1M5PC

Transition state stabilization by a catalytic rna
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
92
structure length
92
Chain Sequence
TRPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Transition state stabilization by a catalytic RNA
pubmed doi rcsb
source organism Homo sapiens
molecule tags Translation/rna
molecule keywords RNA INHIBITOR SUBSTRATE
total genus 23
structure length 92
sequence length 92
chains with identical sequence F
ec nomenclature
pdb deposition date 2002-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1m5pC00
2AYMA 4IOAQ 2DNYA 1VQKS 2M0GB 1FO1A 3CCJS 1VQ6S 4Y00A 3THTA 2DHSA 4UQTA 3J7YU 4LJMA 3MD3A 1N52B 3U1MA 1U1MA 1QVFR 2MKJA 5IFMA 3VAMA 3CCES 2X1FA 2N82B 2BZ2A 2DGWA 3MUMP 2LEBA 1A7GE 4C7QA 2KT5A 2QFJA 3I56S 1ZZNA 2DH7A 2X1BA 3NNCA 2U2FA 2FC8A 4U67Q 2DNZA 1OWXA 4WFNQ 2F9JA 2KHCA 2G4BA 2U1AA 3CMAS 2FHOB 2EK6A 2LXIA 1HL6A 2DK2A 3SXLA 2MZTA 3MD1A 2DNKA 3S6EA 3NS6A 4WIIA 2CPEA 1U1LA 3S01A 1M5OC 5LJ3Y 1X4BA 2RUGA 3EGNA 3HI9A 4TU7A 3G9CA 5GVQA 5LXRA 2KRBA 1QM9A 1FJ7A 2ZJRQ 3UWTA 2MKHA 5DM6Q 4RU2A 2DIVA 2CQCA 3UD3P 2J8AA 2CQHA 2VOPA 1OIAA 4WF9Q 3BO2A 2OJ3A 1YTYA 1VBYA 3G6ES 1ZZFA 1U1RA 1WG1A 2RNEA 1N54B 3G8SA 2L41A 5IM0A 3VAKA 2VOOA 3S7RA 3LPYA 1NJIT 2MGZB 4ERDA 4W90B 2M9KA 2M88A 1U1NA 4LIRA 2DGXA 2E5HA 1VQ8S 4WCEQ 3JB9k 3CCUS 2DGVA 5LSOA 3P49B 1HD1A 2E5GA 1X4AA 2DISA 1WHXA 5HL7Q 2FC9A 2OTLS 2RS8A 2CQBA 3CCLS 2KFYA 2KVIA 2KI2A 4C4WA 2RU3A 1B7FA 5DETA 2XB2D 3IWNC 3RW6A 4P6QA 1HA1A 3VAFA 2LQ5A 3NNAA 4QU7A 1R8HA 1WG5A 2DO0A 1DBDA 2K8GA 1X4DA 2MSTA 2YH1A 2K3KA 4IO9Q 3UCZP 2DNRA 2O3DA 1JJ4A 1X4EA 1F9FA 2MZRA 3CTRA 2CPDA 5GAGU 2MKKA 4YB1P 2KXNB 2KM8B 1Q86T 2XS5A 1M90T 1RKJA 2ADCA 1VQ7S 2CPZA 1YHQS 2OTJS 1VQOS 2LA4A 2DHGA 2KXFA 1JMTA 1PO6A 2YKAA 3UD4P 2DNLA 1YITS 1WF2A 2A3JA 1U6FA 1M5VC 3B4DA 5FJ4A 2CPHA 4CQ1A 2XSFA 2MZQA 3LQVA 3VAIA 1YJ9S 3PIPQ 5BJRA 3CCRS 3V4MA 2JX2A 2JVOA 1WF0A 1PGZA 5DDOC 2MJUA 2MXYA 1SJ3P 2CQGA 1XN9A 1HD0A 2MQLA 1FJEB 2HYIB 3BEGB 1SJQA 3CPWR 1WG4A 3BS9A 4UY8T 2KN4A 1Q81T 1VQ4S 2N7CA 1O0PA 1P1TA 2VODA 3I55S 1VBZA 1IQTA 1H6KX 2MZJA 3TYTA 2L9WA 4WFBQ 3ZZZA 2DNGA 2XS7A 3CF5Q 3VAHA 1AUDA 1DZ5A 2RT3A 2MB0B 3DLLQ 3MXHP 2GHPA 4TU8A 1WELA 5DDQC 4CH1A 3NMRA 2CQDA 2MQMA 1W2BR 3U1LA 4CH0S 1DHMA 4F25A 3NNHA 1WTBA 2M52A 2CQ4A 2MQPA 1VC0A 3MUTP 3MOJB 3G71S 4OZ1A 2LYVA 3IRWP 1Q7YT 2NZ4A 2YH0A 2LA6A 2LCWA 3CXCR 2DNNA 2RQ4A 1L3KA 5LJ5Y 3H2UB 3BO4A 1VQMS 1X4FA 2HGLA 2G1DA 2CQ1A 3D2WA 2JWNA 3MURP 1KD1T 1YJNS 2BOPA 1WI6A 2HZCA 2MQQA 3K0JA 1WF1A 1WWHA 2DNMA 5JVGQ 2I2YA 5LSLA 2DO4A 2N3OA 1A9NB 1N8RT 2UP1A 3THPA 1X5TA 2KG1A 3CC4S 2EVZA 1VQPS 2KYXA 2E5JA 2MY7A 2ADBA 3L3CA 5HO4A 1NU4A 2ZJQQ 3VAGA 1FNXH 1FJCA 2MKSA 5DDPC 1X5OA 3PIOQ 1YWXA 1X5PA 2DNQA 2MSSA 1VC5A 5D78A 2HGMA 1YI2S 2MPUA 5GMKa 3R27A 4FXVA 1SXLA 2DNOA 5CYJA 3G96A 4EGLA 2KM8C 2DH8A 2YTCA 3CCVS 1OPIA 5ITHA 1U1QA 1RK8A 2X1GA 2QEXS 1K73T 4J5OA 1D9AA 2RRBA 1WEYA 1U6BA 2D9OA 4OZ0A 4QQBA 4YUDA 2XNRA 4W92B 2LMIA 1D8ZA 5IM0B 4ZKAA 2DGQA 2RS2A 2MYFA 2MY8A 3P3DA 3FEXB 2AD9A 3CC7S 5CA5A 4PR6A 3FEYB 3UE2A 2MZSA 1WEZA 2CPJA 1S72S 1UFWA 2CQPA 1X4HA 1JJHA 2KG0A 2AYGA 4QU6A 5DM7Q 5D77A 2DGSA 2WBRA 3Q2SC 3CUNA 2MMYA 2OSQA 1FT8A 1N88A 3EGZA 1FHTA 2DGTA 2HVZA 3EX7B 5JVHQ 3CMES 1H2TZ 5CXTA 1VQ5S 2RQCA 4IUFA 4CIOA 3P5TL 2DHXA 3MUVP 2D9PA 2J0SD 1M1KT 3J7ZT 1Q82T 3MI7X 1JJ2R 3P6YC 1BY9A 1X5SA 1VQ9S 2L08A 5H1SV 2CQIA 3RW7A 1M5PC 1SJFA 2G0CA 2J76E 2ERRA 2CQ3A 2DGOA 2M4MA 3SDEB 2F3JA 1U1OA 2YWKA 2MKCA 4TLQA 2CQ2A 3MDFA 2E44A 2MGZA 3CULA 1CVJA 3R1LA 1KC8T 4IOCQ 5DDRC 2SXLA 2FY1A 2MQOA 2M8DB 1WHWA 4F26A 1YJWS 4A8XA 2D3OR 2MQNA 3SMZA 2V94A 3VAJA 1M5KC 2VONA 2RRAA 4PRFA 1KOOA 1YIJS 1VQNS 2DH9A 4WKRA 1UAWA 3N9UC 4TU9A 1UP1A 3HHNB 3H2VE 3TO8A 3CC2S 2OSRA 3G8TA 2ZJPQ 1WEXA 1U1KA 1FXLA 3VALA 2NLWA 3ZZYA 2DIUA 3CCMS 2KRRA 1OO0B 2XNQA 3TP2A 2XS2A 2JVRA 3NS5A 3VF0B 2DITA 3S8SA 2M7SA 2LXUA 2Q79A 1VQLS 2M70A 5LXYA 2GO9A 2LEAA 4ED5A 2HGNA 2CPYA 3CCSS 2B0GA 2CQ0A 2CPXA 2LECA 1WHYA 2I38A 2RVJA 3R1HA 1SJRA 2FPHX 3Q2TC 2DHAA 1KOHA 2OIHA 2QA4S 1VBXA 3B4MA 3CCQS 1URNA 1S79A 2DB1A 1SJ4P 2DNHA 2X1AA 3SDEA 1KQSR 2AYEA 4F02A 4M5DB 4Y0FA 2KU7A 4FXWA 1WHVA 1DRZA 2J0QD 2MJNA 3G4SS 4BS2A 2N3LA 2MZ1A 3CD6S 4Z2XA 1U2FA 5GADU 1P27B 4PKDB 4WFAQ 1VC6A 1WI8A 3OW2R 2M2BA 1QVGR 4QPTA 1K9MT 3DXBA 3UCGA 2F9DA 5GAHU 1R8PA 2CJKA 2MKIA 4YOEA 2DGUA 2KH9A 4LMZA 2PEHA 3UCUP 1UW4A 2PE8A 1U1PA 3BO3A 2CPFA 2LKZA 1G2EA 5EN1A 2MHNA 1X4CA 5GAEU 2KXHA 1NO8A 1X4GA 5MLCV 4V19X 3US5A 1K8AT 2JRSA 3ULHA 2E5IA 1X0FA 1ZH5A 5IQQA 2AYBA 2M8HA 1H2UX 1H2VZ 4C0OC 2EK1A 2CPIA 2DNPA
chains in the Genus database with same CATH superfamily
