1M5PC

Transition state stabilization by a catalytic rna
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
92
structure length
92
Chain Sequence
TRPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Transition state stabilization by a catalytic RNA
pubmed doi rcsb
source organism Homo sapiens
molecule tags Translation/rna
molecule keywords RNA INHIBITOR SUBSTRATE
total genus 23
structure length 92
sequence length 92
chains with identical sequence F
ec nomenclature
pdb deposition date 2002-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1m5pC00
2G4BA 3H2VE 2PE8A 2DGVA 4Y00A 2OSQA 2RQ4A 2YTCA 2J0QD 1X4GA 2RS2A 2MKHA 2E5GA 1DRZA 1S79A 3U1LA 5ITHA 2JWNA 3TYTA 4TU7A 2RVJA 4CQ1A 2AYMA 1M5KC 3NS6A 3UD4P 1YIJS 2M52A 1WI8A 1WHXA 3G6ES 4M5DB 2BOPA 1PO6A 2KU7A 1M1KT 2MQOA 2L41A 1X4DA 3CCRS 1UAWA 2E44A 4F02A 3IRWP 2FPHX 3CCLS 2MQNA 4W90B 1AUDA 4IOCQ 3VAFA 2DGQA 3CTRA 2MXYA 1YI2S 3BS9A 2KXNB 1U1LA 3VAHA 2FY1A 1NO8A 1UFWA 2GO9A 1R8HA 1BY9A 2GHPA 1SJQA 2J0SD 5GAEU 3K0JA 2DHSA 1U1MA 3S8SA 1JMTA 3G8SA 3NNAA 2CQGA 5BJRA 2DNMA 5IFMA 3D2WA 3PIOQ 2MPUA 2RNEA 2ZJPQ 1F9FA 3CCSS 2AYEA 1KD1T 1WTBA 5LXYA 2XNQA 2U1AA 2MJUA 2CPDA 3P3DA 2E5HA 2DGUA 2X1AA 1VQ4S 2MKKA 3CC7S 2MQLA 1X4CA 1OO0B 1H2UX 2G0CA 1JJ4A 2DIUA 2KT5A 1XN9A 4P6QA 2DNRA 3EGNA 3CMAS 1G2EA 3TO8A 4U67Q 1Q86T 1X5PA 1X4FA 3H2UB 5HL7Q 2CQBA 3VAMA 4LMZA 1RK8A 1X0FA 2MZJA 4LIRA 1U1OA 1DBDA 1N54B 3R27A 2J8AA 2DGOA 2MQPA 1VQOS 1WWHA 2RQCA 3BO2A 4QPTA 4UY8T 4TLQA 1M5VC 1SJ4P 3HI9A 4CIOA 1HL6A 3BO4A 3U1MA 4QQBA 4QU6A 4WIIA 3CCES 3MOJB 1VC5A 3J7ZT 2MKJA 1WEXA 2OSRA 5GADU 5MLCV 2YH0A 3OW2R 2N82B 2NLWA 2A3JA 4F26A 3G4SS 1WHYA 2N7CA 1FNXH 1D8ZA 3CF5Q 4OZ1A 2WBRA 5GVQA 1HD1A 1URNA 3CPWR 1VBXA 2MZ1A 2N3LA 2JX2A 2YH1A 2EVZA 2LEBA 3I56S 1IQTA 1X4AA 2CQCA 2M0GB 2MQQA 1WG4A 1FT8A 1ZZNA 2MGZB 3MURP 2KI2A 2M2BA 4ZKAA 1WG5A 2MSTA 3G9CA 3NNCA 2LA6A 1HD0A 1FHTA 2MY7A 3L3CA 1VQNS 4BS2A 3RW7A 2RRBA 3CCJS 3NMRA 2OTJS 1K8AT 3UD3P 2LXUA 2KM8B 2MZSA 1YITS 1CVJA 1VQKS 5LXRA 2OJ3A 4WKRA 5DDQC 3US5A 2DNLA 1VQ7S 2SXLA 5IM0A 2NZ4A 2AYGA 4W92B 3B4DA 2CQIA 2X1FA 3P6YC 4PKDB 3MI7X 1YJWS 2I2YA 3N9UC 2DK2A 5HO4A 2LQ5A 2CQ4A 5D77A 5DM6Q 3S6EA 5IM0B 4PRFA 3VAJA 5GAHU 1X4EA 2X1GA 2LEAA 1KOHA 1L3KA 3CXCR 2DNNA 1YHQS 1H2VZ 2CPFA 1U2FA 1WEYA 4C7QA 1QM9A 2XS2A 3MDFA 2DIVA 1WI6A 4EGLA 2LYVA 1U1NA 1ZZFA 2DGXA 1N52B 2DNOA 1VQ8S 2CJKA 2FC9A 3EGZA 2FC8A 2K3KA 1UP1A 5IQQA 2D3OR 2M8DB 2KRRA 3MUTP 3MD1A 1P1TA 2AYBA 1HA1A 3CCMS 3S01A 2D9PA 4A8XA 4FXVA 1JJHA 1WHVA 2CQ3A 1W2BR 2DH9A 1M90T 5GAGU 4ED5A 1YJ9S 2ZJQQ 1DZ5A 5CYJA 2PEHA 2JVOA 1WHWA 2OTLS 2MB0B 5LJ3Y 2CPEA 4CH1A 1X5SA 1O0PA 3R1LA 1A9NB 3VALA 3JB9k 2U2FA 2KG1A 1WEZA 4WF9Q 2LMIA 2Q79A 4UQTA 2JRSA 4YUDA 2CQ2A 1R8PA 2CPHA 3MD3A 2VOPA 2DISA 2MZQA 4YB1P 1VQ6S 2D9OA 1D9AA 2MHNA 4ERDA 3SXLA 2DHGA 2VODA 2RT3A 2XSFA 5DETA 2F9JA 1M5OC 2CQPA 4J5OA 4RU2A 1N8RT 1N88A 2MQMA 1NJIT 3ZZYA 1K73T 5LSOA 3CCUS 2HYIB 1Q82T 2CPXA 3DLLQ 2MSSA 3CUNA 2CPZA 1A7GE 2HGLA 1RKJA 3S7RA 4WFNQ 2KG0A 1VQ5S 2DITA 2DHAA 2O3DA 2L08A 3Q2SC 5LSLA 4IO9Q 1WELA 1FJ7A 2KVIA 2XB2D 2FHOB 5CA5A 2KFYA 4F25A 5JVHQ 2L9WA 2K8GA 1YTYA 5DDRC 1S72S 2B0GA 2CPJA 2DHXA 1WG1A 2LA4A 3THPA 1SXLA 4IOAQ 4C0OC 2YWKA 3FEXB 2DO4A 2DO0A 1U6BA 2LCWA 2DNZA 2LXIA 3DXBA 5LJ5Y 2CPIA 2EK6A 1FXLA 3MUMP 1P27B 2KN4A 2RRAA 2J76E 2EK1A 2KXHA 2E5IA 3ULHA 1U1PA 1SJFA 3CMES 4C4WA 2XNRA 2JVRA 3P49B 1YWXA 2M9KA 5CXTA 1UW4A 2RUGA 1VQMS 2HGMA 4CH0S 3VAIA 3HHNB 2MKIA 3CULA 2CQ0A 1SJ3P 2CPYA 3SMZA 2CQHA 2MZTA 2KXFA 2QEXS 1OIAA 1H2TZ 3NS5A 2DNGA 4QU7A 1QVGR 2ZJRQ 1VQPS 2HZCA 3B4MA 1M5PC 2XS5A 2MMYA 3LPYA 5JVGQ 4TU8A 1H6KX 2M8HA 2RU3A 2AD9A 3PIPQ 2M7SA 2M70A 3VF0B 3G71S 3UCGA 3P5TL 2DGWA 2BZ2A 2V94A 1FJEB 4FXWA 3Q2TC 4WCEQ 5EN1A 2KRBA 3TP2A 2ADCA 1U1RA 1VQ9S 3EX7B 1WF1A 2KH9A 2QA4S 4PR6A 2XS7A 5DDPC 1VC0A 2DNQA 3VAGA 1Q81T 4IUFA 2YKAA 2HGNA 2MZRA 4V19X 1U1QA 2F9DA 2DB1A 2RS8A 3BO3A 4Z2XA 2CQDA 3FEYB 3CC4S 2KYXA 1X4HA 3NNHA 3CC2S 2MKSA 3SDEB 1U6FA 2CQ1A 2KM8C 2DNYA 3VAKA 2MYFA 5DDOC 3R1HA 1KQSR 2KHCA 1SJRA 1KOOA 2X1BA 1VBZA 2ADBA 5DM7Q 2MKCA 4OZ0A 2UP1A 1JJ2R 1K9MT 2ERRA 1KC8T 3MUVP 3G8TA 3CCVS 1QVFR 1WF2A 1PGZA 3CD6S 1FO1A 1X5TA 3UCZP 2DNKA 2DNHA 2E5JA 4LJMA 1DHMA 1YJNS 2MJNA 4YOEA 1VC6A 1OWXA 1VBYA 3ZZZA 1NU4A 1VQLS 1FJCA 3V4MA 1U1KA 2LECA 2M88A 3UE2A 2VONA 5D78A 2VOOA 1Q7YT 1WF0A 3G96A 4Y0FA 3UWTA 1X4BA 5H1SV 3IWNC 2DH7A 2MY8A 2OIHA 2LKZA 3RW6A 2N3OA 2DGTA 1OPIA 2I38A 3BEGB 4WFAQ 4TU9A 1X5OA 3UCUP 1ZH5A 4WFBQ 2G1DA 2HVZA 3SDEA 3I55S 3MXHP 3CCQS 2M4MA 2F3JA 2MGZA 3J7YU 2DGSA 2DH8A 3LQVA 2QFJA 1B7FA 5FJ4A 3THTA 2DNPA 5GMKa
chains in the Genus database with same CATH superfamily
