A;  4ULW A;  2IM8 A;  4MTG A;  2PFD A;  4O79 A;  1QLE B;  4PJM A;  4AE4 B;  4PAC A;  3S28 A;  3RYH B;  2WLM A;  1NT2 B;  2JJ2 G;  3RFR A;  3IC7 A;  2YI8 A;  3APO A;  3VYW A;  3J7A U;  1IBM B;  2J7P A;  4QI2 A;  4AK9 A;  3G6E V;  5LYJ B;  1FKA O;  1FFT C;  3RQG A;  3LSS A;  2LQG A;  4N4W A;  1I4Z A;  3H1J H;  1WTY A;  4D7S A;  2VH3 A;  1FPO A;  3B9Q A;  1S5H C;  3S84 A;  4BJ5 A;  1R73 A;  1TA8 A;  2HP8 A;  3H1K H;  3FDQ A;  2QKC A;  3GM1 A;  4NY3 A;  4JAS A;  3SXM A;  4R7C A;  3ZRX A;  3CC4 V;  4DRI B;  4XLN F;  4BEJ A;  2P0N A;  2PNO A;  2F1M A;  5LHH A;  3SXZ A;  1FMW A;  5KA5 A;  3Q6N A;  2MK3 A;  4D6T H;  1D0Z A;  3AG2 C;  2EPK X;  3T1Y B;  4UVA A;  3VAY A;  1N0J A;  3K5N A;  4PI2 A;  5JVD B;  1WJZ A;  4CDV A;  4D4X A;  2DYS C;  4I4T B;  4AL0 A;  3ZHT A;  1IZ3 A;  1N1C A;  4DRH B;  2FTK A;  1FXK A;  5B3S B;  1EZV H;  3DC6 A;  4O2B B;  2XLD A;  3LNR A;  4LF8 O;  4JI5 B;  3SGI A;  3W8H A;  2QWN B;  4DV6 O;  3K59 A;  3OMA B;  3KCY A;  4TUY B;  1QKR A;  2XTA A;  5E79 Z;  3ABK B;  1GM5 A;  2VWK A;  3MBG A;  4HYO A;  1P49 A;  2ZKO A;  2YLD A;  1EKY A;  3ZIB A;  3ABM B;  4DV2 B;  2RJZ A;  2I8B A;  1I0H A;  4CBC A;  4IAR A;  1K34 A;  2HZ8 A;  4J7J A;  4E0I A;  4C7O B;  4CS4 A;  4JRZ A;  5FNV B;  4B3T B;  1BR2 A;  2QA4 V;  4H54 A;  4BJ6 C;  4IHJ A;  3W2W A;  3KPH A;  4BAY A;  4N23 A;  4DV5 B;  1LS4 A;  4DV3 B;  4CS9 C;  1VQP V;  1GTO A;  1YI2 V;  3CD6 V;  2PTM A;  4TQD A;  3TGU H;  3AG4 C;  2EIJ B;  1Y74 B;  4EBJ A;  1BHB A;  4WF9 V;  2HG5 C;  4HEA J;  2ZXP A;  2D2C B;  4JI7 O;  4DR2 O;  4B7K A;  3ZED A;  2HMZ A;  5L3F A;  3E8G A;  2L7A A;  3OGC C;  1ZYR F;  5KYW B;  3ZN1 A;  2XT9 A;  5CA1 A;  4LF5 B;  2XS1 A;  4KI2 A;  4CC6 A;  2ADQ B;  2QM8 A;  1VIB A;  1ARO P;  1OQC A;  1RSO B;  2VS0 A;  5EIB C;  2HVK C;  2ZE8 A;  3UO2 A;  1G8M A;  1MSW D;  3U2M A;  2IW5 A;  2HEP A;  3L72 H;  3FFQ A;  4U3F H;  3N2G B;  4RQE A;  1WN0 A;  4JGS A;  2OEV A;  3UGO A;  1ZU5 A;  4TV8 A;  2ZM6 O;  3TK1 A;  1JRA A;  4BIO A;  2LK4 A;  3ZQV A;  5KYY B;  3CSX A;  2QGN A;  3RWR D;  3K58 A;  1PM9 A;  3R7C A;  4JI8 O;  4X66 B;  4X1Y A;  4XPW A;  5H2F Z;  2UUI A;  1GN3 A;  2EPM X;  4ZLC A;  2LW7 A;  5L3D A;  2A7W A;  1DK1 A;  2AHZ A;  4G28 B;  1LE4 A;  4JZA A;  5KUK A;  1HW1 A;  3PCV A;  4BJ6 A;  1RFY A;  2OU6 A;  1AR4 A;  2CYD A;  2Y3D A;  1JX9 A;  4AI8 A;  4IHJ B;  5KMG B;  3ML0 A;  1OKK A;  2B0H A;  3UQ8 A;  4LWS B;  1BQ0 A;  1KP3 A;  1HR0 B;  2IXN A;  3OUF A;  3HKC A;  1A0B A;  1D1A A;  4JAV A;  1MZE A;  1LNQ A;  2WLN A;  4DO2 A;  5L3V A;  4FFK A;  4CDY A;  4CBE A;  3E35 A;  2DN9 A;  3T6J A;  3WB2 A;  3X2Q C;  4X66 O;  1WWP A;  1NR7 A;  1H6G A;  4O4H B;  2WSS G;  4EB6 B;  1K40 A;  4JI3 O;  2ZXW B;  4YIO A;  2PYL A;  1WPB A;  3DJN B;  1VF7 A;  1LPE A;  1WPX A;  2XLW A;  1JFF A;  2R9I A;  1UFI A;  4RQF A;  3O10 A;  3LDC A;  1YJ9 V;  3I5Q A;  4NTB A;  