1M5PC

Transition state stabilization by a catalytic rna
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
92
structure length
92
Chain Sequence
TRPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA INHIBITOR SUBSTRATE
publication title Transition state stabilization by a catalytic RNA
pubmed doi rcsb
source organism Homo sapiens
molecule tags Translation/rna
total genus 23
structure length 92
sequence length 92
chains with identical sequence F
ec nomenclature
pdb deposition date 2002-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1m5pC00
2U1AA 2BOPA 2I2YA 1U1OA 1UW4A 2KN4A 3UCUP 3B4DA 3H2VE 3VAFA 1ZZNA 2DGUA 2YTCA 2DNLA 1DBDA 3DXBA 5GAGU 2F9JA 1HL6A 2QFJA 5DM7Q 5DM6Q 1FHTA 4Z2XA 1Q7YT 2M4MA 4M5DB 2AYEA 3VAJA 1WF0A 1VBXA 1S72S 2N7CA 2MQOA 1U1RA 1VQKS 1VBYA 1WELA 4IOCQ 3CCUS 3G96A 3CCSS 1JJ4A 2DH7A 1VQMS 5HO4A 1S79A 2MZJA 3CCJS 2CQ4A 2E5GA 1DRZA 2F9DA 2DK2A 4FXVA 3G6ES 3UCZP 1X4DA 2K8GA 4WFBQ 4WFNQ 3CXCR 1U1PA 1VQ9S 2E5HA 4W90B 2LCWA 2X1BA 3NNCA 1AUDA 3NNHA 2DO4A 3TO8A 3NS5A 2DGTA 2CPYA 2BZ2A 3G8SA 1YTYA 4V19X 3NNAA 1WHWA 2L41A 2MPUA 2CQHA 3G71S 1WF1A 2NLWA 5LXRA 1VC0A 3MXHP 4TLQA 2DGQA 5JVHQ 3CCVS 1CVJA 4QU7A 3CPWR 3R1HA 1VQ6S 2AYMA 2JVOA 2MKCA 4QU6A 2J76E 4F02A 2KHCA 1WG4A 2CQDA 3P5TL 3N9UC 1G2EA 3ULHA 3VAMA 3CULA 3VAHA 1X4EA 1NO8A 3MD1A 4A8XA 4WFAQ 2CQ0A 3NMRA 3VF0B 2LXIA 1JMTA 3G8TA 5DDOC 1KC8T 2N3OA 3CCLS 1VQOS 5CYJA 1KQSR 2J0SD 1YI2S 1YJ9S 2ADCA 4U67Q 3FEYB 1H2VZ 2MYFA 2DB1A 2LA4A 2MMYA 5IM0B 3OW2R 2CPFA 1YJWS 3IWNC 2KXHA 1R8PA 1U6BA 3P3DA 3L3CA 2CQIA 1WTBA 3G9CA 2DGWA 1OPIA 4PRFA 4UY8T 2GHPA 3LQVA 3MD3A 1RK8A 2SXLA 2DGXA 2RRBA 2M0GB 2L9WA 2XB2D 5JVGQ 2X1FA 1UP1A 2XS7A 2RQ4A 4ERDA 1U1NA 3Q2SC 2KT5A 2KH9A 3UD3P 2EK6A 2XS5A 1VQNS 3CMAS 4LIRA 2PE8A 5LXYA 1YWXA 3I55S 1WG5A 2KRRA 2ADBA 2M8HA 1N52B 2G4BA 2DHAA 3HI9A 3CC7S 3HHNB 1UAWA 1M5VC 5LJ5Y 4CH1A 2JWNA 1SJQA 3S7RA 4J5OA 2KFYA 3CCRS 1X4BA 1X4GA 2E5IA 2FPHX 2YH1A 1B7FA 4YOEA 1WG1A 3MDFA 4WF9Q 1WWHA 4WIIA 1WHXA 1FJ7A 5GAEU 2HVZA 3MURP 2QA4S 2CQGA 3BEGB 2DH8A 2E5JA 3PIPQ 2RVJA 2MGZA 5GMKa 2QEXS 1OIAA 3D2WA 2F3JA 2XSFA 2DGSA 1URNA 4UQTA 2DNGA 2X1AA 2CJKA 1H2TZ 1XN9A 2DNOA 3S8SA 2DH9A 2FC8A 1WHYA 1M5PC 3MUMP 2KU7A 5LSOA 2MQLA 2N82B 2CPDA 3VAKA 1NJIT 2N3LA 2KXNB 2MJNA 2CQPA 2DISA 3R1LA 2YKAA 3MUVP 2DGOA 4BS2A 2RRAA 1VBZA 2VONA 2CQ3A 3CMES 3V4MA 2D3OR 3UWTA 1X5TA 1FJCA 4LJMA 1QVGR 4TU9A 3SDEA 4OZ1A 4IOAQ 2RS2A 1PGZA 3MOJB 2JVRA 2VOPA 1WEXA 2DIUA 2DHSA 4C7QA 2YWKA 2XS2A 1ZZFA 1PO6A 5D78A 2LQ5A 2MKIA 1A7GE 2RT3A 5DDQC 1VQ4S 4WKRA 3CCMS 2DNHA 3UD4P 1KD1T 2DNPA 3BO3A 3MUTP 2MB0B 3G4SS 3DLLQ 1A9NB 3Q2TC 3EGZA 2ERRA 3RW7A 3JB9k 1DZ5A 2DGVA 3S6EA 3EX7B 1X4CA 2HZCA 4EGLA 1P1TA 3ZZZA 3BS9A 2MXYA 2MZ1A 1SJ3P 1Q81T 1K73T 4YB1P 1K9MT 3SXLA 1N88A 2J8AA 2WBRA 2KYXA 3P49B 1F9FA 1VQ8S 2MJUA 2E44A 3CC2S 2CPEA 2DITA 3P6YC 2CQ1A 2LKZA 3CTRA 2MQQA 2MY7A 1W2BR 4QPTA 2LEBA 2CPXA 3UE2A 2LXUA 1D9AA 2NZ4A 2DHGA 1N8RT 3R27A 1U6FA 2KRBA 2KG0A 2M7SA 1M90T 2AYBA 3IRWP 2XNRA 1L3KA 3BO2A 2ZJRQ 2DNZA 4IUFA 2A3JA 2EK1A 2KG1A 1QVFR 2LEAA 1IQTA 4CIOA 5ITHA 4QQBA 1X0FA 2DHXA 5DDPC 5CA5A 2MQPA 2OTJS 2CPHA 3S01A 2MGZB 1KOOA 2DNRA 1OWXA 1U2FA 1SJRA 5LJ3Y 2KM8B 1FO1A 4OZ0A 1FJEB 3UCGA 2KI2A 2DNNA 1H2UX 1JJ2R 3VALA 2OSQA 3CCQS 5HL7Q 3ZZYA 1U1QA 2MQNA 1X4AA 1YJNS 1WI6A 3CUNA 3CC4S 2ZJPQ 5GVQA 2LECA 3FEXB 3J7ZT 2DNKA 1VC5A 1M1KT 1WHVA 2HGLA 4FXWA 2PEHA 4W92B 2MY8A 1U1MA 4IO9Q 2HGMA 4TU8A 4ZKAA 2G1DA 2DO0A 2Q79A 2FC9A 1M5OC 3SDEB 1DHMA 3U1LA 2MHNA 4CQ1A 4RU2A 2MKHA 1OO0B 5IFMA 2CQ2A 2M2BA 3VAIA 5DDRC 3K0JA 1VQPS 2M70A 1SXLA 2MQMA 1KOHA 2X1GA 2U2FA 3SMZA 2EVZA 2KVIA 4C0OC 1X5PA 1YHQS 3CCES 4ED5A 2MZQA 2JX2A 2MKJA 2MKSA 4C4WA 2DIVA 5EN1A 1FNXH 2AD9A 4P6QA 2J0QD 2M88A 2OTLS 1WEYA 5MLCV 5GAHU 1VQLS 2YH0A 1VC6A 1X5OA 2JRSA 1R8HA 3CF5Q 2HYIB 3PIOQ 5FJ4A 3US5A 5BJRA 4YUDA 2HGNA 2B0GA 2V94A 2CPIA 2UP1A 3VAGA 4PR6A 2FY1A 4WCEQ 3LPYA 1YIJS 1RKJA 2OJ3A 4F26A 1SJ4P 3TP2A 4CH0S 1U1LA 2MKKA 2CPZA 2LYVA 5H1SV 3BO4A 1SJFA 1BY9A 2CPJA 2RQCA 2CQCA 2ZJQQ 1YITS 1D8ZA 1VQ5S 4TU7A 2RNEA 2MSTA 2KXFA 2FHOB 2O3DA 3THPA 4PKDB 2GO9A 1UFWA 4Y0FA 5GADU 2M9KA 2AYGA 1O0PA 2DNQA 2K3KA 2VOOA 1ZH5A 1VQ7S 4Y00A 1X4FA 2LMIA 2RU3A 1K8AT 2MZRA 4F25A 2DNMA 3CD6S 2D9PA 2G0CA 5LSLA 2CQBA 2D9OA 2DNYA 3NS6A 5CXTA 2MZSA 1X4HA 1N54B 1NU4A 1WI8A 2MZTA 1HA1A 3I56S 1P27B 3EGNA 3J7YU 1FT8A 3MI7X 2M52A 5DETA 1HD1A 2MSSA 1H6KX 3H2UB 2L08A 2M8DB 1Q82T 1WF2A 2XNQA 2OSRA 5IQQA 3THTA 1M5KC 2LA6A 2RUGA 3B4MA 5D77A 2I38A 1JJHA 1HD0A 3TYTA 1WEZA 1X5SA 1QM9A 2OIHA 3RW6A 5IM0A 1Q86T 1U1KA 1FXLA 2VODA 2RS8A 2KM8C 3U1MA 4LMZA
chains in the Genus database with same CATH superfamily