2PE8A 4M94A 2QLWA 2QTWA 2VF3A 2YNHA 3VV2B 3KHRA 4LVNP 4O44A 3HP6A 4DV3J 2DGVA 3EPIA 4PXEA 2W9AA 2RQ4A 1XEZA 3CD7A 3KLFB 1Y5LB 1URRA 3I0SB 3WIVA 1ZAXA 4OZ2A 1LFPA 5ETTA 3DLHA 3FFIB 1X4GA 1HNIB 3RBXA 1N36F 1P9YA 1WKKA 5CQGA 4LFCJ 5HP1B 1NSAA 5CABA 3CDBA 2OPSA 4NLXA 4ED1A 4ED6A 3TANA 2RMLA 3SSSA 2CDRB 1K0TA 7FD1A 5KTQA 1RTJB 4URGA 5ITHA 2Q6BA 3TYTA 3RB6A 2RILA 2AP6A 2ZBCA 3FRZA 4LSLB 2XSJA 1IWGA 4UY85 3TAMB 3AOBA 4DHVA 4IQXA 3TZZA 2FLLA 4C8YA 4YR3A 5ETMA 4A8YA 3EVMA 4LF7J 4JI1F 1WHXA 3M8SA 3G6ES 4M5DB 2BOPA 4NMLA 4QBUA 1BQMB 1RXOB 1S9GB 4C6AA 2BJ7A 2KO1A 1GAOA 1P1LA 3IBCB 2OFHX 3OT9A 1LQ9A 1PCAA 4ZVTB 5IS2A 1OQ3A 1UAWA 5KG5A 3DI6B 1JLAB 1MMDA 2E44A 4HL9A 3WC0A 4ZK7M 2UUAF 3KHLA 3M6UA 3KTQA 1NHVA 2DHHA 2V2QA 1RZMA 5F41A 2C3OA 2FPHX 3Q86A 2F65A 1HLWA 1AUDA 3QRRA 1RT5A 2BANB 1FA0A 2DGQA 3CTRA 1APSA 2FVRA 4JYAJ 3O8WA 2VPZB 2H4YB 3TRGA 2DEIA 5KFIA 3UN2A 1MNEA 1JLFB 1SKUB 4DN9A 3U1NA 2J0SD 4A46A 1C1BA 4OX8A 2ALZA 3FC9A 1Y10A 3PYGA 3FNNA 4JV1A 3VVUA 1JMTA 4OZJA 3AQOA 3V4IB 5K9FA 4PPZA 2E7VA 1C0UA 2GQQA 3NAHA 4ZCKA 8ATCB 2XM3A 4DXLA 3D2WA 3PIOQ 3BN7A 1PSDA 4DV1J 1F9FA 1ZM3A 1WOPA 5HQMA 3CCSS 1KD1T 4X4PA 2BE2B 2FJEB 4F8RA 3G8QA 2AJFE 2U1AA 3LP2B 5DQGA 5IT9U 5E2QA 3UQSA 5A8KB 1R0AA 2DGUA 2ASJA 2MKKA 2OEJA 4LVOP 4J9KA 2HHHJ 1RAOA 3A13A 2W2QP 2ZC3A 3PJ9A 1H2UX 4C11B 1JJ4A 2GIRA 4X65F 1T9XA 3RZAA 5I42B 5DG7A 3GP9A 1HI0P 3QAEA 1RHUB 4UOHA 1GMWD 5ETVA 3TO8A 4A8WA 1AYEA 3BV8A 1GK8A 1X5PA 4XTTA 1V3RA 2VBYA 5HL7Q 1FE4A 4L74A 4PG5A 4MK8A 3VAMA 1ZH5A 4NX9A 1HBUA 3GG0A 4YDXA 3TQEA 4ZMMA 5A76A 1N5YA 1NRKA 1DY3A 3A3PB 4PXBA 3D0GE 4J9LA 4ZPDA 2CG4A 2MQPA 2GS8A 5I3UA 4PUOA 1NJXA 3L95X 1C2PA 1WWHA 4Q8EA 3BO2A 1S77D 2VDHA 4M5HA 4DV2F 1CEZA 1OY6A 3W63A 4UY8T 4NZ6A 1HPZA 2KFNA 3DRSA 3QGHA 3UDVA 2HRUA 3IR6B 3MMAB 1S1WA 1VK8A 3HVRA 1MMNA 2EW9A 2FJXA 4IFYA 4AQYJ 3I96A 3VZHA 3R2DJ 1N33J 1RT3B 3KMSA 3DMJB 2QT7A 2E1AA 4L6V3 4QIGA 4P74A 4WIIA 2O1PA 5HVFA 2BACA 1QAXA 3J7ZT 1CG2A 1RTHB 1WEXA 2OSRA 5GADU 2YPZA 2H9ZA 2YH0A 2BJ3A 1VOMA 1X7VA 2RF2A 4Z37A 1EQMA 3C6UA 1ZM4A 5T7LB 1B7YB 2FQQB 2NLWA 4C8MA 2N82B 4MJKA 3J81j 4WZMA 1JLGB 1EX8A 1R27B 2FHKA 1RLDA 3LAKA 4IQMA 4ZPWR 5DO2A 4AQYF 4X62J 3WHIA 4LF9J 1H98A 2F1FA 5M2RA 3H5UA 2VG7A 2VQFF 3MR3A 5GVQA 1HD1A 4AYBD 1FWLA 3CPWR 1FFGB 1X9MA 1GFWB 2MZ1A 2N3LA 4X84A 4M5NA 4ANCA 4LF6J 1S1WB 1IBLF 1XNRF 4NCBA 2O67A 4PXCA 4LRCA 2CQCA 1PILA 3KOAA 3UW1A 4J9PA 4FBUA 3GJRB 3VHQA 2C2KB 3M2RA 1WG4A 1FT8A 2HQIA 2H54B 4KGKA 2ZVSA 4EMDA 2MGZB 3I31A 2ZBQA 3B8HA 4WYLA 3MURP 2M2BA 2XYGB 4X66F 1KQFB 1WG5A 3QRPA 1CS4B 1WD6A 5KT7A 2UVRA 2CNOB 5IV4A 2Z0GA 1S57A 2QX0A 2RQKA 2XHWA 1UZDA 2LA6A 4XPEA 3SV4A 4QW8A 1K1QA 3KKFA 4LFBF 1LOUA 1S6PA 2A0FB 3O6QA 4CO2A 4KFBB 1BXNA 1FK9B 4RW9A 2OPQB 2WB4A 4OHZA 5I42A 1XQIA 3UD3P 2EI5A 1KP6A 4K5RA 3FZ2A 4YDDB 2KM8B 2LVWA 3VGTA 1G1XA 3RAQA 3JXOA 1XC9A 2HKEA 3I4HX 1UKUA 4TLRA 1JXVA 2UVVA 1F5BA 3FJ2A 3GE9A 5E3PA 5A0YB 2XWYA 2K2PA 3NGDA 1R0AB 2VH7A 4USWA 3QO9B 3LP2A 2HVHA 3JSRA 3MM8A 1XMQJ 2BE2A 4H4KC 2NR0A 4I68A 3US5A 5J2PA 4R5PB 4NPOA 4I0WA 2DTJA 4X2BA 2IJRA 1SC3B 3O3LA 4O23A 1C0UB 3PW5A 2R2RA 5D3GB 1HWJA 2CQIA 2KVQE 2X1FA 4TQSA 4DR2J 2ROPA 4JI3J 3PY8A 1XK8A 2AJ1A 2EFGA 2FGOA 3DOMB 2H65B 3D6MB 5HO4A 3V6HA 4NZ7A 1AXQA 2J9DE 1LWXA 2QLXA 2WSFC 3GU0A 5D77A 5F9LA 1G3OA 2EFVA 2F4VF 3FMWA 3OL8A 3OFFA 1WNEA 3Q8VA 2UUBJ 4PRFA 3T5LA 4Q0BB 2XBPA 2WHOA 4W4MA 3OJSA 1S7HA 2X1GA 1NJZA 3EM1A 4DWIA 3NG8A 1L3KA 3QO9A 4JB8B 1S1VB 3IFEA 3KK3B 1UPPA 1FWKA 1RT5B 3J7Z5 3KLHB 1RWNB 4USUA 2MTLA 5J2NB 2C2RA 3T1HF 2UXBJ 3GSIA 2MKYA 2LU1A 3W9HA 4PG4A 2L3MA 3H5YA 2CZ9A 1BWVA 6FD1A 1NPPA 1VQYA 3AHPA 3UPFA 1U1NA 1L3UA 2OPQA 2BV3A 2DGXA 5A2QU 4LF7F 2RE1A 1AB8A 1FK9A 4LRDA 4RW9B 4ALZA 5C7PA 3MHYA 3C46A 1JQGA 1HNWF 1S6PB 2DNOA 3D1OA 3M7VA 2I6WA 3VQSA 1S9GA 3GJQB 1BQMA 4NYZA 5L8RC 2ZEJA 4MH8A 2R7WA 5GAEI 5IQQA 1S0NA 1QLNA 2D3OR 4ANDA 2KT2A 2BX6A 4HTJA 4QWAA 2C42A 2J0XA 5KFAA 3TAMA 4RR5A 4LBIA 1HA1A 2R4FA 4OX9F 2DY1A 9ATCB 5KFQA 4X4OA 2HHVA 4LFBJ 4FXVA 1RDRA 1T11A 1RU2A 1YG0A 2GVZA 2OD4A 3W7BA 1U26A 2Z4PA 1TL5A 5T41A 4P2XA 1HARA 2DH9A 2YWGA 3FFIA 3D3CJ 3D67A 3HHLB 5GAGU 1N0VC 2HFZA 2VFVA 3KLFA 4A8FA 4ED7A 2VG7B 2CPEA 3TA0A 1NM2A 1TKXA 1IBLJ 2HS3A 2YNHB 4Y28C 1O0PA 1XERA 1FNOA 3MPVA 3HDSA 2EFPA 4F4YA 3TAPA 2BQ3A 5LMNJ 3AB4B 4UQTA 3C6UB 5E0OA 2JRSA 4M5MA 4EWTA 1OS5A 1RT2A 4K8RA 2CQ2A 2B7BB 2CPHA 4MMOA 4Y6IA 1NDLA 1RTIA 5IC4B 3MD3A 1RSCA 3OL6A 4ECUA 3R7NB 2DISA 2MZQA 2A2CA 2XZTB 3AOCA 3DMJA 2KB2A 3KUHA 4MK9A 2XO6A 4FF4A 1KTQA 2IMWP 4RW4A 3A8JA 2QMXA 4YB5A 2HNZB 2H5JB 2X3DA 2AWZA 2F9JA 3EXCX 3DRSB 3MMAA 1HPZB 4DV5F 1HNXJ 5HMZA 4K4TA 1I3OB 2Y9HA 1HIYA 1VISA 1J2VA 3JTPA 1N8RT 1QSLA 4NYPA 5KT3A 1VGYA 3M9OB 4JI5J 1NJIT 2IRUA 2VBWA 1XR5A 2C3MA 2KDOA 5I3UB 3H25A 3O44A 2HYIB 4J9RA 3DLLQ 2MSSA 2CPZA 2HGLA 2ALYB 2OHDA 4DV2J 3W2VA 1RISA 4DSEA 1S6OA 3CJ5A 3TJ8A 4WFNQ 3PW0A 1KNZA 2H1YA 4TNOA 3Q2SC 5LSLA 2B43A 4GKJJ 2KVIA 2FHOB 4F25A 3MCOA 4ZVGA 1ZM2A 3I32A 3M6VA 3FBEA 3M4XA 1UEKA 5F8IA 4B3SF 2BKPA 3FCWA 1T94A 2PDAA 1RE1B 2FTRA 3MEDB 4PWDB 4N8NA 2BVZA 2V50A 3K8VA 5A8KA 1BE4A 3THPA 4UOGA 4ZLNA 4IOAQ 5E3AA 2J8SA 2NS1B 2XMTA 1VK3A 1PYTA 1KS2A 3GMGA 4FYWB 1NBEB 4LR9A 5LSRA 2HBYB 2DO0A 3I0RA 4QPXA 4EYHB 2LXIA 1ZPVA 2GQ2A 5LJ5Y 5THWA 1Q5VA 5BYSA 3V4IA 5F8JA 5KFJA 3MOZA 5KG6A 5LOQA 3QFHA 2RKIA 1U1PA 1F3VA 3HHNB 4I7FB 4C4WA 5C24A 3FEZA 1SUQA 2NPFA 2QSFA 1HR0J 2CA9A 4DU8A 4B08A 3BKFA 3I87A 2DKOB 2DXFA 1YWXA 1VS3A 2BE9B 1JJCB 2XMKA 2RUGA 1QE1A 4C0HA 5C25B 1CJUB 2PMHA 4OYXA 4G1PA 3H2LA 