1M5PC

Transition state stabilization by a catalytic rna
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
92
structure length
92
Chain Sequence
b'TRPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA INHIBITOR SUBSTRATE
publication title Transition state stabilization by a catalytic RNA
pubmed doi rcsb
source organism Homo sapiens
molecule tags Translation/rna
total genus 23
structure length 92
sequence length 92
chains with identical sequence F
ec nomenclature
pdb deposition date 2002-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1m5pC00
2VONA 1X0FA 3ULHA 1QM9A 5D77A 3TYTA 3CCQS 3S01A 2DIVA 2MQQA 1X4CA 4C0OC 2OIHA 5DETA 3R1LA 1WHYA 2DGSA 2PEHA 2D9OA 2KM8C 4LIRA 2MY8A 1CVJA 3CD6S 2KRRA 1VQLS 1DBDA 2QA4S 2DHAA 2DIUA 1Q86T 5FJ4A 1XN9A 2PE8A 2X1BA 2N3OA 2OSQA 2HGMA 1ZH5A 1NU4A 1NO8A 1JMTA 1SJRA 2G1DA 3CCSS 2MGZB 3SMZA 2YH1A 2CPHA 3G71S 2RS8A 2DNGA 2MPUA 3TO8A 3NNCA 3G4SS 1SJ3P 2E44A 2RRBA 1N54B 3S6EA 2JX2A 2MKJA 4TLQA 1IQTA 1DRZA 1OO0B 5GAEU 2LA6A 2KU7A 1X4AA 3CCVS 1KC8T 2QFJA 2KRBA 3UE2A 2E5JA 2KM8B 1Q82T 1ZZFA 3CCLS 2LEBA 1G2EA 4Z2XA 1HL6A 5IQQA 3I56S 2AYEA 2L9WA 3VAIA 3FEXB 2FY1A 3MUTP 2UP1A 4J5OA 2ADCA 2I38A 1WTBA 2MKSA 1VC5A 2JRSA 2KXNB 3P6YC 2OTJS 2AD9A 1DZ5A 3D2WA 2KN4A 1WEXA 1U6BA 1N52B 2CQPA 2KT5A 2ZJPQ 1H2TZ 2MZQA 2ZJRQ 2MQPA 1FO1A 3P5TL 2DB1A 3V4MA 2ERRA 4P6QA 2FC8A 4OZ0A 4YB1P 3VAMA 5DDPC 1VBZA 4WFBQ 5H1SV 1M1KT 3RW6A 4PR6A 2B0GA 1WWHA 2MZTA 2M2BA 4CH1A 4CQ1A 5IM0A 3NNAA 2JWNA 3BO4A 5JVGQ 1WHVA 2N82B 1VQNS 1U1KA 2MQMA 1X4GA 2DITA 2EK6A 3MURP 4CH0S 4ERDA 1BY9A 1FXLA 3THTA 2HVZA 2G0CA 1A9NB 2FHOB 2M52A 2OTLS 2KYXA 2ZJQQ 1HD1A 2CPZA 2GO9A 3LQVA 3NS6A 2MB0B 4PKDB 2AYBA 3THPA 4YOEA 1FJEB 3LPYA 3CTRA 2XB2D 1SXLA 4WIIA 2XNQA 1UAWA 2MGZA 4U67Q 1YJNS 5LXRA 2EVZA 1Q7YT 2DGWA 1VQMS 2HYIB 4UY8T 