3LEV A;  2YL0 A;  5LMU O;  1O5H A;  1RSO A;  4DOZ A;  3LS0 A;  4LF6 B;  2PY5 A;  3QTC A;  3LDD A;  2C2A A;  4WFB V;  1D5N A;  1YCI A;  3UM7 A;  5HSW A;  1Q6I A;  1YF2 A;  4PR9 A;  2OEX A;  1CPY A;  3HKD A;  4JF3 A;  3H01 A;  2X0L A;  1N34 O;  3TOL A;  3JAS A;  4NXN O;  4QPJ A;  3VQV A;  2IH3 C;  4N21 A;  4TT3 G;  1NZE A;  4EHP A;  5J2U A;  2WWW A;  1K4D C;  1AVM A;  1H38 A;  1VQ7 V;  3K66 A;  2KC3 A;  3G4X A;  4KL1 A;  2R9A A;  4X65 O;  1JQ0 A;  1XMO B;  3ZQY A;  1F1M A;  3C62 A;  5E3C A;  3UMH A;  1HMD A;  3JYY A;  2YIA A;  4DV0 O;  3TD7 A;  1I5X A;  5JJJ B;  4DBR A;  2Q00 A;  2WZL A;  4DV7 O;  4XQ1 A;  2QM4 A;  4B3M B;  3CME V;  3W7X A;  5F2V O;  2Q0A A;  4GX5 A;  4IB4 A;  4UV9 A;  1D1B A;  2LD6 A;  2JEU A;  4GLX A;  4I1M A;  1QVG U;  1Y6D A;  3AK3 A;  3QNE A;  3OEO A;  5L0C A;  1EQ1 A;  3GVM A;  3S3X A;  4G27 B;  2PBE A;  1WA8 B;  2CW0 F;  5KX5 B;  2YSU B;  2P7V A;  2KQX A;  1V54 C;  2XRH A;  3IQ6 A;  2R7W A;  3UCS C;  4FVM A;  1PD0 A;  4J42 A;  1BBH A;  3N2Z B;  1VQ5 V;  2ZR3 A;  4P9T A;  3JD1 A;  3A0B Z;  4I44 A;  2A0B A;  1FAP B;  4KBL A;  4QGP A;  4YJ3 A;  3RYF A;  4WJ0 A;  4CS7 A;  3KCX A;  3VBB A;  1OKK D;  1IBM O;  1TR2 A;  2IXM A;  1UPG A;  3GB7 C;  1U6H A;  4YY3 O;  5D5P A;  4K8Z A;  5EHH A;  3FKS G;  3IJ4 A;  5JUA A;  2W45 A;  4J7Z A;  2KG7 A;  4O4H A;  4U3J A;  3GWL A;  3HNJ A;  3R66 A;  4BR6 A;  4X20 B;  3PMR A;  3A8T A;  2F66 C;  3OR7 C;  2WLI B;  1NBB A;  3MYI A;  4YXW G;  1K05 A;  5COM A;  2B1I A;  2P90 A;  3G80 A;  4LNU B;  3DM5 A;  1OCO C;  4H33 A;  1ZX3 A;  4WFA V;  2LGW A;  3RYC A;  4UVC A;  3EFO B;  4EKW A;  3UGP A;  1FYJ A;  2ZXO A;  4CS9 A;  2QKS A;  4Z9H A;  5B1A B;  1MND A;  3ETG A;  3CRR A;  4FLX A;  5K1X A;  1M93 A;  3CRM A;  1YYX A;  1PD3 A;  3RW0 A;  4AL1 A;  3AG7 A;  3FB5 C;  4MW3 A;  1V54 B;  4OPH A;  2KSD A;  3L1M A;  1I94 O;  2UUA O;  3JT1 A;  1N0N A;  1QNM A;  4E17 A;  1IDS A;  1QR9 A;  4MSW C;  1TWH A;  4FLV A;  3DXJ F;  3HJC A;  2JGD B;  3HTK C;  1BZK A;  3APQ A;  4A2N B;  2Q5Z A;  1VF6 A;  3M7M X;  2OWO A;  3JSE O;  1XHX A;  3T1H B;  2L6L A;  3CWB H;  2C03 A;  2CK3 G;  3K9S A;  1XI1 A;  1G8X A;  3SXK A;  3GM2 A;  4XEK A;  2LCH A;  1F4N A;  1I94 B;  2WVQ A;  2KB1 A;  3G50 A;  1MOF A;  3DAF A;  2UXC O;  3RYL A;  4E4E A;  4QNH B;  4FLY A;  1WAZ A;  4HBN A;  3H2V A;  4U9E A;  5A6J A;  3AK1 A;  3H65 A;  3CYO A;  1HP8 A;  3BPZ A;  2ARH A;  3ABU A;  5KAF Z;  1K04 A;  1D0X A;  3K0G A;  5CA3 A;  4HFF B;  3SPC A;  4H0L B;  1F23 A;  3JAK A;  2UUA B;  2RSE B;  3S29 A;  1GH6 A;  1SKV A;  256B A;  3KKB A;  1HR0 O;  1BL8 A;  3QVY A;  2BE3 A;  3DC5 A;  3FB8 C;  5F28 E;  3UMI A;  4HZ3 A;  5EYP B;  4UFZ A;  4MND A;  5DM6 V;  2Y0I A;  3ETE A;  4WFH A;  1A7V A;  1J5E O;  2TMV P;  3K08 A;  3EGD B;  1SC5 B;  3NKD A;  1GN4 A;  4N6H A;  4UVB A;  1E86 A;  3SDL A;  1TVK A;  4JJG A;  3EVK A;  4DR5 B;  3CX5 