2XCPA 4RW7A 3B4DA 2DGUA 1DBDA 5D0RA 2ZH2A 2M4MA 2W2QP 3T5LA 1T7PA 1MMNA 2CNKB 3ZTPA 1N34F 1FI4A 2KFNA 1RHRB 4TLRA 3PDNA 1D3WA 1DRZA 4A4JA 1R8AA 4DSFA 1S99A 3H40A 3CJ2A 1S1UA 2BZ2A 5J2PB 1WHWA 1UA1A 3JTOA 2MPUA 2E66A 2AP6A 4N41A 1UZDA 2ZE2A 1BC6A 1VC0A 1Y5LB 1CS4B 3GYGA 3R1HA 4ZCIA 3M6UA 3NP5A 3GTYX 4NZ0A 3CB4A 3MCSA 2FJAB 3LF0A 3CGIA 4I6WA 1J5EF 2XM3A 2FZCB 2HK3A 2LXIA 3IM8A 2QLBB 3R6LB 2NXJA 1KQSR 1S1WA 3SI8A 4DFMA 3UI3A 4O4GA 5K8OA 4PXCA 1OPIA 2BJ8A 3LQVA 3KYLA 3GB0A 1MG7A 4USMA 4HHUA 2W9BB 3PZPA 3T9NA 1F0XA 4ZK7M 4WP3A 3NGTA 1T03B 2M8HA 2H9ZA 3HHNB 2JJ4D 3K8WA 2WB1D 3HFKA 3Q8RB 4RWWA 2AT1B 1LWFB 2BBEA 2FPHX 3OL6A 4WF9Q 3MR6A 1FJ7A 4NYZA 2FVQA 2QJ3A 1CULA 2VKZG 3I96A 3NGRA 2BABA 1FTRA 4DQQA 4JI6J 4IR1A 3NCPA 3FZ2A 2LP4A 2DD8S 2BJEA 3ZZRA 2DNOA 5D4PA 1T9WA 4C8ZA 4OI1A 3WBZA 1V6HA 3MR2A 4IDKB 1VLYA 4OX9F 4DPOA 2VQFJ 2DISA 5J1EA 3O1LA 1U8SA 4CYUB 1YJVA 2OUGA 4O44A 2W9CA 3AJDA 1R0CB 1WEXA 4CLFA 2YNIA 4C7QA 1ZZFA 3SZ2A 1FF2A 2D3ZA 1HQ2A 3A4TA 2DY9A 3RW7A 1K0TA 2BJ1A 2FYXA 4M5KA 5KFDA 1F9FA 5JMNA 4QCLA 2HEKA 3BM7A 3GFYA 4R8UA 2DHGA 1N8RT 3BBFA 1FKAF 2GGPA 2KG1A 4CNZA 3BGOP 2MQPA 2YNFB 1LEOA 1OQ6A 1MN7A 4V1Ak 1NK6A 3P8BB 1XWLA 4L74A 1H2UX 1KKHA 3FEXB 4DV6J 4I2PA 2ZHOA 1QDUB 2B4OA 4ZKAA 3NWRA 1UJ5A 1VHIA 1Y3KA 4I68A 4CQ1A 2ZZTA 3QGPA 1Q8KA 5B0BA 5HLFB 5DDRC 5JUMA 2B9WA 4WJBA 3UDLA 1MWYA 3D6MB 1KOHA 3W2WB 2K2PA 3U7JA 1S1VA 3D66A 2EVZA 2HVEA 1R7IA 2P9EA 2CA9A 1TAQA 2FTRA 5I42A 3D68A 4FVMA 4P6QA 2OELA 2VG5B 3DLBA 2DXFA 2HYIB 3I87A 5FJ4A 1ACMB 1B99A 4ICLA 2OPQB 1CSJA 2C3PA 1UKUA 3HHEA 5IZHA 2FY1A 2C2RA 4F26A 3MEDB 5D0HA 4CO5A 4DUZF 2APOA 2CKWA 2M5YA 4OI6A 2AHOB 2W8KA 3CO9A 2JEIA 4HL9A 3KLVA 2JEGA 4OYBA 3L7UA 1VQ7S 3GG1A 2LMIA 5KFVA 1YLXA 2QLFB 2BJDA 4A46A 5KG2A 1TV6A 1VRTB 1X9WA 2V2KA 1HA1A 3L9ZA 3RR7A 2WSEC 2OMOA 4L3NA 4ANCA 3OXFA 4KKOB 5L1IA 4LRDA 2ZBPA 1GTEA 3KK1A 3AA9A 2HVDA 2OSRA 3B4MA 1TK8A 5L1LA 1HD0A 1QM9A 1FDDA 3LO3A 4MYTA 3KLHA 1UW4A 3MMBB 3EJMA 4WIQA 2QFJA 3PKMA 3A8KA 1FHTA 4U8YA 1JKHB 2CXEA 3VAJA 4DF8A 4O3QA 2N7CA 1VQKS 1VBYA 2R7UA 4EYIB 2NPFA 3CCUS 3WX8A 2CADA 4L3KA 1CQNA 4CLTA 3DM2A 2KB2A 4CI0B 3TX0A 1ULRA 4X64F 4LF7J 3MTJA 1TELA 1NRKA 4K50A 4K5RA 4IFVA 5KFOA 2BRLA 3NNAA 3EVMA 2UXBJ 4U7UD 4U7CA 3VGTA 3HKZD 2UUAF 3QYYA 4DCJB 4TY8B 2Z0GA 3FRZA 4X4VA 1M5HA 3W5ZA 1FA0A 2ALYB 3MM7B 5A8RA 3QLHB 5CCMA 4U67Q 4H4KA 4PWDA 2EFQA 3FEYB 3OR1A 2LA4A 3KUGA 2RDJA 4NYOA 4U9RA 5HMYA 4DR5J 3JYTB 4P2SA 4F36A 5FLXY 1HPZB 3UDVA 2IJFA 3BQ0A 4LF4J 2GHPA 4ZPDA 2RAQA 2IM0A 2M0GB 2W2PP 1FKPA 3L4BC 2XB2D 1U6ZA 3CD5A 5HJYA 3BF4A 4DV2J 2XS5A 1VQNS 4DV4F 4IG0A 6FDRA 3BREA 2ADBA 4C97A 1JLEB 2YKMA 2ZZNA 3GIIA 5BXIA 3TA1A 1RT4A 3A1YG 3CCRS 3LA0A 4USHA 4P74A 5KG0A 2PMWA 2DBBA 2DH8A 4PXEA 2F3JA 2WRMA 2DKOB 3G82A 1J5OA 4DV1F 1V3RA 2KJVA 2X1AA 4DV7F 2DH9A 4WU3A 4IFYB 2H48B 2OEJA 2CPDA 1F1BB 2KXNB 3BQ2A 2YKAA 2F4VJ 2DGOA 2GIQA 2HWHA 2Y3YA 4TU9A 4UUXA 3FUYA 4GVBA 3ILIA 1RT5B 3FRYA 1NEEA 4WKRA 2DNPA 3BO3A 5CD4A 1DTTA 2UUTA 2XZTB 3G6VA 4JI2F 1S10A 2HZCA 3AXKA 4JI8J 2W2OP 1T9TA 3HZGA 1WC1A 3P49B 1Y9OA 2E44A 3CC2S 1TQLA 2F63A 2VC0A 1JLAA 5KOWA 3R27A 1U6FA 4DSEA 3QT6A 1L3KA 2EK1A 2IVFB 3BDEA 5CA5A 4YDDB 2YBVA 1HNZF 4I6YA 3QRPA 4XDCA 1FJEB 3KTQA 2ASYA 1RLCL 3VALA 1HR0F 1WHVA 1J27A 4B3OA 3HPOA 1VIXA 5LMNJ 4TQRA 3ZZPA 4F4ZA 2FC9A 1W7WA 4RU2A 5IFMA 3CCWA 4O3OA 4HACB 3W63A 2X1GA 3H4DA 2KO1A 4BDPA 3TUJC 2HW3A 2MZQA 3EPIA 2ZUGA 4AQYF 1W25A 4NLVA 2XMMA 1VYAA 5F9LA 1SC6A 4YMEA 2HWTA 1H74A 3MMJA 1GFWB 4LFCF 3V4IA 1SUQB 4U6PA 2C3OA 4X4NA 1KHWA 3FCHA 4USUA 1XEZA 3FMBA 2VKRA 2XY7A 3M6XA 1HHSA 3W9IA 2NCKL 2ZHAA 1HYSA 3JSMB 3LWMA 1MLAA 1Q16B 5GADU 3GILA 3T1YJ 2JNJA 1ZH5A 4P2FA 1PJ7A 4DS4A 4J37A 2ZFHA 2RILA 4NLRA 1Q1KA 5LSRA 5DG9A 4NLXA 2BKOA 2ZOGA 1O5JA 4PG5A 5B0CA 1U09A 3TYTA 1RTZA 2G13A 3V6DB 2EFVA 2UUBJ 2R7SA 1RLDA 2DNLA 3ELHA 3WIUA 2HQGA 4URGA 2VU5A 1LXJA 1N0UA 1ZM4A 4IYQA 3VR1A 4J9LA 4Y6IA 3CCJS 2B8QA 4FXVA 3UCZP 2VPYB 3D5MA 2K8GA 3KHRA 4HLBA 4WFBQ 3A3OB 2XEXA 4NLTA 3QBCA 3W8PA 1QE1A 2YWHA 1UVJA 1F5AA 3G71S 1RAIB 4PG4A 3AOBA 4KPYA 1QY7A 2VDIA 3C15A 4CP5A 5LXRA 2UVUA 4IRCA 1EIYB 4MFBB 3CPWR 2JVOA 3HSGA 2ZKUA 3POTB 2Y0SD 1OYDA 1D9FA 2Z2LA 4RW4A 1TKZB 2EI5A 5DO2A 4FF2A 4NLOA 4YB5A 4A8XA 1VQOS 5CYJA 3GJTB 1F3FA 5A6WA 5CQGA 2HFNA 1WC5A 4RUBA 3FDSA 1U6BA 2I1RA 2QL9B 5HMWA 4RW7B 3M8SA 1NNDA 2IJRA 1SQFA 1WD6A 2IDLA 4CZCA 1TL4A 2GX8A 5KG4A 1L3UA 1T8EA 1FERA 3R9LA 3BZQA 4FNIA 1GEHA 4I56A 5CZVA 1GXTA 3LH2S 2BJ7A 5KTQA 3CMAS 3I55S 1U8WA 2H54B 1S1UB 1SH3A 4XPCA 4J5OA 2LQ9A 1KS2A 1X4GA 2FJEB 3C6UA 1T3OA 1WHXA 4W98A 2L48A 2ZE2B 3I5AA 3IWLA 1LFWA 3W5XA 4USTA 2MGZA 4OZ3A 1ZPWX 5BR8F 1N34J 1URNA 1XN9A 4OZ5A 4M8LA 5K14B 3DCAA 3GMGA 2KU7A 3QRQA 4IRDA 1EETA 3PW4A 4ECTA 3UO0A 1RT6A 1S1WB 3R1LA 3M2UA 1FVQA 4O4GB 1OY6A 2WOMA 2GJ2A 4LJMA 5F8GA 4OZ1A 1UETA 4ZVHA 3BBBA 3AOCA 4UTGA 1QJHA 1EB0A 3QNWB 1PO6A 2LQ5A 8ATCB 1A7GE 2E29A 3H5UA 1KD1T 3MAHA 5A8KA 5F0UA 1NK0A 3Q2TC 2AQ4A 4OYPA 3EX7B 1J5EJ 1TUWA 3LGMA 3G2XA 2PFDA 2MJUA 4ZPWR 2ZM6F 1HHTP 2LKZA 2C42A 3CDBA 3EWGA 2H3EB 4P7TA 4Y2MA 3DMJA 2YPYA 2NSBA 4C2MA 4UZBA 1UWBA 4PXDA 3HVTA 1JJCB 1CQMA 1JXVA 1S6UA 4K4VA 2NXEA 4KAIA 3JSYA 2C22A 1JJ2R 2BEFA 2DRDA 1VC5A 3I6PA 5KFQA 5J1EB 1U1MA 4KJIA 4KQZA 1N5YA 4RNNA 1QD1A 4O44B 3U1LA 2C2EA 5IQ6A 2W9CB 2YNIB 5AXLA 2BJ3A 3HD1A 2MQMA 2W2MP 4P73A 4B08A 1YHQS 3DOKA 2EKYA 2MKJA 3VVUA 1UZHA 1ELOA 1UVNA 4OX9J 3U1NA 4G1PA 2IA0A 1VC6A 2B5JA 4RW9A 1SCJB 3NAHA 1S0MA 4R8UB 3THVA 1CJKA 2GGPB 5IWAF 1LFPA 2IYIA 1KR4A 3SCKE 2B7BB 3L09A 4F4KA 