2CQ0A 2WVBA 2BANA 2QG9B 5B0GA 5KFDA 3KLGA 3X1LB 4RBUA 1NLKL 2KXFA 3R9LA 2VPWB 1RWVB 3LWMA 4ES3A 3UFCX 1H2TZ 3ZTQA 3HULA 1JKHB 1S12A 2DNGA 3M2VB 3N01A 1H3DA 2YVSA 3CJKB 2ZJRQ 1U2RA 1RHMB 2BRKA 4C9DA 1TUVA 2BYCA 4CNYA 3DLEA 4TU8A 1JX4A 3ZZRA 1H6KX 3IN5A 3KHHA 5B0DA 3AXKA 4IH7A 5DLGA 1IKYA 1RU1A 3JYTA 2UXCF 1BUXA 2CADA 3CB4A 4M5DA 3MR7A 3MEEA 2QRRA 5KFPA 2DGWA 3QSIA 2HNDA 4FPRA 5ETNA 5HMWA 4IDKB 1QTMA 2VKRA 3RAXA 4U8YA 3WX4A 3R8YA 1SKSA 1U8SA 1AA1B 5F8HA 2IRYA 2QL7B 3UVJA 5GAGI 5EN1A 4ZN3A 3GR1A 3ONQA 4I56A 3K57A 4DV4F 5HP1A 2Q66A 4WP8A 1CJTB 5HVHA 4DR6J 5KFWA 3EX7B 2CNKB 1WOOA 3QRQA 4M1KA 1V9OA 1FXRA 1SQGA 4KGMA 4OIXA 5DDPC 1VC0A 2XS7A 1RWUA 2KL8A 2XZWA 4ZIWA 1S1TB 2DRDA 5A6PA 5J1NA 4IYQA 1IBKF 4RKUC 5DQIA 2XMUA 2BA9A 1UMJA 4KBIA 4CYUB 2YKQA 2E1PA 1N48A 1U6ZA 1RJJA 4WKYA 2DB1A 3OXFA 2IHR1 2RS8A 3F44A 1FRIA 2VL1A 3HVTB 2QYCA 3SCKE 3CC4S 4JI2F 2HHTA 4ZPBA 1HQEB 1X4HA 1T03A 4USHA 1UVNA 4DCJB 4DG1B 1JXLA 3ENVA 1YLXA 3E01B 1JK9B 4DLGA 1YBAA 4M5GA 5ETSA 3OVAA 4N7TA 4DL2A 1S10A 1XNRJ 3DOLA 3PJXA 1YJRA 1HHTP 1TKTA 5EX3A 2HAFA 2MYFA 2VZ9A 4KHMA 2PMZD 4CO3A 5K8MA 3OR2B 2JLGA 3VAKA 3R1HA 3NGUA 4A8KA 3C3LA 5B0AA 5KT6A 1DARA 1OSCA 1SJRA 2LDIA 1UTAA 1DJ0A 4Q44A 2ZHBA 3RR7A 3HK2A 4FDFA 3M8ZA 3T9NA 4DJBA 2HG4A 3HKZD 2FY8A 2MKCA 3ZC4A 3K5MA 2KZZA 3ETMA 2EFNA 3QBCA 4NLOA 1KC8T 4MIAA 2KHDA 3HT3A 1V5IB 3MUVP 4DMZA 2E5LF 2HVDA 3SCJE 4ZPCA 1Z2ZA 2QMUB 3KLEB 4ER8A 2XMVA 1NSQA 1TAUA 4QR1A 5ETPA 3AA9A 4J7CA 1VQSA 2P5VA 3UD5A 3EUNA 1GMWA 4ECRA 2HMIB 1Q8KA 1YJUA 4NXMF 1FO1A 3GCXP 1X5TA 4I64A 2FVPA 1RABB 4BWMA 2GZOA 4HH0A 4BC9A 4LQ3A 2D74B 1NK8A 4NL5A 3NGSA 1FTRA 4IUFA 3MGJA 1RT6A 1VRQC 1M1GA 1RT1A 1Y9OA 4HT5A 1VC6A 1GX5A 2K1RB 2Y1RI 4C3LA 3ZZZA 4I2QB 3TOQA 1JLCB 2VFTA 1HBMB 1QAJA 4IR9A 3M8RA 4HHHA 3LWLA 2CVEA 4ZS6A 4IFVA 3HLUA 1RAIB 3TUIC 1U0SA 1MU2B 2V8GA 3PVXA 1IBMJ 3LGMA 2HPUA 1K1SA 3ISND 5K14A 1KTVA 4USIA 3UWTA 4GRSA 2OMOA 3IWNC 3HHDA 1TL3B 3M1VA 1X9WA 3CCZA 2XCAA 1WORA 1Z4UA 2E9ZA 1VJWA 3RW6A 1VMBA 5HMXA 2N3OA 4KYZA 4YR2A 2Z2MA 3TX8A 4PG8A 4OHVA 1EP4A 2AU0A 2AV5A 4WFAQ 4DSJA 3LGNA 1AW0A 1O5JA 3ET6B 1SIZA 3QLHA 5KFHA 2DT9A 1MWQA 1BHNA 1CJVB 1JB0C 4Y2IA 4ZVUB 2OH2A 3I55S 4OJHA 5L39A 3BQ2A 2RD5C 4ED2A 3IBWA 2F3JA 1C0TA 1KVKA 1GEHA 3C15A 2HNYB 3NWGA 3I5AA 5A8WB 1B7FA 5FJ4A 2AHOB 2FVQA 3MFHA 2DNPA 2MB0B 5GMKa 1RHQB 1REVA 3H2VE 2IMOA 5I3PA 2HZVA 2V2VA 1DTTB 5KOWA 4K4VA 2IM1A 3KG4A 1FX2A 2KTQA 1JXEA 2JLFA 2HS0A 1E6VB 2KT3A 3BSAA 1NDKA 3NLCA 4K4ZA 1GT8A 1AZSB 5D0GA 4CCHA 2CJAA 1PBUA 2GVDA 3E2EA 1OJ4A 5BR8F 4JV5F 5KFUA 2ZVIA 1DTTA 2BJ8A 1DRZA 1XNQJ 4ZVOB 1S79A 1FEEA 2HWTA 3M2UA 2ZKTA 2HRYA 2FB0A 1ITPA 4M5IA 4MIWA 4P10A 1B4SA 5AXKA 4U95A 4ZITA 3HHLC 4CWBA 4JUZA 3DOKB 2HNYA 4TU7A 2ZM6F 1ZAVA 4TY9A 3K8WA 2FDNA 2UUAJ 5ETLA 2R42A 3IG1A 2GIQA 4PEOA 2ASLA 4UUWA 2PI5A 4I69A 3DRYA 5EGYA 3UDEA 3R3TA 1TL1A 4OZLA 2JFKA 3OD2A 2XLIA 5HN0A 3J7YI 1AUSL 3L7PA 3MM5A 3OL7A 1T03B 4DR4F 4G1QB 2YXLA 3A4TA 3E8OA 2L41A 3OJUA 1GX6A 2P9EA 3D0IE 1UWBA 2CDQA 3MMBB 4OYAA 3OV7A 2BMBA 3CIMA 3PRDA 1HHQA 3FQKA 3D68A 5IWAF 4TY8B 3H4BA 1Q7LB 5KFXA 1D1UA 1U8WA 2FYXA 4NA1A 2NYHA 2MQNA 3KNAA 3PFOA 3M1VB 4NRTA 3NL0A 1SC1B 3QWUA 3TVYA 4LFCF 1FFWB 1U0HB 2HQGA 3JSMA 5K14B 2F4VJ 1HBNA 1YI2S 1V3SA 4KV8B 2KXNB 1U1LA 3VAHA 2PO4A 1MU2A 1NO8A 1C1CA 1UFWA 2YY3A 1K0VA 1V3ZA 4DR2F 4LF2A 2UZAA 1PC5A 2WSEC 4QR0A 1HBMA 2DR6A 4KGZB 2IYGA 3HFVA 5DGAA 3CJ4A 1UCNA 3PRBA 4J91A 1WSRA 4L3KA 4F7VA 2RB7A 4FF2A 3SSQA 1KFDA 2N7YA 3G8SA 1XMQF 3LP0B 2OPPA 1TL4A 3S1TA 5CH7B 1NUEA 1A6LA 1RHJB 2DNMA 2PFDA 3GFHA 3M05A 5HATA 3Q22A 5LMUF 2YWHA 1YRXA 3K7RA 3LH2S 2ZJPQ 3DDNA 3CO0P 4C97A 2VV5A 2JNJA 3DYAA 2VQEF 1F5AA 4F0KA 2HMIA 1F2GA 2C3YA 1E6YA 2MJUA 1ICEB 3RYLA 5B09A 2JEGA 1IKVA 4DLEA 1NXIA 1X4CA 1KONA 3N6LA 4HDHA 4AXIA 4FP9A 1JLQB 1OO0B 2CUYA 3V6KA 2G0CA 4JI6F 2QLBB 2AQ4A 3KG0A 2W9CB 3M8PB 2B4VA 2ASYA 4QOTA 2KT5A 1RAFB 1XN9A 4P6QA 3PG9A 3KK2A 2LXFA 2W7OA 3BYPA 3EGNA 2HFUA 1UEVA 4IH5A 1ULRA 4WFZA 3T1YF 1Q86T 4KSEB 1Q1KA 2FLOA 1N5VA 4FN5A 3OR2A 1EKRA 1D8YA 4KTQA 1TELA 5KFMA 1OYEA 1VCTA 1Y0HA 2A18A 1RK8A 2MLXA 2MZJA 5KFLA 4LIRA 1X0FA 4I2PB 1KN6A 4RUCA 1BC6A 4UUXA 3D7SB 4JI0F 3RJMB 3DXSX 1NKCA 1H7WA 1PYSB 2W25A 1FEHA 1UVKA 3HVTA 4QPTA 2UXBF 5AXNA 2B3TB 3OFGA 3VVTA 1W25A 4WWSA 4QWEA 1NH7A 1SJ4P 2YX4A 3MEKA 3HI9A 3O5TB 3EZ5A 4O0IA 3KJVB 2R7QA 4TKTA 3FKBA 1NB2A 1PIEA 2HLUA 2J7KA 2E29A 3M30B 3QIPB 5IV3A 4QU6A 1YBTA 2Z8QA 3CCTA 3HZGA 5AXLA 3GJTB 3HJFA 2YNIA 3ITHA 2ZZMA 4X64J 3HX9A 1LW0A 3OW2R 3UVJB 2ADCA 3IM8A 2AJ4A 3I4PA 4RNFA 3W3SA 2A3JA 2FZGB 4DUZF 1SL0A 1WHYA 2IC3B 2OELA 3C6TA 4Y3CA 5E3QA 5HSPA 4ED8A 1FNXH 1KWMA 4OZ1A 4DQQA 3DLGB 2DVIA 1IM6A 4FNHA 2HFNA 1FF2A 1KQKA 1TV6B 3U02A 3TQ1A 1ZTWA 1S0MA 1IVZA 5FLXU 1ZA2B 2HIQA 2JX2A 2HHXA 3CJRA 4QYZJ 3DHXA 3W62A 1B0TA 4U96A 3A12A 1ZAWA 2QSWA 2KKHA 3NOGA 3QMQA 4PWWA 1X4AA 2GNKA 2WVDA 4ED4A 5EWEA 3PW7A 2B6AB 4CLTA 5FLXY 2LQ8A 1EKSA 1NJYA 4QIWD 2EG1A 3W2WB 1JKHA 3M2VA 1ZZNA 2HBRB 3RB0A 1YZ6A 3GFXA 1T3OA 5J1EA 4DI6A 4F50A 1BQXA 4TYBA 4P52A 5A8RA 3FUYA 2AX1A 1FJGF 5C25A 2BUNA 1T9UA 2DCLA 4KGXB 5KAKA 5AXMA 