F;  2H8P C;  1SS3 A;  4NTY A;  1CEZ A;  2F22 A;  3JCU Q;  1I08 A;  2BOC C;  3ASN B;  5GON B;  4XPX A;  1O3U A;  1K7D A;  2X51 A;  2Y3B A;  4LAC B;  2X6B A;  2P6V A;  2A06 H;  4EB6 A;  2EJ7 A;  3LSU A;  1S0V A;  3SYP A;  4B3M O;  4J41 A;  2WLI A;  3NR7 A;  5B3S C;  4W8P A;  2LFR A;  4IT5 A;  1Z5V A;  3ZMU A;  5L0D A;  4I5S A;  1P7B A;  3CCR V;  4UUJ C;  3ZS8 C;  2WAM A;  4CX9 A;  3QMK A;  1ENV A;  1YEW A;  1NTZ H;  3VQW A;  2WVO A;  3ZTZ A;  1TUB A;  4J7K A;  3WG7 C;  1R3I C;  3K5L A;  3AQC A;  1AI5 A;  3JYH A;  3ZC4 A;  2UUB B;  1OCC B;  2GTS A;  4E18 A;  1ZHT A;  2J8W A;  4GKK O;  2PUS A;  4NVP A;  5LHG A;  1QBZ A;  4C3D A;  2IXP A;  3H9V A;  3KMI A;  2UXN A;  4X65 B;  2A3Q A;  5EZY B;  4ZLD A;  2JPU A;  1VQL V;  3RQF A;  3GWK C;  2UU9 O;  2HLD G;  3QG5 A;  1RCP A;  1L8D A;  1KEC A;  3IC9 A;  5EYP A;  3W7U A;  2Q7H A;  5BR8 B;  1TWA A;  4DV7 B;  5GTH Z;  2WL8 A;  2NUT A;  4H37 A;  4K35 A;  5LP6 C;  3DAG A;  2UXD O;  4JI6 B;  2WLJ A;  1IBL O;  1S77 D;  1XWJ A;  4B6I A;  1MMD A;  3FB6 C;  1AUE A;  1DF5 A;  3L73 H;  4I55 B;  5TJ5 E;  1AVO B;  3POV A;  1XUQ A;  3BRC A;  3SPI A;  1LUV A;  3B8M A;  4CC5 A;  4ZOL B;  4J11 A;  3IQT A;  4KNV A;  4NR1 A;  1KUQ A;  3SYC A;  2R7O A;  3ZJZ A;  5IYD O;  4TOI A;  2IJK A;  3U9J A;  4YT8 A;  4HNA A;  3TET A;  4LF4 B;  4DRX A;  1FD9 A;  1IBK B;  3JSZ A;  1PNL A;  4IIJ A;  3C8G B;  2QWR B;  2H94 A;  4PA7 A;  2LFF A;  1GRJ A;  5KAI Z;  1YDX A;  1M2O A;  2NPU A;  4HFK B;  3N2K A;  4LF9 B;  2J9V A;  2N74 A;  5JVE A;  1V4A A;  1VMG A;  2E5L B;  4NCQ A;  2IU0 A;  2D4U A;  4PA4 A;  5EBL C;  2QSA A;  3CEX A;  2KNH A;  3HR0 A;  1SER A;  3SEO A;  2XND G;  2HV6 A;  1VLT A;  3FAP B;  2J0W A;  2YXL A;  4IL6 Z;  1EA8 A;  2M64 A;  4I7Z B;  4LH6 A;  1ZL8 B;  4LF7 O;  4FMT A;  1KBH A;  2NUT B;  3IQC A;  2H7B A;  2XLM A;  3ECS A;  1AP5 A;  4EFB A;  4JYA B;  1RPO A;  3NYJ A;  1T01 A;  1Y4M A;  4ZBM A;  5DS4 A;  1RKC A;  3F46 A;  3AQB A;  5JP7 A;  4UCV A;  2P4V A;  2Y0P A;  3FYE B;  3JAL A;  4U9D A;  4KXR A;  3HKC B;  1KU2 A;  2L6H A;  4FK5 C;  1SYQ A;  4GUN A;  2P67 A;  2A79 B;  1FFX A;  2CDQ A;  3V5X A;  3E8B A;  2QDO A;  2YRF A;  1HE9 A;  2EUL A;  2XOK G;  3EPV A;  1M57 B;  4JTA B;  1FXK B;  4NTF A;  1NI8 A;  3FB7 C;  2Z0A A;  4OD5 A;  5A69 A;  1XOU A;  4X1Y B;  4ABM A;  4C7U A;  3MHS C;  3C7J A;  5LHI A;  4DV3 O;  3V7O A;  3WOD F;  2N05 A;  3LNM B;  2OKU A;  1OW8 A;  2OIG A;  1ZWI C;  4NXN B;  1U97 A;  4F4B A;  1NG1 A;  4UXN A;  1ZLZ A;  3MAQ A;  4B3S B;  2QWQ B;  4WBN B;  5LYJ A;  2CAZ C;  3JAT B;  1R1B A;  3BFR A;  5F5F A;  1M90 W;  4GKJ O;  4MVU A;  4RUE A;  4MVO A;  5LA6 A;  3L8J A;  1JJO A;  1VMA A;  4P30 A;  4WFG A;  1OHH G;  4I50 B;  4PEL A;  1XNQ O;  1ZU4 A;  3I55 V;  4PJ0 Z;  4U7N A;  3NRH A;  4G78 A;  4LFA B;  2J45 A;  3D3I A;  2LP7 A;  3JD0 A;  3L75 H;  2BOB C;  3BHP A;  1FS0 G;  1T6U A;  