1BY9A 1DARA 4JV5F 3JS9A 4WYLA 2AEMA 3AH6A 4FF4A 3A3NB 4K4TA 1C0TA 4I2PB 1NK5A 4DLGA 5KFRA 3C8YA 4O3PA 2I0XA 1NU4A 4CCHA 1H0HB 5KFLA 1HNIA 4KFBA 4ZVPB 3H2LA 1TAUA 3DOLB 2AF6A 2VC1A 3EMTA 1LW2A 5KFMA 2I38A 1S1VB 3I0SA 1X5SA 2OIHA 1IKWA 5F0WA 3R3TA 4EYHB 4CLUA 5I42B 2PA8D 2V8PA 3GIMA 3WC2A 2CJAA 2AYEA 4DX5A 1DAXA 1WF0A 2VA3A 1VRUA 1R43A 3M9OB 4ICLB 1KONA 3G96A 2LVWA 4TQSA 7FD1A 1FDNA 3D3CJ 4LBPA 4WFNQ 1GH8A 2E5HA 3HSJA 5CHCB 2R8GA 3MMAA 3NS5A 4V19X 4DCOB 2L41A 3QFHA 1OQ3A 3KOAA 5FD1A 2JEJA 2NLWA 4KR0B 4WK3A 4CNYA 4M5MA 2RD5C 6FD1A 2MKCA 1TV6B 4RBVA 2OPRA 2OD6A 3CMQA 1VI7A 5E3PA 4GO7X 4MK7A 2YKPA 4DUZJ 3OTOJ 3KK1B 1RT7A 3CIZA 2E1MC 1FX4A 2QL5B 3RBXA 5KFGA 4ED6A 3L3CA 1ZM2A 3KLHB 3KNGA 1S6OA 4ZCLA 1BHNA 1KSPA 3GSDA 4OZNA 1RK8A 2RRBA 3A8IA 3JAMU 3J81Y 2CFXA 1YBTA 2E7VA 4EWTA 4ERDA 2ZWPA 3Q2SC 2KT5A 4NPOA 2AGQA 3CCTA 3DM2B 1YWXA 2MDAA 1N52B 3B78A 1UCNA 3HI9A 5LJ5Y 4CH1A 4IFVB 2FJWA 4GKJF 3HX9A 1TMJA 2DR6A 5GAEU 2RQKA 1S5ZA 1S6PA 3NLCA 3ZTOA 3PEHA 4PYDA 2FC8A 4FS1A 4X64J 4DUTA 3KHGA 4KGZB 3MPYA 4OI3A 5A8RB 1WSVA 2MJNA 4PWDB 5K20B 3OR1B 2RRAA 4BS2A 2VONA 3V4MA 4ZLJA 3ISNC 2UUAJ 2JVRA 1KRPA 3BPDA 3H90A 4AFFA 4YY3F 2XO6A 2B9XA 2HHTA 5D78A 2PI5A 3PR5B 4MJKA 3OJUA 1FKPB 4OMFG 3PJWA 2IRXA 4ED0A 3NOCA 2ERRA 4C98A 4TKTA 4DL0C 1EQMA 1X4CA 4B9LA 1P1TA 1K73T 4IG0B 4JYAF 1NJWA 1N88A 4DSIA 3RJMB 1VCTA 1VQ8S 2VDHA 2YKMB 3FNNA 1UFKA 4ZJQA 2CRLA 4GKKF 2MY7A 1RT4B 1PAUB 3TUIC 3W60A 1XR6A 1N32F 4IUFA 1BQNA 5D4OA 2YKNA 3S01A 1U48A 2RU9A 2VHGA 4Y65A 3G82B 1J5OB 4DR7F 2KI2A 4EO8A 4DV4J 3ZO7A 2DXEA 2OSQA 3QGIA 1Z1ZA 3GJSB 3L7OA 1KTQA 3CO0P 4S0MA 4A8KA 4X84A 4HTJA 3D0HE 5KFHA 2UXDF 2V2QA 5ETRA 1DHMA 2MHNA 1FRKA 1XMQF 5IC6B 1FD2A 4GVBB 3OXLA 2XZDB 3RB3A 2AJFE 4Z37A 4DV1J 2DPIA 4DLEA 1FRLA 4DV7J 3OT9A 4NXNF 1G4CA 1DTTB 4C0OC 3F0NA 4X62J 2NPIA 2IVMA 5DQHA 1RAAB 3W8GA 2HZAA 2ZH3A 4DR3F 4M5DA 2JHEA 4DR1F 4MH8A 1MSWD 1JLAB 2A18A 3KXDA 2O5DA 4URSA 2JOQA 2Y8YA 2LYVA 3BKFA 1U24A 2DCLA 4PQAA 2CQCA 4JI2J 2EW9A 1N0VC 2CDQA 2GO9A 1Q7LB 3E3XA 4USVA 2GZOA 1W2IA 2ZH4A 5RUBA 3MMCA 3AQPA 3OV7A 2IY5B 3DU6A 4NX9A 2MZRA 5F41A 4QWCA 4B3OB 2HLTA 3NS6A 3M1VA 5DGBA 1X9MA 3TUPA 3ITHA 3EGNA 1KN6A 2D41A 4E98A 2MEWA 3I9ZA 3IS9A 1K0VA 1HNZJ 5C25A 1NDCA 3IWXA 1RAJA 1GMWD 1EKRA 4ECWA 4WFZA 1U1KA 4ED2A 1HR0J 1R89A 2Y1RI 1XQIA 3VAFA 1IKVA 3UDEA 5GAGU 5I3UA 5ETMA 2L9DA 4ED4A 2A6OA 1U2RA 4OI4A 5DS7A 3AJ1A 1LWCA 1NLKL 4MT1A 2E9RX 3V4IB 4I6AA 4PG8A 1HYSB 3QPIA 1YRUA 1H72C 1BQMA 1RTJA 4AQYJ 3IGVA 3HULA 1RZMA 4F50A 3W66A 4KC5A 4TLQA 2FHKA 1XK8A 2F65A 1WG4A 5M2PA 4FN5A 3DLJA 4LFCJ 2J6UA 2WSCC 1T0TV 1HI8A 1F60B 1S49A 4ES3A 5IS2A 2HFZA 3EDRB 3MAQA 3G8TA 2N3OA 4EU0A 1RYRA 2J0SD 1YI2S 2LEPA 2FVPA 3MM5A 2ZVSA 3R5CA 2DGWA 2C3YA 3D7SB 3QAEA 5D4LA 5D4NA 1V3SA 5E7OB 2VBWA 2R8JA 1EKSA 3PHEA 2FLPA 4BWMA 1IM6A 2JSXA 2EK6A 3I5CA 4ELTA 3PW7A 5LXYA 1Z4UA 1S1TA 3J7YI 2WSFC 1KFSA 4DL2A 5HQMA 1T02A 2RH3A 4WP8A 1QE1B 3MF5A 2E5IA 3HXMA 3BGFA 3N6NA 3MDFA 5ETNA 3LTOA 3MM8A 3C15B 4Q2MA 1JNZB 3N6MA 3PXGa 2P2CB 1FK9A 1WKLA 3I4HX 1JQGA 1HI0P 5IV4A 2QT7A 4RW4B 5HK4A 1NXIA 2CJKA 1H2TZ 4B17A 2ACYA 2GJIA 3K7RA 2BV3A 2BQRA 1S9EA 1EX8A 2N82B 1FVSA 1MROA 4FF3A 4JI3F 4F3QA 1UA0A 1RBLA 1KVIA 3FBBA 2HS3A 5C24A 2BOAA 4P75A 1ZM3A 3UDCA 5JXSA 4WYWA 4B3MF 5A76A 4DV5J 3H59A 4MMOA 3NMAA 4Y28C 5HVHA 1G7CB 5HI7A 1NSQA 2Z58B 2HPUA 1RHMB 3MPWA 2IVYA 3NGDA 2IM1A 4DQRA 2IDEA 2K1RA 3P6YC 3BH7B 4NI2A 2I9SA 3GCXP 4CLSA 2LEBA 2CPXA 3TQEA 3C6UB 3BO2A 1QUPA 4NASA 3UPFA 3TJ8A 3CDWA 4KYZA 4YFUA 3K5LA 4QQBA 2ZBRA 4N7TA 3SCLE 2PDAA 2MGZB 1R31A 1GAOA 2XYPB 2DNNA 2VJVA 2ZUAA 4J9QA 2RMLA 1CG2A 4WTYA 5K5MA 3HHLC 1EETB 1RT6B 2CZ9A 4IO9Q 3M2UB 4RJVA 5IT0A 2WOMB 5CABA 4KGVB 1C0UA 1SL0A 4IH7A 3K0JA 4KHPF 2P9GA 2E9TA 3CE8A 2V5HG 5A8KB 1Q8IA 4OLOA 2ZOMA 5EN1A 2PIIA 1HBUA 4FBTA 1SIZA 5B08A 3WHIA 3F73A 3PYGA 2WVDA 1UJ4A 1GTHA 1Y11A 2P9CA 4I1TA 3FMWA 5J2QB 3RU0A 3DMJB 3K5PA 2V94A 3GG0A 4HH0A 1B0PA 1UWBB 1RT2A 4WCEQ 3LPYA 1HWJA 3HVTB 3BBCA 1SJFA 2Q6BA 4OHWA 2OEKA 2ZJQQ 4JUZA 2ZVIA 2EWHA 4WE1A 1U02A 2FVCA 4A8QA 4DPYA 4RLEA 1X4FA 5HQ8A 2BKNA 3DLEA 3OTEA 3HO1A 2OAUA 4OL8A 3E01A 3RR8A 3QT7A 3IXQA 5KFSA 4ED7A 3N4WA 1N5YB 4B9VA 4CLZA 1N56A 1O6XA 2NQPA 5H9EJ 4NCBA 3O3LA 2XNQA 1S0NA 2O1PA 2LA6A 2DCUB 3RUBL 2YX1A 3LGNA 1YSJA 4K7QA 1DJ0A 3RYLA 4L75A 3DOKB 5K8NA 1Q86T 2RS8A 2HRTA 1U1OA 2Q66A 2V0NA 2MQ8A 4ZN1A 3ZNUA 4A8YA 3Q86A 1PC4A 2B5JB 3UFCX 3KMSA 4RW9B 4WFYA 3G6XA 1PAEX 1CJKB 9RUBA 3ETMA 4UOCA 4YP3A 4FDFA 3CJQA 5L9XA 2CQ4A 1LK7A 3PTWA 5D8HB 1AUDA 3PW2A 3IN5A 3BKTA 1WKKA 4W4MA 2RHSB 1ZM9A 3TI0A 1H7XA 1C0TB 3MXHP 3CCVS 2PD1A 1VQ6S 5M2UA 1PCAA 4QU6A 3M9MB 2QGFB 2A0FB 3EGVA 3B82A 9ATCB 3BH6B 1WUUA 1HNIB 4KFBB 3LGHA 2JEFA 1B4SA 4JV5J 1KLNA 4MKBA 1LW2B 1YJ9S 1QTNB 4K4XA 3I0SB 4I69A 1IKWB 3OW2R 1YJWS 3MR5A 2H4WB 3M4XA 1RBOB 3T5KA 3B8HA 4UY8T 5A2QY 1N48A 4ATNA 4NMXA 4LRCA 1VRUB 1MMDA 2RQ4A 4ZVTB 1MN9A 3UD3P 2PE8A 4O3RA 4FKXA 5IC4B 2DYAA 4LFAF 3CC7S 1UAWA 2A6MA 3EDQB 3MMAB 2ALZA 2P6TA 3OSNA 4R5PA 4ZLPA 2AEFA 3CD7A 3M8YA 5GMKa 1NSAA 2XSFA 2OPRB 2C2OB 3ILOA 2AGOA 3C66A 4K2JA 2I6WA 1SKSA 1RT7B 3GE9A 