1M5HA

Formylmethanofuran:tetrahydromethanopterin formyltransferase from archaeoglobus fulgidus
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
297
structure length
297
Chain Sequence
b'MKVNGVEVEETFAEAFDIKIARVLITGYDYYWAWVAANEATGFGTSVIMCPAEAGIEIKAKPSETPDGRPGYYIQICHMSKKGLEEQLLARLGQCVLTAPTTAVFNGLPDAEEKDDTGFKLKFFADGYQKEVEVGGRKCWAVPMMEGDFIIENDIGYTNGIAGGNFFIMAETQPSALAAAKAAVDAISDVEGVITPFPGGIVASGSKVGANKYKFLKASTNEKFAPSIRDQVEGTQIPAGVKAVYEIVINGLNADAIKEATRVGILAATKIPGVVKITAGNYGGKLGKHIINLNELF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Formylmethanofuran--tetrahydromethanopterin formyltransferas
publication title Crystal structures and enzymatic properties of three formyltransferases from archaea: environmental adaptation and evolutionary relationship.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Transferase
total genus 81
structure length 297
sequence length 297
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.3.1.101: Formylmethanofuran--tetrahydromethanopterin N-formyltransferase.
pdb deposition date 2002-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01913 FTR Formylmethanofuran-tetrahydromethanopterin formyltransferase
A PF02741 FTR_C FTR, proximal lobe
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.520 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1m5hA02
3.30.70.520 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1m5hA01
2FHKA 1M5SA 1FTRA 2FHJD 1M5HA 2FHJA
chains in the Genus database with same CATH superfamily
1GNKA 1U7LA 4LF4F 2DXFA 1BY9A 4TY9A 3J7YI 4LVOP 3MFIA 2XC9A 3QT8A 1WOPA 4EBEA 2ZWOA 3R5JB 4ZVOB 1HWJA 5DZ6A 5L9NA 3PCOB 1NBEB 4OYWA 4NLQA 3R5GA 3P49B 1FESA 1VQYA 1JJHA 4J9RA 4DR6J 1OPIA 4WXOA 1S9EB 1IWAA 4C8NA 1I6JA 4LRFA 2IIHA 3I96A 4JBCA 2OMOA 3MCMA 5FJ4A 1TU0B 3M1VB 3NCPA 3RAQA 2OEJA 4DZDA 3H4DA 1DLOB 3BF4A 3M7VA 4OYXA 3UCGA 4JI8J 3GR1A 1DJ0A 3R7SB 2LEBA 3MEEA 3HFKA 2YKMA 2Q3PA 3T5KA 3AT1B 1YJ9S 3N6LA 2OFGX 2PI4A 4DHVA 1S4EA 2C3UA 1LWEA 4A8MP 2HGNA 3KUGA 1JLAB 4DBQA 2DY1A 3U02A 4BC9A 1OIAA 3VZIA 2IC3B 1DRZA 1Y9OA 4K50A 1N0UA 2E7VA 5E3RA 1JX4A 1X0PA 2GCFA 4HACB 2BEFA 1FNMA 2ASLA 4C8YA 4I67A 5F9LA 1KS2A 4ZPTR 2KFNA 2V8PA 4CO3A 4CYUB 3HHDA 3KHGA 1VRUB 1KTQA 2K7KA 1XWLA 2IAJB 4NZ0A 1EKRA 5LXYA 2VJUA 2Q79A 3OJSA 2OH2A 4DLGA 5IM0B 3OTCA 1KN6A 4F4KA 3KFWX 3TWZA 1Q79A 1PBUA 2L9DA 3NG8A 1RLCL 3FCWA 1WHXA 2R42A 4WIQA 4OJHA 1ZM3A 4FS2A 3QLHA 4F3MA 3MR7A 2YPZA 4D3HA 1ICEB 1WSRA 5BYSA 2LXUA 4J9MA 2KU7A 2FHJD 1NM2A 4LFAJ 2BE9B 5ETMA 2HAIA 1L3KA 2B4VA 3RGIA 2JEIA 2HIQA 3G71S 4I2QB 3KJQB 3LAMA 5E7OB 5DG8A 2HWTA 4DX8H 3QPIA 2AJ1A 4KV8A 3KK3B 3HMJG 2UUBJ 4OHZA 1B3TA 1N5VA 4A48A 2C2NA 4DL7A 3D1QA 1J5OA 1K0VA 2CAJA 3AXMA 4PG5A 4LF8F 4M5MA 2U1AA 4NYOA 2UVRA 2AEMA 2CNLB 3D0IE 3MTJA 4ZVSB 4EO8A 1F5AA 3GIMA 1YJUA 4WTOB 1RQ0A 4QIWD 3C46A 3OTOJ 3TOQA 3AOAA 3KNGA 2FY8A 3BO4A 2DKOB 4OHXA 4OX7A 4NPOA 5KG1A 4UW2A 3H2LA 1HBUB 3EPGA 3TA2A 3DXBA 2AQ4A 3L9ZA 1MN7A 5HO4A 3TAMB 2XSJA 3EJMA 4ZPDA 3KG0A 2M70A 4YHHJ 1U8SA 4J9SA 2Z2YB 4ECRA 5C42A 3CE8A 3M8RA 3OQ2A 2YPYA 1LWCB 2BJEA 3TEHB 3HJFA 4FBUA 1XR7A 1H98A 3M9NB 1QTMA 5CCMA 3R1HA 4DL3A 3D9BA 5ETOA 5GAHU 2FJDB 4HI1A 1T03A 4XDCA 1T95A 1FF2A 4TY8A 2CQBA 1SQEA 3C6TA 1ZTWA 3SEOA 2KZMA 2G9OA 1T7PA 4ZCKA 3DHWC 3L4BC 3GWCA 1FRXA 2IM1A 2FZGB 3CCRS 2BKPA 2L9NA 2LXIA 3CO0P 4IO1A 1ELOA 5K14A 5EUHA 4JYAF 2QSFA 1KOHA 4WF9Q 5HVGA 1X4AA 3GYXB 1HMVB 5D4PA 2PFDA 4IOCQ 2OLWA 2JDJA 4HL9A 1YJWS 1U1OA 4YOEA 3C8YA 3CDAA 4B3SF 3MEDB 1HI1A 3HK2A 2UUAJ 3PX6A 3SZ2A 2FJWA 3MEKA 3I87A 2I9SA 3VAJA 3UE2A 3DRSB 4ZOSA 4USHA 1YX2A 1BE4A 1ZH5A 1P9YA 2XNRA 2VJVA 1H72C 3T1HF 4TU8A 1D9AA 2B7CB 1R0CB 3OV7A 4FF3A 3PYFA 2DEIA 5I3UA 1K1QA 2XMMA 4H4MB 2CADA 3FFIA 3IO1A 1SIWB 3MPUB 4DUZJ 2FTRA 2HVDA 3AD9C 4I6AA 2YH1A 1RISA 4ICLB 1S0VA 3TUPA 1Q53A 2DPJA 2MKYA 3BGRA 4B9MA 3RRKA 2FPHX 4BCAA 4PXCA 2DHAA 1KFDA 1VQOS 4TQRA 9ATCB 2AGQA 3D1OA 3I9V9 2FZKB 3LW5C 1T9WA 3SDEA 3A8IA 1RT4A 3ILOA 4AFFA 1S10A 1U1RA 1FDDA 2W01A 5FD1A 4P9SA 4UZCA 1HKAA 2ZJPQ 1GMWA 2FJBB 4QWAA 1AW0A 1DTQB 3HJVA 3PKMA 2Y1IA 4P2MA 2JOQA 4F4ZA 3UNGC 3SYZA 1VQ5S 3M9OB 2Y0BB 1LK7A 4FDFA 1NU4A 4LRCA 1VQ8S 4L6V3 1NMEB 2CPYA 2DNGA 1M5KC 3PACA 2VFRA 1JXVA 2HQFA 2ZBCA 3CCZA 2CNOB 2MHEA 2DGUA 3CPWR 5L9XA 2ACMA 1L5UA 2ZE2B 2DGVA 4IUFA 4LQ3A 3QIPB 2E44A 1TL4A 3W2WB 3QNWB 1RB0A 3CJ8A 2GS8A 2YNGB 5LSOA 4CLZA 1FXRA 5KT3A 2WHOA 2RF2B 4I6WA 2QLFB 3D4JA 1WHVA 3LP0A 4F50A 3ZZPA 1N8RT 1XNRJ 2YWHA 4WWSA 1M0SA 5CXTA 3KLHB 3KDOA 4ECUA 1A9NB 3MMCA 3M8PA 5C25B 2D3O1 3IWNC 2QA1A 2MJUA 2M2BA 2PSZA 4USVA 5EDWA 4DU7A 1AFIA 4QYZK 4TYBA 2X3DA 1HNIA 2ALYB 4ZVUB 4URQU 2WVDA 3CD6S 2KT5A 4LF7F 3QJLA 4S0MA 3JB9k 1NKBA 2VFUA 2AJ4A 4CH1A 3CJ0A 1Y11A 5EHHA 3LANA 3MDFA 2OPRB 5I42B 2FJXA 3GE9A 2BE7D 4H54A 1KQKA 2A6OA 2IVMA 3HSGA 2WOMB 1CS4B 3I6PA 1Q16B 3M2VA 4TXSA 4OYZA 2QG9B 4MAKA 1WDDA 1MMNA 2D9OA 4LFCJ 4XK8C 4ZJQA 4Z37A 4ZPCA 2Z56B 1T9TA 2HHUA 1JLCA 2K06A 3GONA 1TL3A 4JI6F 2B4UA 5DM6Q 4EYIB 2C2ZB 5G4DA 1S6PA 1HW8A 4CLSA 1JLFB 3H5YA 3PZPA 5CD4H 3OR1B 4C11B 2CPEA 4WXWA 1F0XA 2UXCJ 2F9JA 3HSJA 4A8XA 1C0UB 1AT1B 1RAFB 4CT8A 1ITPA 3FC9A 4ZP6A 2W4PA 1QY7A 1KLMA 4Q0BB 3QSYB 3T1YJ 3GYNA 