4DK0 A;  1MA1 A;  5IYZ A;  2QEX V;  3DZA A;  1PL0 A;  4TWK A;  1JPX A;  3LDE A;  1ZW2 A;  1I4Y A;  3RIP A;  1S5J A;  3ETD A;  3ASO C;  3OGI B;  2CGE A;  1WP8 A;  3BCC H;  1E84 A;  1Y76 B;  1JVM A;  2UXB B;  4GEH A;  3QO5 A;  4OXS A;  1M9N A;  4JYA O;  3TJ5 A;  4PDM A;  2VWJ A;  3CHX A;  1J5E B;  3CSK A;  1KTM A;  4JV5 O;  5KYU A;  1SF9 A;  2P5O A;  2DJV A;  2YS8 A;  4DUY B;  5K1P A;  4DV4 B;  1VF5 B;  1NZ6 A;  2XAG A;  5BUO A;  3Q4H A;  5AGF A;  3BAB A;  5J2U B;  1Z23 A;  4GX1 A;  3W8I A;  1R6N A;  1V55 B;  1FMV A;  1B68 A;  2WZG A;  2UXX A;  3ETQ A;  3F5W C;  3U10 A;  3UKM A;  4OX9 B;  3K7D A;  5T1D B;  1OCR B;  2YZS A;  3WG7 B;  4O4I A;  4OGQ B;  1T9K A;  2X6A A;  3K3W A;  1NSG B;  5LXT B;  2R70 A;  1IVS A;  5H6R A;  2J9U A;  3VQY A;  2Q0O C;  3G67 A;  5C8Y A;  2Y69 C;  3SYQ A;  4K0D A;  1HE1 A;  4UCU A;  4IGG A;  1NR1 A;  1OXK A;  3CJH A;  2Y3G A;  2KG7 B;  2NLJ C;  3P3P A;  4O2A A;  1RJ9 A;  1NU1 H;  4D7T A;  3NXS A;  4JYB A;  1IXM A;  4W4L A;  3ICX A;  2MYS A;  3B71 A;  2YUA A;  1YLM A;  4LNU A;  2ICW G;  2XLH A;  2R72 A;  2Q68 A;  2GDS A;  3ZTM A;  1JFF B;  3DD7 A;  5BY1 A;  3ZN0 A;  3AJM A;  2DI3 A;  1QZX A;  2H3O A;  5JWP A;  2R7Q A;  1ORS C;  1N36 B;  4WCE V;  3C3T A;  2YL1 A;  3OWT A;  4JE9 A;  4DV5 O;  3S27 A;  2J46 A;  1W0J G;  2ZDI A;  1NJI W;  4PI0 A;  3S3W A;  1VQM V;  4TV8 B;  2KQ9 A;  5L3E A;  3LEO A;  1Z63 A;  2YI9 A;  2Y48 A;  4FZ0 A;  1NU9 C;  3FAV B;  4DUZ O;  1T5O A;  2L6G A;  1K8A W;  1NTK H;  4GT1 A;  2YEV B;  1RPR A;  2R25 A;  3E86 A;  1OW7 A;  3SPG A;  2CGN A;  1FNT c;  1P84 F;  4FES A;  4BJ5 C;  4X64 B;  4JZ2 A;  3JD4 A;  2P06 A;  3ZX6 A;  2PF4 E;  2YHS A;  3LAY A;  1N36 O;  2V3C C;  5JS5 A;  3LS1 A;  3CXH F;  1QPU A;  4IAQ A;  2OCH A;  2EPL X;  2DE0 X;  2CH7 A;  1E1Q G;  4CH3 A;  3BAA A;  4QE9 A;  3FOP A;  3ZHQ A;  2JJ1 G;  1C17 M;  1R6K A;  1D2D A;  1EM1 A;  4KHP O;  3N27 A;  1G4U S;  1WGW A;  4YL1 A;  2ZD9 A;  1OR3 A;  4MT8 A;  4CIH A;  1PV3 A;  4YY3 B;  1YAU O;  3FVY A;  1BZ4 A;  4FAP B;  3OAA G;  4C3E A;  2JX0 A;  1TAE A;  1XEQ A;  2BSK B;  4ONS A;  2YIB D;  4N6C A;  2CTP A;  4DR5 O;  4IRU A;  3GM3 A;  2NUP B;  1MG1 A;  5CBF A;  2AHY A;  5T3W A;  1YIT V;  5LGT A;  2RNB A;  3NDB B;  3E9V A;  2XXA B;  4LFB B;  3FD9 A;  4X1K B;  4AIL C;  2UXC B;  1FR0 A;  4BG0 A;  2EZO A;  2YEV A;  4CS2 A;  4UCT A;  4JJF A;  4YL3 A;  3ZRV A;  4O6Y A;  3QW1 A;  2P7T C;  3A11 A;  4DR7 O;  4DR3 B; 
#chains in the Genus database with same CATH homology