4IOAQ 1NKBA 3BSAA 2I1RA 2OPQA 3BN7A 1NPKA 3LP2A 3ZNJ1 4UTGA 1KFSA 3BDPA 2F7VA 5KT6A 2CJAA 3MAHA 1FO1A 3HSJA 3IM8A 4Y00A 1V3ZA 1XR7A 2GIFA 3ILLA 3GPAA 2BE2B 3CDEA 3TA1A 4USVA 4CYUB 3WC0A 2J9DE 1PJ7A 2ZBPA 2R7QA 2EBEA 1N52B 3D28A 3IS9A 2OKQA 3VZHA 2IBOA 1F5BA 1RTHA 2JH3A 3N5BA 1QVFR 3ITHB 3GR0A 3IFEA 2MKJA 3GFXA 4DPYA 1KDNA 3AOBA 1N36J 2L3MA 3UR0A 3BSNA 4ILMA 2G1HA 2NPFA 3R2CJ 1HWJA 2IPOB 4DR7F 2CJXB 2PMZD 1S76D 2VQFF 1FKPB 2IDLA 1A7GE 4I1TA 4AL7A 4C7QA 2KT5A 1REGX 4CTAB 4DL2A 2XY5A 1TKDA 1AXQA 2DH7A 1YKWA 2VA2A 3NNCA 3PW0A 1M1GA 3K2YA 2FC8A 4I56A 1MMDA 1YJTA 4QR2A 3MAAB 3QBCA 3GONA 3TEHB 3TVYA 3WX4A 2HZVA 4Q2MA 2Y0BB 1EKSA 1RAFB 2OMLA 2UU9F 2BKPA 1C1CB 3A3NB 3W60A 3K58A 9ATCB 4B3TJ 4RW4B 3J81j 4RO0A 1G4CA 2F4FA 1XJWB 1HLWA 2FJDB 1FTRA 2HWIA 2MZTA 5L1LA 2GVDB 2DNKA 3E8OA 4MYTA 4J7CA 3S6EA 3HO1A 4WZMA 4BWMA 3OLBA 4YB5A 1CLFA 3ENAA 2VKZG 4PXCA 4LT6A 4DSKA 4NE9C 1HMVA 3PRBA 4Y2CA 1LWXA 2WBMA 3I0RB 2IM1A 3W5XA 1KVIA 3T9ZA 1VQYA 3D5MA 2AEJA 3K5LA 2B9XA 2BW7A 3TZZA 1VISA 1RDRA 2W9CB 2VJUA 1RKIA 2H1YA 1IR0A 5LOQA 3CD7A 4OL8A 1R8AA 1SQGA 2KFZA 5H9FK 1FJ7A 4C11A 1G6BA 2K1RB 2Z2YB 2BOAA 3QGGA 4IG3A 4ZVSB 3UDCA 4DR1F 4DL7A 5SZTA 1N48A 4TXSA 3LP1B 1T9UA 2J0XA 3PYFA 1LFPA 3KLIA 2VOPA 1EQMA 1YGYA 3DRPA 4WF9Q 3MFHA 3FMWA 4I7FA 3BO2A 1YTYA 5C25A 1U1RA 4DU7A 1WORA 3B54A 3C8YA 4Y65A 3OSNA 1SKWA 2V5HG 4DMZA 3KLGA 3N79A 2HHSA 1FRKA 2EFPA 2WVCA 1YVFA 4M8LA 1B0PA 1UJ4A 2W2NP 2L41A 4NEZA 3G6XA 4DOZA 4B9LA 2K3IA 3RJMB 2NCKL 2AQ4A 4LR8A 1C1BB 3D66A 3S7RA 4QWDA 3H40A 2UVRA 4PUOA 1BWEA 2OFHX 7FD1A 3QGPA 3SSSA 3DRYA 2F4VF 4W90B 1TUGB 3GIRA 5AE2A 3MCSA 4NA2A 2UXCJ 4QBUA 2RH3A 2DEJA 4KGVB 4OZNA 2IM0A 2IRUA 3C46A 4FS2A 1EKRA 4KAIA 2COLA 4WFYA 2R2UA 1ACMB 3BYRA 4ECTA 3QJPA 1HPZA 4RUCA 4AT1B 2J7WA 3DDIA 1FKAF 1TR0A 3DRXA 2JEIA 4K4UA 3W2WA 3CCUS 5DRKA 5B0DA 3H25A 2HG4A 3Q8YA 4E98A 4F36A 5LSOA 4Q8FA 2QYCA 2DISA 3P49B 1KTVA 2FC9A 2ZH1A 1KQFB 2CQBA 1U8SA 1LW2B 2GVZB 4PABA 1VLYA 3MEKA 2KFYA 5KFZA 4ZLJA 4N77A 2LQ8A 1F5CA 1UKUA 4M63A 1PSDA 1B7FA 1PC5A 5DETA 3IWNC 2PA8D 3J80U 1QSSA 2GJFA 1KP6A 4HL9A 4P6QA 3KOAA 2LQ5A 2B51A 1T02A 1CULA 3H8YA 3UNGC 4I2PB 3F56A 1LWFB 3HFZB 1F2HA 3KLEB 3AOCA 1GNKA 4OHVA 4B9NA 3O44A 2QLBB 2PD1A 1NUEA 3DCAA 3UD5A 5IXUA 2YH1A 1SC4B 2HFZA 1W7WA 3WDOA 4WK3A 1N34J 1QE1A 1EJ7L 1I3OB 4HT5A 4P2XA 1WACA 2O3DA 2KL8A 3VZIA 3D4JA 4NA1A 4KHPF 4JOUA 5LSRA 3C16A 1X9MA 2HPUA 1HNXJ 2JHEA 2BBEA 2FJAB 2WOMB 3GWCA 4RWXA 2MKKA 4YB1P 2E9TA 1SKRA 3IR5B 1MU2B 5AJ3F 3H4DA 1VQ7S 4JV1A 2OTJS 1MWYA 1VQOS 1FDBA 4NEYA 3UN5A 2LU1A 3CCZA 5LMUJ 2QZ8A 1PO6A 5E3PA 2YNHB 4ZHRB 2HHQA 2DNLA 1YITS 4ID5A 2XSJB 2XC9A 4X64J 2UUAF 1U6FA 4C0BA 4CNYA 3PV8A 1HNIA 4NLWA 1CS4A 1H74A 2W24A 4RBVA 4USKA 3Q0AA 2Y1LB 5C42B 1YZ7A 4HT7A 3I5CA 2WSCC 4CLPA 3HDSA 1RWUA 1EARA 1BWVA 4P2SA 2AW0A 1DAXA 2AZ3A 2OFGX 4KO0A 3HKZD 5IC4B 1FEEA 4OI4A 4U96A 3JSRA 4WP3A 4DL5A 1SJ3P 4QWCA 2VPXB 4PQUA 3M2UA 5ETTA 4J9RA 3V6KA 3TUJC 3QRPA 4A8KA 3R8YA 1CJTA 1S12A 4RW7A 5AE3A 5D4LA 3CPWR 5L1IA 1SQFA 1N36F 1CPZA 1RT1B 4E0DA 4Y2AA 2VASA 3OHBA 1Y4ZB 1FNOA 3JQMA 3KNAA 4KV8B 2B7CB 4IG3B 1YQHA 2N7CA 2XSJA 2FLPA 2I5JA 2ZC3A 3LWMA 2RQMA 3G82A 2VODA 3J7Z5 2LP4A 4DZ6A 4WTYA 4PAAA 3I6PA 3M7VA 4FKYA 3WBZA 4XO0A 5B0BA 4WFBQ 1J5OB 3BN4A 1RAGB 1QDUB 3WZ0A 3CF5Q 1AUDA 2IJNA 4IH7A 4H4MB 4I4BA 1HBUB 3MMJA 5I3PA 3N28A 4J90A 4CH1A 3I4PA 2CQDA 2XCPA 1W2BR 1HBNB 1JXVA 3U1LA 1XNQF 1UCNA 3HVAA 1J5EF 4ZVFA 3DOLB 2GC8A 1D0EA 3OL7A 1MWZA 5B08A 1ZOTA 2WONA 2ZHBA 4MYUA 4KGMA 3A4TA 4O3QA 2RE1A 3GIMA 3BBCA 4DR2J 2ABYA 4D3GA 1XMQF 4CO0A 1S99A 1VC0A 2C3OA 4ICLB 3EWGA 4M5IA 3EM1A 4O44B 5AXNA 3GSIA 3IGVA 1B64A 2IAJB 3OD2A 2DY9A 5F9NA 5A8WA 4OZ1A 1N5YB 2V8PA 1NJZA 4NI2B 4EI2A 1Q7YT 4J9VA 1RI7A 5E3CA 5ETRA 3D6HB 3SFUA 2YH0A 2Y8WA 2LCWA 2FHJD 1VHFA 5E3QA 2CWKA 1RTDB 3TAMB 4C97A 1D9DA 1L3KA 1CQNA 3M8YA 5CCMA 1WC6A 3IXQA 3HMJG 3DC2A 4DN9A 4UW2A 2HEKA 1R27B 3MTJA 3DLGA 3ITHA 4WK1A 3HP6A 3D2WA 2JWNA 3AT1B 1TVRB 4DU8A 1UVNA 1KD1T 1HI8A 4MK7A 3K89A 1AROP 3AD8C 2HZCA 4X2BA 2ZE2A 4DUZJ 3PZPA 4QYRA 3R5BA 1BQNA 5A0YA 2M5YA 2V68A 4ILRA 5JUMA 1ULRA 2I2YA 1ELOA 1Y3KA 5KFKA 1UVIA 5LSLA 2AJ1A 2N3OA 2R7UA 2I0XA 1N8RT 2UP1A 1X5TA 2XEXA 2KG1A 5LMNF 1NH7A 2EVZA 2JL9A 3AQOA 3IWXA 1KLMB 3HFKA 4B3OA 4FF3A 2KYXA 5L9XA 1TV6B 2AHOB 4U7UK 5F3ZA 1MNEA 1VJWA 3DGVA 3DLEA 3EGVA 4PUOB 4FBUA 3KLVA 3UVJA 1FVSA 3J7YI 2OPRB 3H2LA 5GAEI 2MKSA 1FNXH 1IBMJ 1FJCA 2YNGA 1X5OA 5J2NB 3MEDA 3GG0A 3PIOQ 3WQPA 4DLGA 2MSSA 3MM9A 3KDOA 4CLWA 3H5UA 3HHLD 1OSCA 3QMQA 3JTPA 3GV8B 1U2CA 3MMAA 2V2KA 1MROB 1KNZA 4DPUA 2WZ1A 3R5DA 1RTHB 2CZ4A 3DOMA 3FCWA 3ICLA 1KWMA 3D1HA 4IDKA 2IC3B 2QL5B 3CJKB 3RGIA 2GMJA 5CYJA 1UVMA 2FGOA 3OV7A 1RXOB 3E3XA 3IC1A 1Q1KA 3G96A 4DL6A 1WOSA 4GKKJ 4ES1A 1RT4B 2YTCA 3AJ2A 3QFHA 4Q0BB 2D1CA 1S97A 3SCLE 1OPIA 1Y00A 5ITHA 1JNZB 1NB2A 1S6QB 2UV8A 3POTA 4KGXB 1T03B 1K73T 1HQEB 1B70B 1FA0A 2CXEA 2D9OA 1FESA 1KTQA 4CLLA 5J2MA 3IRXA 1PG5B 4LF5J 4X4UA 7FDRA 1B0VA 4W92B 1U47A 5K14A 3TAPA 1SKUB 3R2DJ 3SZ2A 1N34F 3CCTA 4JI1J 4B3RF 1NRKA 2XM3A 2RKIA 4DV2F 3P3DA 1JLBA 2AD9A 1YX2A 4USWA 2AMCB 3FEYB 5DZ7A 1XWLA 4DR2F 4QW9A 4A8SA 2HQGA 5ETVA 2NSCA 2YX7A 1TKXB 3EPIA 2QSFA 1S72S 4JI5F 4BDPA 4X4NA 3TANA 2IDEA 2W9AA 3T5LA 3B78A 2IVMA 2YX4A 1TQLA 1JJHA 4H4OA 4TN2A 4JI6F 4CLSA 2AYGA 1S49A 4QU6A 4ECWA 1Z1ZA 5D77A 2FVQA 2EEYA 1RAJA 2MMYA 2OSQA 2GHWA 3M8QA 4F4KA 3VWSA 2I5JB 3EGZA 4C6AA 5D6GA 1QLNA 1RT4A 2P9GA 2Q43A 4ZCLA 3PJ9A 4Z7YA 3EX7B 4Q0BA 1FX2A 5KFEA 5HMXA 1SIWB 3F44A 1RAAB 2GCFA 5CXTA 3JSMA 3CMES 5F8GA 