2VFSA 1UWAA 3L95X 1JLEA 1FFWB 4ED0A 3PFEA 1U6FA 1VRQC 3BH7B 4RZRA 4PYAA 2CPJA 2JVOA 1SJFA 4N7TA 3D28A 3WDOA 5F8JA 3A8EA 1Q78A 4YFUA 1B70B 4LVNP 4PQUA 2X3GA 3M8QB 4RUHA 1R0AA 3KMQA 2ROPA 1O0PA 1SI9A 1LW0A 4WIIA 3PYEA 3NKYA 3C6UB 2XZTB 3UDVA 5D77A 1YK9A 1L3VA 3W9HA 1S0MA 4X4OA 1CLFA 5J2PA 3I4PA 3KUHA 5GMKa 3C19A 2Q6BA 2ZUAA 2A6MA 3KJFB 4B3RJ 1WHWA 5CYQA 5K8PA 2DNLA 1WDTA 2DTJA 4CO2A 3KLEA 2IDEA 1Y4ZB 2IRUA 2BJ7A 1IBLF 2GAGC 3W2VB 3B54A 3R3TA 3I5AA 2OFHX 1D09B 2VKRA 4O0IA 3TUZC 3V4IA 1X4BA 1KLNA 4WJBA 2AYGA 1ROFA 4J9UE 3W8PA 5B09A 1RCOB 3PM9A 4E8UA 1HBMA 2I2YA 1VC6A 2X1BA 2I5JA 1Z4UA 2LDYA 3BDEA 1EETA 3TVZA 3ENVA 1UW9A 2RRAA 2DO4A 1YSJA 3KLGB 3LF0A 4ZCLA 1C1BB 1Y10A 4ED1A 3I55S 3DRRA 2XMTA 4GC6A 4I7FB 3OLBA 4X66F 3UN5A 1UETA 3UR3C 5K8MA 1T0TV 3DYAB 3G6VA 1HIYA 3BO2A 3PX0A 3JSMB 2Q66A 4RW6B 1XTZA 2C3YA 2XZWA 2QYGA 5GAGI 4RU9A 3QJJA 1B0VA 1VBKA 1X5PA 1QD1A 1HNWF 3G8SA 2ZC3A 3MM7A 2HMIB 2OKQA 3TEGA 3OFFA 4WKRA 4MH8A 4KH0B 1U0HA 3OVBA 2YKAA 3M2RA 3AXKA 3C16A 2BJ1A 4YB7A 4DJBA 1F1BB 1FRKA 1TKZA 2HLTA 1FERA 1OYEA 2HQDA 4F25A 4WP8A 4XPCA 3DLEA 2CQ4A 2DCLA 3G87A 4PEOA 4N5SA 3GR0A 4KKOB 1NSAA 2ZH2A 1V3RA 3E2EA 2MXYA 1WACA 4W90B 3NGTA 4FN5A 3KLFA 2RKIA 1S57A 4OHYA 4K59A 2HKEA 3UNYA 3QBCA 2DNOA 4Y2KA 3GFHA 4PWUA 5DG7A 2RU3A 1TP7A 1S1WB 3I31A 3LPEA 1TK0A 4RW7A 3MMAA 3POTB 5DZ7A 3GU0A 1FVQA 2CPHA 3IRXA 2OPQB 3EPIA 3OFEA 2ZDOA 4LR9A 2RQMA 4ES1A 1PAUB 1H3DA 3OTDA 3EZUA 4LSZB 3HVWA 4RNOA 1NO8A 3G96A 4DV0F 4ZN3A 2ZZNA 3JYTA 5IZHA 3IP0A 1IBKJ 4ELTA 4NA2A 3MR5A 5BYRA 1S4FA 5E5NA 3TVKA 3W1YC 4QWDA 2R8IA 4XPEA 2VQFF 2M3DA 3HP6A 5HK4A 2OPPB 2AV5A 4PXDA 2EK6A 1URRA 4MIAA 2V69A 1TV6A 3BPDA 4NLWA 5AXKA 1IKWB 3QGPA 2EXUA 4USJC 2Y0SD 2BBEA 4YMEA 2PO4A 2RRNA 4UT4A 1HQEA 4WYWA 1Q5YA 3TANA 1OY6A 1YHQS 4ZPWR 4KE5A 2MSSA 3MR2A 4C2MA 2LECA 3DRPA 2CIMA 2V2ZA 1XMOJ 2V4JA 2LEPA 1RAHB 3SFUA 3OR2A 3KHLA 4F02A 4I2PA 3UVJB 1EZZB 2E7WA 3N9UC 5KFTA 2JJ4D 2GIQA 1MROB 3AFGA 1WOSA 2CKWA 2YQ3A 3D66A 3MECB 1FFSB 5KFJA 5LOQA 3ISNC 1V9OA 1JWWA 4WU2A 3CCES 1S6QA 3R5BA 2KRBA 3HHLC 3AHPA 1T11A 4QYZJ 4O0NA 3Q8UA 4QWEA 3D7SB 4NCGB 2FHJA 4LSNA 2DHGA 3DLGA 3VF0B 3DDIA 3ILIA 3QZ8A 1S0OA 2F4VF 5HQLA 4JI2J 1S1TB 2K2PA 3OXFA 3MWBA 1CJTB 1H2VZ 1T8EA 3AA8A 1N33F 3UW1A 3DOKA 4DSFA 2HRTA 4ZA1A 5BYQA 1KNZA 5D78A 2QJ3A 1RE1B 2YKOA 3LWLA 2VG5A 2Y1RI 2V0NA 4Q7AA 4WCEQ 3CDEA 2E9ZA 4CLUA 3OT9A 5CYJA 1SJ1A 4JV2A 3Q8PB 1N52B 3FJ2A 2UVUA 4OIXA 2YTCA 3M30B 1IBMF 4Z7YA 1F6TA 2E5JA 3VAIA 4OX8A 2OIHA 1ZM4A 5HVHA 2B4PA 1TFWA 2C3PA 2RU9A 3DOMB 3F56A 4KFBA 2YNFB 2BQUA 3L7OA 2BKOA 4CO5A 5M2UA 4L74A 1FX2A 3IR5B 1AZSB 1JLQB 1N5SA 1RTJB 2BJ9A 2HAFA 2JEJA 1HARA 2W2OP 2HNYA 3O6QA 3P96A 1RSCA 4NCAA 1A6LA 2HQCA 5ETNA 1S1UB 1CG2A 3GFXA 4GVBB 4YEAA 2VG6B 1VRTA 4QR1A 4AD6A 3MI7X 3G6ES 1NK4A 1RBAA 1N56A 5I4MA 4OYIA 1M90T 3BSNA 1HI8A 1SBRA 4V1Ak 5HN0A 2VBYA 2XHCA 4UTGA 2YKNB 3MUVP 1SC3B 1S49A 5K8NA 5T7LB 2ZWPA 4NXMJ 2P9GA 1FWKA 2GO8A 2XLJA 4IFYB 1L3UA 1DFDA 5A0YA 2J9EA 1QUPA 3TZXA 2J5AA 5C2CA 1RYSA 4LRBA 4NXNF 2ZITA 3EWGA 3FK4A 2FY1A 1JKHB 1KTVA 2ZBIA 3VGSA 2E5LF 1LK5A 1RT2A 4IG0A 2VV5A 2GAHC 5IS2A 2ZH9A 4EUVA 1RTZA 2AT1B 1PG5B 2MZRA 3QRQA 2W7AA 4W98A 2HZVA 5J2QB 3GCWP 3G8TA 4WFYA 2YX1A 1WG1A 1TL5A 3DI6A 5C24B 2LQ5A 2P9CA 2NSCA 1E6VA 4KB7A 4DV4J 1S1XA 2QMUB 2XS5A 3NNCA 3CJSA 4D3GA 4RBVA 3NS5A 1ZS6A 1WD6A 4E2FB 1RTDA 1HNVB 1DBDA 4OI2A 3C66A 1H6KX 1SV5B 4P2SA 3AY0A 3GP9A 4IG3B 1RWOB 2KT3A 1NSQA 2BM1A 4NI2B 5AJ3F 1QE1A 2BANB 2MZTA 2K1RB 2ILYA 2LQBA 2BOPA 4ID5B 3OHAA 3D67A 5HP1A 1ZTTA 4NEZA 2VDIA 5D0RA 3CD5A 1UJ6A 4A46A 4KHPF 4H4KA 4CT9A 1PYOB 1PBAA 1X5OA 1FO1A 5DRKA 1ACMB 4FVMA 2DNKA 1HQUA 2CPZA 3VAKA 1T05A 2ILZA 5DQGA 2XB2D 1CEZA 3CUNA 1WORA 1WTBA 1S99A 1S59A 1HI0P 1FVSA 4J9NA 3ET6A 1RABB 2AF6A 4PCQA 4IFVB 3CDBA 1U6ZA 3PNIA 1NSKL 5E41A 4BWJA 2J0WA 4KGKA 2Y1JA 4DQPA 1B0TA 3EVOA 5L1IA 3I0SB 4ILMA 2F3JA 1NHKL 3QO9B 4MK7A 1ZAVA 3JSYA 2DYAA 2YQ0A 4EO6A 4PYDA 4HKQA 5J1PA 2XS7A 4Y65A 5L1JA 3BBFA 4M5LA 4HTJA 2VHGA 2NYIA 4OJ3A 2MLZA 3EXCX 5H1SV 2HVIA 2MQMA 2ROGA 4MJKA 1TVRB 4GKKF 1EB0A 5D4LA 1HLWA 3D6MB 5KFNA 5F0UA 5CHCB 3V6JA 5CABA 4ZIVA 4IQMA 2R7QA 3AAWB 2B8PA 2BJ8A 2EFOA 1S1VA 2NUHA 1MW7A 3DMJB 4PWWA 3H98A 1X4HA 5KOWA 1UZDA 4EGLA 5KFKA 3KKFA 2BKNA 1GTHA 4G1QB 3GIRA 4FPIA 1Z1ZA 2PA8D 1AFJA 1JLBA 2L08A 1WF0A 3LP1A 4KO0B 2KJWA 1KWMA 4DPWA 4DV5J 2K7JA 3NNAA 3GQCA 1YITS 3MM9B 3BREA 3N6MA 2IA0A 4OZLA 1TL7A 2WONA 5D3GA 3FMWA 3LP2A 1HL6A 1FDNA 3MZIA 3N28A 4N47A 1N6QA 5IQQA 2EBEA 2ZFHA 3BGUA 4JOUA 3T5HA 1KSPA 2P2CB 3K7RA 2G2YA 3RZAA 3FRZA 2PMWA 4KIAA 3QT6A 3R5AA 5DLGA 4NLVA 5DETA 1EKSA 1MN9A 4LF6J 4NWBA 4YR2A 4LF9J 3N5BA 3C3LA 4G1PA 1HW9A 2W2MP 1VQMS 3JS9A 3H5SA 2JC1A 5AE2A 3GJTB 1NPRA 1FK9A 3AB4B 3BPSP 3FBEA 2HHTA 4K5RA 3RJMB 3DOLA 1IR1A 4DSIA 1RWMB 4DPTA 4IO9Q 4USIA 2EFQA 5IOLA 5E3AA 2MQ8A 3CJ5A 2X1AA 5BR8F 1LWEB 3GILA 2CZ9A 1YJRA 1FJGJ 3RYLA 4AL7A 2KXNB 2ZOMA 2HHWA 2HK3A 3SSRA 1Y5NB 1WOOA 1GAOA 1SC6A 1VHFA 3DFEA 4X62F 1U4BA 1YTYA 3E01B 2VC1A 3PFOA 4DDFA 4JI7J 2LQ8A 4UY8T 4DFMA 3K0JA 1YDLA 2VOOA 2BQ3A 5LMNJ 5LSLA 3BJYA 5KFZA 3EDRB 2WVEA 4Q45A 1ZM2A 1VK3A 4B3MJ 3MEGB 3WHIA 1K9MT 2CNKB 2W8KA 5GADU 4ANEA 3G86A 3CJKA 4K4ZA 2W7PA 2CQGA 3EICA 1Q82T 3U7JA 4F0MA 4OJ1A 4U67Q 4J9QA 4OL8A 5CZXA 5CYMA 2WB4A 4C8OA 1N88A 2AIRB 4ECZA 3QLHB 1YGYA 2MKSA 3PX4A 3PXGa 3FDSA 3ETOA 3M2UB 1NKCA 4J9OA 3QT5A 2OMLA 3G6YA 1B99A 4DR4F 2EW9A 2D3OR 4N41A 2J8AA 1VIOA 2MZJA 3TR5A 5I3PA 3RR8A 2R8JA 3QWUA 2UUWA 2M88A 4I0WA 1XIQA 3MF5A 2N3LA 1RTIA 3O5TB 3O1LA 1U1PA 2HBYB 4DS4A 1SXLA 3HDSA 2XY7A 4KV8B 4RUAA 4V19J 3X3UA 2E5HA 4O44A 4EU0A 2HFVA 1J5OB 5HMWA 5HMYA 3IA0A 4NEYA 2UUCF 4Q44A 2P8IA 4NLYA 1NK6A 3CWJA 3UO0A 5HROA 3J7YU 2B6AA 1S9FA 3FSIA 4E98A 4L3KA 2XHWA 5B0CA 1ZAWA 3LQVA 3DCAA 2IY5B 4ZP7A 4IH5A 2EEYA 1UFKA 4A8KA 2QMWA 2JX2A 2N7CA 2QRRA 2PMZD 2B5JB 1Z2LA 2Z4PA 3HD2A 2APOA 4FXWA 4ECWA 1Q8IA 2NS1B 1PYTA 5IT9Y 5F9NA 2IDLA 4TLRA 4F04B 3TZYA 5THWA 2UP1A 4O4RA 1QTNB 1YJVA 3SFGA 2E7XA 4ZLLA 5C42B 5EWEA 3I9ZA 2UVWA 2FVQA 2XBPA 1EQMA 1GX6A 2VQEF 3CCLS 4NMXA 3SCIE 1U47A 3B8HA 3VGVA 3Q8SB 2VICA 2VPZB 4FPRA 2C2RA 1RHKB 2C2DA 5GAEI 3GTYX 2G4BA 2PMHA 2RE1A 5DDQC 2MY7A 1T03B 2AJQA 2H5EA 3KLVA 4NYZA 2LQJA 2D7SA 1XERA 4TY8B 1PYSB 8AT1B 2J9DA 4WBFA 3C6TB 1Q8KA 2CQIA 1ZETA 4P6QA 4U8YA 2KXHA 3QYYA 1IKYB 1JJCB 3G6XA 2AMCB 3H0PA 3H25A 4X64F 4JI3F 1K44A 3K5LA 4HYKA 1F2GA 4DSLA 3F44A 1G7CB 4B9UA 2HS0A 1GFWB 1V6HA 4PWDB 1N34J 2F65A 2HBZB 3IM9A 4YB5A 3EGZA 4DV3F 5CAAA 4DI6A 4R5PA 2XMVA 1NAQA 3CMES 2BZ2A 1FWPA 2KRRA 3ITHA 4X2BA 3MAHA 4QU7A 4DWIA 1WWHA 3WBZA 2FQQB 4MIWA 1LXJA 4MT1A 1RBLA 2UXBJ 2UXDF 1JLAA 4NX9A 4ED5A 1X31C 4Q2MA 3WX4A 4J91A 3PHTA 2P6TA 2CUYA 1UA1A 3FFIB 1Q1KA 2B3TB 1SJ4P 2ZJRQ 2D1CA 2C28A 2EFNA 2XO6A 1B7YB 2VFVA 2V8DA 1YBTA 2ABYA 3W5ZA 1TUVA 5KFVA 3GYGA 1OWXA 2NYHA 4X4SA 2DNMA 1RT5A 1X5TA 2W2NP 5M2PA 2GNKA 1HQ2A 1NUEA 2WCXA 3UFCX 2RVJA 2OUGA 2IAJA 3SDEB 2GHWA 1GTEA 2NPIA 2J6TA 1HA1A 1RT4B 2R2RA 4BHQA 5A8RA 3EXYA 4OZ1A 4KPCA 1VGYA 2EC2A 1CJUA 2HVEA 3AOCA 4OX9F 2PIIA 5F8HA 2RQ4A 3CJRA 4QYRA 3GSIA 3HHLB 1VBYA 3AODA 3DHXA 4FF4A 4USTA 1S7HA 4Y28C 5B7WA 1SQGA 2NQPA 3F41A 2X1GA 5AXMA 3NGDA 1WC6A 2LA6A 1IR2A 4U95A 2D3UA 1X9WA 3H42A 1J5EJ 1IQZA 5DDPC 1KBRA 3I0RA 3KK3A 1LWFA 4NLRA 2DJWA 5JJBA 4R8UB 3CCMS 2IYGA 4QJVA 1U26A 2V68A 4CM2A 1U45A 3CB4A 1I3OB 2FHOB 4J5OA 5HQMA 1TMMA 3T9NA 1SUQA 3TRGA 2A3JA 3LP0B 4DL0C 1L3TA 2UU9J 3V6HA 4DR7J 4K4TA 1V3SA 4GKJF 4AL5A 1BQMA 4QWCA 4TKTA 1UVNA 3MMCB 3UD4P 1VBXA 2PN6A 3RW6A 5KG0A 3W61A 2F1FA 3SCKE 4EMDA 3PO5A 3EDQB 2AYBA 4CWBA 3CULA 5ETKA 5DDOC 3TAMA 4DSKA 3V4MA 3H40A 3UD5A 1HR0F 1HNIB 3HVTA 1D8ZA 3E3XA 2HHHJ 4ECVA 2RILA 2QV6A 3D68A 2IM2A 3KK1A 3GJQB 4JI0J 1R6VA 2H65B 5C5JA 3EX7B 2CRLA 4P7TA 4K0KF 3FSXA 5M2RA 1PJ5A 3KHHA 2E5IA 3M2VB 1UEUA 3R5CA 1F3FA 1M5HA 3C15A 5ITHA 2Z2ZA 3RB0A 4IKAA 1JLCB 1XNQJ 5L46A 3Q24A 4ZDNA 2QL5B 3MMBA 1S6PB 5KFMA 1WELA 5HSPA 3PHEA 5KFLA 1RUSA 1GT8A 3J7Z5 2XMJA 2WVFA 3VAMA 1JJ2R 1HMVA 4C4WA 2VBXA 1TAQA 2QLJB 3DDNA 1KQGB 5J2NA 4G3IA 1HNZJ 3CT9A 3F73A 4DL2A 3JTPA 4C0BA 1KLMB 5FDLA 3MHYA 4KH1B 2E1PA 3M6UA 3GV7B 5HVFA 5A8KB 2HPUA 3RB3A 4IH6A 1WEXA 3LWMA 3KXDA 1P1TA 2V5HG 4OI6A 2JNJA 4ES3A 5RUBA 4JB8B 3D6FB 2CJQA 4PQUB 1TMJA 4AT1B 3CVKA 5KT4A 4DUTA 3EZ5A 2MQPA 1RHRB 3TZWA 3UQSA 3PO4A 1HYSA 3CC4S 2XWYA 3HSDA 4KGVB 3RBEA 2VBZA 3DGVA 4NA3A 1R27B 4YY3J 5IWAJ 5J2PB 2QSWA 4GO5X 2SXLA 1CSJA 3W5YA 1X4FA 1U1LA 1NJWA 2JHEA 1XBWA 4JV1A 3Q86A 3K5NA 4ZLJA 5LJ5Y 4A8YA 3Q89A 2LQ9A 3KLEB 4FXDA 3BGOP 2M9KA 3MAAB 4RW4B 2RDDA 3OVAA 3V4IB 4ZJLA 5K20B 3DNCA 3NMAA 3MCNA 5DQHA 2BE2A 3R5DA 2QFJA 2HK2A 1RTHA 3T5JA 1HBMB 4IDKA 3J7A1 2ZC4A 2R7RA 2PA3A 3TNVA 1WEZA 3IBWA 4CO4A 3B78A 1GEHA 5JVGQ 3GV8B 3C14A 4DL4A 2I6WA 2ZHOA 1RAJA 1FKAF 3DC2A 1FRLA 4DLEA 1YJNS 3O8WA 3QIPA 4Y2CA 3DRRB 4O4GA 1I1GA 2WBRA 2X7IA 5LMUF 2YNGA 2JEFA 4X4NA 3BH6B 4WFAQ 4K2JA 1N5YA 1N32J 5D4OA 4BWMA 3TYTA 2KVIA 1KOOA 1RWVB 2J7KA 5E3QA 4URGA 1XMQJ 4UY85 2QEXS 1U48A 2LDIA 1YBUA 5KT7A 2ZH7A 2AJ2A 4G1IA 2V63A 4MFBA 3N6NA 2RB7A 2KVQE 2LMIA 1QDUB 3IGNA 5HBMA 2VUGA 3JTOA 3MM7B 3HHEA 3GV5B 1U0HB 3HULA 3M2RB 3C16B 1FD2A 4WE1B 4AQYJ 1KKHA 2MLYA 2XNQA 2LU2A 1TKZB 3IXQA 2HQ3A 3W7BA 4DPUA 5F3ZA 2ATCB 3Q8QB 4KSEB 3VHQA 4YR0A 3ZFVA 4QPTA 2OPRA 2GMJA 1IN0A 4AYBD 5IT9U 3R2DJ 4PABA 1QLNA 2ASYA 1KFSA 2WOMA 2RKIB 2N3OA 2CWXA 5HAOA 1BWVA 4KGZB 1LEOA 2IVFB 3HHNB 3GJRB 1BQNB 2XI3A 2WSEC 4UQTA 2YNIA 4ZPVR 1ZA2B 3ZZRA 4C8KA 3FKBA 2QFIA 1NSPA 2PE8A 1VQNS 3D1HA 2H4WB 3H59A 1KHWA 3SIPB 4JI5F 3MUTP 4DV2J 1UP1A 3MMAB 3UN2A 3Q23A 1JLFA 1FKOA 2OEKA 4C11A 1BUXA 4LF2A 1KVKA 2GGPA 4TVAB 3TARA 1C0TA 2CPIA 2IBOA 4DMZA 1WHYA 1I94J 4XO0A 4ZKAA 4KTQA 2HG4A 1BC6A 1FRMA 1SB6A 1JNRB 1M1KT 2CVEA 1OSCA 1X5SA 4ERDA 2PGCA 3BV8A 5HJXA 3KDNA 5A2QY 4DV7F 1BHNA 4JI4J 1MWYA 3LPYA 4Q0BA 1Y5IB 2WBMA 4DR3F 1HWLA 1YIJS 4R0JA 4CO0A 4ED6A 2AJ0A 2GQ2A 2NZCA 4RL1A 3VVTA 3LUYA 4B9VA 2W9CA 4B3TJ 1HPZB 2E1RA 2RJZA 4I6YA 4LBPA 2OI2A 4OFZA 1RU2A 4B08A 4DR1F 4C9DA 3FQKA 4LF5J 2N4CA 4DPYA 1NLKL 1TV6B 1NZAA 4MIBA 2YKPA 2XYHB 3C6UA 2EBGA 1VK8A 1CC7A 4GRSA 2GC8A 1RAIB 1HQEB 4MKAA 1F9FA 4OHWA 5DQIA 3DRPB 4QBUA 1TZ0A 2V4JB 1KHVA 1RT7A 2DISA 5E33A 1X60A 3OR2B 3PRBA 3IMQJ 3D6TB 4I2PB 3H5XA 2ZVIA 4K4UA 3KJVA 1TTHB 5IFMA 1DY3A 1M5SA 1IKVA 3BGLA 1CPZA 4DFPA 1BWEA 3DGPA 4GVLA 4RX6A 3OTBA 3RAMA 3EUNA 5D0HA 2C42A 3TJ9A 4M5DA 2G1HA 4JI1J 4DR5J 3MM5B 3V6DB 3QQCD 2RQKA 3RTVA 3P4UB 1VQPS 4DR2F 3W65A 