 4Z1M G;  2W45 A;  2ITC C;  5DLJ A;  5IY5 C;  3EGX B;  4UV8 A;  3P32 A;  1BMF G;  4X8A A;  4MVM A;  5J9P C;  1Y66 A;  3T4D A;  3N0T A;  3IFX A;  3PMR A;  4W8K A;  3OR7 C;  2WLI B;  2EIM B;  2EIN B;  1HWY A;  4YXW G;  1PNK A;  3E8H A;  3B0P A;  2B1I A;  1K3E A;  2P90 A;  3MX3 A;  1Q86 W;  1VK5 A;  4I1O B;  4G7H F;  2KGO A;  2ZPA A;  3DM5 A;  4BJ1 A;  1OCO C;  3X2Q B;  1GKF A;  5BZB A;  3G71 V;  4H33 A;  2A68 F;  4WFA V;  5KYN A;  1OCC C;  2IJH A;  1H2G A;  2ZDI C;  4MS2 A;  4UVC A;  2A69 F;  3CC2 V;  3EFO B;  2WB7 A;  4EKW A;  3B0U X;  2Q67 A;  5L3Q A;  3UGP A;  1GM8 A;  2ZXO A;  5E3A A;  2QKS A;  4CS9 A;  5B1A B;  3CPW U;  3ETG A;  1MND A;  2P6J A;  4Q7C A;  1LVK A;  4MVZ A;  3ZMZ A;  2Q9C A;  1AI7 A;  3EFO A;  4PK4 A;  3OMN B;  1IW7 F;  5KYW B;  1PD3 A;  1SET A;  4PA9 A;  3RW0 A;  1YTF D;  5HFL A;  3FB5 C;  4MW3 A;  3VOU A;  1Q81 W;  1V54 B;  2JDI G;  1J8M F;  2HV7 A;  5IDJ A;  3EG9 A;  3ZIA G;  3L34 A;  1M2V B;  3I56 V;  3JT1 A;  1V55 C;  4FX5 A;  4X0R A;  3FYI B;  1QR9 A;  4MSW C;  5E2Q A;  1TWH A;  1K33 A;  3T4Z A;  5B1B C;  5KYU B;  3HJC A;  1D1C A;  3DXJ F;  3HTK C;  2DQ3 A;  5CMU A;  3PHF 2;  4A2N B;  3OW2 U;  3E8F A;  3OM3 B;  1KQS U;  2W9Y A;  1S7Z A;  2C03 A;  5F5H A;  2CK3 G;  3K03 A;  4JTD B;  1BR1 A;  1G8X A;  1MMA A;  3CCQ V;  3ASN C;  5B1O A;  3AG3 B;  4ZKI A;  4JW1 A;  5IYB O;  3EGD A;  1F4N A;  3L0I A;  1AJQ A;  3TCU A;  2KB1 A;  5LGN A;  2WVQ A;  1MOF A;  4YJW A;  4ANJ A;  2XAH A;  3DAF A;  1Q82 W;  2FGY A;  4KNW A;  1GK9 A;  3ASO B;  4QNH B;  3E83 A;  3RYL A;  3W7T A;  5GW7 A;  3ZMS A;  3I5P A;  3H65 A;  3M1C B;  3CYO A;  4BIU A;  3N24 A;  4J9Z B;  1LKX A;  4CS8 C;  4FPP A;  3F7Y C;  3EH2 A;  3HB3 B;  1SZT A;  3ABU A;  3OMI B;  2VAS A;  1OCR C;  2PI5 A;  4O6N A;  4QPK A;  3QO8 A;  1D0X A;  3K0G A;  3B0V C;  5CA3 A;  4J9Y B;  3T2M A;  3RFY A;  1QVF U;  4GYT A;  2EIJ C;  2JIZ G;  4H4K C;  4HFF B;  4BJ5 C;  3SPC A;  3ZCC A;  1F23 A;  1YSC A;  1SF8 A;  2H7V C;  3S29 A;  1GM9 A;  4TSF G;  3KKB A;  4CS8 A;  1BL8 A;  5CN0 A;  1F51 A;  2W6J G;  5DN6 G;  1OZ0 A;  5IYC O;  3GAN A;  2KW3 C;  3Q7L A;  5DQZ A;  3FB8 C;  3OEH G;  5EBM C;  3K33 A;  4PFO A;  5FL7 G;  3OEE G;  1ZHZ A;  3UMI A;  4OIO F;  4HZ3 A;  4BJT A;  4C7O A;  4I9W A;  1M1K W;  3OA1 A;  4MND A;  4XDL A;  2R7X A;  5DM6 V;  5EHH A;  3DZA A;  3ETE A;  2ITD C;  3BY6 A;  4WFH A;  5EK0 A;  1MMN A;  4QDL A;  4CSA A;  3EG9 B;  3SP1 A;  3K08 A;  2M4E A;  2VB6 A;  3EGD B;  1M2V A;  3NKD A;  2C04 A;  4UVB A;  1BHA A;  2R7V A;  4JJG A;  4GX0 A;  4J32 B;  2H8P C;  4JPR A;  4MVS A;  4P2Z A;  1CEZ A;  1KD1 W;  1ZHW A;  3JCU Q;  3RVY A;  2BOC C;  2EIM C;  2QM7 A;  4J30 B;  4LLE A;  3RKO F;  2DWD C;  2ZR2 A;  4U5C E;  2HKO A;  3ASN B;  3O6X A;  1COW G;  1K7D A;  2EIL C;  2IH1 C;  2FFH A;  2X51 A;  2EJR A;  2Y3B A;  1JPJ A;  4LAC B;  2X6B A;  5CI8 A;  2P6V A;  4O7G A;  1YJN V;  1M57 C;  5L3G A;  2G62 A;  1S0V A;  3CP1 A;  2OTJ V;  3SYP A;  5L3B A;  2WLI A;  5D92 A;  2J7P D;  4R6Z A;  5EC2 C;  5B3S C;  2LFR A;  1K9M W;  2Y69 B;  1MNE A;  4N06 A;  2Q69 A;  4U5F E;  4F4L A;  4XTK A;  5DQT A;  1FXH A;  2EIK C;  3ZMU A;  4I5S A;  1P7B A;  3CCR V;  4KC9 A;  4OIP F;  4LCU C;  4U5H A;  2K1E A;  2LFS A;  2XAQ A;  4MTX A;  4UUJ C;  1PD1 A;  2WAM A;  2ZQM A;  3E89 A;  4LLC A;  5KYX A;  3QMK A;  1ENV A;  2IOQ A;  2WVO A;  4OIN F;  5T3T A;  1B6Q A;  3JRT A;  1XL4 A;  3AG1 C;  1R3I C;  3WG7 C;  5LGU A;  4PJJ A;  2B5U A;  1AI5 A;  1K92 A;  3AQC A;  3JYH A;  3MLG A;  3ZC4 A;  3LES A;  2V7Q G;  1I5Y A;  3T4R A;  3P30 A;  1Q7Y W;  3ZG1 A;  1OCC B;  1N8R W;  1VQO V;  1YHQ V;  1ZHT A;  4E7S A;  5LHG A;  1QBZ A;  4C3D A;  1NVP B;  2IXP A;  1Z6A A;  3RVZ A;  3KMI A;  3W7S A;  4Q5S F;  2UXN A;  3ABM C;  2WPD G;  3DTU B;  3OFN G;  4LER A;  4E7Z A;  3S0X A;  1IZM A;  4QJF B;  3GWO A;  4ZLD A;  2OTL V;  4JCH A;  1VQL V;  3EFF K;  5EC1 C;  5B1N A;  2HLD G;  3ZMV A;  2Y39 A;  3OUS A;  1KEC A;  2Z3Y A;  1AI6 A;  1VYK A;  1S3J A;  3W7U A;  1TWA A;  2G3K A;  1DTO A;  2NUP A;  1QCE A;  3GOD A;  3ZVR A;  1PNM A;  3RBZ A;  2WL8 A;  1FXK C;  3RH3 A;  3K9A A;  1YIJ V;  2NUT A;  4H37 A;  4C3B A;  3CCJ V;  3T6B A;  1K4C C;  2XXA A;  2DW4 A;  1FTS A;  3DAG A;  3EJN A;  2Z15 A;  3K1H A;  3NYM A;  4G7O F;  2WLJ A;  4OD4 A;  2QE7 G;  1S77 D;  3LLI A;  4B6I A;  3AG3 C;  4E2L A;  1TKN A;  5E1A C;  2NNU A;  1VQK V;  2Z5U A;  1MMD A;  3FB6 C;  4AX2 A;  2JD3 A;  2GHY A;  3W7W A;  1W2B U;  1DF5 A;  4QIW F;  1O87 A;  2W4M A;  3POV A;  3O39 A;  2DQ0 A;  2DGJ A;  4KUM A;  3SPI A;  3B8M A;  2OT5 A;  4KFM A;  2D5R B;  1QR8 A;  4QI0 A;  3IEE A;  4R50 A;  4KNV A;  1JPN A;  3SYC A;  1E1R G;  2ATK C;  4BW5 A;  5KA6 A;  2R7O A;  3ZJZ A;  4ULW A;  5IYD O;  2V26 A;  2IJK A;  4YT8 A;  1TWC A;  1RM1 B;  4MTG A;  2PFD A;  3TET A;  3CC7 V;  2XAS A;  4O79 A;  1LS1 A;  3EHN A;  5EGY A;  2HFE C;  1VQ9 V;  3JSZ A;  4I3M A;  1PNL A;  1QLE B;  4PJM A;  5C93 A;  2DWE C;  4XDJ A;  3ZMT A;  3UMK A;  3FHD A;  3S28 A;  3DGE A;  2H94 A;  2E87 A;  2WLM A;  2JJ2 G;  4PA7 A;  1J95 A;  1ST6 A;  3JCZ A;  4MW8 A;  4Q20 A;  3IC7 A;  4G2K A;  1M2O A;  3EZH A;  2W4B A;  3VYW A;  4HFK B;  3EZI A;  1H8H G;  4LBE C;  5CI9 A;  1DLB A;  3SJQ C;  2M7W A;  2J7P A;  4AK9 A;  4QI2 A;  3SYN A;  3G6E V;  1FFT C;  2J9V A;  5E33 A;  3LSS A;  4FJC C;  2LSE A;  5KYY A;  2IU0 A;  2L9J A;  2PP4 A;  1W2W A;  4PA4 A;  5EBL C;  2VH3 A;  4JAU A;  1S5H C;  2KNH A;  3B9Q A;  1SER A;  3SEO A;  4BJ5 A;  1R73 A;  2XND G;  2HV6 A;  3FDQ A;  3EHM A;  4NY3 A;  4JAS A;  1KC8 W;  3CCS V;  3KH2 A;  2J0W A;  4R7C A;  1UJW B;  1FFH A;  1PCX A;  3QZC A;  2V1D A;  3ZRX A;  2ZXW C;  3CCV V;  3CC4 V;  3NG1 A;  4BIZ A;  4XLN F;  2R9R B;  4FMT A;  1XL6 A;  2Q9B A;  4BEJ A;  2NUT B;  5B1B B;  2H7B A;  4ASU G;  3ECS A;  3DJU B;  4AE4 B;  5LHH A;  1FMW A;  3AG4 B;  5KA5 A;  3Q6N A;  2IJI A;  2MK3 A;  1K97 A;  4JVS A;  3UNG C;  1RPO A;  1D0Z A;  2O9X A;  3NYJ A;  1JCH A;  3AG2 C;  1Y4M A;  1VYI A;  3B8N A;  3K0D A;  4PDV A;  4ZBM A;  5CBG A;  4UVA A;  4YN0 B;  4L87 A;  3F46 A;  3VAY A;  3CCM V;  1VQN V;  5DS4 A;  3AQB A;  2XAF A;  4CS7 A;  3FYE B;  4MTF A;  