2W2PP 3HT0A 1XMBA 3OUYA 2QTWA 4NX9A 5IWAF 3HXMA 4XPEA 4MKAA 1GTHA 1HHSA 3MI7X 4LF9J 1SH2A 5KFXA 2XGQA 1C0UB 1FXDA 5H1SV 1NSPA 2CQIA 2E7VA 1CC7A 3L9ZA 3TWZA 3PW2A 4R0JA 1ZTTA 1F1BB 2G0CA 2BE9B 1SJFA 1HBNA 4JI5J 3DLBA 4CDIA 4QW8A 1Y9OA 4KB7A 2ERRA 5HSPA 3CGIA 3HJVA 3QYYA 3AODA 4WYWA 5KFGA 4EO6A 2X3DA 3SDEB 2UXBJ 2YPYA 2EXUA 1SV5B 2KDOA 2MKCA 1PYSB 3DU6A 2HVEA 1ZBTA 4ZOSA 1KC8T 5F8LA 3EVOA 3EZ5A 4IOCQ 1L3TA 4OIXA 2PIIA 2SXLA 3C14B 4EWTA 4A8XA 2K2PA 2Z4PA 3UDVA 4K0KF 2V94A 4LF4F 3C66A 1UEUA 2C42A 5KT3A 3K7RA 3RZAA 2VPZB 3R7SB 5RUBA 1FFWB 3LP0A 4EZ9A 3FSIA 4PRFA 2VUGA 4H4OB 1HBMB 5KG1A 1IKVA 3GE9A 4EUVA 3PR5B 1HR0J 4LVNP 4WFXA 4YB7A 4DI6A 3BPSP 1YIJS 4H4KA 4DV4F 3DU5A 3MF5A 1N32J 1HBOA 2C2DA 3TZYA 3DLGB 2Z2LA 3CDWA 5CZVA 3UPFA 4O3RA 3FZ2A 2DH9A 2VZ9A 1BLUA 2WOMA 3NLCA 4WKRA 2AX0A 3WHIA 1RSCA 3Q8RB 2J6SA 4OYIA 1RTZA 3T1HJ 2QMUB 3G86A 1T05A 3K59A 2BV3A 3BKTA 2E7WA 3OSPA 3TUPA 1S6UA 3OBIA 3ZTRA 3KJQB 3J80Y 3H2VE 2YWHA 1S9FA 5KFLA 5HJYA 4YDDB 4K5SA 2J6UA 1TV6A 4Y2MA 2MLZA 4CLZA 4GKJJ 3ZZ0A 1FDDA 4NYZA 4ED7A 5JMNA 4ZVEA 5I42A 2V8DA 1XMOJ 1Q0NA 4O44A 3PFEA 4Y2IA 2FJBB 3MZIA 4I2PA 2HQDA 4ZLLA 4I64A 3PKYA 3VALA 4ECVA 1FXLA 1OY9A 1ZA1B 2DIUA 5D0GA 3CCMS 3DOLA 3A8KA 4LQ3A 2EG2A 2WVDA 2JVRA 2P6TA 2GGPB 2FVRA 2CDRB 3TQ1A 3M9NB 3RW6A 1IBCB 2M7SA 3NGSA 2JFKA 3FC9A 3QLHA 5KFTA 5KT7A 2BDPA 2M70A 3DDKA 4NL5A 2GO9A 5KFYA 5LXYA 1RT2A 3H4BA 3CCSS 3D6MB 1G7CB 3FBCA 2CZ9A 4TQRA 1DQ9A 1IM4A 1WKKA 2I38A 4P2MA 2CG4A 3UFCX 4QYZJ 3FCVA 4J91A 3ZTQA 3RB0A 3HLUA 1X60A 1IWGA 4RW6B 3KHHA 4X4QA 3O6QA 4DZDA 2JLGA 1LWCB 4RNHA 1TL3B 1VBXA 1WNEA 1HNVA 3AOAA 3FSYA 1GX5A 4KV8A 2Z57B 2HVDA 2HK3A 2FD2A 1DTTA 3ISNC 4P73A 3ZTOA 4YFUA 2IVFB 3GV7B 1SJ4P 2AJFE 3BYPA 4K5RA 4YS2A 1GMWD 4P74A 2Y1IA 4QIFA 1FCAA 4ECRA 1C1BA 2HVIA 2QJ3A 2NUUG 1T9TA 3C19A 1KONA 5A0YB 1S1TA 1RBOB 4G6VB 3JYTA 4F04B 4DSJA 4ECSA 1XNRF 1UPPA 2CNLB 2R7XA 2JLFA 4WPAA 1UWBB 4BS2A 1RT2B 2N3LA 2MZ1A 2FZCB 3FQLA 2ZZNA 2NQPA 2YY3A 3AJ1A 1P27B 2ZITA 1GXTA 1KVJA 2VDHA 2H54B 4DX7A 2UXDJ 3MPDA 1QVGR 1JLGA 5KOWA 3LA0A 5GAHU 1HPZB 4PG8A 3HK2A 1TL5A 3I4HX 4C11B 2CJKA 3CEDA 4B08A 4KGZB 1VOMA 2BRKA 3MM8B 4CM0A 2W9CA 2KH9A 4DV3F 4F2RA 5KG7A 4KRWA 3ZZUA 1Q79A 4GO7X 3HHLC 3NGDA 2PE8A 1T9YA 2CNKB 5CD4H 3NOCA 2LKZA 4KQZA 4AFFA 3L7OA 2KXHA 2GIQA 2W25A 4Z7CA 2KT3A 1PBAA 1JLEA 4N7TA 5MLCV 1UETA 1NMEB 3NGRA 5AXLA 3D3BJ 3ZO7A 3R6LB 1VIXA 4B9MA 2JRSA 3ULHA 4ZPTR 2JOQA 2W9BB 3AY0A 1HARA 2E7XA 5HQMA 1O51A 5KFRA 3Q23A 2C2KB 2C2EA 2AYBA 3JSBA 5ETOA 5C25B 5DQIA 5ETLA 2VQFJ 1PYOB 4C0OC 4DV1F 1HHQA 5HVFA 2DNYA 2RIJA 1VQKS 3UNYA 1LWFA 3SBMA 1FE0A 3MPYA 3PJWA 3D0IE 3N4WA 4CNZA 1NDCA 2YQ3A 2AZ1A 2VG5B 2M0GB 3MMBA 4MT1A 2HAIA 3DYAA 4R25A 3CCJS 3AFGA 2DHSA 4LSLA 1JLAB 4IG0A 4TY9A 4UZCA 1PILA 1XMQJ 4ZCKA 4GKJF 2G0JA 1U49A 1WJ9A 1HIYA 4C8MA 1IBLJ 2OEKA 4LJMA 3OL8A 2HRUA 3BGFA 1QD1A 2IM3A 2WB4A 4CRJA 4NMXA 2O5DA 1J5EJ 1U02A 1MU2A 3A8IA 4ZJOA 4WE1A 5A8KB 1U1MA 1SI9A 2V63A 4OJHA 4H4KC 3QJJA 2AEMA 4ZVQB 4CT9A 4GRSA 1L5UA 4LFBJ 1X9WA 2GJIA 2VFRA 2GX8A 4Y6IA 3W61A 5J2PB 1R0AB 4JI8J 2PMHA 4KT0C 2B9EA 3W2WB 2XMWA 3H42A 4IQMA 3MUMP 4JI3J 3T1YJ 2QFJA 5E0OA 4C8NA 2UVWA 1F9EB 2V4JA 2HHHF 4YEAA 2MQ8A 1K0VA 2X1BA 2V6AA 4S0MA 1UEKA 3V4IB 2IMOA 3BB5A 2KTQA 3ENVA 1J2VA 3KKFA 4OI3A 2BA9A 2KHCA 2ROPA 4IRDA 2U1AA 3H20A 2APOA 2BJDA 4F0HA 2HRYA 4X66F 1I1GA 4LBIA 2LXIA 3O2IA 4ID8A 5HBMB 2DK2A 5L1KA 2D69A 2UUCF 1SKSA 5D0EA 3AB4B 3GFHA 4LSNA 4P72A 4R8UA 2ZOFA 1RT7A 3S01A 3THVA 5KT2A 3CJ3A 4ZVTB 4O4RA 4DDFA 4OX8A 1M5OC 1R0BG 3PM9A 4HI1A 1X4BA 2RUGA 2Z58B 2RSQA 3EGNA 4IDKB 4JUZA 5F3TA 5KFUA 4XPCA 4USJC 4J9NA 4U95A 1SVDA 4CO5A 2WRMA 4UQGA 3HI9A 5AE1A 2F5GA 2BRLA 3NOGA 2D41A 2DRDA 2K1RA 4NOHA 5T7LA 1QM9A 4CLKA 4YR3A 4AQYF 4ED6A 3KFWX 1VYAA 3NCPA 3NG8A 4NLRA 3FKBA 1VBKA 1TU0B 2VFTA 4KKOB 3DOKB 3R7NB 5EDWA 1ZS6A 1OIAA 2DD8S 4N47A 4YB6A 1VLOA 1D9FA 1C2PA 1ZZFA 2ZBRA 2XMVA 2Z30B 4ZVHA 1WG1A 4LF1A 3VCDA 1J27A 1VRTA 2HBRB 4IKAA 3ISZA 1SPBP 3G8SA 1SL1A 1UVJA 4F8RA 1GX6A 3LOUA 4RUAA 3RRKA 2QLFB 4WBFA 2VOOA 3NWGA 1C1CA 2UUTA 3LPYA 3RBEA 4DSLA 2HBYB 4ZDNA 2AWZA 1RCXB 1RLCL 2ZFHA 3HVWA 4CLFA 1XNQJ 2V4QA 1RYRA 4ELTA 3HFVA 4K2XA 4RWWA 3M9MB 4DQRA 1HNWJ 1AA1B 4LIRA 1HFEL 5K5MA 4DUYJ 1JLAA 4IG0B 3TNVA 4QYZK 1NJYA 2HHXA 4P75A 3BQ0A 1ZAWA 4WJBA 3KLFB 4J9SA 1QAJA 2A2CA 2CG8A 1WHXA 3WIUA 3GQCA 2XY6A 1H7WA 1RTDA 4C98A 2Q6BA 1EB0A 2FLOA 5DG9A 1QAYA 2VB6A 5DJBA 3W5YA 5J1EB 2KVIA 1VJQA 2KI2A 4JB8B 4C4WA 1YLXA 2XMJA 3MCNA 4AE5A 4C9DA 2XMAA 1Q8IA 1JLBB 2XHCA 4FXDA 3OFHA 5IQ6A 3M6VA 2YNFA 3CSKA 5C5JA 4WXWA 4QU7A 4H4MA 3V6JA 3LP2B 4DWIA 4N56A 2ZNZA 4ENOA 3QJLA 3BGOP 2R7WA 2Y1JA 5DS7A 3DN9A 4MKBA 1Q5YA 2MSTA 4DUYF 2EKYA 2GMHA 2QE5A 2B4VA 1DQAA 2DCLA 2OPSB 3M2VB 1SCJB 2K3KA 2F63A 2WVBA 4ALZA 3LWLA 4IO9Q 4NXMF 2E66A 1TL1A 1JB0C 2D74B 3TAMA 5IWAJ 3QZ7A 3KMQA 4MJKA 3VV2B 3SCIE 6AT1B 1X4EA 1SQEA 3Q8SB 2VG6B 2PI4A 2CJ9A 3JAMY 1H3DA 1CJVA 2UUAJ 5GAGU 7AT1B 3D0HE 2KXNB 2XS5A 4ZITA 1ZTWA 2AJQA 2IC3A 3PYGA 2OUGA 1WKJA 1S1VB 2NXEA 3CJKA 3SQGB 1M90T 4V19J 2CPZA 4ANEA 2DHHA 2LA4A 4L3KA 3Q24A 2KXFA 2IYGA 1U8WA 3N0VA 5C2CA 