2FVRA 4RUBA 4UUXA 5U47A 5GAGU 2LA4A 2KJVA 3PY8A 1F9HA 1I5OB 3WC2A 4QIGA 3ENAA 2IJRA 3BYRA 1MWZA 4X65F 2MSTA 3DLBA 2GV1A 5ETPA 3ZTSA 3E51A 3FCHA 4LR8A 1RZMA 1RHUB 2W9BA 1LW2B 3B4DA 2HNDA 3OFHA 2WRMA 2XYPB 3ADAC 3ZZOA 5B08A 1XR5A 4I7FA 3JAMY 2HBRB 3FZ2A 1HWUA 4USMA 3N79A 3K8VA 1Y5LB 1IVZA 1NDCA 3GG0A 2VG5B 1SPBP 2RMLA 1T9XA 5HMZA 4DCJB 3IS9B 4YUDA 2JC0A 3OL6A 2RDIA 1HD0A 3AH6A 2Z8QA 3JSMA 4JV5F 4K8RA 2FGCA 3PIPQ 5IC6B 2DGTA 3V6KA 1JXLA 2HQIA 3P45B 3FEXB 3QAEA 1DQ8A 3PEJA 3AD8C 4RNFA 3GIIA 4EZ9A 2HGMA 5E0OA 1TKTB 2ZH5A 3KTQA 3TA1A 2CQ1A 2FGOA 1FKPA 1C1CB 2DBBA 7FD1A 3MM8B 1FFGB 2FIUA 2XTJP 3KLIA 3GSDA 1RWUA 1XR6A 2HNYB 1F5BA 4H4OB 2R7WA 1TL1A 1IJFB 1UA0A 4DR6F 2V67A 4XDDA 2CFXA 3NL0A 2WVCA 3J81Y 3QGGA 1S76D 2HWHA 4KKOA 3FMBA 3FNNA 2DO0A 4LFBJ 3AQPA 4NLDA 3M32A 2VG7B 3BR8A 4OMFG 1QSLA 4KGXB 4JI8F 4FYVB 2DGQA 3WQPA 3W9IA 1FT8A 2V50A 4C8LA 4PXEA 4RO0A 5A0YB 4ZVRB 5A76A 1UMJA 1S7IA 1NEEA 2J9CA 4NASA 2AD9A 4G6VB 3OSNA 3UWTA 2AEJA 2ZM6J 2CZVC 1HBNA 1I51B 2DR5A 2F8EX 3HFZB 4PZVA 5IC4B 4CLFA 4ZVTB 3NWGA 2QE5A 4GMKA 5HQ8A 4RNHA 3DI6B 3CMAS 3GFZA 2E9TA 1H2TZ 3EE3A 2GA7A 1S1XB 3CCTA 4QU6A 2J76E 1SKSA 2FLLA 5L39A 3FCVA 3US5A 3B4MA 1VJQA 1RTDB 3VALA 3EZOA 5A8WA 4ILRA 4IRKA 3IR6B 2HVZA 3DU6A 1D9DA 3A3NB 4ZITA 2W25A 1D0EA 4C7QA 5CD4A 4NLUA 3M9MB 3CCVS 2ZUGA 5HP1B 1VDHA 5KFDA 1IKWA 3ZC4A 2DIUA 4ZPBA 2ZH3A 2XG8A 3DLKA 1YQHA 3GZ7A 1TQLA 3ISND 4DXLA 4L76A 3IAS9 4JV0A 2MZSA 1S12A 4LFAF 4DU8A 3DXSX 1NK8A 1HQUB 4OX6A 3HHLD 4N8OA 5EX3A 1T05B 2HURA 2RD5C 2IMWP 2EG1A 2Q6CA 1PJ7A 2A10A 3BDPA 1RAOA 1EIYB 1NJXA 3UVJA 2GX8A 2YQ1A 4ETZA 1OY9A 1REVB 3ET6B 3ZZUA 5E3PA 1UW4A 2NCKL 1B0PA 3PRDA 2PEHA 2UUBF 2WVBA 2AP6A 2XY6A 4LT6A 3TAPA 1Q86T 1W2BR 1N36J 1OSDA 1P6TA 3BZQA 1J27A 1QAXA 1BQXA 1LWXA 2B9WA 1HNXJ 1U09A 4USUA 3TAQA 1OQ6A 4X4RA 3CF5Q 4DV1J 3S6EA 1MMLA 2BV3A 1LOUA 2VH7A 1VBZA 5AT1B 3OTOF 1HD1A 3IR7B 4NCGA 1R7IA 5K8OA 4QOTA 5L8RC 5KG2A 4DV6J 4NLPA 2AYEA 2RS2A 5DM7Q 3DRYA 1S1TA 4DUYJ 1UPMB 1DHMA 2DRAA 4U7UK 1CJTA 3HHKA 3N4WA 3K89A 4YHHF 2DR6A 4ILLA 4PG8A 2HIYA 1UJ5A 2C2OB 2GZOA 5KFYA 1S1VB 2V94A 4OI1A 1HFEL 3M8SA 1NJYA 3M6XA 3TX0A 3R7NB 2G2OA 2YWWA 1IM6A 2FHKA 1KQSR 5HATA 2RHSB 2LU1A 4FBTA 3VZHA 1RK8A 2QMXA 2DB1A 1WC5A 1U6BA 4CLTA 3GMGA 4ZVEA 1SKWA 2YNFA 1JLBB 5KG7A 2CQ0A 2Y1LB 2RUGA 2VC0A 3MGJA 1OQ3A 1SC1B 1WF2A 2U2FA 5IV3A 3NP5A 2YY3A 3A3OB 4CLYA 1AZSA 2IHR1 1RTJA 5KFRA 3SSSA 3KNAA 1TL7B 4P10A 3LO3A 2WONB 2KHDA 4KHRA 1S77D 3LP2B 1IJEB 4UUWA 4EI2A 2CQ2A 1TELA 2NUUG 2YXLA 3ELHA 2MDAA 1RKJA 3NS7B 2F8MA 4HR2A 1KEKA 2X1FA 4ER8A 3UCUP 4LF4J 4YDDB 4I56A 4ZN1A 1F2HA 2N7YA 3BBCA 2UUAF 1N5QA 3AB2B 4M63A 4TNOA 1CQNA 3T41A 3I5CA 5D8HB 2FJVA 1FD8A 1RAGB 4WP9A 4KQZA 3ZNUA 1X9SA 4C3KA 2B8QA 1XEZA 2DNHA 1JKHA 1RHJB 1YBAA 5HANA 2ZVSA 2QGFB 1RXOB 4MKBA 4AL6A 4DUZF 1NHUA 4Z2XA 5DDRC 1DTTB 4DX7A 1UL3A 4QQBA 2NXNA 1RLDA 5J2QA 2ZKTA 3RG6A 4YB1P 4ZP9A 2HHVA 1EP4A 2LXFA 4QPXA 4M5NA 2D9PA 2BUNA 5F8MA 1S9GA 3BBBA 4M1KA 2XGPA 2XY5A 2MQNA 3RBZA 3WX8A 1HNVA 1SV5A 2MQOA 3SQOP 3GIJA 2XS2A 2J0SD 5A2QU 3R1LA 3CCWA 2LCWA 2X51A 5ETVA 1APSA 1VC5A 3VWSA 3Q22A 5JMNA 2V2KA 2KO1A 4BBYA 5F8NA 1K8AT 4HDHA 5FLXY 2CPXA 4RU2A 4X4PA 4YR3A 4EYHB 3CJKB 5L1LA 4LQ9A 3FUYA 3W64A 1NK5A 5KTQA 5C7PA 3PR5B 2CQDA 2W4CA 4URSA 5CYMB 2BRKA 1U8WA 2HW3A 4ANCA 2ZOGA 3SSQA 4CQ1A 2NLWA 1D8YA 4P2XA 4IOAQ 3OUYA 1GX5A 2RS8A 4TN2A 3R8YA 2PI5A 5CH7B 1GQEA 4F67A 5H9EJ 2VOPA 5KAKA 3UD3P 3LOUA 4F3OA 5KFHA 2KXFA 3NAHA 2I38A 3C2PA 3NOCA 2KFYA 1Q7LB 2V9WA 1XNRF 1RTIB 2MQQA 2ZBQA 2CJKA 5JVHQ 4GO7X 4ZMMA 3EGVA 1A7GE 1SIZA 3HCXA 4O44B 4XTTA 1JQGA 4RJVA 1U2CA 1RT3A 1G1XA 1LFWA 1N54B 1FJEB 1DZ5A 2H54B 2RNEA 3T6BA 4J9PA 1UPPA 2B6AB 4NLOA 2PD1A 3W9JA 3BKTA 4BC7A 4LF8J 3MCOA 2QT7A 2XGQA 2YH0A 1UVMA 3W3SA 2R7XA 5L1KA 2O5DA 2POKA 1T3NA 2NXJA 2O1PA 2YX4A 3RBDA 4M5HA 2K3IA 3G9CA 3FQLA 1VJWA 2MQLA 5F8GA 3JAMU 3VCDA 3PKYA 3CC2S 3JQJA 2CVIA 3OBIA 5ETQA 4F4YA 4LFCF 1NDPA 4FP9A 3K17A 3MM9A 2KYZA 2HHSA 3I4HX 4NRUA 2YNHA 1SJQA 1X4EA 5KFFA 2GIFA 4WTYA 2DHXA 3E8OA 1NK0A 2R7VA 1T3OA 4CO1A 4DQQA 2UVVA 2VDHA 4LRAA 2IJNA 2UXCF 3KMSA 3VGUA 3BQ1A 2CZ4A 5EWGA 5IV4A 3OL9A 1WG5A 1BXNA 3DLLQ 3SCLE 3GLJA 3DLJA 4FNHA 3M8WA 3T1YF 4O23A 1F60B 3MR3A 2CDRB 2GVZB 1TKDA 4AXJA 1W7WA 1FE0A 5KT2A 4B9LA 2PFFB 3J81U 2VL1A 3TW0A 2RRBA 1CBKA 3CIZA 1R8HA 2B4OA 1S79A 5GMEA 4JYAJ 4M5JA 2JH3A 1NNDA 1PSDA 4ZPAA 1R43A 2W1BA 4J9KA 2EFGA 1QAYA 4R5PB 4B3SJ 3ITHB 1RP5A 2XWXA 4WFNQ 1ULRA 1E6YA 2EFVA 1H73A 1IWGA 5E2QA 4B3OA 1D3WA 1KVJA 1NJIT 3HX9A 1U25A 2CQ3A 3HT3A 3GJSB 1R3NA 1H2UX 3T1HJ 4B3RF 1WKJA 2V8HA 4U7UD 2F5GA 2OHDA 4DG1A 3E01A 2G2ZA 4YN3B 2BMBA 5KG4A 1RT5B 4IR9A 4N77A 3BO3A 3NBPA 3N0VA 4USKA 2M7SA 3GG1A 1VR6A 3HZEA 2FC9A 3RAXA 1U1MA 3MEGA 5A8RB 4KR0B 3PW7A 2JLFA 3D3CJ 3SCJE 1WKKA 4FKYA 2ZD1A 1CJUB 3SV3A 2A2CA 1RHMB 1RKIA 3NWRA 4CIOA 5KFAA 2C3MA 2F7VA 3KG1A 3GB0A 3CD0A 2FZCB 3UDCA 5AE3A 3M2UA 3V81A 5CZVA 5J2MA 4FYXB 3J81j 1Q4RA 5F8LA 4K5SA 2FLPA 3BR9A 5JUMA 3MM6B 3D6HB 5HI7A 5ETTA 3CIMA 5CCLA 3D54A 3P3DA 4HLBA 3NGUA 2HS4A 1HHSA 2KN4A 4FKXA 3VQSA 2DHHA 1RWNB 3JXOA 3PW5A 2DNPA 3BSCA 3W8GA 1RT6A 3I0RB 3UDLA 4CTAA 1YZ6A 1NK9A 1D1UA 1LWFB 2OJ3A 5ETRA 3TQEA 2ZZTA 3O2IA 1M5VC 5GAEU 2QA4G 