3NNCA 3ENQA 3V81B 2MY7A 5HLFA 4B9SA 4FPIA 4LF8J 2R7TA 1TKZA 2RRBA 5K5MA 4O3PA 1SIWB 1IBCB 8AT1B 1SUQB 3TR5A 3K89A 2ZHAA 4I7FA 1LWEB 3K58A 2FIUA 2J7WA 4ZP7A 1K8AT 5KG1A 5CZVA 4ECSA 4DPTA 4K50A 2I8EA 2FJDB 1SPBP 3KJNB 3M8YA 4N41A 3BDEA 3W60A 1YJTA 2ROEA 5LXRA 2C2NA 5A6WA 1RAEB 1RYSA 2R7XA 1WC0A 2ATLA 5DDQC 3HFZB 2HHPA 3M8QA 1VQ7S 2B8QA 4QIFA 3W9JA 5IT4A 4YEAA 2BDPA 1RHKB 4AL7A 4PWDA 2G1HA 5KFRA 5HI7A 2AYGA 2HW3A 3B4DA 1RTDA 2V34A 5AE2A 5KT5A 3CT9A 1FKOB 5DG9A 1CPZA 3QYYA 2EBEA 3IP0A 3N9UC 4WK3A 5AE1A 1Y5NB 4X4QA 1OY8A 1RAJA 3NMAA 5DM6Q 3ADAC 4TXSA 4UTGA 5DS7A 1S4EA 1LW2B 3DU5A 1KVIA 3OTDA 3VAJA 2J0WA 4OYIA 1HKAA 3AY0A 2Z58B 4P2FA 5GAHU 1X4EA 1Y00A 3W61A 4Y34A 2RJZA 3KJFB 3UDLA 3ZZOA 3MAHA 4YS2A 3KYLA 1U2FA 1DAXA 4MKBA 4XDDA 4LIWA 5H9FJ 3G82A 2X3GA 1FERA 3MECA 2ZD1B 3GZ7A 4YHHJ 4LBPA 1WI6A 1X31C 5MAOA 2IAJA 1KLNA 2LYVA 5KFCA 1SH3A 4EI2A 2HHQA 5F8NA 3D6HB 1OQ6A 3FBFA 4DX7A 3RU0A 4WPAA 1WC4A 4QIVA 2CJKA 4EU0A 4LT6A 2K3KA 5E41A 2FJVA 4X4UA 4RJVA 4QYRA 4DCOB 3GPAA 4DFMA 2M8DB 1RTIB 1J5EF 5HQLA 3W5XA 1HQUA 2V9WA 2WVCA 4DX6A 3OVSA 5KG3A 2VFUA 3VGSA 1IBKJ 1P1TA 4GVBB 1VHIA 1UVJA 3PRVA 3S01A 3IR7B 3Q8YA 2H4WB 4P7VA 2YBVA 4BDPA 2HVEA 3SIPB 1SJ3P 4DR6F 2W1BA 4XPCA 1WHVA 4IR1A 3KDNA 1PG5B 1TTHB 3R5CA 1FE0A 4K2JA 4NOHA 1CBKA 2VC1A 1YRUA 4OJ3A 5CYMA 1YJ9S 2ZJQQ 3HSZA 1IXKA 2CZ4A 2V4JA 5CYJA 3U27A 1DZ5A 2HBZB 5LMUJ 1B0VA 1FRXA 1TUWA 4CH1A 3BB5A 1DTQA 1LFWA 4ZPAA 2HQDA 4EO6A 2GVZB 3Q89A 1XMBA 4DX5A 1T05B 4JBCA 5C2CA 3AXMA 3KLIA 4JI5F 5IT9Y 1B64A 2Z56B 3P5BP 3N6NA 1IJFB 4ECVA 2Q79A 4YUDA 4WU2A 2FJBB 2ACMA 2XY6A 2VD3A 1PAUB 5F3TA 1NNDA 3KDOA 4Q7AA 4WZQA 3IM9A 3OFHA 4WIQA 4ERDA 3H90A 4GMKA 1N5SA 3MM6A 2RT3A 2XSFA 4IG3B 5G0RB 4HVZA 3PV8A 5CCLA 4RU9A 3NS7B 3OVBA 4LF4J 5KOXA 2FVCA 3CWJA 4KH0B 3PXGa 2WRMA 2CQPA 4J5OA 1Q53A 3JQMA 4WP9A 3OSPA 4ELVA 4NLYA 5K20B 1RWOB 2C3PA 5J2NA 1TQLA 2ZNZA 5JUMA 4H4KA 2R8GA 3KLHA 4KO0A 2ILZA 3F41A 1K73T 2PT0A 4URSA 2XQCA 1Q82T 2HFOA 1U09A 2R9LA 4DS4A 4TVAB 3LALA 1RKJA 3A8IA 2VG6B 4U9RA 2KG0A 1AT1B 3N79A 2DITA 2IY5B 2GMLA 4WP3A 1ZOTA 1XR6A 2L08A 2O3DA 3FDSA 4MT1A 2AIRB 4DPXA 4DPWA 3J81Y 1BQNA 2ZDOA 1I94F 2DXDA 3IAM9 2KFYA 2UVWA 2RU9A 2K8GA 3FCVA 3H7HB 3DOMA 2OEMA 4NI2A 4B9NA 5KFFA 2ZM6J 2XC9A 1OYDA 2CRLA 2GGPB 2GW8A 1RCOB 1Y5IB 2XG8A 4MFBA 5J2MA 2G9OA 2UUBF 5D3GA 3GV7B 1N36J 4ETZA 3WZ0A 4X4TA 4X4VA 3RUBL 2PC6A 3EYZA 4V1Ak 3GYXB 2B51A 1SQEA 5J2PB 4R5PA 2ZHOA 3TJ9A 1Q78A 2YWKA 2RDDA 1L5UA 2DR9A 1KLMB 3W5YA 4JI3F 4KR0B 4OI3A 1R7IA 2ABYA 1H38A 5A0YA 5LT5A 5AJ3J 1V6HA 4ZCIA 2CPIA 2HQ3A 2EK6A 4MFBB 5C42B 3W1YC 1FXLA 2KN4A 2J76E 4DFPA 2EK1A 1ZPWX 4ZVSB 5CAAA 1SH0A 2ZH8A 1SJFA 4NI2B 2XNRA 1S0OA 3GIKA 1WDTA 2BM1A 2XEXA 3IGNA 2IYIA 4I4BA 2JVRA 4KFBA 5J1PA 2GFFA 2K7KA 2V5HG 3PTWA 2JEFA 3R7BB 1SB6A 2WCXA 1VLYA 2BEFA 2M9KA 3HKWA 1U47A 2R8KA 4DSIA 2HHUA 1MSWD 4W98A 4K59A 1VRTB 1VQMS 2CJ9A 2HGMA 1IUJA 3B82A 2KFZA 4CH0S 4DV5J 1HNXF 3PHEA 4F4ZA 4F4KA 2VBZA 2Y1LB 3WX8A 4KO0B 2R7OA 3C16A 3VWSA 4L72B 5KFEA 3IS9A 4DL4A 4C3MA 1I51B 3QT6A 3T6JA 4QU7A 1FTCA 2HIYA 4JV0A 4DR5F 3M2RB 1WJ9A 4HLBA 3JAMY 2XS5A 5KFNA 2Y0SD 4YP3A 1HWLA 3NBPA 1N4LA 5G0RA 1B3TA 1C4AA 3FQLA 2YKPA 2GA7A 3P45B 3HT0A 5HK4A 3ILOA 4CLYA 2GJFA 3VF0B 3ZZTA 3UCGA 4H4MB 2HBQB 1ACMB 4J37A 4GKKF 3ZO7A 1RADB 1VIXA 3CIZA 3C14B 3NKYA 3HJVA 2ZH1A 3PM9A 3PX6A 2R7UA 2Y1JA 2WVFA 1NPKA 4PYDA 1H7XA 3MZIA 5DGBA 3RR8A 1D9DA 1TL7A 3FK4A 1S4FA 1HNZJ 4EZ6A 3MEGA 4C8ZA 1FKPB 1U49A 1W2IA 3HO1A 2MLYA 1T05A 3CE8A 3PZPA 1NDCA 1U1RA 3H20A 3BKUA 3X3UA 1RT4A 2YQ1A 1VQ9S 2J6UA 1RAHB 1NKBA 3T5KA 4PCQA 3A8KA 3GYNA 2HVIA 2UUCJ 4NMXA 4M5JA 5CYMB 2DNQA 3VAGA 4DSLA 1KHVA 3GFZA 2YKAA 4IKAA 4J9VA 1RWPB 3R5GA 4V19X 2IDEA 2E9TA 4NXNF 4USMA 4R0JA 3BO3A 3NGTA 4ZDNA 2HQCA 2NXUA 4ZHRA 2KYXA 4PUOB 4EFAC 2D3ZA 4ELTA 1Y4ZB 4BBYA 3NNHA 3Q83A 3CC2S 1RWWB 1HQUB 2MKSA 4DZ6A 2Q43A 4JV2A 1U6FA 1HBUB 1ZA1B 5EUHA 2DNYA 1S1UA 1WC1A 2CJQA 2UUWA 2EXUA 3EVOA 4LQ9A 1ZTTA 4EBEA 4C8KA 2NSCA 2RIJA 2OKQA 4NZ0A 1S7IA 2L48A 4Y65A 4UT4A 4DFKA 3N5BA 2VQFJ 1HMVA 2IBKA 3M8WA 4NLVA 4CLLA 1KOOA 4LSZB 1NH8A 2IVFB 4A48A 2F8EX 5DM7Q 1NK9A 5K8NA 1LK5A 1T02A 1U24A 3V2UC 1NK5A 2RH3A 4DF4A 2XMAA 4C11A 2ZD1A 1GMUA 3CCWA 2ERRA 3W8GA 3PW2A 3D28A 2CIMA 3PACA 3UO0A 3RRHA 4X4NA 1Q8LA 5DZ7A 3I9V9 3GG1A 3LGHA 3QNWB 1QVFR 1N34F 2XLKA 2KJVA 3DM2A 2EFQA 4ZP9A 8RUCA 2I5JB 2P9CA 3UCZP 4WYWA 2DNKA 4Q43A 1SV5B 1S9EB 5FDLA 5F0WA 4CTAB 4DV4J 3SZ2A 1P6TA 2IIHA 3GFYA 3HVWA 1VBYA 3BREA 1QDUB 4RBTA 3WC2A 3V4MA 5DLFA 4B9TA 3FRYA 4E8UA 4HEA9 3G6VA 4ELUA 1NMEB 2M88A 2VG5A 2FD2A 1JLFA 5D78A 2JFDA 2VHGA 2FLPA 2VOOA 4ZLJA 4CLPA 3R7SB 1S5ZA 2G2ZA 1Q7YT 4DQPA 3MPYA 1OMSA 2UV8A 3UR0A 3G96A 1X4BA 2KJWA 4A47A 3V5RA 5H1SV 4LF8F 1RWMB 2H51B 3LPEA 3PFEA 4E98A 5F8LA 1NDPA 1NHUA 2V68A 5IC6B 3TNVA 2OIHA 2F40A 1HWUA 3QGPA 2WONB 3DCAA 1OPIA 3H98A 1LWEA 4LRBA 1FJGJ 1JLAA 5B0BA 3EGWB 3FGVA 4MK7A 1CSJA 1H0HB 1WSVA 2HHHF 4EZ9A 9RUBA 2VC0A 3R5DA 1I6JA 2IRXA 4HACB 1VR6A 3V81A 5HLFB 4OV1A 3KHGA 2NUUG 3ZNUA 4LFAJ 2UU9F 4ZLLA 4K2XA 1Q95G 1IR0A 3SDEA 4NLWA 3VGVA 3BBFA 5IWAJ 2XZDB 3QT8A 3UNYA 2C2MB 3IMQJ 1XMOJ 3NXZA 