2CQPA 3NGKA 3GV8B 2VICA 2B56A 2AX0A 2CQ3A 4LQ9A 2ZEJA 4Z7YA 4P10A 4E0DA 4B9SA 3MECA 4JI5F 1QTMA 1V3ZA 2VQEF 2A2DA 5DDQC 8AT1B 2B8PA 2HHVA 3HDSA 3NBPA 2VG7A 3T5HA 2VFSA 1SI9A 4G1IA 4ZPBA 3J80U 2Z30B 2DXDA 4AUKA 4LSZB 2B4UA 2QE5A 4HR2A 3G6YA 4CIOA 4YR3A 2HKEA 1D8YA 5DDPC 1Q8BA 2D69A 2G2ZA 5L1KA 4LF1A 3QZ8A 5G4DA 1S6PB 4C8KA 3ENVA 3KNAA 4RUCA 2GCFA 5G0RA 3ZZYA 3KDNA 1U1QA 3MZIA 3QJPA 4B3TF 4DQSA 3PJXA 1IQZA 4ER8A 4GKJJ 2PEHA 4DR2F 3PX6A 3TEHB 3LOUA 3MEEA 2NR0A 4TU8A 2V6AA 3D0IE 1VHFA 4B3RF 1U0SA 1TKDA 3VAIA 4EFAC 2VG6A 3PR4A 4MYUA 3PG9A 4ZPCA 3CW2C 2EPIA 2IAJA 5D0GA 1FFGB 3M7VA 5D6GA 4AL5A 2DIVA 2PMZD 3Q0AA 3PKYA 1IKYA 4C0HA 4NLQA 3OFHA 2CAJA 1TUGB 1V5IB 1YBAA 4LREA 1SH2A 1SL2A 5LOQA 3JQMA 2HBRB 4YY3J 4PR6A 1KDNA 1BQNB 1SC1B 3W7BA 3TP2A 1FCAA 2MKKA 2CPZA 2YKNB 3QZ7A 3GJQB 4Q5VA 2RQCA 2I5JA 4OX7A 2C2NA 4H4OA 1JLGA 4DL4A 4HI2A 3OUYA 4PWUA 4GKKJ 3H5XA 3EYZA 2Q6CA 5EWEA 1UFLA 3GIRA 2AKWB 2CWXA 1N32J 1X4HA 2HG4A 4L76A 3C46A 3UR3C 1FRIA 1KTVA 3RBZA 1FT8A 2CNOB 1FDAA 1XIQA 3O5TB 2KZZA 1HNVA 2L08A 3FGVA 4B3SF 4DR7J 1ZAWA 3D6TB 3D1OA 3TAPA 1JJHA 3QFWA 1ZETA 3RTVA 2VODA 1NK8A 1GXLA 3W9JA 3UCUP 1YJ7A 2UXDJ 4QW8A 2EG2A 4M5DB 4EI2A 4KTQA 2GV1A 2MQOA 1XMQJ 4A8OA 2D74B 2B9EA 1S79A 3N5BA 2E5GA 5D0EA 1B0VA 1FWPA 2LU2A 4CH7A 3PRBA 4M5GA 4KH1B 1RAHB 1OMSA 3L95X 4MK8A 3MMCB 4DR3J 2VH7A 2F8MA 2VFTA 4X4TA 3QAUA 4OLPA 2J76E 3M1VB 3W2VA 3ITHB 4BWJA 2OKQA 3B54A 3ULHA 1NO8A 2JLGA 3IS9B 4ZDNA 1H38A 4JI0F 1SC3B 3PRDA 5C25B 1YGYA 5E41A 2V4JA 2ZDOA 2BW2A 3M30A 4OYAA 1N5QA 1F6TA 1IKVB 5I3UB 3D28A 3QGGA 3C14A 5GADI 1Q78A 1T9VA 3O6QA 4DSLA 3A8JA 1LWCB 4FXDA 4RUAA 4F2SA 3MEGA 4ETXA 2G2OA 1SBRA 4LSLA 4DBQA 4LIRA 1WOSA 2HURA 3LP0A 2XI3A 4OZ2A 4ED8A 3V6KA 1UPPA 4LF6F 3ZFVA 1YJTA 1HBOA 1BQMB 2DPJA 1RTJB 4ZP7A 1QSLA 4NLPA 1IBKF 5B7WA 2Y1IA 4C8NA 4WIIA 5L38A 3PIPQ 4A8MP 3OVBA 3BDPA 4PEOA 1Y7PA 1C1CA 1RADB 4DCPB 4N5SA 2FY8A 1TMMA 4NRTA 2R7XA 4XO0A 2RE1A 2R7TA 5DQGA 4L73A 5FDLA 3UN3A 2FHJA 2VBXA 1NJXA 3F41A 3MM5B 2QYGA 3AB4B 4IOAQ 2DIUA 3NKYA 3HHDA 3KFWX 1DTQA 1VQ4S 3NS7B 4EBCA 2HIYA 2KTQA 3NXZA 3BN7A 3EICA 3NCRA 1S59A 2WHOA 2YPZA 3KLFA 4FKYA 1ZAXA 1K9MT 4K0KF 2WBRA 1S1TB 2MQQA 1CJVA 2ZNZA 3H5SA 1BMQB 1T3NA 3MM8B 1WACA 1FK9B 3G87A 1K47A 1SQGA 5LJ3Y 4EZ6A 1FJGF 3UCGA 3C6TA 5C42A 1Y5IB 4IH5A 1S9EB 2XYGB 1MROB 1ZS6A 2QLXA 4KV8A 1R8BA 2HZVA 5K8PA 4AXIA 4TYBA 4ZLLA 4RW6A 5C24B 3AY0A 2NS1B 1OO0B 2CQ2A 2E9ZA 2KT3A 1SXLA 1FRXA 1YKWA 3CCES 3K17A 4CTAA 1JB0C 4CLWA 4RNHA 3GR0A 4JI3J 4DFJA 1FNXH 2L3MA 4YEAA 3KK2A 2BUNA 2J0QD 2M88A 3CJ3A 2K1RB 4NI2B 3IA0A 1K1QA 1XNRF 4ZVEA 2C2DA 2XGPA 5EGYA 1HWLA 3CNQP 1RTHA 1P8GA 1YIJS 5ETQA 4ZVGA 1SJ4P 1U1LA 3HKWA 4OYIA 2HNZA 3MR7A 2BE2A 2G2YA 1YITS 5K14A 1S97A 1REGX 2FZKB 4Y0FA 4DHVA 2E5LF 3GJRB 4CO3A 3RBEA 5IOLA 1JLFA 1AZSA 4RNMA 1TL1A 3UN5A 1N54B 4J9RA 3MAAA 3SSSA 4ES1A 1GXUA 1C0UB 2YNGA 3FFIA 2D1CA 2FHMA 1L3SA 2J7UA 4PQUA 4DPXA 3M8PA 1CC8A 3BR8A 3PY8A 1WEZA 3PM9A 4QR1A 2V2VA 3TAMA 1O8BA 1TP7A 5DGAA 1ZZNA 1HBUB 5HSPA 5DM7Q 4QYZJ 4CLLA 1Q7YT 5AXMA 4ZPTR 4Y3CA 2R7RA 2POKA 1UJ6A 3A3PB 3M8QA 1NJYA 4KHPJ 1RT2B 4C48A 1LK5A 3DXSX 3DN9A 2LCWA 3NNHA 2DO4A 4WE1B 4DX8H 1ZA2B 5KOXA 2R42A 4EMDA 1B7YB 2VPWB 4M63A 4DN0A 3DLEB 1QUVA 5HN0A 4QU7A 1V9OA 1HQEA 3E01B 2AYMA 1URRA 1U7LA 2R8KA 4MIAA 2CQDA 1RWXB 1B0TA 2OFGX 3NMRA 2EC2A 1J2VA 4JBCA 3CJKB 3RRGA 2R4FA 3IWNC 1SH0A 2AZ1A 4LR9A 2VA2A 4QWDA 2OD4A 2V4QA 1VISA 3G9CA 1RSCA 5KFPA 4C8MA 1RTDA 5DZ7A 4NA2A 1RB0A 1T9XA 4LF8J 2OPSA 1TFYA 2RKIA 3OHBA 2CZVC 2IM3A 1ROFA 1S77D 3TZXA 2D3O1 2FLNA 3GIKA 2AJ4A 3UN2A 3S7RA 1N4LA 5ETOA 3OBIA 3WX4A 3GONA 3BEGB 1OJ4A 2RVJA 2FB0A 2MLYA 4CLPA 3DOLA 4LR8A 1NSKL 4P71A 1JK9B 1M5PC 2OHDA 2JLFA 2JFDA 4MKAA 1XERA 2W8LA 3VAKA 3SIPB 2JC1A 2QRRA 2ZH8A 2NUHA 3UWTA 3V6JA 4WFXA 4WXOA 3BGRA 4LBHA 1VQYA 3CDEA 3PW0A 3G4SS 5A8WA 3WQPA 1S9GA 3W5YA 3OL9A 3HM9A 1DZ5A 4J90A 1Q81T 2MZ1A 3ZZTA 4YB1P 1RTIA 2DITA 4X65F 4QPTA 1VMBA 4FP9A 4R5PB 1M90T 4HT5A 2V8GA 3GWCA 1YBUA 1FFWB 3DLKA 3T3FA 1G1XA 1C2PA 4OZLA 4NLYA 5IT9U 2KM8B 3Q89A 3M2VA 1GNKA 5DG8A 4DOZA 1OPZA 3AQOA 2W25A 4LFAJ 3CC4S 4NZ6A 5B0GA 4JI7F 3H0PA 3LP1A 4C3KA 1H7WA 1X60A 2MY8A 1MNEA 3PHTA 2HGMA 3FKBA 2R7WA 2DO0A 4USKA 2DJWA 4I2QA 3MECB 3EZ5A 2M70A 4ANEA 1TZ0A 3NBPB 1JLBA 1Y4ZB 5GAEI 2VG7B 2UVVA 1F9HA 4RWXA 4ZHRA 1BUXA 1X5OA 4LFBF 1RT1A 3AXMA 3US5A 2Z2ZA 1JWWA 2B0GA 3JSBA 2J0XA 4CT8A 4JI5J 3W9HA 3VAGA 3BKUA 4XIUA 5ETKA 2GAHC 2VQEJ 3EZUA 2FQQB 3PX0A 1TK0A 2ILYA 3MPVA 3Q22A 3ZZOA 1KNZA 2RIJA 1RABB 5G0RB 1Q8LA 1KHVA 2Y1LB 2PGCA 3MPDA 4Y00A 2V50A 5F9NA 1FWKA 3CD6S 4PXBA 1U45A 3MEEB 4DPUA 1HHQA 3I4PA 5A6PA 2XQCA 2IIHA 2J0WA 5FIIA 2GVZA 2MSSA 4PPZA 3H2UB 1Q82T 1UVMA 1HBNA 2VG6B 3FBCA 1UVIA 2IBKA 3DRRA 2RUGA 3ZZ0A 2CJBA 1NHKL 2CG8A 4AL6A 4CM0A 1IBMF 2IAJB 4WBFA 4QWAA 4B3TJ 3N79A 3N6LA 2W24A 4OI2A 1IKYB 2IBOA 4Z7CA 4DR2J 3P96A 1ZOTA 4B3RJ 4BCAA 4F04B 3R5JB 1U1RA 1HW9A 2DH7A 2NYHA 3LUYA 2IHR1 3OFEA 4LF7F 2GA7A 5KFZA 2F9DA 2KT2A 1X4DA 3R7BB 4XDDA 1I3OB 1VQ9S 2X1BA 4KO0A 1LQ9A 2I5JB 4RX6A 1K1SA 4DR6F 3P4UB 3KJFB 1YTYA 1BD6A 4H4MA 1GMUA 4H4OB 1JLGB 1BWVA 3OUYB 4Y2KA 