3VTIA 2XYGB 4RW8B 2JWNA 4HEA9 1TKXA 1FRHA 2BACA 1RACB 3Q83A 1SUQB 3QZ7A 4CLWA 2FLNA 3DKDA 1BQMB 2HSEB 3MPYA 3Q2SC 4KY3A 2KL8A 2CPDA 3OJUA 1WI8A 2B5JA 2B56A 3PJ9A 5E3CA 5KFGA 2EC0A 1K1SA 2VA3A 2MPUA 5J1EA 3R6GB 1CJVA 1QUVA 2QIFA 2FJAB 3HVTB 3K2YA 1U49A 4U9RA 2M4MA 1NJZA 1ZPVA 4NLSA 4OHVA 4LBHA 1TFYA 3VGTA 4ES2A 3KK1B 1HBOA 5EX0A 4J90A 1F9EB 3LAKA 1VLOA 2EI5A 4LF7J 2R7TA 2NPFA 2I8EA 3QGIA 3R97A 3ZO7A 1S6OA 4OV6A 3IG1A 2XLKA 1MNEA 4LMZA 3C15B 4OZNA 5DO2A 1H7XA 1XMBA 5GVQA 1EARA 2PDAA 3B6BA 2A1BA 5KFPA 1EX8A 9RUBA 1IKYA 4CCHA 2MKKA 1MU2B 4ZCIA 5J1NA 3THTA 5LT5A 2GO9A 1AB8A 3MMBB 3G8QA 1IBKF 4WFXA 2WSFC 5DGAA 1PAEX 4ZHRA 5DS7A 4JI6J 3FBBA 3HXMA 5ETSA 1X9MA 2MKJA 1RGVA 4OLOA 3CJTA 4QCLA 2JFKA 3UCZP 3EVMA 4ED4A 3FEZA 2DNYA 4OYMA 5D0EA 5J2NB 4PWDA 4UOHA 4BDPA 4V19X 5FDLB 2BXJA 4ZK7M 1NXIA 3NMRA 3THVA 3OXLA 1Q7YT 2QA4S 1X0FA 1XQIA 1DURA 5F8IA 3RB6A 2HFOA 2VFTA 1Q0NA 4O3QA 3AD7C 3OLAA 1H38A 1GXLA 1XMOF 3CCUS 4OI3A 1VISA 2C22A 2DRDA 2B43A 4WFZA 1DARA 1Q8LA 3CJ3A 1WC0A 3IRWP 1YKWA 2WB1D 1HYSB 5L38A 4F8RA 2A0FB 4A8QA 3OTEA 3ZNJ1 3W66A 2NSBA 2HNZA 4CZCA 3TVYA 3Q8VA 3G82A 4ELVA 2HZCA 1SC4B 4LREA 2GVDA 5SZTA 2MKCA 5KOXA 4ECQA 5CA5A 2F8HA 4RW9A 4M5KA 1FRJA 1RT1B 1JLGA 5MAOA 3SMZA 2IMOA 1NDKA 1P1LA 2DNNA 3R2CJ 4LUBA 3VQTA 2VD3A 2DGOA 3T6JA 4AXIA 2ZHAA 1U1NA 1UWBA 2AHOB 4C8MA 4K4XA 3EGNA 4OJGA 5GMDA 1FI4A 3HHLA 2FVSA 1UTAA 3KYLA 1IBLJ 1WI6A 4JI2F 2DCUB 4A8OA 2BE2B 3NRBA 4YQWA 5MLCV 5FLXU 5D6GA 3R7BB 1RTHB 1C4CA 4IDKB 4LR7A 3BQ2A 1VOMA 2VZ9A 1Q8BA 3KK2A 3J7ZT 3TQ1A 3LGHA 2W4DA 3C14B 4HHHA 2LFVA 4QIVA 2AW0A 4OZ3A 2F63A 1UVLA 2FC8A 5HJYA 2NXEA 4A8SA 4R0EA 4OYOA 1U2RA 5B0AA 1YRXA 3IAM9 4PUOB 4O4GB 3J80Y 4R8UA 4U6PA 1FX4A 1UVIA 3OD2A 1S72S 1MWQA 3VVUA 3VV2B 1C4AA 3RB4A 2ZEJA 1N5YB 3MTKA 4F4WA 4DFKA 3MUMP 4X66J 5CQGA 2G0CA 4IQXA 3NAIA 4OZ5A 3F0NA 2GMLA 1RJJA 2NR0A 3K8WA 4MFBB 1CC8A 4F0KA 4Y0FA 1LKZA 3P8BB 3PJWA 4N76A 2FUG9 3NEKA 5HBMB 1ZBTA 2RUSA 1RI7A 1OO0B 4LJMA 4M95A 1ZM9A 1FRIA 3S8SA 1HNWJ 3K58A 1J2VA 3RBXA 1UJ4A 2OTLS 1AROP 4NXMF 1G3OA 1FEEA 3W62A 5B0FA 3HKZD 3OPKA 2HYIB 2E1MC 2O3DA 3R6LB 3THPA 4ED8A 1AA1B 4PRFA 1YRTA 4DN0A 4B9NA 1NKEA 2VASA 2CPFA 1CJKA 2QLBB 3ZZYA 3DM2A 3IWLA 2W7OA 5KFEA 1Q81T 1WJ9A 4LSLA 2BOAA 3CCJS 2M8DB 4XAKA 2R2UA 4DEZA 4ZVHA 2EWHA 2YNIB 4G65A 1AYEA 4X4UA 1LV5A 1JXEA 4CDIA 2Q1LA 1R8AA 1F5CA 1U02A 4DV4F 3MEEB 1WUUA 5BJRA 1N0VC 2YKMB 1X4CA 3CO9A 1FKOB 1AXQA 2GGPB 2AX0A 2HBQB 1C0TB 2RIJA 3UI3A 2MGZA 2LP4A 3H2VE 2AKWB 2J0XA 1OJ4A 5IQ6A 1Q95G 2HFSA 1S97A 3PG9A 1PO6A 2Y8WA 2CJBA 4UOFA 5A8KA 2AZ1A 4RUCA 2R2SA 1FNXH 2W9CB 4DV0J 3HVRA 3S7RA 3HM9A 3QSIA 4PG6A 4KYZA 3Q8YA 1PILA 1WEYA 4Y6IA 1VS3A 4DQIA 1IKXA 4OZ2A 2ZZMA 2VF3A 3A3PB 2ADBA 2VQFJ 1UEKA 3QMQA 2MTLA 2MY8A 1UFWA 5G0RA 3PW2A 2CQCA 2ZH6A 2KG1A 3MCSA 1Q5VA 2HGLA 2LYVA 2BM0A 4K4VA 1RT7B 4Y34A 1A0OB 1MSWD 3L09A 3KJVB 1QSYA 4HI2A 1HHTP 1IKVB 4UZBA 2B0GA 2VB6A 3DGPB 1TK8A 3IBCB 4CH0S 4DF4A 1U2FA 4QIEA 3MAAA 4RW4A 3DDKA 1X8DA 3HD1A 4M5DB 1DAXA 2VBWA 3TZZA 2IA6A 4ECYA 4FYYB 2Y9HA 2C3OA 2MEWA 1O8BA 3SQGA 1NZ8A 3MPDA 1HHQA 2B51A 1K73T 2JVRA 2EKYA 5AE1A 1T9UA 1UFLA 3QATA 4ZVPB 3IGVA 3VAGA 2ATLA 2RT3A 2JL9A 2OPSA 3S1TA 1FNOA 3FBFA 5JXSA 2C2MB 3A12A 2GJIA 2BX6A 2W9BB 3M05A 1JIHA 4DQSA 1ZZNA 4ZVGA 2HFUA 4RNNA 1IM4A 3VAHA 2HNDB 3CDWA 3UPFA 5HLFA 2DEJA 2F4VJ 2XSJB 1N33J 4DV5F 3TUIC 1CULA 4O3NA 2CQPA 3QFHA 3VR1A 3LH2S 2ZBPA 4MK8A 2CXEA 2GIRA 2XM3A 4PG7A 2DXEA 1V3ZA 3AQOA 2DGXA 2C1EB 4OI4A 4X4QA 2CG4A 3TP2A 4WZQA 2R8HA 1IBMJ 4IRCA 2IBKA 2LEAA 4F0HA 3ILJA 5D0GA 1FKPB 3DLHA 2KG0A 5IT0A 2R8KA 1WNEA 4WE1A 2WTFA 1BMQB 4F36A 4P7VA 3KLIB 1YRUA 1XK8A 1KD1T 3LTOA 1ZA1B 4LF6F 4LF9F 3M8ZA 1TL1B 1PGZA 4KRWA 2EG2A 2ZH4A 2QZ8A 3KWMA 2XO7A 4TLQA 5K14B 4DPXA 2R8GA 3H5UA 4MKYA 2XMAA 1V5VA 3T5LA 4DSEA 4K4WA 3D0HE 3M32B 1VQ6S 1S9EA 4M8LA 4RNMA 4NCBA 4NZ7A 1BQNA 2DXDA 2H3EB 3QWPA 4YB6A 3M1VA 4HH0A 2XCAA 1DLOA 3MMJA 3RRGA 1FJGF 5GAHI 4DS5A 1IBCB 2XULA 1PCAA 2ASDA 4K7QA 1NH7A 2FJEB 4KHMA 3TJAA 1HBNB 1RWWB 2EKNA 4QWBA 4RPFA 4NXNJ 3TO8A 3D0GE 2HRUA 1VLYA 2IRXA 5I3UB 4F7VA 3HKWA 2OP5A 2MZQA 2W9AA 1D9FA 3R9LA 2E5LJ 2IC3A 4JI7F 3CCQS 2ZNZA 3CDUA 2M8HA 5K9FA 4NE9C 3AJDA 4HVZA 4LRDA 1T9VA 4HT5A 4RBTA 4HACA 5LMNF 5D15A 3I5BA 4NL5A 5EGYA 3BGRB 2KFZA 4TQSA 4WK3A 1N4LA 4J9VA 4B3MF 3NXZA 1HPZA 2HLUA 4CYUA 5KFOA 3NGRA 4KT0C 3PRVA 2AYMA 1VRUA 1RYRA 5A8WB 1Z2ZA 1S48A 3CJ2A 3PIOQ 3JSBA 2EK1A 4WK1A 4MK9A 2BW7A 5IM0A 3VAFA 4RWXA 2BDPA 1R8PA 4F4AA 4CM0A 4AUKA 2OD6A 1VHIA 3HZGA 4H4KC 5AJ3J 2A18A 3DLKB 5FIIA 4DX5A 1KC8T 4A4JA 1NDLA 1QSSA 4Q43A 3ULHA 4CNZA 3K5OA 2I1RA 4KHPJ 2COLA 3PVXA 4QW9A 2QLWA 3ZZ0A 2VPWB 3ZTQA 3QRRA 2ACYA 3JQMA 4I2QA 4OYBA 1EQ0A 2MLXA 4RWWA 2DGSA 4ED7A 2ZNYA 1B64A 3IM8A 2ZBRA 5DJBA 2YWEA 3MM5A 3V6DA 2ROEA 3NGKA 3A1YG 3P5TL 2IFXA 3SI8A 3LGMA 3UDEA 2DVIA 2VPXB 4O3OA 5KFUA 4J7CA 4U7CA 3WZ0A 3O3LA 3NY0A 5SUHA 5F3TA 1IXKA 2V4QA 4NA1A 4WYLA 1NPKA 2L3MA 4M94A 1KDNA 1S5ZA 1KQFB 2GHVC 3MXHP 4MKVA 1ZZFA 2XMUA 1TK5A 2KYXA 1LW2A 3DU5A 4K4SA 3X1LB 4CLKA 4KC5A 1LQ9A 4OZJA 3M8PB 2FB0A 2J0QD 1LFPA 3HT0A 4IR1A 4GKKJ 1HBUA 2N4DA 4NLTA 2F4FA 5B0BA 2K8GA 4ENOA 4USWA 1VQ9S 1NCLA 5EN1A 1KVIA 3IS9A 4Q5VA 3G2XA 3CJ4A 3I32A 2C2KB 1LWCA 3CJQA 2M0GB 