4JI7J 2XSJB 1HR0F 5H9EJ 3ISNC 2A2DA 3MCNA 1Y11A 3W2WA 3PW4A 2WBMA 1MN9A 3N5FA 2QFJA 4YY3J 4OJGA 3A1YG 3AQPA 3THTA 5E3RA 4M5LA 3THVA 5E5NA 1YKWA 1HNIA 4MAKA 5J2QA 1ELOA 1RTZA 4NCGB 2OLWA 5CD4H 1N0UA 2YTCA 4K4SA 1S6QA 3KWMA 2YQ3A 1TAQA 4OL8A 2WW4A 2RS2A 1HHSA 4O44B 3DC2A 4LBHA 4M8LA 2MKHA 3CDWA 1LNQA 2QGFB 3DLKA 5EWGA 5SUHA 4K4UA 3U1LA 5E3CA 3L9ZA 2UUCF 2JWNA 2RVJA 2AYMA 4H4OA 4B9MA 4K5SA 2V8DA 4ID8A 1UW9A 2A1BA 2QA1A 2WOMB 3NCRA 1R0CB 3NS6A 3OTEA 4WTOB 1YIJS 4KKOB 1QUVA 3ZNJ1 2YQ0A 4O4GA 1MW7A 1PO6A 2YKMA 1GTHA 1M1KT 4ED3A 3KJVA 1NSKL 1RGVA 3DRRB 3NEKA 2MQOA 4KQZA 2C2OB 2J5AA 2BJ9A 4RNMA 4DR7J 2ZZNA 3CDEA 3J7A1 3OR1B 2C28A 1HYSA 2WK4A 2J9CA 4Q2MA 2BOAA 3TZYA 1FCAA 4L75A 4A4JA 3IRWP 4K4YA 3C8YA 2CWKA 1GXTA 2LU2A 4W90B 1GXUA 3BZQA 5D8HB 4P73A 3VAFA 5D0HA 4LF4F 4I2PA 5GMDA 4B3RJ 3AOAA 3UI3A 2MXYA 4RW6A 3BS9A 5IOLA 4JI6J 3MM7A 4J9OA 3MMCB 1R8HA 2B4OA 2GHPA 2PGCA 4PG7A 1AROP 2ZBRA 5KFBA 2A6MA 2RQMA 3BH6B 3MAAB 5BYRA 1GMVA 1B70B 2BKNA 5BXIA 5C2GA 2FZKB 4J9MA 1S1XB 3K5PA 4B9UA 2WB1D 1VDHA 4RNOA 4EBDA 1UZHA 3S8SA 5L1KA 1O8BA 4G6VB 5BJRA 5H9EK 1EIYB 2ZE2B 4U6PA 2HSEB 1OSDA 2MPUA 2RNEA 1IQTA 4IOBA 5F3ZA 4ITSA 5LL6d 2B5JB 2EKNA 3CJ8A 5HBMB 5LXYA 5DQHA 4KRWA 4NLGA 1IKXA 2ROGA 4J9UE 3SFGA 4C0BA 3OHBA 2CPDA 1RT7B 1DQ9A 2E5HA 3CC7S 2H5EA 1VQ4S 5HVGA 2MQLA 2P6SA 4USVA 1GH8A 3R6GB 3LP0A 1XWLA 4TN2A 1M5SA 3HHEA 3AA8A 4DEZA 3LF0A 4ID5B 4IRDA 2QFIA 3V6DB 3DRPA 3AB2B 1XNQF 2DNRA 2HLTA 2R8JA 2QN6B 2W9BA 4U67Q 2IA6A 1Y3KA 4RW8A 3TEGA 2JC0A 3H2UB 2G0IA 2JEJA 3OLAA 4JI4J 2HAIA 2CQBA 2ZFHA 2W2MP 4LMZA 4ECTA 4D3HA 1MWZA 3BYRA 3KK1B 4IG0B 4KHRA 3JSMB 1U0HA 4HKQA 2VFSA 2J8AA 1JLBA 1W26A 2W7AA 2DGOA 4FNIA 1NZAA 2FVSA 1VQOS 2RQCA 1KDNA 3M32A 3TEHB 4B3MF 4ECQA 4X4SA 4O0NA 2C2DA 5AT1B 4YHHF 4LSNB 1L3TA 4FZVA 4TLQA 1MROA 1Q5YA 1SQFA 2XWXA 3D54A 4AD6A 3MMBA 3T1HJ 1IR1A 1M5VC 3KXDA 4MKAA 3FCHA 2V8VA 3D4JA 3LW5C 4Q45A 3LTOA 4G1QA 1HL6A 2EFOA 1NZ8A 1I1GA 4ICLB 5B7WA 3BO4A 3U1MA 2R7RA 4JI2J 4ED5A 3OXLA 3TUJC 4QQBA 1HBOB 3MOJB 1HNVA 3HPOA 2VU5A 2MKJA 1CULB 3QZ7A 4QWBA 3IG1B 5MLCV 4WE1B 4FXDA 4NLDA 3T9ZA 4IRCA 1XR7A 1F60B 1CLFA 2YWFA 5CYQA 4ZA1A 3DOKA 2M5YA 4F26A 5CYQB 2Z2LA 5D4LA 1SBRA 4DN0A 3HM9A 1HW9A 1Y7PA 1UL3A 3CF5Q 2KYZA 2ZOMA 2GVDB 3Q8RB 1WUUA 1YQHA 2NUHA 2COLA 1YVFA 2DYAA 3BKTA 3HMJG 1M1HA 1VBXA 2HHSA 1B0PA 1U02A 5ETQA 5H9FK 1MWYA 1RQ0A 2YH1A 4DL5A 1Q79A 3OBIA 5HANA 1REVB 4GO5X 3N28A 1JLEB 2M0GB 2MQQA 4YQWA 1VIOA 2QIFA 1TMJA 3BN4A 4YB6A 1PC4A 1C0TB 3AJDA 3NGRA 2KI2A 3Q0AA 1FNMA 1RWXB 3M6WA 1UWAA 3VGUA 3JAMU 4C8OA 4NLPA 4NE9C 4A8MP 3SQGA 4UZCA 2V4QA 2ZOGA 4FYVB 4XK8C 2IFXA 2Z30B 3QLHB 4J9NA 1AFJA 1FHTA 4OHXA 4CLFA 2WAQD 3D1HA 3D6FB 3L3CA 3RW7A 2E5LJ 2RSQA 2V63A 1Y3JA 3ILLA 4FVMA 3FZBA 4NCAA 1FESA 4ZVRB 2UV8G 3ZTRA 3V6DA 3G87A 4PYAA 3C19A 1LXJA 2IPOB 1EAYC 2MZSA 4N47A 2V6AA 1YITS 2J9DA 1CVJA 1VQKS 3J7AN 2W4CA 4F67A 2OJ3A 1YK9A 4PZVA 1F1BB 2CXEA 3MTKA 4LR8A 5KG2A 1IKXB 4DV6F 2VDIA 4WKRA 1N6QA 3SCIE 4TQRA 5HBMA 2WSCC 4O3SA 2YX7A 2SXLA 4XIUA 2BXJA 2HK3A 5IM0A 2WW8A 5HROB 2VJVA 4I67A 3PO5A 4W92B 4I2QA 3P6YC 2YPYA 4DL0C 4PKDB 2K1RA 2P6TA 3MI7X 3MPUB 2V2KA 1RT1B 6AT1B 4DUZJ 4ZN1A 1LEOA 2DK2A 4OHWA 5KFGA 3SI8A 3LAMA 3LOUA 1UFLA 3R2CJ 1UFKA 3IA0A 5HROA 2LEBA 1SCJB 1GTEA 2VBXA 3GIRA 3S6EA 5IM0B 2DY9A 3D3BJ 4P72A 2QA4G 4QW9A 3MMCA 2LEAA 4EBCA 4RW6B 1N6QB 1F0XA 3CXCR 2J6TA 2DNNA 3BF4A 3KLEA 4DX8H 4DR3J 4QCLA 1N33F 2NZCA 2CPFA 2X51A 1WEYA 1MG7A 4ZVEA 4C7QA 1TMMA 1QM9A 4DUTA 1OY9A 2Z2YB 4KT0C 2XS2A 3TVZA 4U7CA 3CO9A 3MDFA 3OTOJ 5M2PA 1T8EA 1J5OA 2JL9A 1ZZFA 3I82A 3W8PA 4EEYA 2CVIA 2ZKUA 4O4RA 2OEKA 1G4CA 3EGZA 4O3NA 2YKMB 1D9FA 4L3NA 4RNHA 4UQGA 1FRMA 2B8PA 3NP5A 3BJYA 2GC8A 2CG8A 2QV6A 4WU3A 1IQZA 1DQAA 3EGVA 1ZYQA 1HQEA 1LWCA 1IN0A 2D41A 2YNFA 4WBFA 1QUPA 4NLTA 5KG0A 4ECZA 3DDIA 3OLBA 4DF8A 2AX0A 3GIMA 2F8HA 4ES1A 2MDAA 1UPMB 4DQSA 2CQ3A 4DL3A 3DLKB 1T9YA 1VRUA 4CYUA 2XMWA 1W2BR 3B78A 3TWZA 3IAS9 1S1TA 4L76A 1FRHA 4DR1J 2AMCB 7FDRA 4NCGA 4CH7A 4Q5VA 4DV1F 3HD1A 4AT1B 2JVOA 1WHWA 4FS1A 1SL2A 4ETXA 4JI7F 1CJTA 4A8QA 3NNAA 4WXOA 4RNNA 1LV5A 2P2CB 5HAOA 3BGRA 5CHCB 3BBCA 3R1LA 4ZVHA 4R25A 5JMNA 4F04B 3JB9k 4WK1A 4ZVQB 2C3UA 3DGPB 1WEZA 4LFAF 4WF9Q 2LMIA 1R0BG 4IDKA 3SQOP 2W7PA 2R8HA 1SKRA 1M0SA 4OMFG 1UVIA 3ZTSA 2AZ3A 1TK5A 3G6YA 2ZBPA 1WACA 1RBOB 2GMJA 2XHCA 3EVWA 4F3QA 4P2MA 1HNVB 1VYAA 3EZOA 3MEEB 1TKDA 3TI0A 5F8GA 4PAAA 2R8IA 1NJWA 1VQ6S 4YB1P 2D9OA 2I1RA 4ICLA 2C1EB 2GHWA 3KG1A 4HACA 2VODA 2BW7A 2QMWA 3AD9C 4X64F 3BQ0A 2RAQA 5DETA 2ZZTA 5KFTA 4HH1A 3HFKA 2Q1LA 2FHJD 1MROB 2CJYB 3O1LA 5EX0A 1M5OC 4CLWA 2XYHB 2HRTA 2UXDF 2IA0A 3JS9A 4ZP8A 3CJKA 3M32B 2WONA 3MCSA 1EZZB 1CC7A 2V4RA 3UN5A 3VCDA 4DV0F 2MQMA 2XI2A 4UW2A 1OPZA 4KH1B 1NEEA 3TZWA 5LSOA 4DR7F 3KK1A 1A7GE 2P9GA 2DR8A 2J6SA 4NEZA 1ZM9A 3S7RA 3UNGC 4DFJA 1S76D 4N56A 3DDKA 3ENWA 3PEJA 4P7TA 2PN6A 4ZJOA 4RW8B 1WELA 3CJSA 5HJXA 5I3QA 4IO9Q 4AL6A 3QQCD 2W9BB 4P2SA 4EK2A 1NB7A 3J81U 5CA5A 2XB2D 2W8LA 3DRPB 3FSIA 4HDGA 1HWKA 1FDDA 2V2ZA 4ID5A 3MFIA 4P75A 1WDDA 2RKIB 3LP1A 4RWXA 2Y8YA 2N4CA 3A3OB 4GO7X 1U25A 3T1YJ 2E1CA 2QZ8A 1QSYA 