3RTVA 2BJ7A 1SL0A 1RWMB 1ZA2B 2A3JA 1TZ0A 2NYIA 1M5VC 2MLYA 2VL1A 2PN6A 3B4DA 4M5JA 4NCBA 3GJSB 2GO8A 1HWKA 1ZM2A 2PC6A 3MAAA 2F8EX 4Q8EA 4AQYJ 4OYMA 3P8BB 4DV2J 1HQEA 2FZKB 2MZQA 3LQVA 4HDGA 4GMKA 3VAIA 2A18A 5CZXA 4DFMA 3SCKE 4F3QA 1FE4A 1UVKA 3I31A 1WC4A 1GT8A 3JQKA 3QO9B 3V4MA 2ZD1B 5K8OA 5B0CA 2W7OA 1Y0HA 2JVOA 5ETNA 1WF0A 1PGZA 1UMJA 2PDAA 2KVQE 4ED3A 1U6BA 3V5RA 1HYSA 5D8HB 4ZPDA 2MXYA 4URGA 2QA4G 1KFDA 3BKUA 4U7UD 1XN9A 1HD0A 3CJ5A 3TZWA 4F3OA 1JKHA 4C8YA 4Q43A 2L48A 2FVPA 3MAQA 4C8LA 4YHHF 4ZK7M 1XEZA 3BEGB 2HYIB 5BXIA 1SJQA 2HFVA 4FYVB 4N8NA 3H0PA 1S6PA 1WG4A 3HZGA 2KN4A 1Q81T 4MIAA 3RAXA 2HZAA 3C6TA 1TAUA 1IUJA 3C16B 2OMOA 1S0OA 1O0PA 1P1TA 4TVAB 2ZWOA 4DCJB 2ZBIA 2FJWA 4YOEA 3NGKA 3DLKB 1IVZA 4X65J 2M3DA 4JI2J 1VBZA 3C3LA 3PTWA 4RW8B 3PJXA 2W2QP 4CO3A 4FYWB 3Q22A 1NZ8A 2MTLA 2C28A 2VHGA 4OZ3A 3J81Y 1TKTB 4LIWA 4ZMMA 3MTKA 2RT3A 4DR5J 5ETPA 3ZZTA 4Z37A 1Q8BA 4NLUA 2GIRA 3EGWB 4XDDA 3NMRA 2MQMA 1CJUB 4F67A 2ZKUA 3O1LA 4CH0S 3D7SB 4ECZA 4O23A 5IT9U 1REVB 3TI0A 2M52A 1MWQA 3GP9A 2K06A 2UZAA 2CQ4A 2MQPA 4HVZA 3MCMA 3UQSA 1UVLA 1N5SA 5HVHA 2J8SA 3MOJB 3G71S 1VK8A 4FN5A 3RRHA 2OPPA 4OX9J 4QR0A 4UF4A 2PGCA 3IG1A 2LYVA 3IBWA 3PXGa 3IRWP 2NZ4A 1HBMA 2ASYA 2ZVIA 1HNZF 1W25A 2ZVSA 2RDDA 1F6TA 2HS0A 4LUBA 5CABA 4X4RA 2RQ4A 2HIYA 2HS3A 4F0MA 2FY8A 3CJRA 1KEKA 5LJ5Y 4GC6A 1CC8A 1X4FA 4RU9A 4HR2A 3MPVA 3TVKA 1FHTA 4DCOB 3RAQA 2QMWA 4NPOA 2VBYA 4DPOA 5IOLA 4F4ZA 1X8DA 3U02A 3V2UC 1YJNS 3M30B 2HFOA 4EBEA 3QRQA 5F8JA 2KYZA 3ZZPA 5FLXY 3BR8A 4NXNJ 4FF1A 3K0JA 3I5AA 1WF1A 3M2RB 4ZP8A 1S1TB 1T0TV 3PACA 4NLOA 2AT1B 3OXLA 1Q5VA 3M6UA 3UR3C 1JLEB 1PKUA 4H54A 3NKYA 4DL4A 3THPA 5HN0A 1VDHA 3VTIA 3J7A1 3DDNA 2E5JA 2ZWPA 6FD1A 4PXEA 4CP5A 3C6UB 2J9CA 2ZJQQ 1RAIB 4GKKF 1H73A 2VG6A 3T19A 2XYGB 1U6ZA 3SFGA 4UOFA 4ZIVA 1PAUB 5ETQA 4CLTA 1YRTA 4J9UE 4DR3J 1HWUA 2DTJA 2J9DA 4YDXA 2IJFA 1FJGF 2ZHAA 2HGMA 4NRUA 5CH7B 1UFKA 2MPUA 5GMKa 3SSQA 4B3MF 2VC1A 3W66A 2BMBA 1RA6A 4HACB 3LGNA 4RUBA 1IJFB 3DRSA 4ZS6A 5KFIA 4CI0B 5FIIA 1QSLA 2IA6A 1Z2ZA 2KJWA 4HH1A 4F4YA 2UVVA 2XBPA 2WB1D 3KNGA 1S5ZA 3E2EA 3CDAA 4TQSA 2FYXA 4I67A 1RP5A 1RK8A 2X1GA 3OTCA 2RRBA 1XK8A 3IN5A 2WW8A 3K5MA 3CT9A 1TK0A 3GCWP 3GU0A 4PWDB 1JK9B 4QQBA 3OTBA 1OJ4A 1TKTA 2P6SA 1GEHA 4OJ1A 4YUDA 3RBDA 1SL2A 3PO5A 2E1RA 3W2VA 1CQMA 3GILA 1D8ZA 5IM0B 1CULB 1NB7A 5CCLA 2C2RA 2HS4A 2MYFA 1JX4A 4IRKA 2RILA 1W26A 3N6LA 3CC7S 2RU9A 4PR6A 1K0TA 1GTEA 4FNHA 2WAQD 5A6PA 2C2NA 1S4FA 1O5JA 2EC2A 1S6PB 1WEZA 2CUYA 1T9XA 3IBFB 4OZLA 2CQPA 2ZBCA 3VVTA 1X4HA 2QG9B 5A2QU 4MK8A 2ASDA 4FBTA 3BR9A 1TP7A 3ELHA 4FYYB 3TZXA 5LMUF 3JTOA 4K4TA 1PIEA 2V50A 1RA7A 3IS9B 3NGUA 5K20B 3I82A 3CUNA 2C2MB 1TL4A 5T14A 5I4MA 2A2DA 3BV8A 3OFEA 2V2VA 2NXNA 2FIUA 5F0UA 4CCHA 1B4SA 1U48A 4USMA 2GFFA 1Q8KA 1BQMA 1H2TZ 1T3NA 1VQ5S 4IUFA 4OYXA 3IR7B 3OL6A 4ZVUB 5G4DA 3L09A 4A8MP 1CJKB 2PA3A 3PRVA 2J0SD 4ED8A 1M1KT 2HAFA 4C8KA 4DHVA 1PYTA 2BACA 1BQXA 4ZPVR 1BY9A 1JJ2R 1S6QA 2L08A 3POTB 2JNJA 5AT1B 4K4YA 1VQ9S 3RW7A 4CTAA 5F8NA 4GC7A 1TAQA 2V4JB 3A8JA 1LW0A 3RYLA 2E1PA 2J76E 1RAHB 1BQNB 2AV5A 4NYPA 4ZPBA 2CQ3A 2OO4A 3UN2A 1WC3A 2ILYA 3LGMA 1S57A 2ZDPA 3GCXP 2KZZA 1X0PA 2UXCF 2CQ2A 2KZMA 5KAKA 2MGZA 3CULA 4JV5J 3R1LA 2D3ZA 2XLIA 4LRCA 2QX0A 3M8PB 2M8DB 4DQPA 1WHWA 1NNDA 3I32A 5EHHA 2MQNA 2XQCA 4DV1J 1H38A 5KFNA 5IV4A 3A3PB 3KLHB 4DX6A 1M5KC 3DYAB 2RRAA 4YR2A 4OHYA 1AYEA 3KK2B 2CJQA 3PRDA 4FNIA 1CJKA 1KOOA 3IMQJ 1NPRA 3OXFA 3DOKA 5GMEA 1FK9B 2FDNA 2QN6B 2Q1LA 4OV1A 2O01C 1C4AA 2HMIB 2B9WA 2MDAA 3MR7A 1DQ8A 3QT7A 3UW1A 4JYAF 3K17A 4TU9A 1U45A 1G1XA 4W4MA 2W9BA 3HHNB 1IM6A 3B6BA 1RHRB 4NLXA 2RB7A 2W2MP 4RLEA 3GFZA 2HHPA 2ZH7A 1ZAXA 1APSA 3FBEA 2XWXA 5K14B 3HM9A 3M8WA 4DFJA 5DGBA 2HLTA 4JI8F 3G8TA 1JLCA 2ZJPQ 3PX4A 3MFIA 3LGHA 5B0AA 2E5LF 4X4OA 1WD6A 2NLWA 2HW3A 2HSEB 3MPUB 4AXJA 2KRRA 2P9EA 5B0GA 1QY7A 3TP2A 4X64F 4HYKA 2ROGA 4ZJLA 2VG5A 4ED2A 5LL6d 3K5NA 4UUWA 1RHQB 4Y2KA 4CZCA 3SV3A 2VBXA 3C15A 2LXUA 2V8HA 1UFLA 5GADI 4DV7J 3AD7C 1XC9A 1Q78A 4DQIA 3DOMB 2P5VA 3M2UB 4RBUA 3PHTA 1CG2A 3R1HA 2DHAA 2H48B 2F65A 2QA1A 4U8YA 4K7QA 4X62J 2G13A 2OIHA 3OXGA 1C0UA 2RDJA 4K59A 5J1EA 4KIAA 1UTAA 3DRSB 2VDIA 4Y34A 1OYDA 3CCQS 2HHHJ 1RWKB 1SIZA 4ZN3A 4UY85 1URNA 1P1LA 5C24B 4QIVA 2HWHA 3JSMB 5KFCA 1IXKA 5C42A 2C3MA 2O67A 3I96A 5BR8F 2L9DA 1NEEA 2CNOB 5HATA 2AYEA 5F8HA 5F8IA 2BQUA 2XZDB 1FRHA 4IH6A 4RW9B 2VQEF 4DG1B 1LWEB 3EZUA 1R8CA 4Q7AA 2KU7A 1NK6A 4O4GB 2A6MA 1UZDA 1H7XA 1N5TA 3K5PA 3BBBA 4Q2LA 2CVEA 2CYYA 1Y5LB 5HVGA 1NPPA 3QT5A 1U2FA 3CD6S 4DR7J 4I68A 2Y9HA 4FPIA 1S9EB 2WVFA 4F4AA 1WI8A 2ZZMA 2A6OA 1XERA 1FRMA 3DXBA 4OFZA 2F9DA 4FYXB 3MEDB 1A0OB 3FBBA 3OR2B 1YJRA 4IFYB 3AA9A 1NHKL 1V3RA 4ED4A 3PY8A 2F4VJ 3CVKA 2PSZA 2FJEB 4NCGA 5IT0A 3BSOA 2VD3A 2PEHA 5LM7E 2E1CA 3UCUP 1UW4A 1NM2A 2GNKA 1OY8A 1SC6A 3BO3A 3K8WA 1JLQB 2CPFA 3OFFA 5DZ6A 3QT6A 4ZCIA 1HI0P 2MHNA 2DR7A 5EN1A 2BJ3A 1TUVA 4L3NA 3TR5A 4TYBA 4U7CA 4CO4A 1VIOA 3US5A 2KT2A 4LQ9A 4USTA 2DYAA 4QWAA 4DSEA 1K8AT 1YDLA 1XTZA 1MG7A 4ZVGA 3MM7B 4DS5A 1Y5NB 5KFQA 5I3UA 2DR6A 8AT1B 1X0FA 1RWXB 2C3PA 3DKDA 2NS1B 4HHUA 