1FXDA 3AA9A 2BABA 4EEYA 3J80U 3QJPA 4NMLA 2FVPA 1TKTA 4C98A 2EVZA 4NRTA 3ZTOA 3PJXA 5T14A 4PQAA 3OXGA 1UZHA 1C1CA 4DF8A 3Q2TC 3MM8A 1KONA 4ED2A 4PPZA 2WZ1A 1Y0HA 4Y00A 1QM9A 2DY9A 3UR0A 1WC4A 4H4OA 2ZHBA 2YWGA 1OS5A 2BJ3A 1G4CA 3QIDA 3Q8RB 1TL3B 2VPYB 1RHQB 2OTJS 2H4YB 2VKZG 3M6WA 3ZTRA 2N82B 1O51A 2MHNA 3D3BJ 1UKUA 4HHJA 1N34F 4RR5A 2O01C 2VG7A 2B7BB 2BJDA 4F4XA 4KPYA 3MEDA 2OO4A 3QAUA 1U24A 2R9LA 1CVJA 1IQTA 2KDOA 2YX7A 4P75A 3MOZA 3HFVA 4F2SA 1JLEB 3DRSA 2UXBF 2DT9A 1X4DA 3V5RA 3ISZA 3MPVA 3IC1A 3D5MA 2FVCA 5I3QA 3HLUA 3I82A 2NXCA 1R0AB 2F40A 3U1NA 4H4MA 3K5PA 1LW0B 4NZ6A 1P8GA 1EP4B 2LVWA 2AZ3A 4ICLA 2DH8A 3NS6A 3PV8A 1TUGB 1S9GB 5BR8J 5AXNA 2J7UA 3MURP 4F2RA 2R3VA 4X4TA 3WC0A 3I56S 4ITSA 4OQJA 1QJHA 2KTQA 4OI0A 1M1GA 4UOCA 2E66A 2AU0A 5LJ3Y 2AGOA 2Z57B 1N5TA 3TJ8A 4FS1A 2GMHA 1REGX 1UCNA 2HWIA 2ERRA 1RAAB 4RBUA 1VI7A 3NLCA 5CYQB 2G13A 2HEKA 2IPOB 5B0GA 1RU1A 1DTQA 4X62J 4X84A 2CA9A 1SVDA 1M5OC 3MR6A 4CI0B 2YKQA 1G2EA 2NREA 2ADCA 4Q2LA 5KT6A 2KM8C 2IM0A 3RRHA 2DGWA 2KHCA 5F0WA 1BGXT 2HVHA 3KG4A 3ICLA 3IBFB 2H5JB 4I64A 4DOZA 4C3MA 1J5EF 3LA0A 1REVA 2I5JB 1FHTA 5DGBA 1EETB 3BSOA 1DQAA 2ZE2A 3CNQP 1LNQA 1WC3A 3OUYB 4ZLPA 1RWKB 3L7UA 1R8BA 1UEVA 2BRLA 1UAWA 1NK7A 1TR0A 3W2WA 3HI9A 2QL9B 4CNYA 4BS2A 1B7FA 4DR4J 5KFXA 3ZZZA 2GJFA 2UU9F 4DR7F 1U0SA 2IRYA 2RF2A 4Y2AA 1WF1A 2DNRA 1XN9A 3M8YA 1RT3B 3KLHA 4ZVFA 5HL7Q 4EBDA 6FDRA 5A6WA 5C25A 2OSQA 3QFWA 2QL7B 2EFPA 2B9EA 2UUCJ 2B9XA 3MOJB 2XZDB 2LKZA 5KFSA 2HHHF 3TA0A 2UZAA 2GQCA 5C2GA 2FHMA 1VCTA 1XJWB 4JI0F 2W2PP 2QTWA 1RDRA 3DLEB 2MYFA 4ZIWA 3GFYA 3N5FA 1CQMA 2MJNA 3SV4A 1X4GA 5I42A 6FD1A 3DN9A 3PEHA 1B4SA 2OGUA 2IJFA 4B02A 5KFCA 3RR7A 5A6PA 3KLFB 4EFAC 1CS4A 3JSRA 4J37A 1XNQF 1PC4A 3SBMA 2FYXA 2YNHB 2RQCA 1GXUA 3CCSS 3MAQA 2VQEJ 5H9FK 2KB2A 2H51B 2VIHA 3FGVA 2C2EA 2ZH1A 2JFDA 4WFBQ 1X7VA 4RW7B 4I68A 1NB2A 2Z58B 2R7SA 4DN9A 1H7WA 1G6BA 3OR1A 1HNZF 3IRXB 3RUBL 4W92B 1O5JA 4MYUA 2XMWA 1C0UA 2RHQB 2J6SA 1NHVA 3Q0AA 2B9YA 2MKHA 3TUJC 4DX6A 4DPOA 4Y3CA 4I69A 4C0HA 4X64J 1S6UA 3W63A 1KRPA 3IFEA 3JYTB 2HFZA 4JI3J 1L3SA 3K57A 3ZZTA 4B9TA 2RSQA 2DPIA 4AE5A 3V2UC 2DIVA 2AJFE 1UVJA 2W2QP 2K3KA 3P6YC 1Y7PA 1DTTA 2V2VA 3M8QA 3B82A 1FJ7A 4PXBA 2R7UA 2HQGA 7AT1B 1U1QA 1GMVA 3U27A 4NYPA 1R0BG 4TU9A 4LF1A 2RAQA 4YY3F 5IWAF 3WIVA 1E6YB 2MB0B 4DV3J 4B3OB 5BXIA 1HWKA 4HT7A 4ZS6A 1MG7A 4NOHA 3OVSA 4XIUA 4FVCA 2CWKA 3MD3A 2JSXA 2CG8A 4P71A 1MLAA 2AGPA 2DNZA 4EWTA 2UXDJ 2J9DE 2KKHA 2VA2A 4DG1B 4CP5A 4HDGA 2E5GA 1FA0A 1T94A 4ETXA 1VQLS 1HWIA 5ETLA 4FF2A 2QA2A 5LL6d 1GXTA 3FSYA 3NBPB 4N56A 1DQ9A 3CEDA 3W2VA 1VQ4S 2YBVA 4RKUC 3PDNA 3ETMA 1RA6A 2W8LA 2NXUA 1IUJA 2LLZA 2E29A 1VYAA 2GW8A 1PC5A 3PW4A 2O66A 1ZPWX 2F9DA 1JB0C 3TI0A 1EHWA 8ATCB 2ZD1B 3OSPA 1RAEB 4HH1A 2DR9A 4I4BA 1S6QB 4ECTA 4W4MA 2D69A 4DZ6A 3NCQA 4C3LA 4IRDA 2VONA 3KJNB 3BYPA 3JQKA 1XC9A 3FZBA 1RCXB 1H0HB 2D3ZA 2CJYB 4LSNB 3CW2C 4FZVA 5ADZA 4OX9J 3V81B 2L48A 3EGWB 3DLGB 5J2MB 3KLGA 4Z7CA 2D41A 1C1BA 4DL5A 2UUTA 2H1YA 3IN5A 3QGHA 3A8KA 3AJ1A 3ENQA 4QW8A 1N32F 3DOKB 2EPIA 3R27A 2CYYA 3SXLA 1XMQF 2BA9A 3DYAA 4L3NA 1SKUB 1RT6B 1Y3KA 4CTAB 2DRBA 5LM7E 1U1KA 1W2IA 3LALA 4ZJOA 1QVFR 5DLFA 4EK2A 4RW6A 2ZOFA 4PG4A 2DH9A 4YDXA 5T41A 4EZ6A 2CQHA 1YZ7A 1K0TA 3H7HB 5H9EK 1RWXB 3OHBA 1TKXB 2VU5A 4IOBA 4KFBB 2L41A 4MYTA 4ATNA 4AQYF 2E1AA 2VODA 3KOAA 4RLEA 4P52A 1VIXA 2HMIA 5B0EA 4LIWA 3GPAA 2QC3A 2FLOA 3ENWA 2YWKA 3EYZA 1SH2A 2CDQA 2DR7A 4CLPA 4ID8A 1YWXA 2AX1A 4GKJJ 4KJIA 2ZJQQ 2AEFA 2JLGA 4PPDA 2XQCA 4DCOB 1YJ7A 2QO3A 2IVYA 3H2UB 2XCPA 1N48A 3A8JA 4L72B 5J1EB 5LXRA 1CJVB 3G4SS 3GCXP 3AJ2A 4BLGA 3PTWA 1VRTB 2W24A 1EJ7L 3BGFA 4OZ0A 4ZP8A 3QRPA 1NPPA 1HR0J 3H20A 2FDNA 3CSKA 1HBOB 4QR2A 3PYGA 4DV2F 2DHSA 3OL8A 1FWLA 1S1WA 2OSRA 2A2DA 3FBCA 1UVKA 2RDJA 1I94F 4P74A 2RH3A 3IG1B 3ZTPA 2R4FA 3POTA 3NCRA 1SKRA 4K0KJ 3MFHA 2IM3A 3RW7A 1R31A 3CC7S 3JTNA 5LSRA 2OPQA 2V34A 4JI4F 1RT2B 4IG0B 3BS9A 1VFJA 4HHUA 2WW4A 4K4YA 4C6AA 4WP3A 2GVZA 2PC6A 3DRXA 1SQFA 1JMTA 4ZHRB 4F26A 4ELUA 3BB5A 4B3TF 1E6VB 4WZMA 1NH8A 2V4RA 1WG4A 2V2QA 3L7PA 4K2XA 4CH7A 3H8YA 4N8NA 3RU0A 4C48A 3EM1A 5KFIA 2BQRA 4LF5F 2HFNA 3K5MA 2D74B 4R25A 3QT7A 1R6YA 3K59A 2OPPA 5K5MA 2Y3YA 3ZXWA 1QE1B 2M5YA 4I1TA 3N01A 4FNIA 2OELA 3AOBA 1SH0A 1H74A 1Y00A 2ALZA 4PKDB 1GMWD 4ANDA 1FDBA 2XI2A 4Y2IA 3O44A 3FVYA 4ALZA 2BW2A 2XSFA 4ECXA 1WSVA 3PW0A 1SL2A 2WW8A 1VQ7S 1W25A 4YS2A 5KG6A 1P9QC 2HNZB 1YG0A 3G82B 3BQ0A 2ZDPA 2O67A 3D2WA 4JI1F 1MMDA 4DR5F 2Z2LA 2GVDB 1ZAXA 2XEXA 4M5IA 2G1DA 3WIUA 4O3RA 4RW9B 5F41A 2GQQA 1MROA 1JLGB 4DFJA 2DK2A 5DG9A 3MECA 3UN3A 3MD1A 4DL6A 3NNHA 5KT5A 2H5IB 2DD8S 5HMXA 1VMBA 4A47A 3T9ZA 4IYQA 3W5XA 5KG5A 4DQRA 1UWBB 4PR6A 1KR4A 1TUWA 4O3SA 2XLIA 1QAIA 4KBIA 3U1LA 3ONQA 3IWXA 1FTCA 2R7OA 4OV1A 4A8FA 5D4NA 2CNNB 3KK2B 2M52A 3MM6A 4DSJA 1JK9B 1PKUA 1YI2S 2KH9A 4NLGA 1OPZA 4L75A 3BM7A 4ZLNA 2DR8A 5IXUA 1JNZB 3HVAA 4B17A 1LXNA 1VQKS 1SJRA 1OY8A 4C97A 1GMUA 2JLEA 5H9FJ 3M30A 5KFWA 2V8GA 4RW8A 2HHXA 1FXLA 4QIFA 1W26A 3FEYB 3CD7A 3DOMA 1FJCA 5LMUJ 3OW2R 1TAUA 3LP1B 4LIRA 5EWFA 1QVGR 2Z2MA 4P73A 2DITA 2V8VA 1JLQA 2KZZA 4CLLA 3OL7A 4ZCMA 5D3GB 2H48B 5IT4A 1S1UA 4LFBF 4ZVQB 1Y3JA 4O3PA 3KHRA 4GVBA 1N6QB 