5LM7E 5BYQA 1SV5A 1WG1A 3HZEA 2R2TA 3I0RB 4UF4A 2V9KA 3DM2B 3CGIA 4DS5A 2LQ9A 1R8CA 4C0OC 4ILMA 3PR5B 2B5JA 3LANA 3FEXB 5KT4A 2FGCA 3J80U 1U6BA 3ILJA 2LCWA 1FVSA 3MEDA 4XAKA 2ZE2A 3VZIA 1S9FA 4KHPF 3L09A 4QIEA 1X60A 3Q8SB 1PJ7A 2AW0A 1RA6A 5F9NA 3J80Y 3OTOF 4OZ3A 2KXHA 2MQ8A 3R5BA 4QJVA 5LMNF 1NPRA 3CMES 2D3O1 2YWEA 1S1XA 3TARA 1HMVB 3N4WA 3P49B 4B3OA 2B56A 4Y2KA 2C2ZB 6FDRA 5CXTA 1IKWA 3MM7B 3AODA 1UW4A 3W2VB 2YNGB 3BM7A 5B0FA 4DBQA 2MKIA 2J9EA 1PJ5A 2ZH2A 1Q4RA 2CPYA 2NCKL 3H0PA 2YKNA 4N5SA 3ZZ0A 2CQHA 2QEXS 3H40A 4Z7YA 4ZHRB 1RBLA 3NS5A 2VA2A 1O51A 1TP7A 5D0RA 3R97A 1IJEB 2I9SA 4OX6A 1QVGR 3IXQA 1SJ1A 4CNZA 1R43A 1VQPS 2HZCA 2NYIA 2VASA 4NLSA 2E66A 5K8PA 4FYYB 1J5EJ 3H8YA 4L73A 1EETB 1LXNA 2M8HA 2ZITA 2AD9A 2PFFB 4DL6A 3R5JB 2M7SA 3VR1A 3G71S 3AD8C 4O4GB 2JC1A 3ZZUA 2E1MC 1M5HA 2OAUA 4J9SA 3C66A 1UJ4A 2ATCB 2BZ2A 2V94A 3HVAA 3MWBA 2ZH7A 4GC6A 1FJEB 4H4OB 3EICA 3Q2TC 1F9HA 4WCEQ 1FDAA 1T3NA 4RWWA 1TL7B 3KUEA 4ILLA 2KRBA 5IXUA 1Z1ZA 2JOQA 1RKIA 4UOCA 1TKXB 2FJWA 1UEUA 1WF1A 5KT2A 5K8OA 1S6QB 2E9RX 2W2NP 3TUPA 4CT9A 1U48A 1RLCL 4PR6A 4M95A 4DR5J 5J2QB 3HHLA 1Q81T 2BE7D 4O3OA 4MYUA 4UOFA 2HGNA 1MLAA 1S49A 3GWCA 4J90A 2FZCB 4I6YA 5AE3A 4RO0A 2BQUA 1U1QA 2QYGA 4OI1A 4J9QA 1BLUA 3H42A 3TUZC 2OO4A 3E3XA 3FVYA 1LWFB 3T6BA 3IS9B 3T1AA 1ZETA 2OD6A 1FXDA 2GAHC 4YR0A 4FKXA 2J7UA 3PDNA 4A8SA 4IO1A 1TFYA 3QJPA 3SDEB 3K17A 4Y2MA 2CQ1A 3JTNA 3PYFA 2QLFB 1Q8BA 1Q0NA 2BJDA 1KHWA 2KHCA 2AEMA 4M63A 2QJ3A 3P8BB 4OQJA 3C2PA 1PAEX 2X1BA 2ADBA 4BLGA 2UU9J 2D7SA 2EEYA 3I5CA 1DLOB 2VPXB 1C4CA 4OZ0A 2IJNA 2ZH4A 1JJ2R 2CNNB 3WBZA 2CFXA 2HFSA 3GSDA 3DKDA 4CRJA 1K9MT 2GCFA 3DFEA 4OLPA 2JHEA 4RW7B 3KK3A 2NQPA 2KZMA 1FDBA 1ROFA 1S1VA 2LQBA 4OYBA 4USTA 2XLJA 3CCVS 2AF6A 2P8IA 2RDIA 1L3VA 4V19J 1WF2A 1F3FA 1RB0A 4ZP6A 1PGZA 3CD6S 2XI3A 4Q0BA 2VG5B 5KFSA 2B9YA 2DNHA 1BGXT 3MCMA 3QWPA 4LRAA 4OZ5A 2NSBA 1VLOA 2LQJA 3ELHA 4CO0A 1I94J 1DHMA 1RCXB 4OFZA 4Y2AA 1YJNS 3MF5A 3RBDA 2W2OP 2L9DA 2LDYA 2O5DA 4CO1A 2G0JA 3A3NB 1NU4A 2GMHA 1UJ5A 4DDFA 3LA0A 1GXLA 4CTAA 3DHWC 3RRGA 1AFIA 1S9EA 5FDLB 1U1KA 1BQNB 5L9XA 2AT1B 3JSBA 5L38A 3BGLA 2LECA 2I5JA 4OYOA 1K47A 2AKWB 3Q8UA 3IWXA 3JQJA 3UDCA 4DV0J 1WTFA 2VG6A 2XTJP 3MM8B 3PEHA 4F0HA 4ZCMA 1WF0A 4LRFA 3PKMA 1KBRA 5L46A 5C5JA 4Y0FA 3ILIA 2R2UA 1N56A 4LF9F 4MKYA 1EQ0A 2DH7A 2H48B 2MY8A 4DPUA 1RHRB 2F63A 2GV1A 4EUVA 1GQEA 2LKZA 5D6GA 2DGTA 3K5OA 4ZVFA 1N32J 3Q8PB 2XO7A 4JI8F 4AXJA 3HHKA 1ZS6A 4F4AA 1FRKA 4FYXB 4YN3B 2UXCJ 1X5OA 3MM6B 4IG3A 2FLNA 2IM0A 4P9SA 4CP5A 3QATA 3GCWP 3NGKA 1YDLA 1S1UB 2W2PP 2K3IA 4LF1A 2VICA 1CC8A 2G1DA 1UJ6A 2HFVA 4ZOSA 2WTFA 3MXHP 1JWWA 1S59A 1CS4A 3ZTPA 5U47A 4LF6F 2MLZA 3CCQS 2M4MA 4PWUA 3GQCA 3Q24A 2CWXA 2V67A 2ZC4A 1I5OB 4WXWA 2MGZA 3J7YU 2DGSA 4K7QA 4MYTA 3LQVA 1EJ7L 1YBUA 2G4BA 3CDUA 1DTQB 2ZDPA 2QL5B 2PMWA 5B0EA 5DG8A 3OUYA 2LFVA 3PO4A 4Y00A 1EARA 1PBAA 2OSQA 2V4JB 1SI9A 4DL7A 4LF5J 3GIIA 4C8NA 4DUYJ 2J0QD 2E7WA 4XO0A 1IWAA 1RT4B 1SC4B 1O6XA 2BJEA 3OUYB 3UN3A 3FBCA 1YJ7A 2E5GA 3M9MB 1UA0A 2RDJA 2EC0A 1FJ7A 1FDNA 1VJQA 4F3MA 1JLGA 3TX0A 3G6XA 2VIHA 4HI2A 4U8VA 1FKPA 2B4UA 5T7LA 1D3WA 3MEGB 4CQ1A 2RF2B 3B6BA 2DPIA 1RI7A 3EJMA 4GVBA 3W9IA 2ZH3A 1M5KC 3UD4P 3QGIA 1RTHA 2M52A 4NEYA 3C14A 1WI8A 4RBVA 4GKJF 4BC7A 4F4XA 2VQEJ 4H4MA 3SFUA 3ISZA 2KU7A 4H54A 1RT3A 4C3KA 1HNZF 2DJWA 3TZXA 4B9LA 4IFYB 3UR3C 1F6TA 3DNCA 3OFEA 3NBPB 4F0MA 4NWBA 5HJYA 3VTIA 1X4DA 3AJ2A 2HHWA 2G13A 3F0NA 1MMLA 4ENOA 2BW2A 3CCRS 3BQ1A 4BWJA 2IAJB 2R3VA 3CJ0A 4N8OA 4ZLPA 4F02A 1NK7A 2HZAA 3PX4A 1S99A 3CCLS 3QT7A 3G82B 3MECB 1R31A 1J27A 3C16B 2H5IB 3MTJA 1KRPA 4IOCQ 2OGUA 5L1JA 5F8MA 1N5YB 2ZUGA 2MEWA 3EPGA 4Q8FA 4JI8J 2Z2ZA 1VRTA 3D1QA 1HI1A 4DPYA 4QWCA 2FY1A 2GO9A 4LF5F 4OV6A 3IBFB 2DRBA 1BY9A 3NAIA 1N32F 2HEKA 1SJQA 3PYEA 2AEJA 3QAUA 2BJ1A 2CAJA 5KFZA 3W66A 2E1RA 4CI0B 5GAEU 3IO1A 3K0JA 1BMQB 4CO4A 2DHSA 4I1TA 4YY3F 1U1MA 3H59A 1FKOA 2PA3A 3HSGA 3NCQA 3OSNA 1T9TA 3CEDA 4KPCA 4RUHA 5C42A 4K4WA 1RP5A 2CQGA 3KLVA 2IBOA 2QO3A 3NWRA 3QGGA 4B02A 2IM3A 5IFMA 2AGOA 1XMOF 4R0EA 2UVUA 3W5ZA 4GC7A 2AYEA 1KLMA 1KVJA 1H73A 1WTBA 3BPSP 2XNQA 2W24A 2YX1A 4OYZA 4Y2CA 1FRJA 2GX8A 4IRKA 3P3DA 5IT0A 3DLBA 5DJBA 4HR2A 2X1AA 2RHSB 4RW7A 5J2MB 4E0DA 2C22A 2GGPA 3EWGA 2ZWPA 3T5JA 1JNZB 2OFGX 3NY0A 3W65A 1DLOA 4NLUA 1JIHA 2DIUA 3QJLA 2YWWA 2ZWOA 1QAYA 1UA1A 2ZH9A 4OX9J 1C1BB 1YSJA 2G2YA 3IWLA 2FUG9 1TKZB 4O3QA 3RRKA 3CMAS 2XY5A 1T9VA 4JV5J 1G2EA 1X4FA 4URQU 4CO5A 2BQRA 4B3SJ 3MMJA 3N6MA 1TUGB 4KB7A 4ANEA 3H5XA 2GO8A 3K5NA 3Q23A 4FBTA 3I5BA 3PR4A 1U1OA 1H72C 1DBDA 3O2IA 1N54B 1Q16B 3R27A 4CDIA 1XBWA 3IC1A 5ETRA 5A8RB 1HNWJ 4AE5A 2DRAA 2Q3PA 1R3NA 4ZIVA 1LWFA 4C48A 3EDRB 2ZH5A 2A6OA 3KMQA 1F2HA 2PEBA 1NHKL 2HS4A 3L7OA 3CVKA 3DI6A 3JQKA 4G65A 4ILRA 1NK4A 1Z2LA 2O01C 3H5SA 3ZTOA 5CZXA 2BKOA 4CIOA 2GIFA 4NA3A 4WFXA 5GAHI 3B54A 4WTYA 1TV6A 2RHQB 1IR2A 3CCES 3CMQA 1VC5A 1N5QA 3HSDA 4DSKA 2DR5A 5CD4A 3GIJA 3MR6A 4K0KJ 3C6TB 3Q8QB 2NXNA 2NXJA 4LSLA 3CDAA 1HYSB 5F0UA 1RTJA 5SZTA 2Z57B 2ILYA 2V8HA 3KLIB 4A8OA 4CM2A 3G4SS 3GONA 1LW0B 2N7CA 2OPSB 1FWPA 2YNIB 3ITHB 2I0XA 1D8ZA 