2QTO A;  3D36 A;  2G3V A;  4U7O A;  2DYS C;  4HAM A;  1F4M A;  1KU2 A;  2PX3 A;  4FK5 C;  2OCC C;  1BR4 A;  2P67 A;  2A79 B;  2EIK B;  2CDQ A;  1N1C A;  3E70 C;  2FTK A;  1FXK A;  4YWQ A;  4M63 A;  1M56 B;  4XBF A;  4PJN A;  3CMA V;  3E8B A;  5B3S B;  5HFM A;  1NKD A;  2XOK G;  4U5E E;  3LNR A;  2IYL D;  4X88 A;  1M57 B;  4JTA B;  3EPV A;  1FXK B;  1ROP A;  2B1G A;  2EBO A;  4LP8 A;  3W8H A;  3R65 A;  3ABK C;  3ABL B;  2OG2 A;  5D91 A;  3FB7 C;  1WLE A;  3OMA B;  4OD5 A;  3V7O A;  5EBW C;  4AE4 A;  3MHS C;  3ABK B;  5LHI A;  3WOD F;  4EWC A;  4YT2 A;  3LNM B;  3ZRS A;  4HYO A;  5H6Q A;  1K73 W;  1ZWI C;  4F4B A;  4EBB A;  1NG1 A;  3ZIB A;  5KYW A;  4UXN A;  3ABM B;  1H8E G;  1AJP A;  3X1O A;  2I8B A;  1M56 C;  4CBC A;  2MWQ A;  1K34 A;  2A9H A;  5KUM A;  4C7O B;  2OCC B;  5F5F A;  1M90 W;  3JD3 A;  1BR2 A;  2QA4 V;  2Q3T A;  4MVU A;  4BJ6 C;  1EFR G;  4RUE A;  3UR3 C;  1OCZ B;  3M99 B;  4MVO A;  4N23 A;  4BAY A;  3W2W A;  4CS9 C;  1VQP V;  1VMA A;  1GTO A;  2KJG A;  1YI2 V;  4P30 A;  1QLE C;  1OHH G;  4WFG A;  3T1C A;  3G4S V;  3CD6 V;  4PEL A;  1ZU4 A;  3KL4 A;  3I55 V;  3AG2 B;  2WLL B;  4U7N A;  3NRH A;  3WFV A;  2A0L A;  2Q9A A;  4WFF A;  3HPL C;  3AG4 C;  2J45 A;  2EIJ B;  3I4U A;  3D3I A;  4WF9 V;  3CCE V;  1BHB A;  2HG5 C;  2R7U A;  2LP7 A;  3JD0 A;  3SPH A;  3K79 A;  2ZXP A;  2BOB C;  3SYO A;  4HEA J;  1FS0 G;  2Q6A A;  2R7R A;  1QLN A;  2Y3H A;  3FAJ A;  2QEX V;  1VQ6 V;  4P6I C;  4RBN A;  4MVQ A;  3STL C;  5L3F A;  1E79 G;  3E8G A;  2HR3 A;  1L1F A;  1PL0 A;  3K04 A;  1JPX A;  3OGC C;  4TWK A;  4WFE A;  1AR1 B;  2W0F C;  3ZN1 A;  1ZYR F;  1THZ A;  2EIL B;  3LDE A;  4RDA A;  5DVW A;  3RIP A;  3W2V A;  4OIQ F;  3ETD A;  3ASO C;  2A6H F;  2CGE A;  4KI2 A;  1GO3 F;  2QM8 A;  1ARO P;  3STZ C;  1JVM A;  2HVK C;  4GEH A;  3QO5 A;  4OXS A;  1G8M A;  1M9N A;  1MSW D;  2IW5 A;  1FFT B;  4RQE A;  1FXV A;  4PDM A;  3K1I C;  3ITF A;  4JTC B;  4JGS A;  3UGO A;  3SZR A;  3KG2 A;  3CSK A;  1ZU5 A;  3SPJ A;  5CBH A;  4YT5 A;  3TK1 A;  5DS5 A;  5KYY B;  4KP4 A;  2A6E F;  3ABL C;  4LC1 A;  1NH2 D;  5KYU A;  3CCL V;  2WZF A;  4MQ9 F;  3OR6 C;  5DS6 A;  3B77 A;  1W0K G;  2XAG A;  5BUO A;  5L3C A;  1Z23 A;  4GX1 A;  3W8I A;  1R6N A;  4ZLC A;  5L3D A;  1V55 B;  1FMV A;  2X7R B;  2WZG A;  2AHZ A;  2UXX A;  4G28 B;  3F5W C;  3UKM A;  4DXW A;  1YTF B;  5KUK A;  1S76 D;  3QO7 A;  4MVR A;  3K7D A;  4IAO A;  4RUF A;  2DYS B;  4JZA A;  2Y3D A;  5T1D B;  1OCR B;  2YZS A;  3WG7 B;  4BJ6 A;  1JX9 A;  4U5G A;  2X6A A;  2X6C A;  3K3W A;  4X89 A;  3ML0 A;  1OKK A;  4R8C A;  5KYX B;  1YJW V;  4MTO A;  1KP3 A;  3CZ6 A;  2IXN A;  3DMD A;  3OUF A;  5H6R A;  2J9U A;  1D1A A;  4JAV A;  3K6B A;  3ZSU A;  2WVN A;  5L3V A;  1LNQ A;  2WLN A;  2Y69 C;  2IU3 A;  4DO2 A;  4CBE A;  2EZP A;  1GMG A;  3E35 A;  3SYQ A;  1ZHY A;  4K0D A;  1OCO B;  3X2Q C;  2A1D