2YVSA 1FDAA 1GH8A 2Z0GA 2VG6A 3T1AA 3BKUA 3HPOA 2DH7A 1NB7A 4J9LA 1M1HA 2JEGA 3H4BA 2YKNA 4MMOA 2P5VA 1SL1A 2MKIA 5T7LA 1AUSL 4UQGA 3BKFA 2KI2A 1JJ4A 2E9RX 1YJTA 4KAIA 3FRYA 2WK4A 1CJKB 1YLXA 2QX0A 1SL0A 4IFYA 3DM2B 3BN7A 2PT0A 2ZM6F 2Q43A 2V9KA 1K47A 3CTRA 4UF4A 4LSLB 1FE4A 2UV8A 1RWPB 2ZKUA 4L73A 4YP3A 2HHQA 1FK9B 2BVZA 2KT2A 1MU2A 2BR0A 3DOLB 4C0OC 4PAAA 2ZH8A 2QN6B 1SH3A 2HS3A 1ZOTA 4FXVA 2CJ9A 3M6VA 3T19A 3CXCR 5C24A 4LBIA 2MGZB 2AWZA 1WKLA 4NLXA 3BN4A 4JI5J 1C2PA 1RA7A 3HSZA 3P5BP 4EBCA 2V6AA 3U1MA 1FCAA 1OMSA 1WC1A 3TX8A 2ASJA 2I0XA 4P72A 6AT1B 1BD6A 3KUEA 4M5GA 4GC7A 3H90A 4X4VA 4IG3A 4Q8EA 3BEGB 4E0DA 1YVFA 4NI2A 4P2FA 1VC0A 4DV7J 2BANA 2QYCA 2K1RA 2YWFA 4DR3J 4ID5A 4FYDA 2J8SA 1SCJB 7FDRA 1R8CA 2MMYA 1P27B 2GJ2A 3NOGA 2UV8G 4B9SA 4WKYA 4C8ZA 1SJ3P 4TU7A 2E1CA 1URNA 1IKXB 3PR4A 5KG3A 4QZVB 3S01A 1PIEA 2JZ5A 1F3VA 4JUZA 4CRJA 2KM8B 2R2TA 4KGMA 4DR1J 3A4TA 4IH7A 5KFBA 5G0RB 3J7AN 4QR0A 2CJAA 2GHPA 3LGNA 3NGSA 1N36F 2MZ1A 4U8VA 4A8WA 4IFVA 4JP8A 1HNXF 1RT1A 3A13A 4WPAA 1IR0A 3EMTA 3MPWA 1FEHA 3CGIA 1T02A 3I0SA 3HO1A 2P9EA 4DV1F 3QO9A 2G0JA 5B0DA 2BYCA 2HRYA 2JRSA 2HZAA 2FD2A 3PYDA 4OLPA 4OYPA 3W60A 4ECSA 4MTPA 4DV6F 5KFQA 1R89A 2PEBA 4FF1A 2L9WA 3SQGB 4DUYF 4DCPB 4ED3A 1TVRA 5GADI 4TYAA 2IYIA 1T9YA 2XMKA 1O6XA 4HTIA 2GFFA 4DR2J 2OPSB 5HROB 3EVWA 2DNQA 1PJ6A 2CJXB 2OD4A 1NRKA 8RUCA 3T3FA 1GK8A 1RBOB 3GIKA 1RADB 3ILLA 3M4XA 4X65J 1OYDA 1AUDA 2G0IA 2OEMA 2WSCC 3L3CA 4WU3A 5HLFB 3DMJA 4PUOA 4Y2MA 1QAJA 4Q8FA 2OAUA 1KP6A 2WAQD 3OFGA 4UOGA 1VQSA 1WTFA 3CMQA 4G1QA 1ZYQA 1FTRA 1CULB 1M5PC 2J7WA 2NZ4A 3HF5A 4FYWB 4KO0A 3BSAA 4OYAA 1EAYC 2Z30B 2J6UA 4F3QA 4JV5J 2HHPA 1S0NA 2QLXA 4U96A 2Y8YA 1V5IB 2H9ZA 5AXLA 2P6SA 1BLUA
chains in the Genus database with same CATH topology
4LFAF 2FJEB 3DXSX 4KHMA 5KFNA 1GNKA 1U7LA 5F0UA 1HBNB 1NK8A 4LF4F 5CHCB 3V6JA 1BY9A 4TY9A 1HQUB 3J7YI 4QWBA 4IQMA 4LVOP 4OX6A 3MFIA 3TO8A 2R7QA 2XC9A 3HHLD 4N8OA 3AAWB 4EBEA 3D0GE 2HRUA 5EX3A 1T05B 1VLYA 2IRXA 2RD5C 2IMWP 5I3UB 2EG1A 2Q6CA 3HKWA 2A10A 2OP5A 2MZQA 2W9AA 1D9FA 3BDPA 1HWJA 2EFOA 1S1VA 2IC3A 1NJXA 4JI7F 2GX8A 3CCQS 5L9NA 2NUHA 4ETZA 1REVB 3ZZUA 2ZNZA 3CDUA 2M8HA 1UW4A 5E3PA 5K9FA 4HVZA 4NLQA 1MW7A 4HT5A 3DMJB 4RBTA 1B0PA 5LMNF 3PRDA 3I5BA 2PEHA 2UUBF 4NL5A 5EGYA 3H98A 3BGRB 1X4HA 2KFZA 4TQSA 5KOWA 3P49B 2AP6A 2XY6A 4LT6A 3TAPA 4EGLA 4WK3A 1FESA 1VQYA 1W2BR 1Q86T 1N4LA 1JJHA 4J9RA 5KFKA 4B3MF 3KKFA 1OSDA 1P6TA 1HPZA 2HLUA 3BZQA 5KFOA 1QAXA 1GTHA 1BQXA 1OPIA 4KT0C 4G1QB 4WXOA 1S9EB 2B9WA 2AYMA 1VRUA 1RYRA 1U09A 1Z1ZA 4C8NA 2PA8D 1I6JA 1AFJA 5A8WB 1Z2ZA 3TAQA 1JLBA 2L08A 3I96A 4JBCA 2OMOA 1S48A 1OQ6A 3CJ2A 3PIOQ 1WF0A 3LP1A 3JSBA 4X4RA 2EK1A 3CF5Q 3S6EA 4WK1A 4MK9A 1MMLA 4KO0B 5FJ4A 2KJWA 2BV3A 1LOUA 3M1VB 2VH7A 1VBZA 3OTOF 3NCPA 5IM0A 3RAQA 1HD1A 3VAFA 4RWXA 2BDPA 1R8PA 2K7JA 3IR7B 3H4DA 4NCGA 1DLOB 3BF4A 3UCGA 2OD6A 1R7IA 4AUKA 3GQCA 1YITS 3NNAA 3MM9B 3BREA 3GR1A 3HZGA 3N6MA 2IA0A 4H4KC 5K8OA 1DJ0A 4QOTA 5L8RC 2LEBA 3MEEA 4OZLA 5KG2A 2A18A 3HFKA 3DLKB 2WONA 2YKMA 4NLPA 5FIIA 1KC8T 5D3GA 2Q3PA 3T5KA 2AYEA 1YJ9S 4A4JA 3N6LA 3FMWA 1QSSA 2OFGX 2PI4A 2RS2A 3LP2A 1HL6A 4Q43A 1FDNA 5DM7Q 3DRYA 1S1TA 4DHVA 3ULHA 1DHMA 2C3UA 1LWEA 4A8MP 2DRAA 2HGNA 3MZIA 3N28A 4U7UK 4N47A 4CNZA 1N6QA 5IQQA 3HHKA 3K5OA 3N4WA 2EBEA 2I1RA 1JLAB 4DBQA 4YHHF 2ZFHA 2COLA 4ILLA 3BGUA 4PG8A 3U02A 3PVXA 4QW9A 4BC9A 1UJ5A 4JOUA 3T5HA 1OIAA 3VZIA 2QLWA 1KSPA 5KFYA 1S1VB 2IC3B 3K7RA 2V94A 1DRZA 3ZZ0A 3RZAA 4OI1A 3FRZA 1HFEL 2VPWB 1Y9OA 3M8SA 4K50A 1NJYA 1N0UA 3M6XA 4KIAA 2ACYA 5E3RA 3R5AA 1JX4A 4I2QA 1X0PA 2GCFA 5DLGA 4NLVA 5DETA 4RWWA 1FNMA 2ASLA 2DGSA 4ED7A 2ZNYA 4C8YA 1B64A 2FHKA 4I67A 1KQSR 5F9LA 1KS2A 5DJBA 4NWBA 4ZPTR 4YR2A 2YWEA 3MM5A 2KFNA 3N5BA 3V6DA 3C3LA 2ROEA 2LU1A 1HW9A 3NGKA 4G1PA 3A1YG 3VZHA 3P5TL 2IFXA 4CO3A 3SI8A 1RK8A 2QMXA 3LGMA 2DB1A 1U6BA 3HHDA 2DVIA 2VPXB 4O3OA 5KFUA 3KHGA 1VRUB 1VQMS 3GMGA 4U7CA 1KTQA 3WZ0A 4ZVEA 2K7KA 1XWLA 1SKWA 3O3LA 3H5SA 2JC1A 5SUHA 2IAJB 1JLBB 2YNFA 1IXKA 2CQ0A 4NZ0A 5F3TA 5KG7A 2V4QA 2RUGA 2VC0A 4NA1A 5AE2A 3MGJA 4WYLA 5LXYA 1OQ3A 2Q79A 3OJSA 2OH2A 4DLGA 1WF2A 1FK9A 2U2FA 2L3MA 5IM0B 3OTCA 4M94A 4F4KA 1KN6A 3KFWX 3AB4B 2HHTA 3NP5A 2YY3A 4K5RA 1KQFB 4DSIA 3DOLA 1Q79A 2GHVC 2IHR1 3MXHP 1RTJA 2L9DA 3NG8A 5KFRA 3SSSA 4IO9Q 4USIA 1ZZFA 2EFQA 3KNAA 3LO3A 5E3AA 1WHXA 2WONB 3CJ5A 2X1AA 2XMUA 4OJHA 5BR8F 2KHDA 4KHRA 1ZM3A 4FS2A 1TK5A 2KYXA 1S77D 3LP2B 3QLHA 1LW2A 1IJEB 3DU5A 4K4SA 4UUWA 1LWEB 3X1LB 2CQ2A 4F3MA 2NUUG 3GILA 4KC5A 1LQ9A 4OZJA 3M8PB 2FB0A 2J0QD 1LFPA 1YJRA 4D3HA 4J9MA 5BYSA 2LXUA 4IR1A 2KU7A 2MDAA 1RKJA 2FHJD 2F8MA 3RYLA 1KEKA 4AL7A 2X1FA 1HBUA 2N4DA 2KXNB 2ZOMA 2HHWA 2HAIA 4NLTA 3UCUP 4YDDB 4I56A 5B0BA 2K8GA 1L3KA 3SSRA 1Y5NB 1VQ9S 2B4VA 2N7YA 1GAOA 5EN1A 2JEIA 2HIQA 2UUAF 1KVIA 1SC6A 3IS9A 3G71S 4Q5VA 1N5QA 1VHFA 3AB2B 4I2QB 4M63A 3CJ4A 3DFEA 4X62F 3I32A 4TNOA 1CQNA 3LAMA 1U4BA 1YTYA 3E01B 2VC1A 3I5CA 3PFOA 5D8HB 4DDFA 5E7OB 4UY8T 1LWCA 5DG8A 2HWTA 4DFMA 3K0JA 4DX8H 2M0GB 3QPIA 2AJ1A 2FJVA 1FXDA 3AA9A 2VOOA 2BABA 1FD8A 4EEYA 4KV8A 3KK3B 2BQ3A 3HMJG 3QJPA 5LSLA 4KQZA 4OHZA 1X9SA 4C3KA 4NMLA 3BJYA 1N5VA 5KFZA 4A48A 4Q45A 2FVPA 1TKTA 4C98A 4DL7A 