1OSDA 1Q53A 1WC0A 4JB8B 5JVHQ 3KWMA 1RWOB 2NREA 4ZLNA 1PYTA 4G1QA 1NZ8A 1WNEA 2W1BA 4M94A 2BMBA 3CULA 1FRMA 2CJQA 4FPRA 2XY5A 4Q8EA 1HNVB 4JI1F 1P6TA 1G3OA 2LQBA 1KC8T 2WVCA 3AT1B 1N6QA 2MMYA 2RRNA 4UZCA 4X4UA 4OHVA 2CZ4A 5HMXA 2ZDPA 3EVWA 4QJVA 2XMTA 3QATA 4OQJA 1IKXA 5DQIA 3ISZA 3M8ZA 4I64A 3KLGA 2GFFA 2COLA 5LL6d 3HZEA 4B3SJ 2Z57B 2LU1A 5J2NA 4X4SA 3HF5A 2J9DA 1H73A 4DL7A 1R8CA 1X31C 2ZITA 1XTZA 1X4BA 1RU2A 4WZMA 3KJQB 3OJSA 4I4BA 4ZJLA 1WG1A 3MURP 2MKYA 3T5JA 4ECQA 1N5TA 3CJ0A 2QEXS 2JZ5A 4GRSA 2ZBQA 5DZ6A 3W2VB 3HHLA 4Y2IA 4UT4A 5GAGI 4DXLA 3UNGC 2ASLA 5J1NA 4CLYA 4P7VA 1Y3JA 3GYXB 3EXYA 4BBYA 4ID8A 2V4JB 2XO7A 3Q8VA 4ECUA 4F3OA 3ENWA 3TJ9A 2H65B 1SVDA 3M30B 4DV0F 3H7HB 1WTFA 1HIYA 3SDEA 3K89A 1X7VA 1LKZA 3M6WA 2V4RA 2YQ3A 2DT9A 1NKBA 1S4FA 3HFZB 3C14B 4EK2A 2C3UA 3DHWC 2H51B 2MB0B 3EVOA 4JI8F 2ZBIA 4HT7A 4ZN3A 4JI0J 4LQ3A 1R0BG 3MEGB 3W1YC 1NHVA 4LSLB 3ZZZA 1NM2A 4QWBA 3LP0B 2J8AA 3N01A 3KMQA 2CUYA 1P9QC 2LXUA 1M5SA 1HBOB 3CJTA 4HDHA 2FVSA 4ES2A 2KHDA 2LEAA 2ZC4A 5KFAA 4ZP8A 3OFGA 1WDDA 3IAM9 1Q5VA 2Z8QA 1C1CB 5L8RC 3CJ8A 5ETTA 2DRBA 5AJ3F 4YR0A 4HDGA 2MQNA 3K59A 2L9NA 3N28A 5HBMA 1VOMA 5K9FA 1E6VA 5FDLB 4LRBA 4NEYA 2ACMA 3F56A 3KHLA 3ICLA 4NLUA 2V2ZA 1Q5YA 2YKQA 4F7VA 1F5BA 4WPAA 1FEEA 4DEZA 4A48A 4RBTA 1DTQB 3ET6A 2XHWA 4WZQA 2EFNA 4R25A 1SQEA 3MM9A 4KHMA 2KVIA 3KLFB 2V8HA 2IC3A 3PW5A 1TL3A 4ZVRB 2UXCF 3DDIA 3PO5A 2Q3PA 2J6TA 2YH0A 1CJVB 1S0VA 2X51A 2XZWA 3R6GB 1JLQA 5BJRA 4YUDA 2B9YA 2P6SA 3HD2A 1A0OB 4J9KA 5GMEA 4CH0S 2FJXA 3HFVA 5E3CA 3R5BA 3MTKA 3PNIA 2AJ0A 3DYAA 4J7CA 3G8QA 1PC5A 4PKDB 1UWAA 3C6TB 5C42B 3AOAA 4K0KJ 2AYGA 1O0PA 1R6YA 3ENAA 1K8AT 1RE1B 4KV8B 1UVKA 2B51A 4RW6B 4DSJA 2XCAA 2QYCA 3JTPA 1UEKA 3AD8C 5IQQA 3THTA 2DR8A 1M5KC 2IYGA 1FJGJ 2VFRA 4RBUA 1AROP 1BE4A 2VD3A 2BVZA 4CTAB 3TWZA 3U1MA 3PYDA 2BA9A 2I2YA 4QR2A 3VHQA 1EP4A 3KK2B 4F4WA 3CJSA 3SQOP 2A10A 4OX6A 4RO0A 3HVAA 1UL3A 4DZ6A 3LALA 2ZZMA 4NOHA 1SIWB 4LRAA 3MOZA 1RTHB 4O23A 2MZJA 1WC3A 4O3SA 2WAQD 1RISA 1X0PA 2HNZB 1LWEA 4NRUA 3CXCR 2BE2B 2EG1A 4IG3A 4W90B 3UD5A 2DGTA 1IJFB 3H42A 2IRUA 1KVKA 1RA6A 2ILZA 3TJAA 4IR9A 1FNMA 3MPUB 1JLFB 4ENOA 1AZSB 1SJ1A 1TL1B 1XNRJ 4C3LA 1IVZA 4F02A 3R8YA 4OFZA 3MAAB 3J81j 4A47A 4Q8FA 2YNGB 3FFIB 5E2QA 1NKCA 2F8EX 4O3NA 3VF0B 4PQUB 5KT2A 3M8PB 1RAGB 4ZA1A 3DRYA 1YJUA 2ADCA 1S76D 2E5LJ 1LV5A 1RAEB 2HHHF 3TAMB 2V69A 2EFPA 4PG7A 5U47A 1M0SA 3KLIA 3BSOA 5EX3A 3K58A 2PEBA 3PFOA 5J2QA 3TZYA 1F5CA 2YX4A 1UP1A 1AA1B 3M8QB 4ECSA 1HARA 3V2UC 4PABA 1RHQB 2KRRA 1XR7A 1NJZA 2KFYA 3JQJA 1TK5A 3SV4A 3E2EA 3FZBA 2PSZA 1HLWA 1HQEB 5F8LA 4Y34A 5B0AA 5KG7A 1NKEA 1FE4A 2XG8A 4UOFA 2NSCA 4QIVA 1NAQA 1NJIT 5KFXA 4RNOA 3R97A 4HVZA 1Q79A 2Q43A 3BSCA 4TN2A 1RHKB 3HMJG 3FSYA 2V9WA 4M5NA 2DHSA 1RTDB 4K4ZA 5HJXA 5FLXU 2OPSB 1AW0A 1BQXA 3UD4P 2RKIB 3D4JA 1A9NB 2ZH5A 1JXEA 3QIPA 2BE7D 2DGVA 3S6EA 4F4AA 3BS9A 3DRSA 2YQ1A 3QRRA 4ZITA 3I0RA 2HNYB 1SPBP 1T05A 2BM1A 4IKAA 2AIRB 3QWUA 2RHQB 2W4CA 1D9AA 2W4DA 3NAIA 2N4DA 2AYBA 2H5EA 3ZTRA 4C6AA 1EQ0A 1XMBA 3IM9A 1U2FA 1FO1A 4YN3B 4UY85 3GR1A 3NGUA 5HL7Q 1X4AA 2O01C 3K57A 1HQUA 3J7ZT 1MU2A 2R7OA 2ROEA 1HFEL 2O66A 1IBLF 2J6SA 2VBZA 2HK2A 3MHYA 2A1BA 3M32A 4XTTA 4JV1A 4DFKA 4E8UA 2XLIA 3HHKA 4QR0A 4KY3A 3BGRB 2J8SA 2FGCA 5ETPA 1YDLA 5A8WB 1S9GB 1H98A 5KG1A 2QA1A 4OYXA 1HBMA 1S7HA 4M5IA 2DEJA 1I94F 1CEZA 1BGXT 1RTIB 3CIMA 3NRBA 3TAQA 4GC6A 2IMOA 1RAOA 4C11A 4LF2A 2DEIA 2HFVA 2VASA 1IBCB 2XMJA 1OY9A 2CPIA 1RI7A 1JXLA 2J5AA 5LMUF 2NZCA 3DLKB 3BQ1A 2UUCF 4Q0BA 1CC7A 4QIEA 3BR9A 4HTIA 4ZMMA 2MSTA 3M2VB 1ZBTA 3OSPA 4PAAA 4J9PA 3QWPA 5E0OA 4QYRA 3OD2A 1LOUA 2RU3A 3LP1B 4X65J 4FZVA 5HP1A 4NZ7A 5CXTA 2BANA 2MHEA 2MZTA 5D3GA 5B0DA 1FFSB 2OEMA 4I2QB 5J1PA 3KG4A 4U96A 3IG1A 1B70B 2M8DB 4USJC 4H54A 5F8HA 3BGUA 1JLBB 3RW6A 3R7SB 4JI7J 1QSYA 3VVTA 4YDXA 2XLKA 3DXBA 1HL6A 4ZHRB 3KG0A 3TRGA 2XBPA 5E5NA 1RT1B 3MR3A 2XULA 4DPWA 3HSZA 2JC0A 5ETSA 1N5VA 4DG1A 3SV3A 2OFHX 2QLJB 5IXUA 4F0HA 1CPZA 1JLCA 2CVEA 5MAOA 1T9YA 4DPTA 3U27A 5T7LA 3MM6A 3ONQA 4CT9A 4LFBJ 4NL5A 4O0IA 2ASDA 5L9NA 3OTCA 2QMUB 1Z2ZA 1EARA 3H5YA 3OTOF 1S7IA 3N9UC 1WOPA 2E7XA 4AL7A 4GVLA 1I6JA 2Z2MA 2GVZB 1TKXA 1DQ9A 2LLZA 5CYQB 5KFWA 1HBNB 2UU9F 4F8RA 3DRRB 4NE9C 1U25A 3HVRA 2XWXA 1RQ0A 2DB1A 4IQMA 4BLGA 1QAIA 1XBWA 2KYZA 5DLGA 3M6VA 4DS5A 1IJEB 1RXOB 8RUCA 5IT4A 4FNHA 4FBUA 2HQCA 3QSYB 2NXCA 3VGSA 4JV2A 3H98A 4OX8A 1RGVA 4LIWA 2HS4A 4DUYF 4YB6A 1VK3A 2FGOA 7FDRA 4OYOA 2G4BA 5GMDA 1IBMJ 4NYPA 4NLWA 4KO0B 3DLGA 4H4MB 3SCIE 1TFWA 2YWEA 2QA4S 2E5JA 4IH6A 1VR6A 3IMQJ 3FQKA 3D2WA 4G1QB 1VLOA 3DKDA 5AT1B 3DDKA 3MEKA 3S8SA 3LAMA 2PN6A 3BSAA 4UW2A 2PFFB 2NXUA 1IR2A 2JLEA 4DR6J 3KLEA 2IJNA 4AE5A 2KFZA 3SFGA 1N6QB 3KJNB 2WZ1A 2WVBA 1YX2A 3M8RA 1FJCA 2P5VA 1HMVA 4QZVB 3LW5C 2VF3A 4DFPA 1RWKB 3OL8A 4ZPAA 1RWUA 1YVFA 2XS2A 1IKXB 4C3MA 3KLGB 5AE3A 5SZTA 4JI1J 3OVSA 1NMEB 4EZ9A 2YWWA 5J2NB 1ZA1B 2ROGA 1Z2LA 3UE2A 3ZZUA 2KRBA 2HQ3A 2VJUA 2DHXA 4USWA 2D7SA 2CYYA 4MK9A 5KFJA 3HHLB 4DZDA 1C4CA 1REVA 3OVAA 5KT5A 4YHHF 3CCQS 4F3MA 4WXWA 2ZJPQ 5GVQA 2QSWA 2F8HA 2MTLA 2DR9A 2I8EA 1M1KT 4XK8C 