3BR9A 2WBRA 4DCPB 3D6TB 3T41A 1URNA 3QIPA 2AJQA 3M30A 4FVCA 3D5MA 2DXEA 3I0SA 4ZPVR 4B3MJ 5FD1A 3DLJA 3PX0A 1QY7A 3D66A 1EETA 5L9NA 2X7IA 1QJHA 1XIQA 2EVZA 3G86A 2EC2A 3I56S 3GV8B 3ZFVA 3ICLA 5KG4A 4C2MA 4AL5A 4K4XA 1TK8A 3GR0A 1TVRA 1HW8A 2OPRA 1PKUA 4FF3A 3OL9A 2B9XA 3AH6A 4ZKAA 1KEKA 2YKNB 4PQUB 2BM0A 2QE5A 2NXEA 1WKLA 2ZOFA 2NPIA 2VUGA 3F56A 4MKVA 4ES2A 2MSTA 3QSYB 1MN7A 1CJKB 1HI8A 2YNGA 3MAQA 1X8DA 3G9CA 3PNIA 1TK0A 1IKWB 2IDLA 3ETOA 4RUAA 1HD0A 3GJSB 4CLUA 1VQNS 3PHTA 4BS2A 4B3OB 5D4NA 1CQNA 1RUSA 3KK2B 2DCUB 3AD7C 3WDOA 5KG7A 4X66J 3CCJS 2VJUA 3M8PA 3AAWB 3NMRA 2HQFA 2OTJS 2LXUA 4N77A 2EBGA 3K2YA 3CJQA 1WOSA 5I4MA 2V69A 4ZJLA 2AEFA 3MPDA 1E6YB 1LKZA 2JSXA 2XULA 3L7UA 5DZ6A 4R8UA 4ECXA 3I9ZA 4FYDA 2Y0BB 2DNLA 3F73A 4RPFA 1U45A 1P8GA 1LW2A 1TZ0A 3CD0A 3LUYA 1RWKB 2RUSA 2DR7A 2NZ4A 1NSPA 2ASDA 2OPPB 1W7WA 4S0MA 5G4DA 3T3FA 2DPJA 4QR2A 3LP1B 1YJWS 2I2YA 2JH3A 4G3IA 2E7XA 4KY3A 1RTDB 2LQ5A 2OMLA 2CQ4A 4NASA 1T0TV 3K59A 2CNLB 4RZRA 3SSRA 3TW0A 4OX7A 3ENAA 2V8PA 3KJQB 3IRXB 3M8QB 5RUBA 2CJBA 1KOHA 4ZCLA 3RBEA 1HBNB 2VA3A 1S48A 3R5AA 4Q2LA 3BGUA 1RYRA 4NLRA 4HI1A 1YHQS 1H2VZ 1TU0B 2LLZA 3VQTA 3QJJA 1D0EA 4YB7A 2FJAB 1H74A 1XJWB 1B99A 3GB0A 4ZJQA 2ZNYA 3EE3A 2DIVA 2XY7A 4EGLA 2F4FA 4LREA 3EMTA 5ADZA 3FMBA 1TR0A 1DURA 2EWHA 1UWBB 4LR7A 1YJVA 2POKA 1N52B 4F2SA 1XTZA 1VQ8S 1R6YA 2FC9A 2HWHA 2FC8A 1K44A 2PA8D 1UP1A 4JI4F 4QWDA 3RG6A 2ZBIA 3RAMA 2KRRA 3T19A 3MD1A 2PIIA 3MR2A 3MUTP 2UXDJ 2MHEA 4X4RA 2AGQA 2N4DA 2W4DA 2WZ1A 3EDQB 2F7VA 5J1EB 5JXSA 3CCMS 2AYBA 5FIIA 2D9PA 2NXCA 1F5CA 3DGPA 4A8XA 3NRBA 2JDJA 3CW2C 4USKA 1IM4A 3OHAA 4X65J 1JJHA 2B6AA 2VKZG 1SC6A 3M2UB 4B3TF 3BGRB 4KIAA 3G2XA 5IQ6A 3AJ1A 1M90T 4D3GA 4CM0A 4MIBA 1AZSA 2EPIA 1P9QC 2Q6CA 3PYDA 4P71A 3GV5B 1DFDA 4E2FB 4F4WA 4AFFA 2PEHA 1EB0A 2OTLS 3DLGA 3HF5A 4ATNA 5LJ3Y 1VRUB 1HQ2A 1X5SA 1NAQA 3CJTA 3POTB 4DV7F 1RA7A 1A9NB 3AT1B 2IC3A 1RACB 4I6WA 3OTBA 1S6UA 3VALA 1VFJA 5A8WA 2U2FA 2KG1A 4DOZA 4B17A 2XCPA 3C15B 4F3OA 1U4BA 1G6BA 4FKYA 1LWCB 2YNFB 3KNGA 4BCAA 2PD1A 1WC5A 4X62F 1R8PA 1R6VA 4AUKA 3QPIA 3NOCA 1RAGB 4ED0A 1CJVA 2VOPA 3SEOA 1D9AA 2MHNA 3ZZPA 4GVLA 2HURA 3SXLA 2DHGA 3JSYA 3KFWX 5KFYA 1L3SA 3PCOB 1KR4A 4FF1A 1EHWA 3RBZA 5T14A 3HCXA 1KKHA 1J5OB 4RU2A 2R7SA 3BSOA 4PPDA 4ZPTR 3DRXA 1IBMF 1N88A 2OUGA 3A8EA 3RTVA 1U2CA 2D1CA 4OI0A 1TL3A 3ZZYA 3BGOP 4DSFA 4OYWA 3CCUS 2CPXA 1HWIA 3CUNA 2QLJB 1QAIA 5L1LA 1A0OB 3GTYX 1NK6A 1KQGB 2VPYB 1SKWA 4CLZA 1VQ5S 2DHAA 4KHPJ 4DR1F 1FKAF 4OI6A 4F2RA 5EWFA 4JI0J 3EXYA 4ECYA 3DGVA 4JI1J 2AZ1A 5ETOA 2Y1IA 1JLCA 1FVQA 1ZBTA 3BGFA 2L9WA 4NRUA 5JVHQ 2D69A 1YTYA 5DDRC 2W9CA 2GHVC 3GILA 4DQIA 4NXMJ 1RT6B 1V5VA 1S72S 2JEIA 1S97A 1JLQA 2B0GA 2CYYA 2CPJA 2DHXA 1IKVB 2PI4A 3AFGA 2HK2A 3V6JA 2QC3A 2LA4A 3MM9B 1CQMA 1SXLA 3DN9A 5ETKA 1WKJA 3DYAB 3BSCA 4NYOA 4QZVB 4DPOA 5EDWA 2XGQA 2DO4A 3MM9A 3IGVA 2DNZA 1VI7A 3DXBA 3L4BC 3QZ8A 4RX6A 1P27B 3MUMP 2RRAA 3K5LA 1N5TA 2WVEA 3CJ3A 2W01A 2E5IA 3R6LB 3ULHA 1YZ7A 4PXDA 5A2QY 2M3DA 4DV7J 4DV6J 4KPYA 3T5HA 4OHYA 4DUYF 4CT8A 1YRTA 5D4PA 5DRKA 4DR3F 2JJ4D 4KGVB 2FHMA 1C1CB 2FHJA 1X0PA 2BR0A 4KV8A 1TKTB 1FI4A 5M2UA 3DOLB 2NREA 4WFYA 3ZXWA 3SQGB 3VAIA 3GYGA 3KUGA 4LUBA 2XMMA 3TA1A 4NXNJ 1BD6A 3CULA 3SMZA 4DG1A 4B3TJ 2MZTA 1OIAA 3TJAA 7AT1B 4OI4A 4JYAF 2K7JA 2OI2A 4TY8A 1JLEA 1FX4A 3B4MA 3CSKA 3FBBA 4EYIB 3IR5B 1M5PC 2MMYA 3LPYA 1QD1A 5JVGQ 4RUBA 1U7LA 2D3UA 2OP5A 2RU3A 3PKYA 3M9NB 4CZCA 2IM2A 2M70A 3MM5B 4OI2A 3PIPQ 1R8BA 1TL1B 4C98A 2F8MA 4CLKA 4KAIA 2DD8S 1UVLA 4HHJA 3TVKA 3P5TL 3D9BA 4U7UD 2PSZA 4YFUA 4DR4J 1R89A 3OTCA 3JTOA 4OZNA 4PG6A 1RAAB 2XGPA 4FXWA 5D15A 3M6XA 1T95A 4I6AA 1GNKA 2Y8WA 1FRLA 5D4OA 2HNDB 2L9NA 4WE1A 3TP2A 1QTNB 3RGIA 2R7VA 4JOUA 5CCMA 2DBBA 1RBAA 1CULA 3POTA 2B7CB 5JJBA 2QA4S 2KH9A 2APOA 1YX2A 3MR5A 1HBOA 3W64A 4DU7A 3TA2A 1JNRB 2B9WA 1N34J 1KSPA 5HQ8A 1SL1A 1X9SA 1IKYB 1F9EB 2IVYA 1E6VA 2QA2A 3SCLE 3JYTB 2GJ2A 4G1IA 4DQRA 2QL9B 2DEJA 5KFVA 3DLEB 1KFSA 4KJIA 2MZRA 3BSNA 2YKOA 5BR8J 2F9DA 2AJ2A 4LSNA 4M5KA 1WC3A 3RB4A 4Z2XA 2Y3YA 2CQDA 3FEYB 5KFOA 4DV3F 2W8KA 3I6PA 1PJ6A 1JLBB 3CJ2A 3KLGB 2ACYA 5L1IA 1PYOB 4IG0A 1CJUA 3E51A 4MTPA 5GMEA 3FSXA 1S0VA 4QYZK 2KM8C 1WC6A 1QE1B 4HTIA 2H3EB 4KE5A 5DDOC 3P96A 5D0EA 4DZDA 3NCPA 3RB3A 1KQSR 3ET6A 3SYZA 3N0VA 2IJFA 2CKWA 1FD2A 4BHQA 2GQCA 4XDCA 5AJ3F 2RRNA 1EP4B 2VFRA 3CD5A 3OPKA 4UZBA 2GJIA 4HYKA 1VBZA 5C24B 3CNQP 2EKYA 3BDPA 3QFWA 2HWIA 2UP1A 1LK7A 2B4PA 2CJXB 2W4PA 3BBBA 2BABA 2LP4A 2JLEA 2XYPB 1T7PA 2VB6A 3U7JA 1RT7A 1T9WA 3BR8A 3SBMA 1G7CB 3G8TA 3DU6A 3HD2A 3HXMA 5HMYA 1FD8A 4C8LA 2C2EA 4OYMA 2IVMA 3IRXA 3SV3A 4U7UK 1R8AA 2UUTA 4IFVB 4CLSA 1QSSA 2E5JA 1YGYA 4LJMA 2LEPA 5E33A 4B3RF 5IZHA 2BRLA 3FSYA 2MJNA 2AGPA 4EO8A 4RL1A 4YOEA 1OWXA 4WJBA 4JP8A 4USJC 2ZH6A 4HHUA 1VQLS 4ECWA 1FJCA 4NA2A 4YMEA 4O3RA 2V0NA 3MAAA 1TFWA 2B9EA 3EZUA 2A10A 3UE2A 2VONA 2XMJA 1SH2A 3OXGA 4KC5A 1BWEA 4FS2A 3PJWA 4R8UB 5EHHA 1VHFA 2G2OA 4HT7A 4N76A 3QT5A 1NK0A 3BH7B 4NLQA 3H4DA 3HSJA 2EG2A 5B0CA 1DQ8A 2F5GA 3BPDA 4RLEA 5GADI 3P4UB 1NKEA 1HFEL 2O66A 2JZ5A 3OR1A 2I38A 3BEGB 3QIDA 4K0KF 4GKKJ 1FFSB 1UVMA 2HNZA 4OYPA 1UETA 4TU9A 1REGX 4PABA 4RW4B 2R2SA 3DRRA 2BBEA 2AJ0A 3UCUP 1D09B 1SVDA 1NCLA 3TAQA 3MPWA 5B08A 4WFBQ 2ZUAA 1CJKA 2HVZA 5E7OB 3HHLD 4KKOA 2GAGC 3E01A 4Z7CA 4PQUA 2WOMA 1RT2B 4PQAA 1Q8IA 3OQ2A 4F36A 5KFKA 4IH6A 1VBKA 3GLJA 4ZVPB 4OLOA 2DH8A 2K06A 2OPRB 4TYAA 3WQPA 3D0HE 4B9VA 1TVRB 3WIUA 3LO3A 4OJ1A 2CZVC