3D1QA 1J5OA 1ZM2A 1VK3A 1XEZA 2EVZA 4NRTA 1K0VA 3MEGB 3PJXA 2DNHA 4PG5A 5T14A 1K9MT 4LF8F 1JKHA 4PQAA 5GADU 2W8KA 1YBAA 3G86A 2U1AA 3CJKA 2ZVSA 4K4ZA 3OXGA 4NYOA 2UVRA 2W7PA 2CQGA 4MKBA 4AL6A 1C1CA 4DF8A 4DUZF 3Q2TC 3D0IE 3MTJA 1NHUA 4Z2XA 1Q82T 3MM8A 5DDRC 4EO8A 1KONA 3U7JA 1DTTB 1F5AA 3GIMA 4ED2A 4OJ1A 4U67Q 4J9QA 1YJUA 4OL8A 1RQ0A 1UL3A 4PPZA 4QIWD 1Y0HA 4Y00A 1QM9A 4QQBA 3C46A 5J2QA 5CZXA 2ZKTA 5CYMA 2WB4A 3UR0A 4C8OA 1N88A 3TOQA 4ECZA 4H4OA 3KNGA 2ZHBA 3BO4A 3QLHB 2YWGA 4OHXA 1YGYA 4YB1P 1OS5A 4ZP9A 2MKSA 2HHVA 3QIDA 3Q8RB 1TL3B 4OX7A 1EP4A 3PX4A 2VPYB 4NPOA 3PXGa 2OTJS 3FDSA 2LXFA 4QPXA 2VKZG 3ETOA 3M6WA 2D9PA 2BUNA 5KG1A 4UW2A 3M2UB 5F8MA 1S9GA 1O51A 2N82B 2MHNA 1NKCA 4J9OA 2OMLA 3H2LA 3G6YA 1HBUB 4M1KA 2XGPA 3EPGA 1UKUA 2XY5A 3TA2A 4HHJA 1N34F 2MQNA 4DR4F 3DXBA 2EW9A 2D3OR 4N41A 2AQ4A 2J8AA 1VIOA 5HO4A 3TAMB 2XSJA 1HNVA 2O01C 2MZJA 2VG7A 4ZPDA 1SV5A 3KG0A 5I3PA 3TR5A 2M70A 2MQOA 1U8SA 4J9SA 3RR8A 2B7BB 3GIJA 2R8JA 2XS2A 2J0SD 3QWUA 2UUWA 4ECRA 2BJDA 2M88A 5C42A 3CE8A 4I0WA 3R1LA 4F4XA 3CCWA 3MF5A 2N3LA 3M8RA 4KPYA 3MEDA 2OO4A 2LCWA 3OQ2A 3QAUA 1U24A 1LWCB 1RTIA 2BJEA 3O5TB 2X51A 3O1LA 2R9LA 1CVJA 3HJFA 1IQTA 1APSA 1U1PA 4DS4A 1XR7A 2KDOA 2YX7A 1VC5A 4FBUA 3MOZA 1H98A 3VWSA 1SXLA 3HDSA 3Q22A 2XY7A 4F2SA 4KV8B 3M9NB 1QTMA 5CCMA 1JLEB 4RUAA 3R1HA 4V19J 3X3UA 2E5HA 4DL3A 2V2KA 2KO1A 4O44A 3DRSA 4BBYA 2UXBF 4EU0A 5F8NA 2DT9A 1X4DA 1K8AT 3V5RA 4HDHA 1J5OB 3ISZA 5FLXY 3MPVA 2CPXA 5GAHU 2FJDB 5HMWA 3IC1A 5HMYA 4HI1A 3IA0A 1T03A 4RU2A 4X4PA 4YR3A 4EYHB 4Q44A 2UUCF 3CJKB 4XDCA 1T95A 4NLYA 5L1LA 1NK6A 1FF2A 3CWJA 4LQ9A 4TY8A 3D5MA 2FVCA 5I3QA 3HLUA 2CQBA 5HROA 1NK5A 3J7YU 1SQEA 3I82A 5KTQA 3C6TA 2B6AA 1ZTWA 1R0AB 2F40A 3SEOA 3U1NA 3PR5B 2KZMA 2G9OA 2CQDA 1S9FA 2W4CA 1T7PA 4ZCKA 4E98A 3FSIA 2XHWA 4URSA 5CYMB 5B0CA 4H4MA 3DHWC 1ZAWA 3LQVA 3DCAA 3K5PA 4ZP7A 1LW0B 4IH5A 2BRKA 3GWCA 1FRXA 4NZ6A 4A8KA 2HW3A 2ZOGA 2IM1A 2QMWA 1P8GA 3CCRS 2L9NA 2JX2A 1EP4B 2N7CA 2LVWA 3SSQA 2QRRA 4ICLA 2DH8A 2LXIA 3NS6A 2PMZD 2B5JB 4CQ1A 2NLWA 3PV8A 1Z2LA 2Z4PA 1D8YA 1S9GB 2APOA 5AXNA 2J7UA 3MURP 4F2RA 4FXWA 4ECWA 4IOAQ 4IO1A 3WC0A 4X4TA 3OUYA 3I56S 1ELOA 1Q8IA 4ITSA 4OQJA 5K14A 5EUHA 1GX5A 1QJHA 4JYAF 2NS1B 2RS8A 4TN2A 2QSFA 1KOHA 2PI5A 2KTQA 5IT9Y 4WF9Q 5CH7B 1GQEA 4F67A 5H9EJ 1X4AA 3GYXB 5F9NA 4OI0A 4TLRA 1HMVB 4UOCA 2E66A 2AU0A 2VOPA 5KAKA 3UD3P 5LJ3Y 3LOUA 5THWA 2UP1A 4O4RA 4F3OA 5D4PA 2AGOA 4IOCQ 2OLWA 5KFHA 1N5TA 2JDJA 4HL9A 1YJWS 2GMHA 2KXFA 1YJVA 3NAHA 2I38A 3SFGA 4FS1A 2E7XA 2HWIA 5C42B 5EWEA 1U1OA 3I9ZA 3C2PA 4YOEA 3C8YA 3CDAA 2KFYA 2ERRA 2UVWA 1Q7LB 3MEDB 2V9WA 4B3SF 2FVQA 2XBPA 1XNRF 1RTIB 4RBUA 2MQQA 1VI7A 1HI1A 3NLCA 5CYQB 1GX6A 3HK2A 2CJKA 5JVHQ 2G13A 2VQEF 4GO7X 3CCLS 5B0GA 4ZMMA 3SCIE 1U47A 3B8HA 3PX6A 1DTQA 3SZ2A 2FJWA 1A7GE 3Q8SB 3MEKA 1SIZA 3I87A 2I9SA 3VAJA 4X84A 3UE2A 2VPZB 4O44B 3DRSB 4FPRA 4ZOSA 2C2RA 4USHA 2C2DA 5GAEI 2G4BA 1RT3A 1M5OC 1ZH5A 2PMHA 2RE1A 5DDQC 1G1XA 3MR6A 4CI0B 2XNRA 1LFWA 1N54B 2YKQA 1FJEB 2MY7A 3T1HF 1G2EA 1T03B 2NREA 2AJQA 2H5EA 2ADCA 3KLVA 4NYZA 4TU8A 4Q2LA 2LQJA 5KT6A 2KM8C 2IM0A 2D7SA 1DZ5A 1XERA 4TY8B 3RRHA 1D9AA 2B7CB 2RNEA 3T6BA 3OV7A 4J9PA 4FF3A 2DGWA 2KHCA 5F0WA 1BGXT 2J9DA 2HVHA 3KG4A 3C6TB 3ICLA 2B6AB 4NLOA 2PD1A 5I3UA 2CQIA 1K1QA 1ZETA 4P6QA 4I64A 4BC7A 4DOZA 2QT7A 2XGQA 2YH0A 1UVMA 4C3MA 2XMMA 1J5EF 3W3SA 4H4MB 3FFIA 3IO1A 2KXHA 1SIWB 2R7XA 5L1KA 2FTRA 2O5DA 2POKA 3QYYA 1REVA 1T3NA 1IKYB 2I5JB 3G6XA 1FHTA 5DGBA 2O1PA 4I6AA 3H25A 2YH1A 2YX4A 1EETB 1RISA 4ICLB 1S0VA 4X64F 1Q53A 3BSOA 3RBDA 2DPJA 1DQAA 3BGRA 2ZE2A 4JI3F 4B9MA 3OUYB 3K5LA 2K3IA 3RRKA 2FPHX 4ZLPA 3FQLA 4HYKA 3G9CA 1VJWA 1F2GA 4BCAA 4PXCA 4DSLA 3F44A 2MQLA 2DHAA 1G7CB 5F8GA 1KFDA 1VQOS 4B9UA 2HS0A 4TQRA 2AGQA 3D1OA 1R8BA 3VCDA 3PKYA 3CC2S 1UEVA 3I9V9 2BRLA 1UAWA 3LW5C 1NK7A 1TR0A 3SDEA 3W2WA 2CVIA 1V6HA 3HI9A 3OBIA 4CNYA 4BS2A 4PWDB 1B7FA 1RT4A 4AFFA 5KFXA 1S10A 1U1RA 1FDDA 5FD1A 3ZZZA 4F4YA 2UU9F 4LFCF 4DR7F 4FP9A 4YB5A 2IRYA 2RF2A 2ZJPQ 3EGZA 2FJBB 4Y2AA 4QWAA 1WF1A 1AW0A 1DTQB 2DNRA 1XN9A 3MM9A 2KYZA 2HHSA 4DV3F 3I4HX 3PKMA 4NRUA 2YNHA 1SJQA 4R5PA 2Y1IA 2XMVA 1NAQA 1X4EA 2BZ2A 3CMES 2JOQA 5KFFA 2KRRA 3ITHA 4F4ZA 4X2BA 4WTYA 3MAHA 3UNGC 3SYZA 1RT3B 2DHXA 1VQ5S 3E8OA 4QU7A 3M9OB 1NK0A 4DWIA 1WWHA 2R7VA 1LK7A 1T3OA 3KLHA 4CO1A 4ZVFA 3WBZA 4DQQA 4MIWA 5HL7Q 4EBDA 2UVVA 1LXJA 6FDRA 1NU4A 5A6WA 1VQ8S 5C25A 2OSQA 4L6V3 2IJNA 2UXDF 3KMSA 3BQ1A 2UXCF 2CZ4A 1JLAA 4NX9A 5EWGA 2DNGA 2CPYA 4ED5A 4Q2MA 3OL9A 2EFPA 1WG5A 3WX4A 1M5KC 2P6TA 3DLLQ 3PACA 2VFRA 3SCLE 2B9XA 3MOJB 1UA1A 3FFIB 2ZBCA 1Q1KA 3DLJA 2LKZA 5KFSA 2B3TB 1SJ4P 4FNHA 2HHHF 3TA0A 2UZAA 3CCZA 3T1YF 2ZJRQ 2D1CA 2MHEA 2C28A 2EFNA 4O23A 1F60B 2DGUA 3MR3A 2GQCA 2VFVA 2V8DA 2ABYA 3CPWR 5L9XA 2FHMA 1TUVA 5KFVA 1L5UA 1TKDA 4JI0F 4AXJA 1OWXA 2ZE2B 2DGVA 4X4SA 1FE0A 2DNMA 1RT5A 5KT2A 1X5TA 4IUFA 4LQ3A 4B9LA 1RDRA 3DLEB 2MYFA 5M2PA 2VL1A 3TW0A 2PFFB 2RRBA 3GFYA 2GNKA 3N5FA 1CQMA 2MJNA 3SV4A 2WCXA 3QIPB 3UFCX 1X4GA 2E44A 2RVJA 1TL4A 3CIZA 1R8HA 2IAJA 3SDEB 2B4OA 3W2WB 5I42A 1S79A 1GTEA 2GHWA 2NPIA 6FD1A 3DN9A 3PEHA 1HA1A 2J6TA 2JH3A 1RT4B 2IJFA 4B02A 5KFCA 2R2RA 2YNGB 5LSOA 1NNDA 3RR7A 4BHQA 1PSDA<