3RG6A 3T6BA 4RL1A 1R6YA 2FQQB 1H2VZ 2HQFA 3BZQA 4I6YA 4URQU 3VQTA 5ADZA 2VV5A 4LF6F 2DNPA 2RF2A 5EUHA 1VHIA 2ZM6F 1HI1A 3DMJB 3FUYA 1RT7B 1FVQA 5E33A 2FLLA 2V0NA 1SC1B 2Y8YA 4DQQA 2YNIB 3LP0B 1GXLA 4KJIA 3ZNUA 3Q8UA 4PEOA 4M5HA 2GHVC 2BM1A 2CNNB 3MD3A 2QFIA 3ETMA 3PKMA 4TY8B 3U1MA 5HQLA 2XO6A 1RADB 4MK9A 4TNOA 5DQGA 2Q66A 3EJMA 3LANA 5IFMA 3QGIA 5C24A 4UOHA 4RW8A 4J9KA 4PG7A 1TL3A 1URRA 2MLXA 5KFHA 1RZMA 2RAQA 2N82B 1NJWA 3KJFB 1D8YA 3TAQA 1FF2A 4KYZA 2LEBA 4ZPAA 1S1UA 1M5PC 3QGHA 3M2RA 3KJVA 1T05B 5HP1B 4M5DA 3BQ2A 3A3OB 1RWNB 3L7PA 3SSRA 1S77D 3OTOJ 4HTIA 1WOOA 2RF2B 5BYRA 2O1PA 2ZEJA 1WC1A 2DNZA 1OWXA 4U67Q 3EYZA 3CCWA 3OT9A 4AXIA 5CYMB 1S7HA 2YKNB 1F3VA 2B8QA 1HNIB 3W63A 2G4BA 4ITSA 5I3UB 4DQSA 1EAYC 3FJ2A 2FHOB 4I69A 3RUBL 1R43A 2BJ9A 2EK6A 3HHEA 2A10A 1HL6A 1UL3A 3BSCA 3HD2A 3SXLA 1R3NA 2LU2A 3NS6A 1JLGB 4USIA 3T6JA 1TL1B 5F0WA 2R7VA 1MN9A 3FQKA 4CLUA 2V34A 4EZ6A 1FRXA 2OD6A 3QSIA 5LJ3Y 2OPPB 1FDNA 4FVMA 2HFNA 2BR0A 2LFVA 3R5CA 5M2UA 1I94J 4JI1F 3ONQA 4W98A 4TU7A 4X84A 5GVQA 4DN0A 3N6MA 5LXRA 3HT3A 2R2SA 2KRBA 5HP1A 1BUXA 3HF5A 2YKPA 4JP8A 4PYDA 2MKHA 4BBYA 1YJVA 2ACYA 3BGUA 4QZVB 3M30A 2GV1A 2DIVA 3VHQA 2ZH9A 4RU2A 2AIRB 2CQCA 4TYAA 1KN6A 3T41A 4I7FB 5DLGA 4EFAC 2R7TA 3T1YF 1AFIA 3KHRA 3AD9C 2BJ1A 2HK2A 2CWXA 3K57A 2JC1A 3V6DA 2NREA 1VBYA 2DKOB 1TMJA 1LQ9A 5G0RB 4DL3A 3RB6A 1RJJA 2ZHOA 2HQIA 3CO0P 5EX0A 4IOBA 1U09A 5A6WA 5KT5A 4NLSA 1N54B 1JLFA 4P10A 2DR9A 5EWFA 3OPKA 4IQXA 1FRJA 1LNQA 4DX5A 3GIKA 4DR1J 4AL6A 3VAKA 1FFSB 3GB0A 2YKNA 4B3SF 4Y3CA 2BXJA 2OI2A 3M8PA 1DFDA 4WZQA 3KK1A 5L38A 1SV5A 2QLWA 1NJIT 4EK2A 2FHKA 2IFXA 4QR1A 1TMMA 2MGZB 1N33F 2M9KA 1RUSA 4O3OA 4J9PA 3V81B 2ZZTA 4OJGA 3MMAB 4N76A 3FMBA 1HYSB 1U1NA 4B3TF 3RAMA 5DDOC 3HPOA 4BC7A 1VCTA 2NXJA 4LF7F 1IR1A 1VRUA 4WCEQ 3MM5B 4XIUA 3JB9k 1VQ8S 1IKWA 5ETKA 4EYIB 1RISA 1HD1A 2XI3A 2LDIA 1FJGJ 2HHTA 3VR1A 4G65A 2UV8G 4DUZF 4PQAA 3CCLS 2IMWP 2BM0A 2D3UA 3SQOP 3NRBA 4J9OA 4MKYA 4EBDA 1AB8A 2ALYB 1S4EA 5HROB 2CAJA 3MMCA 4O3PA 2P8IA 3R9LA 3NWRA 2EFOA 3KLGB 1HA1A 3VAFA 2ZE2B 3D6TB 4KE5A 1S48A 4Q5VA 3NNAA 3PFOA 1EQ0A 3M8RA 1R8HA 1WG5A 2VC0A 2KB2A 3M32A 2HFSA 3UDEA 3BH6B 1X4DA 5CYQB 5GAGI 2UXDF 4WFZA 1Y7PA 4PWUA 2EFNA 3LAMA 4JI0J 1NSAA 4LSNB 3UCZP 4OI0A 2ZC4A 4LBPA 2OHDA 2V67A 4DV0F 1U7LA 1F9FA 1RBAA 2HWTA 1WUUA 2MZRA 3UVJB 3W9JA 2HURA 3FNNA 2CPDA 3HSZA 2BVZA 2NXCA 2UUCJ 2DEIA 3F41A 4LF4J 4XAKA 2KM8B 4PZVA 1RKJA 2ADCA 5H9FJ 1YHQS 3OVBA 1VRQC 2H5EA 4PWWA 2DHGA 4NCGB 2YKQA 4IFVA 4ZCMA 4ER8A 2OELA 1S59A 3UD4P 3PDNA 5B0EA 2XHWA 4ATNA 2XTJP 2VJVA 2XULA 4ED0A 2WSFC 5H9EJ 2EC0A 1RHUB 1TVRA 3GYGA 4K4VA 2WK4A 5FJ4A 1HBUA 3CJ2A 3GMGA 3KMSA 1T11A 4O0NA 1E6YB 2J7UA 3KK1B 4J9MA 3PIPQ 1VQ6S 1Z4UA 1TTHB 1IKYA 3F0NA 3LH2S 3OTEA 2YPZA 4PG5A 5J2NA 3KK3B 4A8QA 3HULA 1KS2A 1IKYB 2OD4A 4LF8J 3C14A 1BD6A 2GQ2A 4NLGA 4M94A 1NSQA 2H5IB 2MQLA 3W8PA 4LFAF 1YRXA 1FJEB 3BGRA 1RT1A 3MECA 1HMVB 4JI4J 3DLJA 2OLWA 1YBTA 3BS9A 3JTNA 1IR2A 4OYBA 3HHLB 3KG4A 1QAIA 1VRUB 5L8RC 4KH0B 2VPWB 4LRAA 1AZSB 4IYQA 4EBCA 1XMOF 3W3SA 1X7VA 2FGCA 4OX9F 1IKXB 2ZDOA 3I55S 3TARA 2KKHA 4C3MA 4OX7A 4DSIA 1PBUA 2DNGA 1FK9A 3P96A 1YZ6A 4WE1B 3G8QA 5EX3A 3O5TB 3HX9A 5M2RA 3T1AA 5A8KA 1XR6A 1DZ5A 2MB0B 4HHJA 1P8GA 3DLLQ 1YJUA 4M95A 3O8WA 3MR5A 2CJYB 1WELA 2MHEA 2LDYA 2V8VA 2ILZA 4WYLA 4YN3B 2V69A 2YVSA 3N5FA 4NZ7A 5AJ3J 2Z2MA 5LT5A 4F25A 1WTBA 5KG6A 4K4XA 2DXDA 3PG9A 1TKZB 1VQSA 5G0RA 2BANB 2EPIA 2VIHA 4ECXA 3B8HA 5DG8A 2GW8A 1HHTP 1RACB 3ILIA 2LLZA 1EZZB 2Z2ZA 2FTRA 2ZH6A 2A1BA 4QIGA 5CYMA 4AUKA 2R9LA 4RPFA 3VQSA 1RB0A 2C2ZB 4IH5A 4K0KJ 1UPMB 1ZAVA 2NZCA 5H9EK 4O0IA 2UUBJ 1NK4A 3Q8QB 3TX8A 2W8LA 3EZOA 3MM9B 2LA6A 3W62A 4KPYA 4LRBA 3QRRA 4ED5A 2BQ3A 3ILOA 1LXJA 2HNYB 1RT6B 3W7BA 2OEJA 2LVWA 4KFBB 1PCAA 3AA8A 1Y11A 3LTOA 4BWJA 3W8GA 1LOUA 1VQMS 2DPIA 2HGLA 1XR5A 2IVYA 1JWWA 1NZAA 2EKNA 3H59A 4OHWA 2ZH3A 3E51A 2CQ1A 4KKOA 4NZ0A 3TA2A 3ZC4A 1FWPA 3T5JA 4N8OA 5F41A 4OLOA 2B7BB 4TY8A 4LR9A 3M6WA 2BOPA 1FD2A 3ADAC 1SH3A 1WI6A 1B99A 1FKPA 1LWCA 1T9WA 3ENQA 4GVLA 4I6AA 1Q8LA 4BCAA 4C2MA 5MAOA 1RHKB 1WWHA 3HVRA 2DNMA 5HLFB 1IBLF 2ZH4A 4C0HA 1EIYB 1E6VB 1A9NB 2AJ0A 3CB4A 3CIZA 3SEOA 5IS2A 3FEZA 3CC4S 5HANA 2C3UA 3NBPA 2LQBA 2J0WA 3MWBA 1FNMA 1VQPS 3UO0A 4X4VA 2MY7A 4L75A 1D09B 1JKHB 2C22A 5IV3A 1U26A 4HEA9 4QOTA 4DCPB 2CFXA 5D4PA 1CSJA 4Q44A 3CMQA 2G2YA 2YBVA 4KPCA 1FKOA 1WSVA 2HBZB 3F73A 2FUG9 4FXVA 3MEEA 2F1FA 2DNOA 3P5BP 2ACMA 2KM8C 1FXRA 2QL9B 1BHNA 1BXNA 4ID5B 2RHSB 4X66J 2DH8A 4IRCA 2AKWB 2CRLA 2ASLA 4DV7F 2FLNA 2PI5A 3GIJA 4K4SA 1N0VC 3GSDA 3T9NA 2QL7B 1U1QA 3BBFA 4J5OA 3PHEA 1WEYA 1N4LA 2ZNYA 3AQPA 4NLYA 3GJRB 4OZ0A 2HFUA 1P9QC 3TEGA 3FBFA 4DV5J 4LF7J 4JV0A 4OQJA 2KJVA 1TL7A 2XNRA 1S9GB 3Q8VA 3ZTPA 1RTIB 3I0SA 2B8PA 3HHKA 2LMIA 3KDNA 5E3AA 1ICEB 1KQKA 3VVUA 4ZKAA 1KQSR 1TKZA 2IRYA 4R5PA 2RS2A 2MY8A 4O4GA 1CJUA 4MFBB 4LSLB 1QE1B 5A76A 2V2QA 5CA5A 1LK7A 4Q45A 5HK4A 3HZEA 4ECUA 3NAHA 1NCLA 1RWWB 2LEPA 2MZSA 3EUNA 3Q86A 2CPJA 2FVCA 4WP8A 1UFWA 2HNZA 1C4CA 1LKZA 1U0HA 4F0KA 1RWPB 1CJTB 5KFSA 1EETA 1YK9A 2C1EB 1RWVB 4IR9A 2HNDB 1KQGB 3CJQA 