D;  3T6J A;  2XSE A;  2R7S A;  2D3O W;  3OE7 G;  1NQT A;  1NR7 A;  1NR1 A;  2WSS G;  1J8Y F;  1D0Y A;  1SZI A;  2ZXW B;  2Y3G A;  3DJN B;  1VOM A;  3EGX A;  2ZXR A;  3NKE A;  1SMY F;  3Q6M A;  2NLJ C;  1R3J C;  4JYC A;  1NVP D;  1DF4 A;  1RJ9 A;  3F47 A;  4PA6 A;  5IY5 B;  1WPX A;  1JJ2 U;  4QE7 A;  1P4R A;  2R9I A;  3NXS A;  4JYB A;  1IXM A;  4RQF A;  1Z3I X;  4U5D E;  3LDC A;  4PFP A;  2DYR B;  1YJ9 V;  2MYS A;  3I5Q A;  3JD2 A;  3LEV A;  2Q68 A;  4Q4Z F;  1JOY A;  1O5H A;  3DD7 A;  3JYC A;  3ZN0 A;  1ZHX A;  4DOZ A;  3LS0 A;  1QZX A;  1GM7 A;  3LDD A;  4U5B E;  2R7Q A;  2BE5 F;  2C2A A;  5LBQ A;  4WCE V;  4WFB V;  3OWT A;  1KKD A;  3S27 A;  3E2E A;  1W0J G;  2ZDI A;  3UM7 A;  1NJI W;  2J46 A;  3EQL F;  1K5Q A;  3MD0 A;  2H7O A;  1VQM V;  1VQ4 V;  2KQ9 A;  5HSW A;  1AI4 A;  4CZZ A;  5L3E A;  1Z63 A;  5B1A C;  2Y48 A;  3DM9 B;  1NU9 C;  1CPY A;  4JF3 A;  3H01 A;  1RM1 C;  1K8A W;  2X0L A;  4JUR I;  3MHH C;  3LLK A;  4GT1 A;  3SYA A;  2YEV B;  1RPR A;  1CP9 A;  2WLL A;  1ORQ C;  3E86 A;  4QPJ A;  4IWB A;  4O6M A;  2IH3 C;  4N21 A;  1RJ9 B;  4TT3 G;  4YT4 A;  1NZE A;  3SPG A;  2B0J A;  4G7Z F;  4FES A;  4K7B A;  3Q7G A;  1PKX A;  2WWW A;  1K4D C;  3JD4 A;  4PA3 A;  1EBO A;  1SRY A;  1H38 A;  1VQ7 V;  2PF4 E;  3EH1 A;  3ZRW B;  2IJJ A;  2YHS A;  3K66 A;  3LAY A;  4XLP F;  3F7V C;  2F43 G;  2V3C C;  2XAJ A;  3LS1 A;  1JQ0 A;  4FIP C;  3AEI A;  2JEX A;  1Z5Z A;  3ABT A;  3EHB B;  3UMH A;  5E3C A;  3CCU V;  1K5S A;  4XDK A;  4HE8 D;  1VQ8 V;  3TD7 A;  1E1Q G;  1I5X A;  1TUE B;  4DBR A;  4CSA C;  4PDR A;  4GX2 A;  2JK5 C;  4PDL A;  4QE9 A;  1KP2 A;  2WZL A;  2JJ1 G;  2HJF C;  3LSQ A;  3LUT B;  4DBQ A;  1R6K A;  3CME V;  2GSM B;  3W7X A;  1WGW A;  1MMG A;  4GX5 A;  4G0H A;  4UV9 A;  4RAI A;  2ZD9 A;  1D1B A;  4MT8 A;  4CIH A;  3LJB A;  2PX0 A;  2JEU A;  2J0X A;  5H9C A;  4I1M A;  1QVG U;  3SNH A;  3PJS K;  2HVJ C;  3QNE A;  3OEO A;  4FWV A;  3FVY A;  3OAA G;  4C3E A;  3HLZ A;  2WLK A;  4IJJ A;  1NU7 D;  1R3L C;  4RD9 A;  1NBM G;  3CQZ A;  4G27 B;  4IRU A;  2CW0 F;  2GFH A;  2YSU B;  2P7V A;  1TWG A;  2NUP B;  1S72 V;  1MG1 A;  3BEH A;  1V54 C;  2AHY A;  3IGA C;  5CBF A;  2XL4 A;  2XRH A;  5T3W A;  2R7W A;  1SES A;  3AG1 B;  3K06 A;  2R7T A;  1EZJ A;  3ZRW A;  1YIT V;  1PD0 A;  4PJL A;  1G4Y B;  1NH2 B;  3N2Z B;  4OIR F;  5LGT A;  4GCZ A;  3CXC U;  4P9O A;  1MAB G;  1VQ5 V;  1OCZ C;  2ZR3 A;  2QTV A;  5FCL A;  3JD1 A;  4I44 A;  1AJN A;  2NG1 A;  4XWJ A;  2WLH A;  3NDB B;  4KBL A;  3E9V A;  2XXA B;  2PI4 A;  2QY9 A;  3NYL A;  3A0R A;  4DVY P;  4BG0 A;  4WJ0 A;  1R3K C;  2EZO A;  2W6I G;  2YEV A;  3VBB A;  1OKK D;  1TR2 A;  2IXO A;  2IXM A;  3GB7 C;  4JJF A;  4DVZ A;  2L81 A;  3ZRV A;  4O6Y A;  2J9W A;  2EIN C;  2DYR C;  2P7T C;  4P9P A;  4RO2 A;  2CNW A;  2CNW D;  3FKS G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...