2HHUA 4QIFA 4ELUA 3SSRA 1M1HA 3SDEB 4KIAA 1YG0A 2R7QA 1UEVA 2M2BA 4AT1B 1KVJA 4GC7A 4DX6A 5ADZA 2BRKA 3HJVA 4X62F 4LVNP 2JX2A 1R27B 1S1XA 2EXUA 5DRKA 3NEKA 4NLSA 2OTLS 5GAHU 2PT0A 1R8HA 1G6BA 1PJ5A 4DV0J 3PIOQ 5BYQA 3U02A 2HFSA 1WDTA 1PBAA 4J9OA 1FTCA 1KLMA 1WC6A 5I4MA 2OJ3A 4K4SA 2ROPA 4DI6A 3S1TA 4BC7A 3ADAC 4OYMA 1DFDA 4FYDA 2QA2A 4QW9A 2RNEA 4EO6A 2IRYA 2FHOB 5A0YA 2M9KA 4F2RA 4TYAA 2DNQA 5E3QA 1FRJA 3VZIA 5HBMB 2DNMA 1E6VB 1MWZA 2HS0A 4GMKA 5LSLA 2CQBA 2RDIA 1JIHA 2DR5A 1NDPA 4Q7AA 1P27B 4J9SA 3OPKA 2V63A 1HD1A 3T6JA 1RJJA 3KJVA 1UEUA 5AJ3J 3ET6B 3MM9B 4P2XA 1KFDA 4YR2A 1FXLA 2KM8C 2IC3B 1TL3B 2V9KA 3K2YA 2YTCA 2DHHA 2GVDA 1RT3A 4LR7A 4Z2XA 3JAMY 1FX2A 2CNNB 1NB2A 3GV7B 1PYOB 1JLQB 3F44A 2WBMA 1WKJA 2RF2A 3DGPA 4C8YA 3TVKA 4CO0A 3GSIA 1N33F 5HATA 3CJ4A 3CCZA 1ZPVA 3DNCA 2XI2A 3DYAB 2CPYA 3Q8PB 1NH7A 1S4EA 2UXCJ 2WTFA 2BJ9A 3AFGA 2E1PA 1QAYA 3IR6B 3AA8A 4LF9F 2Y1JA 2QFIA 2KL8A 4HHJA 2QMXA 1EJ7L 1G2EA 4KGXB 1P9YA 2GC8A 2HNDA 4RW8A 3Q83A 2B6AA 4HI1A 2PMHA 3MD1A 1JMTA 2GS8A 2XMWA 1IUJA 4I0WA 4URQU 3LP2A 3Q8YA 1R0AB 3BGLA 3FEZA 5HQLA 2N4CA 1S6QA 3IRXA 2KXHA 1R8PA 1FNOA 1EP4B 1WTBA 4JV0A 2Y0BB 1L3TA 2G9OA 4A8SA 3AB2B 3GFHA 4OYWA 3VGUA 3HP6A 1PJ6A 4C9DA 2CJ9A 1U1NA 3BN4A 2BW7A 3GZ7A 2ZD1A 3T9ZA 3VTIA 1WG5A 2GHWA 1WJ9A 3C19A 1LWEB 3I31A 4KRWA 4IG3B 4MIBA 2JWNA 5DG7A 2R3VA 2RJZA 1PG5B 2HMIA 3FC9A 3K5NA 1VGYA 2J9CA 1GX5A 4DU8A 1OIAA 1VS3A 4UQTA 3QT5A 1FKOA 4C8OA 2OI2A 4IRKA 5BR8J 5F8IA 4CDIA 1KQGB 5LSOA 1SC4B 4J9UE 3HCXA 3TANA 2ZH1A 1U26A 3R5GA 1I5OB 4GO5X 4PWWA 2KDOA 1R3NA 4ECZA 4DV5F 3UVJA 3KLIB 2C2ZB 2FIUA 2XLJA 2K06A 1L3VA 1TKTB 3KK3A 2E7WA 1Q95G 3D1HA 1RCOB 2DNHA 3TNVA 2V8DA 2GIFA 3R2DJ 3EM1A 3Q8QB 2AGPA 3J81U 4B9MA 1UW9A 1IXKA 4EGLA 3KDOA 3SEOA 3PEJA 5CYMA 4NMLA 3ILLA 3O2IA 2CQ1A 5ETLA 2HHHJ 2ZM6J 3IBFB 1CBKA 2UUWA 2XSJA 4FF1A 2M7SA 2ZJRQ 2DNZA 2A3JA 3PV8A 3QO9A 5ITHA 1YZ7A 1RWNB 1GMVA 2R7VA 3TOQA 4O0NA 4NLDA 2ABYA 2YNHA 3PYFA 1AFJA 3DC2A 3SFUA 1U0HA 2Q1LA 1WI6A 3CJKA 2ZOFA 5IV3A 3QGHA 2F4FA 2DNKA 2H5IB 1UTAA 5E3RA 4DF4A 3MFHA 2EEYA 2NYIA 3V6HA 4HHHA 4DL5A 1TVRA 4F4XA 3IAS9 5F8NA 1S57A 1SKRA 2D3UA 3SBMA 3FQLA 4QPXA 2M3DA 1N36F 1NCLA 4NWBA 2U2FA 3D6FB 2AX1A 4C8LA 4ED5A 3QIPB 1FEHA 3FSXA 5THWA 1NDLA 2MKSA 3MGJA 3DRSB 2AD9A 1XC9A 1ZTTA 3NG8A 3I0RB 4CLKA 1T05B 4EBDA 3VCDA 4P2MA 3GP9A 1P1LA 4TY9A 2GAGC 3RGIA 3IR5B 1KQFB 2FZGB 3Q24A 1TUVA 2AWZA 4PPDA 5IWAJ 2QA4G 4LSNA 4C0BA 2QSFA 2CPJA 3D54A 4DQPA 1NSPA 1VQ5S 2F5GA 4TU7A 3EPGA 4EEYA 1OS5A 2O3DA 2FD2A 4MKVA 4I7FA 3DI6A 2K3KA 3DOMA 2QX0A 1PKUA 1HQUB 1MU2B 4LF5F 2WONA 2G0CA 1DY3A 2ZKTA 1HWIA 1FE0A 2D9OA 4JOUA 4D3GA 1WSRA 1CULB 4FVCA 2HQDA 3M32B 3NWGA 4FYXB 3MI7X 5B0EA 5B09A 2DVIA 2HRYA 1XMOF 5LM7E 4WWSA 3HVWA 2QN6B 2IFXA 3JTNA 3AD7C 4X66F 4DJBA 4LMZA 2OPPA 3LANA 1HBMB 2KN4A 2CG4A 3C2PA 4X4OA 1YJRA 2BQUA 4NCGA 1PSDA 3ENQA 3AJ2A 1IBLJ 2G0IA 1VBXA 4P52A 4AXJA 4C11B 1S9FA 2BQ3A 3WZ0A 4N47A 3RB6A 2OP5A 5H9EK 2VUGA 1UPMB 1RP5A 4Q0BB 4B02A 4NEZA 5SUHA 3TO8A 2ZH9A 7AT1B 1I94J 2WVFA 3FBFA 2CQHA 2GMJA 4U7UK 1RACB 2C1EB 4YB7A 4X2BA 5HP1B 1CVJA 5B0FA 3QJLA 1CLFA 4RUHA 2BANB 5LMUJ 5D3GB 1FDBA 1H3DA 4KSEB 2UVWA 3VAHA 2UUCJ 3EZOA 3IG1B 4WFAQ 2CQ0A 2J7WA 4USIA 1IR0A 2F40A 2YQ0A 5K8MA 1GX6A 2PO4A 1IWGA 1TL7A 2W4PA 1UMJA 3MWBA 2C2MB 4ID5A 3P3DA 5KFKA 2CQIA 3VQTA 4L72B 4DR4F 1BWEA 3MD3A 1NZAA 2JL9A 2GMLA 2SXLA 2R2UA 4K8RA 5JVGQ 4G3IA 2XS7A 1T95A 2VPZB 4CRJA 2HFOA 4DG1B 1T9UA 2GW8A 3QMQA 3K5OA 1OYEA 3FJ2A 1JLCB 1AXQA 2BX6A 3CJ5A 2QTWA 4J9VA 1YQHA 4YOEA 3CD0A 1WWHA 2BR0A 5T7LB 3MM6B 4FYYB 2B7CB 1L5UA 2FVRA 5M2RA 2G1HA 5J2MA 2E1CA 4ZCKA 1OY8A 2XMUA 3VWSA 4M5JA 4OJGA 4RR5A 4DV3F 3GQCA 1TKXB 2WCXA 2RQMA 6AT1B 3JXOA 1RWMB 2DY1A 1SV5A 2RSQA 2HQFA 1M1GA 3RAMA 3IO1A 1HNXF 2R9LA 3CMES 3OR2A 2FUG9 1X5TA 1QVGR 2X3GA 1VQSA 1PGZA 1KP6A 4ZP9A 5CZXA 3T1HF 2H4YB 2CNLB 4LBIA 1NH8A 2IM2A 1E6YA 4DMZA 3GYNA 4P9SA 5BYRA 4AYBD 2YX7A 2LDYA 3CDUA 3TEGA 2WK4A 2DR7A 4A8WA 3JB9k 5D15A 2F7VA 2XC9A 1BXNA 2J9EA 2UU9J 3SXLA 1N5SA 1KQKA 3CTRA 4JYAJ 3R5DA 3DLGB 2UV8A 2GQCA 2OH2A 3IRWP 2HWIA 3GV5B 2Z56B 1CJTA 2AMCB 2CPHA 1Q0NA 2B3TB 2HBQB 4M95A 5HROA 4DUYJ 1MW7A 1NDKA 3OFFA 3D1QA 3CUNA 5KFBA 1QSSA 4KB7A 3AODA 1YZ6A 1D09B 3T19A 1B3TA 1KWMA 5KFFA 3KLEB 4ILMA 2DRAA 1EAYC 1RWWB 1XR5A 3M2RA 3M8WA 2G1DA 1T94A 1M5OC 2VFUA 3SQGA 4MTPA 1HMVB 2G0JA 4KH0B 2GO8A 1VQPS 4LRFA 2PA3A 4IQXA 4OV6A 4F67A 1X5PA 4A8FA 1NPKA 5KG3A 4NXNJ 4OJ3A 2AJQA 2AZ3A 3DDNA 4PUOA 3WDOA 3VZHA 2E1RA 2XWYA 4HEA9 3FCWA 3SCJE 2EFOA 4DR1J 2UP1A 2HLUA 2HBYB 2HFUA 1Q4RA 2LQJA 2HHWA 3BO4A 3T6BA 1NPRA 3T1AA 4ZIWA 2BKPA 2W7OA 3GCWP 5KG6A 1D8ZA 1REVB 2KXFA 3OQ2A 1YRXA 1DLOA 1T11A 1UFWA 3KUHA 2GJFA 5EDWA 2D9PA 3LAKA 4FPIA 3BJYA 4NXMF 2C28A 4UF4A 3D6HB 5DETA 5I3PA 2CJYB 3IGNA 5D77A 1VFJA 1X9SA 1NPPA 4NCAA 4YHHJ 4TXSA 4OIXA 5IM0A 2BE9B 3ZC4A 4K5SA 3GFXA 2ASJA 2U1AA 2BOPA 1RUSA 1S1XB 2HSEB 2KJWA 3H2VE 2LDIA 3SYZA 1RCXB 2H5JB 1NBEB 3D0GE 3Q8UA 1C1BA 1S72S 1VK8A 4ZVOB 1WELA 4IOCQ 3C3LA 3CCSS 1KLMB 1AB8A 1QLNA 4K59A 4N76A 4KT0C 2FHJD 1U1PA 3TVYA 2VBYA 2YVSA 4YS2A 3NNCA 2W01A 4ZVFA 4DSKA 3G8SA 5A0YB 2ATCB 