1ZPWX 1O8BA 5DM7Q 3CWJA 4RNNA 2D7SA 2DGSA 2P9CA 3DM2A 4KFBA 3HSDA 1LK5A 4I6WA 1RYSA 1U24A 4P7VA 1FT8A 1NDLA 1FTCA 1S1UB 2JEFA 4HKQA 3FRYA 2DGTA 3QIPB 4OHZA 2GQQA 5JVHQ 3WC2A 1OQ3A 1ZM4A 1GMVA 2W4PA 3CD5A 2RQCA 4DR3F 3T3FA 3LAKA 1S1VA 3SQGA 4CIOA 2H4YB 3DLHA 2D9PA 1CS4B 3FFIA 3PX6A 2IIHA 4XK8C 3RR7A 3J7ZT 4ZN1A 4ELVA 3P6YC 4B9TA 1X5SA 2J9EA 1EHWA 4YQWA 4ZP7A 1TUWA 4QWEA 1AT1B 3NL0A 3QO9A 2W1BA 1TFYA 4M1KA 4R5PB 2QLXA 1R31A 1JXLA 3G87A 5KG5A 2M4MA 1FWKA 2XI2A 3M2VA 4DL0C 1WTFA 2F3JA 2G2OA 3IG1B 4USHA 2YWKA 3CW2C 1UZHA 3OHAA 4TLQA 2YKOA 1U1OA 1E6YA 3I0RA 2E44A 2Y3YA 2DJWA 3MDFA 1CVJA 1VI7A 1RTJA 5E2QA 3GV5B 5DDRC 2MQOA 1U2RA 4F26A 1YJWS 3OJSA 3JYTB 2D3OR 3HCXA 3LO3A 3SMZA 4B9UA 4XTTA 3BH7B 1H98A 3DM2B 1X9SA 5DLFA 4M5LA 2G9OA 1RT3B 2VFUA 1Y5IB 3DRRA 1Q95G 2UVUA 1PAEX 1L3VA 3UN3A 1ZYQA 1NBEB 2XZWA 3PVXA 2QRRA 3MECB 2IY5B 1JLQA 5CHCB 4ETXA 2W8KA 1NHUA 4KHMA 4YMEA 2AF6A 1FEHA 2P2CB 3PX0A 1S0MA 2YKMB 2E5LJ 1T03A 1R7IA 2N7YA 2XO7A 1UJ6A 1KBRA 2VFVA 3TUZC 2BW2A 1S1WA 1UP1A 4ZP9A 4DR4F 1AFJA 4QCLA 3SIPB 1KLNA 3TX0A 2X7IA 3TO8A 1T3OA 4G1QA 1S9GA 1HNXF 1I51B 1CBKA 3TRGA 3ETOA 1WC0A 2X51A 2EI5A 4D3HA 1QTMA 3NBPB 1I5OB 1NH8A 1WEXA 1QAXA 1U1KA 2BX6A 1R6VA 4DR6F 5SUHA 2GQCA 3DI6B 2OP5A 3D1OA 3KUHA 4JI4F 3AB2B 1OO0B 3GYNA 4J9LA 1BC6A 4HTJA 2B4UA 2H3EB 3CJ0A 3VF0B 2J5AA 2Z56B 3DLEB 1Y3JA 3QFWA 3BKFA 1P9YA 1RAEB 2Q79A 3S8SA 2RQKA 1LFWA 2X3GA 1ITPA 3GTYX 2B5JB 3I9ZA 2W2OP 4NYOA 3OQ2A 1T95A 2W01A 4KY3A 4P71A 2AGQA 1B3TA 2B0GA 2AP6A 1BQMB 5IT9Y 3AJDA 3NP5A 1YJ7A 4CT8A 5GMDA 1FWLA 4X4PA 2FPHX 1TFWA 1YRUA 4JV5F 1S10A 1FDAA 1IKXA 3VGSA 3EE3A 2ATCB 3B4MA 2QC3A 3FRZA 3PO4A 2EBGA 2XYPB 1F9HA 3HD1A 3J81U 1UA0A 2DB1A 3LPEA 3MEGB 3PYEA 4RNOA 3X1LB 1DTQA 3D3CJ 2XG8A 4FS1A 3KUGA 1V6HA 1N32F 4CWBA 1RCOB 3QWPA 2V4RA 2QSWA 1V5VA 2XMKA 4A8OA 4Y0FA 4FYDA 3R5AA 4FXWA 1F5AA 3KK3A 1LWEA 1Q7LB 3R5GA 1IBKJ 2FJVA 3BM7A 4FF2A 4KR0B 2AGPA 4B3MJ 3MMBB 1VGYA 1DRZA 4X65F 2J0QD 5DGAA 2MJNA 4NI2A 2K7JA 4A47A 3FCHA 3D54A 2IBKA 1KLMA 4PCQA 4Z2XA 5DG7A 2HIQA 3M1VA 1L3UA 3QIDA 4B3OB 3TJ9A 2RMLA 4JI3F 4PKDB 2ALZA 3QT8A 5A8RB 3OW2R 2IHR1 2M2BA 2B3TB 2YQ0A 3OTDA 3DFEA 1RT3A 1K9MT 1RWOB 5T7LB 3UCGA 1R8PA 4C8OA 3EDRB 4F2SA 2H9ZA 2MKIA 4AD6A 5AXKA 5J2PA 1EX8A 3RB3A 4ZLNA 3IAS9 2R8IA 2DR5A 3W64A 3H5XA 4E2FB 4DV6F 2AU0A 1U1PA 1GXUA 1QTNB 2OAUA 1PJ5A 1UJ5A 5J2MB 1G2EA 1IBMF 1LXNA 1X4CA 5GAEU 2ZH2A 1F60B 5AXMA 4ED1A 2IA0A 2BJEA 1X4GA 2XLKA 3KUEA 1NAQA 2B6AA 1IQZA 1EP4B 4OI6A 5CQGA 4ES3A 1ZPVA 2Q6CA 2JJ4D 3BREA 2IYIA 2E5IA 1XIQA 1YSJA 4UOGA 1ZH5A 1NSKL 5HJXA 3C6UA 2M8HA 1H2UX 3CJ8A 4OZ2A 3OLAA 4PWDA 4DBQA 4ICLA 5CYQA 4RW7B 2AYMA 4WXOA 3LALA 2JLEA 4PQUB 1BGXT 2FHJA 2NYHA 2DPJA 3GFYA 3CIMA 2E1AA 2VQEJ 3THTA 3PEJA 1DARA 4UQTA 3R7BB 4PPZA 2UUWA 4JI7J 3J7YU 2RJZA 2WCXA 4B02A 4P52A 2KFNA 4IFVB 4QIEA 1WOPA 4MIBA 2HMIA 4KSEB 4B3RJ 1S1XB 1U0HB 3QWUA 5KG3A 4ZVOB 1PJ6A 2B5JA 3IO1A 4M5MA 4C3KA 1BE4A 5B09A 3GYXB 3KLFA 2CJBA 1DTTB 1U4BA 3VAMA 2DRBA 5I3QA 2ZOGA 3GJTB 3AHPA 3CCES 3MM8A 2X1FA 2Q3PA 2BZ2A 2DGWA 2GZOA 3AXMA 3ET6B 2JC0A 3EXCX 2JZ5A 4FKXA 4IO1A 3ZXWA 3I56S 1RT5B 1NJXA 5HAOA 1ZZNA 3ISND 3EMTA 3I0SB 2U2FA 4GVBA 4BC9A 4JI2F 3FVYA 3EVWA 3M05A 3DMJA 3MGJA 4WFNQ 2XLJA 3BJYA 5D15A 4F4WA 4KHPJ 2F9JA 2RUSA 3T5KA 5IZHA 3CMAS 4G1QB 1HNWF 1S0NA 2BE2A 2GGPA 4U6PA 2DXEA 2EFGA 5L39A 1K47A 1LW0B 3GJQB 2YNGB 3HVTB 3NGTA 5E7OB 4LFAJ 2ZM6J 4L76A 3MD1A 1JLFB 2W4CA 4WIIA 1JNRB 2CPEA 2I6WA 4DPWA 3PW4A 1HR0F 2HNDA 2XMUA 2DBBA 2AGOA 3RB4A 2LQJA 1U1LA 3MM6B 3HSGA 4L74A 3IM9A 2IAJA 1JXEA 3QQCD 5HMZA 5KFFA 1IJEB 1C0TB 2LECA 3M8ZA 2VKRA 1DLOB 5DO2A 3G9CA 5KOXA 3H7HB 3V4IA 2JEGA 4G3IA 2I8EA 3EICA 2ZJRQ 1GMWA 2QT7A 3UWTA 4PPDA 5DM6Q 3UD3P 2J8AA 2CQHA 5FD1A 3R5JB 2GVZA 1RLDA 1SUQA 1HBOB 2DCUB 1OQ6A 3DGPA 3A1YG 3IA0A 4RNMA 5KFMA 3OVSA 3MR6A 1M1HA 2OJ3A 3G6ES 3KTQA 4NXMJ 3M8SA 3PNIA 4JI6J 1R8BA 5C2GA 2VFSA 2HBQB 2RNEA 2VBZA 2XS7A 1NK9A 4DV6J 1JJCB 2GAHC 1U0SA 5J2QB 1RGVA 5IM0A 4DEZA 2O66A 3X3UA 4YP3A 1V3SA 1HWLA 2FZGB 2HRTA 1K1QA 4F7VA 3D68A 2IRXA 3W9IA 2XCAA 2MEWA 5I42B 4NLPA 2FHMA 2OH2A 3RR8A 3PW5A 4ERDA 2Z0GA 3T1HF 2B56A 5L1JA 4ECYA 4DX8H 5KFPA 2M88A 2A0FB 2WSEC 2XWYA 2KO1A 3E01A 4KH1B 3QIPA 4QIWD 2XMTA 1KSPA 4WP9A 4OYWA 4MIWA 2DRAA 2DGXA 2BEFA 2E5HA 2B4PA 2FVSA 4LF6J 2QLJB 4R0EA 1R0AA 1KR4A 1SBRA 2PFDA 4LRFA 4Y28C 2DGVA 3NS7B 3P45B 2GMLA 2E5GA 1X4AA 1JIHA 2DY1A 2RDIA 5HL7Q 2OTLS 2QMXA 4LFCF 2RS8A 4ANDA 4DV0J 3OUYB 4NXNF 4HDHA 2HHVA 3OR1A 2H51B 3KWMA 5B0FA 1E6VA 4XDCA 4WTOB 1VMBA 1M5SA 4RNFA 1I94F 4LF2A 4MAKA 2RU3A 2VG7A 3RBZA 5J2QA 1R0CB 3KXDA 4CM2A 3ET6A 4LBHA 4MFBA 4YY3F 3ENWA 3EPGA 2XB2D 2NUHA 3B82A 3SI8A 2LQ9A 4OI1A 2V8GA 1OSDA 1Q53A 2ATLA 2DO0A 4NLVA 4PG6A 5E3RA 1TL7B 5HMWA 1DBDA 2HHUA 2GAGC 2K8GA 4LVOP 1D1UA 5EGYA 1NK0A 1MN7A 4USUA 3TA0A 5L9NA 3U1NA 2CIMA 2DNRA 3QPIA 1HWIA 5B7WA 3ZTSA 5KFOA 2UUBF 3CNQP 3W65A 3L7UA 1JJ4A 2BYCA 3A8EA 1QUVA 2R4FA 4YR0A 1SB6A 3CTRA 3IBCB 2E29A 3K8VA 4RJVA 5ETMA 5FDLB 4PXDA 1UW9A 1Q86T 4HH0A 2YQ1A 4O3SA 3TQEA 1FD8A 4HI2A 4MKVA 3BGRB 3OJUA 4LF8F 4NLTA 1NXIA 1NLKL 4EU0A 3L95X 2FB0A 1IN0A 1F0XA 1JMTA 4G1PA 