chains in the Genus database with same CATH topology
2PE8A 4M94A 2QLWA 2YNHA 3KHRA 4LVNP 4O44A 3HP6A 2DGVA 3EPIA 4PXEA 2W9AA 2RQ4A 1XEZA 3CD7A 3KLFB 1Y5LB 1URRA 3I0SB 1ZAXA 1LFPA 3FFIB 1X4GA 1HNIB 1N36F 5CQGA 5HP1B 4ED1A 3CDBA 2OPSA 4NLXA 4ED6A 3TANA 2RMLA 3SSSA 1K0TA 7FD1A 5KTQA 1RTJB 4URGA 5ITHA 2Q6BA 3TYTA 3RB6A 2RILA 2AP6A 2ZBCA 3FRZA 4LSLB 2XSJA 4UY85 3TAMB 4DHVA 4IQXA 2FLLA 4C8YA 4YR3A 4A8YA 4JI1F 1WHXA 3M8SA 3G6ES 4M5DB 2BOPA 4NMLA 4QBUA 1BQMB 1S9GB 2KO1A 1GAOA 1P1LA 2OFHX 1LQ9A 5IS2A 1OQ3A 1UAWA 5KG5A 3DI6B 1JLAB 1MMDA 2E44A 4HL9A 3WC0A 4ZK7M 2UUAF 3KHLA 3M6UA 1NHVA 5F41A 2C3OA 2FPHX 1AUDA 1RT5A 2BANB 1FA0A 2DGQA 3CTRA 1APSA 2FVRA 3O8WA 2VPZB 3TRGA 5KFIA 1MNEA 1JLFB 4DN9A 3U1NA 2J0SD 4A46A 1C1BA 4OX8A 2ALZA 3FNNA 4JV1A 1JMTA 4OZJA 3AQOA 3V4IB 5K9FA 4PPZA 3NAHA 1C0UA 2GQQA 4ZCKA 1T03B 2R7SA 3D2WA 3PIOQ 3BN7A 1PSDA 1F9FA 1ZM3A 3CCSS 1KD1T 4X4PA 2BE2B 2FJEB 4F8RA 3G8QA 2AJFE 2U1AA 3LP2B 5DQGA 5E2QA 3UQSA 5A8KB 1R0AA 2DGUA 2ASJA 2MKKA 4LVOP 4J9KA 2ZC3A 4C11B 1H2UX 1JJ4A 2GIRA 4X65F 3RZAA 5I42B 5DG7A 1HI0P 3QAEA 3TO8A 4A8WA 1X5PA 1V3RA 2VBYA 5HL7Q 1FE4A 4PG5A 4MK8A 3VAMA 4NX9A 1HBUA 3GG0A 4YDXA 4ZMMA 1N5YA 1NRKA 4J9LA 4PXBA 3D0GE 4ZPDA 2CG4A 2MQPA 5I3UA 4PUOA 1NJXA 3L95X 1C2PA 1WWHA 4Q8EA 3BO2A 1S77D 4DV2F 1CEZA 4UY8T 4NZ6A 1HPZA 2KFNA 3DRSA 3QGHA 3HVRA 2HRUA 3IR6B 3MMAB 1S1WA 1VK8A 2FJXA 1MMNA 2EW9A 4IFYA 3I96A 3VZHA 1RT3B 3KMSA 3DMJB 2QT7A 2E1AA 4L6V3 4QIGA 4WIIA 2O1PA 2BACA 1QAXA 3J7ZT 1CG2A 1RTHB 1WEXA 2OSRA 5GADU 2H9ZA 2YH0A 1VOMA 1X7VA 2RF2A 4Z37A 4DUYF 3C6UA 1ZM4A 5T7LB 4C8MA 2NLWA 2N82B 4MJKA 4WZMA 1JLGB 2FHKA 1R27B 3LAKA 4IQMA 5DO2A 4ZPWR 4AQYF 1H98A 2F1FA 5M2RA 3H5UA 2VG7A 2VQFF 3MR3A 5GVQA 1HD1A 4AYBD 3CPWR 1X9MA 2MZ1A 2N3LA 4X84A 1S1WB 1IBLF 1XNRF 4NCBA 2O67A 4PXCA 1IQTA 2CQCA 1PILA 3KOAA 3UW1A 4J9PA 4FBUA 3M2RA 1WG4A 1FT8A 2HQIA 4KGKA 2ZVSA 2MGZB 3I31A 3MURP 3B8HA 4WYLA 2M2BA 4X66F 1KQFB 1WG5A 1WD6A 5KT7A 2UVRA 2Z0GA 3PX0A 2RQKA 2XHWA 2LA6A 4XPEA 3SV4A 4QW8A 1K1QA 3KKFA 4LFBF 1LOUA 1S6PA 3O6QA 4CO2A 4KFBB 1FK9B 4RW9A 2OPQB 2WB4A 4OHZA 5I42A 3UD3P 2EI5A 4K5RA 4YDDB 3FZ2A 2KM8B 1G1XA 2LVWA 3RAQA 3KTQA 1XC9A 3I4HX 4TLRA 1UKUA 2UVVA 4OI0A 1F5BA 3FJ2A 3GE9A 5E3PA 5A0YB 2XWYA 2K2PA 3NGDA 1R0AB 2VH7A 3QO9B 3LP2A 2HVHA 3JSRA 3MM8A 2BE2A 4H4KC 2NR0A 4I68A 3US5A 5J2PA 4R5PB 4NPOA 4I0WA 2DTJA 4X2BA 4O23A 3O3LA 3PW5A 1C0UB 2R2RA 5D3GB 1HWJA 2CQIA 2X1FA 4TQSA 2ROPA 3PY8A 1XK8A 2AJ1A 2EFGA 2FGOA 3V6HA 5HO4A 4NZ7A 1AXQA 2J9DE 2QLXA 2WSFC 5D77A 5F9LA 2F4VF 1G3OA 2EFVA 3FMWA 3OL8A 3OFFA 1WNEA 4PRFA 4Q0BB 3T5LA 2XBPA 2WHOA 3OJSA 1S7HA 2X1GA 1NJZA 4DWIA 3NG8A 1L3KA 3QO9A 1S1VB 3IFEA 3KK3B 3J7Z5 3KLHB 1RT5B 2C2RA 5J2NB 3T1HF 2LU1A 4PG4A 2L3MA 3H5YA 6FD1A 3UPFA 1L3UA 1VQYA 3AHPA 1U1NA 2OPQA 2BV3A 2DGXA 4LF7F 2RE1A 3C46A 1FK9A 4RW9B 4ALZA 1HNWF 3MHYA 1S6PB 2DNOA 3D1OA 3VQSA 1S9GA 1BQMA 4NYZA 5L8RC 4MH8A 2R7WA 5GAEI 5IQQA 1S0NA 1QLNA 2D3OR 2KT2A 4HTJA 4QWAA 2C42A 2J0XA 5KFAA 3TAMA 1HA1A 2R4FA 4OX9F 5KFQA 4X4OA 2HHVA 4FXVA 1RDRA 1YG0A 2OD4A 3W7BA 1U26A 2Z4PA 1TL5A 5T41A 1HARA 2DH9A 2YWGA 3FFIA 3HHLB 5GAGU 1N0VC 2HFZA 2VFVA 3KLFA 4A8FA 4ED7A 2VG7B 2CPEA 3TA0A 1TKXA 2HS3A 2YNHB 4Y28C 1O0PA 1XERA 1FNOA 3MPVA 3HDSA 2EFPA 4F4YA 3TAPA 2BQ3A 3AB4B 4UQTA 3C6UB 5E0OA 2JRSA 4EWTA 1OS5A 1RT2A 2CQ2A 2B7BB 2CPHA 4MMOA 4Y6IA 1RTIA 3MD3A 3OL6A 4ECUA 2DISA 2MZQA 2A2CA 3DMJA 2KB2A 4MK9A 4FF4A 1KTQA 2IMWP 4RW4A 2QMXA 4YB5A 2HNZB 3MMAA 2AWZA 2F9JA 3EXCX 3DRSB 4DV5F 1HPZB 5HMZA 4K4TA 1J2VA 3JTPA 1N8RT 1QSLA 4NYPA 5KT3A 1VGYA 3M9OB 1NJIT 2IRUA 2VBWA 1XR5A 2C3MA 2KDOA 5I3UB 3H25A 3O44A 2HYIB 4J9RA 3DLLQ 2MSSA 2CPZA 2HGLA 2AJQA 4DSEA 3W2VA 1RISA 1S6OA 3CJ5A 4WFNQ 3PW0A 1KNZA 4TNOA 3Q2SC 5LSLA 2B43A 2KVIA 2FHOB 4F25A 4ZVGA 1ZM2A 3I32A 3M6VA 3M4XA 5F8IA 4B3SF 1T94A 2PDAA 2FTRA 3MEDB 4PWDB 4N8NA 2BVZA 3K8VA 5A8KA 3THPA 4IOAQ 5E3AA 2NS1B 2XMTA 1VK3A 1KS2A 3GMGA 5LSRA 2DO0A 3I0RA 4QPXA 4EYHB 2LXIA 1ZPVA 2GQ2A 5LJ5Y 5THWA 5BYSA 3V4IA 5F8JA 5KFJA 3MOZA 5KG6A 2RKIA 1U1PA 4I7FB 4C4WA 5C24A 3FEZA 1SUQA 2NPFA 2QSFA 4B08A 3I87A 1YWXA 1VS3A 2XMKA 2RUGA 1QE1A 4C0HA 5C25B 2PMHA 3HHNB 4G1PA 3H2LA 2CQ0A 3KLGA 2BANA 3X1LB 5B0GA 5KFDA 4RBUA 2KXFA 2VPWB 3LWMA 4ES3A 3UFCX 1H2TZ 3N01A 1JKHB 3M2VB 2DNGA 1H3DA 2YVSA 3CJKB 2ZJRQ 1U2RA 2BRKA 4C9DA 1TUVA 2BYCA 4CNYA 3DLEA 4TU8A 1JX4A 3ZZRA 1H6KX 3IN5A 3KHHA 5B0DA 4IH7A 5DLGA 1IKYA 3JYTA 2UXCF 3CB4A 4M5DA 3MEEA 2QRRA 5KFPA 2DGWA 2HNDA 4FPRA 5HMWA 4IDKB 1QTMA 2VKRA 3RAXA 3WX4A 1SKSA 1U8SA 5F8HA 2IRYA 5GAGI 5EN1A 3GR1A 3ONQA 4I56A 3K57A 4DV4F 5HP1A 2Q66A 5KFWA 3EX7B 4M1KA 1V9OA 1FXRA 4KGMA 4OIXA 5DDPC 1VC0A 2XS7A 1RWUA 2XZWA 1S1TB 5A6PA 1IBKF 5J1NA 4IYQA 4B9NA 4RKUC 5DQIA 2XMUA 2BA9A 1UMJA 4KBIA 2YKQA 1N48A 1U6ZA 1RJJA