1WF1A 1F2GA 3G86A 5KG5A 2KVQE 3QJJA 4RZRA 3RG6A 2DGQA 3TUZC 4IOBA 2VFVA 3QQCD 2EC0A 3P5TL 2AV5A 1CJUA 3V81A 3PVXA 1ZTWA 2HQIA 2WB4A 1YRTA 3M9NB 5AE2A 2CJXB 1Y10A 3KJVB 4Q44A 3K8VA 3RAXA 5DDOC 2GQ2A 3FCVA 3CCLS 3PRVA 3TQ1A 1AT1B 2MYFA 3VGVA 5H9FJ 3KUEA 2FDNA 3RBDA 3H8YA 4ECRA 3RZAA 2GVDB 1RT3B 3Q23A 4R0EA 4F0KA 2RF2B 2X1FA 3DGPB 4ILRA 2VIHA 1U49A 3J80Y 2KH9A 4G6VB 1V5VA 2FJVA 1IR1A 3W64A 2OLWA 2NXNA 1ICEB 1XNQF 4N77A 2UZAA 2CIMA 4HKQA 1RHUB 1GMWA 4J9NA 5ETVA 5T14A 2EFGA 1B7FA 4JI4F 2VB6A 3AAWB 1QAJA 2K7JA 3JQKA 2C3MA 2RDDA 1HWKA 4UUWA 2HAFA 3OLAA 2DGSA 2Y8WA 1N33J 2DNGA 4UOGA 2HNDB 5EX0A 4I67A 4RW8B 2B6AB 2WW8A 1LW0A 1RYSA 2CWKA 5L46A 3LP2B 4ETZA 4K4WA 1SL1A 1S6QB 3IRXB 2QLWA 2D3OR 4DL6A 4LF9J 4J9MA 2HHSA 3MOJB 2YWKA 2MLZA 4H4KC 4B3MJ 2RT3A 3CCMS 2ATLA 5A2QU 4ZPVR 3D67A 3DLLQ 2HVHA 2ZWOA 3RB0A 3GU0A 3A13A 3RRKA 3K5MA 2MXYA 2ZD1B 3KHHA 1D9DA 3A8EA 3PCOB 3MCMA 4K4YA 1WORA 2OO4A 2HMIB 1HNWF 2NZ4A 1ZAVA 5KFYA 3H25A 2KG0A 2VPXB 1TTHB 3C16A 2CVIA 1SKWA 1X0FA 2OTJS 1D0EA 1KOOA 3H20A 2DNRA 1FKOB 4RNFA 4ED3A 2B43A 4ED1A 5T41A 5C2CA 5H9FK 2HHPA 3NY0A 3ZTSA 1A6LA 1EHWA 3CWJA 3UVJB 3DRPA 2MKHA 3KK3B 4R0JA 3WC0A 4KHRA 3FVYA 4F0MA 2HIQA 1PIEA 1O51A 5KFUA 4WP9A 4K4UA 3RB4A 4C4WA 4RU9A 5CYMB 5F3TA 3RRHA 4M5HA 1IWAA 1WEYA 1VQLS 2LXFA 4Q43A 2QMWA 5CCLA 3NOGA 4MIWA 3HK2A 3GPAA 3O8WA 2H1YA 2K7KA 1BLUA 2RB7A 2XSJB 2J7KA 3ISND 1TL5A 3QO9B 4ITSA 3FSIA 3UNYA 2BM0A 1RWVB 2YNHB 4XPEA 5J2PA 1U0HB 2X7IA 3LPEA 5KT6A 3AD9C 4F25A 1CS4A 3TX8A 2R8HA 1X8DA 1DURA 2B4PA 2DNYA 2MZSA 4NA3A 3I56S 1TVRB 3TZZA 1FD8A 3I5BA 2AW0A 5KT4A 3BYPA 1GK8A 3AHPA 4DX7A 1S12A 3QT8A 2GIRA 1NB7A 3N5FA 4YQWA 5C7PA 1VDHA 2ZHBA 2HNYA 1WC4A 5KFNA 3EUNA 2F9JA 4LT6A 3FK4A 1UVLA 1KBRA 4RL1A 4N8OA 2W9BA 4WK1A 4LVOP 3J7Z5 2BDPA 3PJ9A 4JI6F 3T41A 3FBEA 1T03A 2IPOB 1RDRA 1VQMS 3IP0A 4N8NA 1N36J 3CEDA 1F9EB 3OTBA 3KKFA 4LSNB 1VJWA 1RWPB 1B64A 5AXNA 4X4RA 2EBGA 3DRXA 4ZVSB 2VQFF 1LWFA 3BYRA 2QG9B 4I7FB 5HANA 3DI6B 3DU5A 1NUEA 3DOMB 1W26A 2A2CA 2BXJA 5KT3A 2WONB 3DFEA 4F4YA 3VQSA 3V5RA 4QYZK 1K44A 2KHCA 4BHQA 4HH1A 2WW4A 1C4AA 5I3QA 1X4EA 4OV1A 1WOOA 4WTOB 4DWIA 2K3IA 4IDKA 1JNRB 2FLOA 1H2VZ 2YWFA 3PFEA 4ZS6A 2KZMA 4OJ1A 2CPFA 1S48A 1VBKA 4CYUA 5C5JA 2OPPB 3D9BA 4LF5J 2Z2YB 4NCGB 4LF8F 2LQ8A 3CDAA 4PRFA 3R7NB 3TA2A 4UOHA 3X3UA 4RKUC 1XMOJ 2R8IA 2B4VA 1LNQA 1QAXA 1FWLA 4ECVA 2LFVA 4B9TA 2DHAA 5CAAA 1M5VC 3GFZA 4DV6F 3OHAA 2V67A 3QIDA 4X66J 4J91A 5EHHA 5HMZA 4ZIVA 2YH1A 3PX4A 4D3HA 4PZVA 2HVZA 2MLXA 3MCOA 5KT7A 4OI0A 2X3DA 2YNFA 3RAQA 1GT8A 2NUUG 1RBAA 3IFEA 5AXKA 4NA1A 1WHYA 1GQEA 1RHJB 2ZH6A 2N3LA 1TL7B 4ECXA 4ID5B 2HVIA 4OZJA 2XMVA 2RS2A 3DHXA 3HJFA 4KGKA 4OHZA 2GQQA 5HLFA 3D3BJ 4K2XA 4N56A 3W2WA 3MUTP 3NGSA 1RA7A 3PACA 4KE5A 2HRUA 3R2CJ 3HSDA 4ZJOA 1SJ3P 5F3ZA 2KYXA 4KGMA 3QSIA 2VG5A 5C2GA 1Y5NB 1KEKA 2XMKA 3I82A 3ETOA 4DR4J 2BACA 3TZWA 2OPQA 5LT5A 4O4RA 1QVFR 1IQTA 2VV5A 5L39A 3MEDA 4DDFA 2W7AA 4Q2LA 2YWGA 4Y2CA 2HBZB 5J2MB 5BYSA 4OYZA 2QL7B 1OWXA 1SJRA 3N0VA 1RU1A 2FJDB 5CYQA 1FXDA 1VJQA 3R5AA 1SV5B 2EBEA 2FJBB 4ZCMA 2AEJA 2HGLA 4FXWA 5F8MA 1VRTA 3OR2B 1F3VA 4KKOA 4U95A 3UQSA 2ZC3A 2W9AA 1E6YB 1TU0B 3SMZA 2PI4A 4ANDA 4DV3J 4G65A 2P8IA 1Y00A 2HAIA 2KKHA 3MMBA 3J7AN 2UXBF 2YY3A 5MLCV 1F2HA 1JKHA 1HNXJ 5JJBA 2JRSA 3CF5Q 1NK4A 4P72A 3UR0A 4Y2AA 4KPCA 2GHVC 5KFCA 3CSKA 5F8JA 3L7PA 3J7A1 3T1HJ 1RKJA 1CJTB 4X4QA 2UV8G 4ZP6A 3I32A 3OLBA 5HROB 3GLJA 2QIFA 3OTDA 4DR5F 3TR5A 5DJBA 3NCQA 3KG1A 4B9UA 4TY8A 3HT3A 3M2RB 4LF4F 1I51B 1WI8A 5HAOA 5HVGA 2F1FA 3SQGB 1Y0HA 2HHXA 4DU7A 4EUVA 4DV2F 5EUHA 3MM7A 3SSQA 1YK9A 3QLHA 4DQIA 1ZYQA 4BC9A 4E2FB 1S0OA 3ZTQA 3B6BA 1JX4A 1VIOA 3JYTA 2AJ2A 4DL3A 1HPZA 5DM6Q 3Q8SB 4M5LA 2GMHA 4ZVQB 4PUOB 3W65A 4CO2A 3HHLD 5HVFA 3TARA 4ZOSA 3M05A 3CJRA 3H4BA 1JJ4A 3TVZA 3MCNA 5HO4A 1MWQA 4FYVB 4UQGA 2DK2A 3G6ES 1JLEA 2CDRB 3BSNA 1RKIA 5E3AA 4MKYA 1DLOB 5EWGA 2F4VF 2R2SA 2XHCA 4PCQA 2QZ8A 4MAKA 4XAKA 1FESA 2UVRA 3EGWB 1SKUB 2AU0A 1AFIA 5GAHI 3VAMA 5KFTA 3DLHA 4IFYA 1NK9A 3WIVA 3IBWA 4Q45A 1RAFB 3W62A 3P5BP 1D1UA 3EE3A 3HLUA 1FRHA 5IM0B 1SB6A 1NHUA 3NL0A 1RT5A 4NXMJ 1C1BB 2DGXA 2L9WA 4ZVUB 3GIJA 1HWUA 3MFIA 3IR7B 2V34A 1TR0A 3DGVA 3P45B 2YKOA 3PO4A 3E8OA 1SJQA 1R6VA 4QWEA 2XYHB 4QIWD 5LMNF 4LF6J 2W7PA 4LUBA 2CQGA 4WU2A 4QBUA 2HHQA 2O67A 1IBKJ 5IT9Y 1CJUB 3V81B 2W2NP 1DQAA 2XGQA 5DLFA 3MUMP 4EBEA 2MQLA 4QOTA 3BV8A 2JFKA 1OSCA 3TW0A 2IMWP 3TA0A 3MUVP 2EKNA 3BPSP 1VBZA 4X4PA 3UW1A 3ZXWA 1AUSL 2VOPA 1FXRA 4AD6A 4HACA 2MKIA 2DTJA 2ZBCA 2R2RA 1U4BA 4CM2A 3OXGA 3EGZA 3E51A 3T1YF 2CPEA 1W2BR 1HKAA 1VRQC 4U8VA 3X1LB 2XNRA 3OL7A 2V68A 3BB5A 3O44A 1HI1A 2XTJP 4OHYA 1SUQA 1DQ8A 3CT9A 4QIGA 5KFEA 2WVEA 4PYAA 5EWFA 1ITPA 4OZ0A 3IBCB 1NK7A 3JSMA 2IA6A 4FYWB 1PBUA 4RPFA 2BYCA 4ECYA 1YJNS 2UUBF 1XNQJ 2LECA 1I1GA 1LW0B 2RUSA 1R0AA 2OMLA 1PYSB 4W92B 3LWLA 4M1KA 4JI4J 2Q79A 4PG6A 2XY6A 2VZ9A 4DN9A 1U47A 3VV2B 4KBIA 1AYEA 2R2TA 2AJ1A 4IO1A 2PC6A 1U2CA 1IN0A 3EXCX 3V6DA 4ALZA 4NLGA 5AE1A 2GNKA 4CO4A 4OHXA 3HT0A 1HW8A 3ILJA 2E1AA 4TNOA 4FS2A 3CVKA 2ZNYA 2VL1A 4CO1A 4OJHA 2FLLA 2HGNA 4JP8A 3I9V9 5E33A 2QV6A 3PYEA 4ELVA 3C16B 1LWXA 5KAKA 3W3SA 3ZNJ1 2QO3A 5H1SV 4B9NA 1LXNA 2Z4PA 2C2KB 1MMLA 3THPA 2Y9HA 4HYKA 2VOOA 1EZZB 3A12A 1IM4A 2ZH7A 2J9DE 4L6V3 4V19J 1XJWB 2V8VA 4MFBA 2YXLA 1HNWJ 3POTA 5KFIA 1TKTA 1TKZA 5CH7B 1APSA 4ILLA 3J7YU 3IC1A 5L1JA 3DRPB 2M52A 2QC3A 1H6KX 4CWBA 3JSRA 1WF2A 2N7YA 2JH3A 5CD4H 4WKYA 1PILA 3W61A 2XMAA 4TVAB 2JDJA 2OGUA