2BQRA 3LF0A 2YKAA 4MMOA 2POKA 2R8JA 1EP4A 1WF2A 4DLEA 5IC6B 4I2QB 5D0HA 8ATCB 4RBTA 3OR1B 1RBLA 1WDTA 3GR1A 2J7KA 3N01A 4OV6A 1FFGB 2G0IA 4UZBA 1KRPA 1IBKF 1F3FA 1AW0A 2CPHA 4C3LA 4B9SA 4CQ1A 2XSFA 4DR4J 3IWLA 2F8MA 1YJ9S 4MTPA 3D9BA 2MKYA 3Q8PB 2RD5C 1V9OA 3G2XA 4HHHA 4GVBB 5BJRA 2GVDA 3CCRS 4FF4A 1REVA 4QJVA 2ROEA 2JX2A 3DHWC 4LR7A 2ZD1A 2B9YA 4ZVRB 5HQ8A 2MJUA 2XMMA 2F8HA 4KHRA 2CQGA 4M5KA 5A8RA 2HQCA 2EFVA 2QGFB 3FK4A 3RU0A 4A4JA 3QSYB 4FP9A 4OYAA 4ZLPA 1S1XA 4UY8T 4OHXA 1V5IB 4ETZA 2ZH8A 1HNVB 3OVAA 1UEVA 3PW7A 4OYPA 4OLPA 5A2QY 1VQ4S 1U25A 3DLKA 1RU1A 3M8QB 4UUXA 4JI0F 4CO2A 3OR2A 4IFYA 3MHYA 3A13A 3OTOF 3AAWB 1IQTA 1H6KX 1XNRJ 2MZJA 3TYTA 2L9WA 2QO3A 3ZZZA 4AL5A 2HVHA 3JS9A 3KJNB 5CAAA 3VAHA 5IT4A 1T94A 2OEMA 3ZFVA 5THWA 4X4TA 2R8HA 2H4WB 3MXHP 2GHPA 4TU8A 5DDQC 3R6GB 4OJ3A 1SJ1A 5HLFA 3T5HA 1FRLA 5D3GB 2EG1A 1HNZJ 4PYAA 3GG1A 1DHMA 3CD0A 1VRTB 5LMNJ 5HROA 3JQJA 3NNHA 1ROFA 2E9ZA 5C7PA 3OFGA 4AYBD 3KHLA 1G3OA 2B6AB 3M4XA 2J6TA 1WSRA 2VH7A 2VPYB 2YWWA 3VGUA 1RABB 2OPSA 2NR0A 3GZ7A 1RU2A 3W2VB 1L3SA 4JI7F 3V6HA 1JLCB 2AJ4A 3MUTP 1QJHA 2QIFA 2WVEA 1KHWA 2G2ZA 2W7AA 1NKEA 1RT6A 5BR8J 1HQUA 2Y0SD 3HVTA 5KFBA 2DNNA 3CJ4A 4I0WA 4YHHJ 2ZUAA 5KT4A 3CXCR 4P2FA 4F4XA 3RBXA 4RR5A 3MR3A 1XBWA 5KFDA 1AZSA 2C2OB 1K1SA 2BJ8A 3NCQA 1OPZA 5K8MA 3H2UB 3BO4A 3P4UB 2IJRA 3NAIA 3LUYA 4J9QA 1GAOA 2G1DA 3GIIA 3VGVA 2BE7D 1MROA 2R42A 3KLIB 4BLGA 2ZKTA 4ZVPB 3MURP 1SH0A 1RT5A 2XY7A 4ES2A 4DXLA 4K50A 2WHOA 4I2QA 4RUHA 1HW9A 2MQQA 4NLDA 3LW5C 2QYGA 4DPXA 1CEZA 1NK8A 4GO5X 2YKMA 1QUPA 1ZM9A 5JVGQ 4RW9A 4K2JA 3CDBA 4DUTA 4B3SJ 2DO4A 2IM2A 2CKWA 2K7KA 1D3WA 1WC5A 1MSWD 3U7JA 2BABA 5FLXU 2RRNA 1NKCA 4A8FA 1AUSL 3AXKA 1UA1A 3DXSX 1ZM3A 2ADBA 4FZVA 3L3CA 1TKXA 1WKLA 5HO4A 3RRGA 2YNFB 1NU4A 1T7PA 1XQIA 4L72B 2HLUA 3VAGA 1JQGA 5KG4A 4WWSA 2JDJA 4TKTA 3TUIC 5ETSA 3ILJA 5DDPC 1I6JA 4ZPWR 5E5NA 4QPXA 4CYUA 4LRDA 5J1PA 3HJFA 1YWXA 1X5PA 2DNQA 1HQUB 2RKIB 4RX6A 1GMUA 1VC5A 2GA7A 5D78A 3V81A 2JSXA 4N5SA 4DSFA 1YI2S 1N56A 3E01B 1FRIA 1MMLA 2CADA 4RKUC 4HACA 3TVZA 3SCJE 1S0VA 4K4WA 1YBAA 3R27A 2YWGA 1SC3B 3AH6A 3NEKA 2HNZB 1J5OA 1NDPA 1BMQB 1SXLA 3KG1A 3KK2A 4OZ5A 1NK7A 4EGLA 4K8RA 5KFJA 1ZETA 3KLHA 1HQ2A 2CDQA 4J37A 4ZP6A 2C3YA 2UXBF 3CCVS 2VG7B 3FSXA 5D3GA 2L9NA 5GAHI 3FGVA 4A46A 2QEXS 3MPWA 1D9AA 1OY6A 2HQ3A 3DHXA 3PCOB 3FFIB 4RZRA 4HLBA 3H5SA 4CH7A 4C48A 2VA3A 3DNCA 3FDSA 3DGPB 5L46A 3M32B 4U9RA 4ZA1A 2E9RX 1LEOA 1KKHA 1KVKA 3MEGA 4DF4A 8RUCA 3CDUA 1UWBA 2DGQA 5M2PA 3JXOA 1OMSA 3HKWA 4R8UB 3ZZRA 3MMCB 1GFWB 3PR4A 3FEXB 3H98A 2FJXA 4C8ZA 3SYZA 2OPRA 4DV4J 4WIQA 5KTQA 3UE2A 2WTFA 4DFKA 1GK8A 5K9FA 3CJSA 1DLOA 1OYEA 1W2IA 1UWAA 3M1VB 4U8VA 1RHJB 3MEEB 3W5ZA 6FDRA 2DXFA 3MCOA 2QA2A 2XZTB 5DQHA 2Z8QA 2KG0A 1MLAA 1GQEA 2NSBA 2H5JB 2KHDA 3M6XA 3MM6A 2B4OA 3NXZA 4TLRA 1IKWB 2B43A 2N4DA 2WBRA 3Q2SC 2R3VA 3EDQB 5CD4A 2W7PA 3DRRB 4F50A 1N5VA 2CZVC 5F8MA 1N88A 2R2TA 3QAEA 2D3O1 1P6TA 3D1QA 4O3NA 2DT9A 3U27A 2WW4A 3MR2A 2DR8A 4B9VA 2HVZA 4LF5F 4WU2A 4E8UA 4DS4A 3IP0A 4KBIA 4OYZA 4YY3J 4QWBA 3P5TL 2DHXA 1SUQB 2PFFB 3MUVP 4FVCA 4OI2A 3I9V9 4NZ6A 3KHGA 3ZZOA 1Q82T 2DVIA 1NHVA 1FX4A 3QZ8A 3PYDA 4EYHB 4EMDA 1HW8A 5JXSA 5HMYA 3KJVB 2R8GA 1YBUA 3I87A 3MM7A 5K8PA 2VBWA 5HBMA 2GJ2A 1Z2LA 2AX1A 2DGOA 4OMFG 2XGPA 3IR6B 1N0UA 5A8WB 2LXFA 3L4BC 1N5YA 2V9WA 1Q16B 3FZBA 4LSZB 2RHQB 4NLQA 3MOZA 4LF9F 4OX6A 4EEYA 1NK5A 3A12A 1RAOA 2FY1A 3MM5A 3EVMA 3R3TA 5FDLA 4JYAJ 1N6QB 3VAJA 1TELA 4UT4A 3JAMU 3CO9A 3DI6A 1QSYA 2CVIA 4LREA 2PO4A 4ELUA 2VONA 4ILLA 3PEHA 4DR5F 4DFPA 4NA3A 3K5OA 3S1TA 1S6OA 2CA9A 3QLHB 3DRPB 1Y10A 3BQ1A 3QNWB 2AJ2A 2V2ZA 1KHVA 1VQNS 1GH8A 3KG0A 1CJVB 4M5GA 1UAWA 3LP1A 3N9UC 2PT0A 5F9LA 1PC4A 3KYLA 4DR6J 1T8EA 2YXLA 1N33J 3G82B 4ANCA 4KTQA 4CLYA 4M5NA 2VU5A 1B0TA 1VR6A 2NXUA 3BDEA 3SV4A 2R7SA 4DG1A 3NY0A 4DV5F 5BYQA 3N6NA 2R7RA 1RTIA 2ZBQA 2OSRA 3CC2S 3V6DB 3EXYA 4A48A 3KLEA 3O3LA 5E41A 2WONB 4P9SA 4LFCJ 1RQ0A 3ZZYA 1H72C 2F40A 4ZJQA 1N5QA 2XNQA 2XYHB 5K8NA 4KO0B 3BF4A 4OZJA 2XS2A 5D4NA 1VK3A 4FDFA 1N6QA 3NS5A 4K4ZA 2DITA 1VS3A 1RTJB 3HHLA 1S9EA 4NRTA 4ZPCA 3M9OB 1VQLS 1O6XA 4X4SA 3H90A 5EWEA 2LEAA 2VICA 2OGUA 1DJ0A 2HGNA 1IKVB 2CPYA 2V9KA 1IWAA 2CQ0A 2CPXA 1T9VA 3HHDA 1WDDA 1WHYA 3IGNA 4NASA 3D67A 1YG0A 2RVJA 4NWBA 3UI3A 2PEBA 4BHQA 3OL9A 1SJRA 3Q2TC 3D0GE 2HKEA 4LFBF 5KG2A 1KOHA 2BUNA 2YNHA 4ZHRA 2BKNA 4V1Ak 2E1MC 2QA4S 4WU3A 2QV6A 4RW6A 2W4DA 1S7IA 2EWHA 2PMWA 2YWFA 3C2PA 4NMLA 4P7TA 1S79A 4KGKA 2YX1A 3Q83A 5BYSA 2HHWA 3W9HA 4FPRA 1B7YB 2DNHA 2VF3A 3JSYA 3R97A 3BGLA 1Q4RA 4DJBA 1NDKA 3GLJA 3SDEA 2X1AA 4ECQA 4B17A 1DTQB 4PXBA 3W1YC 1DURA 1R89A 3TW0A 1M0SA 4F3MA 4F02A 4M5DB 1OS5A 2ZOMA 2UU9J 3D6FB 3TJ8A 2EW9A 1RE1B 1VFJA 4G1IA 1MMNA 1WHVA 2ASJA 1X31C 4RW4A 4IR1A 3I5BA 5KFVA 2AEFA 3BPDA 1EETB 4KC5A 5D0RA 3G4SS 2ZH5A 4JBCA 3NMAA 1DY3A 3TJAA 2JEJA 1C0TA 5HI7A 3WX8A 3G6YA 4JV2A 2Y1RI 1FKOB 2NPIA 3C15B 2N4CA 5KG0A 5GADU 4WFAQ 2R2RA 1VC6A 2EFQA 1TK8A 1K44A 3QATA 5T41A 4L6V3 4QPTA 4L73A 2BKOA 4OYOA 4CO1A 2HNYA 2YNIA 4PG4A 4WKYA 1LV5A 1RHMB 3VGTA 1F2GA 2DGUA 3C6TB 1A6LA 1HKAA 2R7OA 3NCRA 3Q89A 5D4OA 3UDLA 3H5YA 4LMZA 2JFDA 1FERA 4X62F 3G6VA 4ZIWA 1TK5A 1LW2A 2YWEA 2H65B 3QAUA 2R8KA 2I9SA 1NO8A 9RUBA 4V19X 5KFAA 4EO8A 4MH8A 5EWGA 2BANA 5J1NA 4A8WA 3TOQA 3WIVA 2GS8A 3J7AN 3CE8A 4DF8A 1S1WB 4DPTA 4NCAA 4DV3J 3IAM9 5IQQA 5KFWA 4URSA 5U47A 4UOCA 4A8YA 1FI4A 1H0HB 1M5HA 2OPQB 4N41A 3IRXB 2EK1A 1MW7A 5JJBA 2CPIA 3CJTA 2ZUGA