chains in the Genus database with same CATH topology
2W24A 2OPPA 3LANA 2Y1RI 1HBMB 2KN4A 2CG4A 2XCPA 4RW7A 3B4DA 4X4OA 1YJRA 3VAFA 2BQUA 3C2PA 1IKVA 4NCGA 2DGUA 1PSDA 1DBDA 3ENQA 3AJ2A 4OI2A 5GAGU 5I3UA 1IKYB 2IBOA 2L9DA 3P96A 2ZH2A 2M4MA 1ZOTA 3T5LA 1T7PA 4BCAA 1VBXA 4C11B 4AXJA 1U2RA 1S9FA 4OI4A 1MMNA 5DS7A 1U1RA 1HW9A 3AJ1A 1LWCA 2DH7A 2BQ3A 3LUYA 3WZ0A 2IHR1 4N47A 1N34F 2E9RX 3OFEA 3RB6A 3V4IB 2OP5A 4LF7F 2GA7A 2KFNA 4I6AA 4TLRA 5KFZA 3PDNA 1D3WA 2F9DA 2VUGA 1DRZA 4A4JA 1RP5A 2KT2A 1X4DA 1R8AA 4XDDA 4Q0BB 4DSFA 4B02A 1S99A 3H40A 1VQ9S 5SUHA 2X1BA 4KO0A 4PG8A 1LQ9A 2I5JB 3CJ2A 1K1SA 4RX6A 1S1UA 1HYSB 3TO8A 4DR6F 3QPIA 1YRUA 2BZ2A 2ZH9A 5J2PB 1BD6A 1BQMA 1YTYA 1RTJA 1WHWA 4H4MA 1UA1A 3JTOA 2MPUA 2CQHA 2E66A 2AP6A 2GMJA 4U7UK 4H4OB 3IGVA 1JLGB 4N41A 4F50A 3OUYB 4YB7A 2ZE2A 4Y2KA 4KC5A 1BC6A 1OSDA 1Q53A 4X2BA 1VC0A 1Y5LB 4TLQA 5JVHQ 5HP1B 1CVJA 2FHKA 5B0FA 3KWMA 3R1HA 1XK8A 2NREA 4ZCIA 3M6UA 4G1QA 1WG4A 3QJLA 3NP5A 1CLFA 4RUHA 5M2PA 1WNEA 4FN5A 3CB4A 2BANB 4NZ0A 3DLJA 4M94A 2J6UA 5D3GB 2WSCC 1FDBA 1H3DA 4KSEB 2UVWA 1HI8A 1F60B 3MCSA 1FRMA 2CJQA 3VAHA 3CULA 4FPRA 2FJAB 3LF0A 2XY5A 3CGIA 3IG1B 4Q8EA 4WFAQ 1HNVB 2CQ0A 4JI1F 2J7WA 4I6WA 1J5EF 1P6TA 1S49A 1G3OA 4ES3A 2LQBA 5IS2A 2HFZA 2LXIA 3MAQA 3G8TA 1KC8T 4USIA 1IR0A 2N3OA 2F40A 4EU0A 5K8MA 1GX6A 1RYRA 2PO4A 1KQSR 2J0SD 1YI2S 1S1WA 2LEPA 3SI8A 2W4PA 1N6QA 1UMJA 2MMYA 2FVPA 4DFMA 3MM5A 3MWBA 3UI3A 2RRNA 4O4GA 4ID5A 4X4UA 2ZVSA 3P3DA 4OHVA 5KFKA 2CQIA 3VQTA 4L72B 4DR4F 3R5CA 5K8OA 2CZ4A 1BWEA 2DGWA 5HMXA 2C3YA 4PXCA 2ZDPA 1OPIA 4QJVA 3QAEA 5D4LA 3LQVA 2XMTA 3GB0A 3MD3A 5D4NA 3KYLA 1NZAA 1V3SA 1IKXA 2GMLA 2JL9A 2SXLA 4OQJA 5DQIA 5E7OB 2R2UA 3ISZA 2W9BB 5JVGQ 4G3IA 3PZPA 2VBWA 4I64A 2R8JA 3KLGA 3T9NA 1F0XA 4ZK7M 3PHEA 2GFFA 2XS7A 2COLA 2FLPA 1T95A 1T03B 4BWMA 2VPZB 2JSXA 2HFOA 5LL6d 3HZEA 2EK6A 4DG1B 2GW8A 3I5CA 4ELTA 3PW7A 3QMQA 2LU1A 5LXYA 5J2NA 1Z4UA 3K5OA 4X4SA 2M8HA 2H9ZA 3HF5A 2J9DA 3FJ2A 1S1TA 4DL7A 1R8CA 3J7YI 3HHNB 2WSFC 1JLCB 1KFSA 2ZITA 2JJ4D 3K8WA 1AXQA 4DL2A 1XTZA 2WB1D 3CJ5A 3HFKA 3Q8RB 1T02A 4RWWA 1X4BA 2RH3A 4WZMA 1QE1B 3OJSA 3MF5A 1LWFB 2E5IA 2BBEA 2FPHX 4I4BA 3HXMA 1YQHA 3BGFA 3N6NA 4YOEA 1WG1A 3OL6A 3MDFA 3CD0A 1WWHA 4WF9Q 2BR0A 3MR6A 5T7LB 1FJ7A 3MURP 3MM6B 3MM8A 4NYZA 4Q2MA 3T5JA 4ECQA 2B7CB 1L5UA 2FVQA 1JNZB 3N6MA 2FVRA 5M2RA 2VKZG 3I96A 3PXGa 2BABA 1FTRA 1N5TA 3CJ0A 4DQQA 2QEXS 1FK9A 2JZ5A 5J2MA 3I4HX 2E1CA 3NCPA 4ZCKA 3HHLA 4Y2IA 3W2VB 1HI0P 3FZ2A 4IR1A 2QT7A 4RW4B 2DD8S 5GAGI 2CJKA 2XMUA 1H2TZ 2BJEA 2DNOA 3ZZRA 2ACYA 3UNGC 2GJIA 4B17A 5D4PA 3K7RA 3VWSA 2ASLA 4OJGA 4C8ZA 5J1NA 2BV3A 4DV3F 3GQCA 1TKXB 4OI1A 2WCXA 2RQMA 4P7VA 1Y3JA 3GYXB 1S9EA 3EXYA 3WBZA 4BBYA 2BQRA 4ID8A 1V6HA 2N82B 1FVSA 1MROA 4FF3A 2V4JB 4F3QA 4JI3F 1SV5A 2XO7A 3MR2A 1UA0A 4IDKB 2RSQA 1VLYA 4OX9F 1KVIA 4DPOA 4ECUA 3RAMA 4F3OA 2DISA 3ENWA 2HS3A 5C24A 5J1EA 3IO1A 1HNXF 3O1LA 1U8SA 2R9LA 3CMES 3OR2A 3M30B 1YJVA 1ZM3A 1X5TA 2FUG9 3UDCA 1WTFA 4DV0F 1QVGR 3SDEA 4O44A 1X7VA 2X3GA 4WYWA 5JXSA 1LKZA 3M6WA 1VQSA 2W9CA 1PGZA 4B3MF 4ZP9A 2V4RA 2YQ3A 5CZXA 1WEXA 2DT9A 2YNIA 4C7QA 1NKBA 3H59A 1S4FA 4MMOA 1ZZFA 3T1HF 3NMAA 4Y28C 3SZ2A 1NH8A 1FF2A 2IM2A 1E6YA 4DMZA 1G7CB 3GYNA 5BYRA 4AYBD 2YX7A 2LDYA 5HI7A 2D3ZA 2C3UA 3DHWC 3CDUA 2MB0B 4JI8F 2WK4A 2ZBIA 4HT7A 2HPUA 2DR7A 4A8WA 3MPWA 4LQ3A 3RW7A 3JB9k 2F7VA 3MEGB 2IVYA 3NGDA 2XC9A 1K0TA 2IM1A 2J9EA 1NHVA 4LSLB 3ZZZA 3SXLA 4QWBA 3LP0B 4DQRA 1N5SA 2J8AA 3N01A 5KFDA 1F9FA 3KMQA 2K1RA 3P6YC 1KQKA 3CTRA 4QCLA 2I9SA 3BM7A 3R5DA 3DLGB 3GFYA 2LEBA 2CPXA 1P9QC 2LXUA 4R8UA 1M5SA 2UV8A 1HBOB 2GQCA 2DHGA 1N8RT 4HDHA 2OH2A 2FVSA 1FKAF 3IRWP 2GGPA 3C6UB 3BO2A 2HWIA 1QUPA 4ES2A 2KG1A 3GV5B 2KHDA 3UPFA 2LEAA 3CDWA 2ZC4A 4YFUA 3K5LA 4QQBA 5KFAA 4ZP8A 4CNZA 2MQPA 2YNFB 3OFGA 2CPHA 3SCLE 1OQ6A 2PDAA 3IAM9 2MGZB 1R31A 1GAOA 2B3TB 2Z8QA 1NK6A 1C1CB 5L8RC 4M95A 2DRBA 5HROA 5AJ3F 1XWLA 1MW7A 2DNNA 1H2UX 3OFFA 4YR0A 4HDGA 2MQNA 3D1QA 3K59A 2L9NA 3N28A 3CUNA 4J9QA 5KFBA 5HBMA 2RMLA 1CG2A 4KB7A 1QSSA 1VOMA 3FEXB 4WTYA 5K9FA 5K5MA 1E6VA 4I2PA 3T19A 5FDLB 3HHLC 1EETB 2ZHOA 5KFFA 3KLEB 3F56A 1RT6B 2DRAA 4ILMA 3KHLA 1XR5A 3M2RA 3ICLA 4IO9Q 4NLUA 3M2UB 2B4OA 2YKQA 4ZKAA 2G1DA 5IT0A 1F5BA 1T94A 1UJ5A 2WOMB 1M5OC 1Y3KA 2VFUA 3SQGA 4I68A 4CQ1A 4MTPA 1C0UA 1HMVB 3QGPA 1SL0A 5B0BA 4IH7A 5HLFB 5DDRC 5JUMA 2B9WA 3K0JA 4KHPF 1FEEA 2GO8A 2P9GA 4WJBA 4DEZA 1VQPS 3UDLA 1MWYA 4A48A 4RBTA 1KOHA 2PA3A 1DTQB 3W2WB 2K2PA 3U7JA 1S1VA 4IQXA 3N79A 2E9TA 2XHWA 3CE8A 2EFNA 4R25A 1SQEA 2V5HG 2EVZA 3MM9A 4KHMA 4F67A 2KVIA 1X5PA 5A8KB 1R7IA 2P9EA 4A8FA 1Q8IA 4OLOA 1TAQA 2ZOMA 5KG3A 4OJ3A 3KLFB 2V8HA 2IC3A 3PW5A 2FTRA 1TL3A 2AJQA 5EN1A 5I42A 2PIIA 1HBUA 4FBTA 2UXCF 4FVMA 1SIZA 4P6QA 5B08A 3PO5A