chains in the Genus database with same CATH topology
4IOAQ 1NKBA 3BSAA 2I1RA 2OPQA 3BN7A 3LP2A 1KFSA 2F7VA 5KT6A 2CJAA 3MAHA 1FO1A 4Y00A 1V3ZA 1XR7A 3TA1A 2BE2B 3CDEA 3WC0A 2J9DE 2R7QA 2EBEA 1N52B 3D28A 3IS9A 2OKQA 3VZHA 2IBOA 1F5BA 1RTHA 2JH3A 3N5BA 1QVFR 3ITHB 3GR0A 3IFEA 2MKJA 3GFXA 2L3MA 3UR0A 3BSNA 4ILMA 2NPFA 1HWJA 4DR7F 2PMZD 1S76D 2VQFF 1FKPB 1A7GE 4I1TA 4AL7A 4C7QA 2KT5A 4CTAB 4DL2A 2XY5A 1TKDA 1AXQA 2DH7A 3NNCA 2VA2A 3PW0A 3K2YA 4I56A 2FC8A 4C3LA 1MMDA 1YJTA 4QR2A 3TVYA 3WX4A 2PI5A 4Q2MA 2OMLA 2UU9F 1C1CB 3K58A 4RW4B 2FJDB 1FTRA 2HWIA 2MZTA 5L1LA 2DNKA 3E8OA 4MYTA 3S6EA 4WZMA 4BWMA 3OLBA 4YB5A 1CLFA 2VKZG 4PXCA 4LT6A 4DSKA 1HMVA 3PRBA 4Y2CA 2WBMA 3I0RB 1KVIA 2IM1A 3T9ZA 1VQYA 3D5MA 3K5LA 2B9XA 1RDRA 2W9CB 1RKIA 4OL8A 1IR0A 3CD7A 1R8AA 1FJ7A 4C11A 1G6BA 2K1RB 4IG3A 3QGGA 3UDCA 4DL7A 1N48A 4DR1F 5SZTA 4TXSA 3LP1B 2J0XA 2VOPA 1LFPA 3KLIA 1YGYA 3DRPA 4WF9Q 3MFHA 3FMWA 4I7FA 3BO2A 1YTYA 5C25A 1U1RA 1SKWA 3C8YA 4Y65A 3OSNA 2V5HG 4DMZA 3KLGA 3N79A 2HHSA 1FRKA 2EFPA 4M8LA 1YVFA 2L41A 1B0PA 1UJ4A 4B9LA 3G6XA 4LF4F 4DOZA 2K3IA 4PUOA 2AQ4A 1C1BB 3S7RA 4QWDA 2UVRA 3H40A 1BWEA 2OFHX 7FD1A 3QGPA 3SSSA 3DRYA 2F4VF 4W90B 5AE2A 3MCSA 4NA2A 4QBUA 2RH3A 4OZNA 2IM0A 2IRUA 3C46A 4FS2A 4KAIA 2COLA 4WFYA 2R2UA 4ECTA 3QJPA 1HPZA 4RUCA 2J7WA 1FKAF 1TR0A 3DRXA 2JEIA 4K4UA 3W2WA 3CCUS 5DRKA 5B0DA 3H25A 2HG4A 4E98A 5LSOA 3P49B 2QYCA 2DISA 1KTVA 2FC9A 2ZH1A 1KQFB 2CQBA 1U8SA 1LW2B 1VLYA 3MEKA 2KFYA 5KFZA 4N77A 1F5CA 1UKUA 4M63A 1PSDA 1B7FA 1PC5A 5DETA 3IWNC 2PA8D 1QSSA 3KOAA 4P6QA 4HL9A 2LQ5A 2B51A 1T02A 3H8YA 3UNGC 4I2PB 3F56A 1LWFB 3KLEB 4OHVA 1GNKA 4B9NA 3O44A 2PD1A 3DCAA 5IXUA 2YH1A 2HFZA 3WDOA 4WK3A 1QE1A 4HT5A 1WACA 2O3DA 3VZIA 4NA1A 4KHPF 4JOUA 5LSRA 1X9MA 2HPUA 2JHEA 2BBEA 2FJAB 2WOMB 3GWCA 4RWXA 2MKKA 4YB1P 2E9TA 1SKRA 3IR5B 1MU2B 5AJ3F 3H4DA 1VQ7S 4JV1A 2OTJS 1MWYA 1VQOS 1FDBA 2LU1A 3CCZA 2QZ8A 1PO6A 5E3PA 2YNHB 4ZHRB 2HHQA 2DNLA 1YITS 4ID5A 2XSJB 2XC9A 2UUAF 1U6FA 4C0BA 4CNYA 3PV8A 1HNIA 4NLWA 4RBVA 3Q0AA 2W24A 5C42B 4HT7A 3I5CA 2WSCC 3HDSA 1RWUA 4P2SA 2AW0A 1DAXA 2OFGX 4KO0A 3HKZD 1FEEA 4OI4A 3JSRA 1SJ3P 4DL5A 4QWCA 2VPXB 4PQUA 3M2UA 4J9RA 3V6KA 3TUJC 4A8KA 4RW7A 5AE3A 5D4LA 3CPWR 5L1IA 1CPZA 1N36F 1RT1B 4E0DA 4Y2AA 2VASA 3OHBA 1Y4ZB 1FNOA 3KNAA 4KV8B 2B7CB 4IG3B 1YQHA 2N7CA 2XSJA 2FLPA 2I5JA 2ZC3A 3LWMA 2RQMA 2VODA 3J7Z5 4WTYA 3I6PA 3WBZA 4XO0A 5B0BA 4WFBQ 1J5OB 3BN4A 3CF5Q 1AUDA 3WZ0A 2IJNA 4IH7A 4H4MB 4I4BA 1HBUB 3MMJA 5I3PA 3N28A 4CH1A 3I4PA 2CQDA 2XCPA 1W2BR 1HBNB 3U1LA 1XNQF 3HVAA 1J5EF 4ZVFA 3DOLB 2GC8A 1D0EA 3OL7A 1MWZA 5B08A 1ZOTA 2WONA 2ZHBA 4MYUA 4KGMA 4O3QA 2RE1A 3GIMA 1XMQF 2ABYA 4D3GA 1VC0A 4CO0A 1S99A 2C3OA 4ICLB 4O44B 5AXNA 1B64A 3IGVA 2IAJB 5F9NA 5A8WA 4OZ1A 1N5YB 1NJZA 1Q7YT 1RI7A 5E3CA 3SFUA 2YH0A 2LCWA 2FHJD 1VHFA 5E3QA 1RTDB 3TAMB 4C97A 1D9DA 1L3KA 1CQNA 5CCMA 3IXQA 3HMJG 3DC2A 4DN9A 4UW2A 1R27B 3MTJA 3DLGA 3ITHA 4WK1A 3HP6A 3D2WA 2JWNA 1TVRB 1UVNA 1KD1T 1HI8A 4MK7A 1AROP 4X2BA 2HZCA 2ZE2A 3PZPA 4QYRA 3R5BA 1BQNA 5A0YA 2M5YA 4ILRA 5JUMA 1ULRA 2I2YA 1ELOA 1Y3KA 5KFKA 1UVIA 5LSLA 2AJ1A 2N3OA 2R7UA 2I0XA 1N8RT 2UP1A 1X5TA 2XEXA 2KG1A 5LMNF 1NH7A 2EVZA 2JL9A 3AQOA 3IWXA 1KLMB 3HFKA 4B3OA 4FF3A 2KYXA 5L9XA 1TV6B 4U7UK 5F3ZA 1MNEA 1VJWA 3DLEA 4PUOB 4FBUA 3KLVA 1FNXH 1FVSA 3J7YI 2OPRB 3H2LA 5GAEI 2MKSA 1FJCA 2YNGA 1X5OA 5J2NB 3MEDA 3GG0A 3PIOQ 4DLGA 2MSSA 3MM9A 3H5UA 3HHLD 1OSCA 3QMQA 3JTPA 3GV8B 3MMAA 2V2KA 1MROB 1KNZA 3R5DA 1RTHB 2CZ4A 3DOMA 3ICLA 4IDKA 3BDPA 3D1HA 2IC3B 3CJKB 2GMJA 5CYJA 1UVMA 2FGOA 3OV7A 3IC1A 3E3XA 3G96A 1Q1KA 4DL6A 4ES1A 1RT4B 2YTCA 3AJ2A 4Q0BB 2D1CA 1S97A 3SCLE 1OPIA 1Y00A 5ITHA 1JNZB 1S6QB 2UV8A 3POTA 1T03B 1K73T 1FA0A 1HQEB 2D9OA 1FESA 1KTQA 5J2MA 3IRXA 4X4UA 7FDRA 1B0VA 4W92B 1U47A 5K14A 3TAPA 3SZ2A 1N34F 3CCTA 4B3RF 1NRKA 2RKIA 4DV2F 3P3DA 1JLBA 2AD9A 3FEYB 4A8SA 1XWLA 4DR2F 4QW9A 2NSCA 2YX7A 1TKXB 3EPIA 2QSFA 1S72S 4JI5F 4BDPA 4X4NA 3TANA 2W9AA 3T5LA 3B78A 2IVMA 2YX4A 1TQLA 1JJHA 4H4OA 4TN2A 4JI6F 2AYGA 4QU6A 1S49A 1Z1ZA 5D77A 2FVQA 1RAJA 2MMYA 2OSQA 2GHWA 3M8QA 4F4KA 3VWSA 2I5JB 3EGZA 5D6GA 1QLNA 1RT4A 2P9GA 2Q43A 4ZCLA 4Q0BA 3EX7B 5KFEA 5HMXA 1SIWB 3F44A 3CMES 2GCFA 5CXTA 3JSMA 5F8GA 1XMBA 3OUYA 4NX9A 5IWAF 3HXMA 4XPEA 4MKAA 1GTHA 1HHSA 3MI7X 1SH2A 5KFXA 2XGQA 1C0UB 1FXDA 5H1SV 2CQIA 1ZTTA 1CC7A 1M5PC 3PW2A 1SJFA 4R0JA 2G0CA 1HBNA 3DLBA 2ERRA 4QW8A 1Y9OA 4KB7A 3CGIA 3QYYA 5KFGA 4WYWA 4EO6A 3SDEB 1SV5B 2KDOA 2MKCA 3DU6A 1ZBTA 4ZOSA 1KC8T 5F8LA 3EZ5A 4IOCQ 1L3TA 4OIXA 2PIIA 2SXLA 4EWTA 4A8XA 2K2PA 2Z4PA 4K0KF 2V94A 3C66A 1UEUA 2C42A 5KT3A 3K7RA 3RZAA 2VPZB 3LP0A 4EZ9A 4PRFA 3FSIA 2VUGA 4H4OB 1HBMB 5KG1A 1IKVA 3GE9A 4EUVA 3PR5B 4LVNP 4WFXA 4YB7A 1YIJS 4H4KA 4DV4F 3DU5A 3MF5A