3EGZA 2AYMA 1K73T 3BEGB 2RUGA 1UFWA 4PRFA 3TP2A 3VF0B 2E5IA 3S8SA 2E5HA 3VAJA 1U2FA 2M88A 1B7FA 1U1RA 1YI2S 2AYGA 4Y0FA 2J76E 1N88A 2RT3A 4IUFA 3CCMS 4TU7A 2DHGA 3CC7S 4QU6A 2FC9A 3P49B 1U1OA 2DNMA 5IM0B 1K9MT 5GMKa 2DNLA 1M5OC 3VAHA 2LEAA 1WG5A 2LMIA 4WFNQ 3MOJB 2D9PA 4LMZA 1A7GE 1N8RT 4IO9Q 2DNRA 4F26A 1Q81T 2K8GA 5DM6Q 1X4BA 4C7QA 2X1FA 3L3CA 3HHNB 1VQKS 3NMRA 2M9KA 3DLLQ 3G8SA 1RK8A 1URNA 2MKKA 2LECA 1OIAA 2X1GA 2DH9A 1OPIA 2MZJA 2CQHA 5HO4A 1AUDA 3CUNA 1X5TA 2HZCA 3U1LA 3G96A 2RRAA 2CQ2A 2M0GB 2MSSA 1U1MA 4WFAQ 1X5PA 2KG1A 3BO3A 2G4BA 5CYJA 3H2VE 2MJNA 2K3KA 2LKZA 1U1PA 1WELA 3B4MA 3BS9A 1PGZA 1SJQA 1SJ4P 1WF0A 2DGVA 1NJIT 1FT8A 1YJWS 2LA4A 2M4MA 3SXLA 1RKJA 2MQNA 5EN1A 3MD1A 4F02A 4ZKAA 1UW4A 1U1NA 2DK2A 2U2FA 3UWTA 5LSOA 2ADBA 2CJKA 3US5A 1KD1T 1WHXA 3CMES 3EGNA 2DNYA 2X1AA 2MKIA 1O0PA 1M5KC 3UD3P 4W90B 5BJRA 1X5OA 3CF5Q 3B4DA 2CPEA 1X4EA 1X5SA 2VODA 2MZRA 2MKCA 2MZ1A 2RS2A 4YUDA 1QVGR 3VALA 2BOPA 2MJUA 1VQ8S 4WKRA 3IWNC 1WI6A 2DGUA 3VAKA 1R8PA 4ED5A 2CPDA 1YITS 3Q2TC 1M5VC 2CPJA 2DO4A 2LQ5A 2J0QD 1FJ7A 2DGQA 3OW2R 3R27A 1VQ9S 1VC6A 1H2UX 4CIOA 2RQCA 2XS2A 5CA5A 1VBYA 4F25A 3CC2S 2BZ2A 2YWKA 4OZ1A 1S79A 1YHQS 5GVQA 2J0SD 3Q2SC 4QPTA 5CXTA 2XSFA 1UP1A 1FNXH 1SJFA 2DNHA 2XS5A 2WBRA 4FXWA 3CC4S 2CPIA 2CQDA 1KOOA 2L41A 3FEYB 3I55S 2DGXA 3MUMP 2JVOA 1KOHA 1HD0A 2NLWA 3CCES 2DNPA 4Y00A 3SDEA 3CCJS 1FJCA 2KHCA 1F9FA 2D3OR 1HA1A 5GAHU 1PO6A 3N9UC 1D9AA 2MXYA 5LSLA 1ZZNA 2LYVA 3RW7A 2CQIA 3P3DA 1U6FA 2XNRA 2YH0A 4TU8A 1DHMA 1WI8A 2MMYA 2DNNA 2RVJA 2KG0A 2MKHA 4V19X 2JVRA 5LXYA 3EX7B 3CPWR 3H2UB 1VQOS 4W92B 4QU7A 2KI2A 2YKAA 2CQCA 2KVIA 5DM7Q 2F9JA 2SXLA 2I2YA 3MXHP 2OJ3A 2DH7A 2MHNA 2LCWA 2LXUA 2Q79A 3S7RA 2DNQA 2F9DA 4IOAQ 3NS5A 4WCEQ 2N7CA 2CQ0A 3J7ZT 1X4FA 5LJ3Y 2HGLA 2DNOA 2FPHX 2U1AA 3K0JA 1M5PC 1JJHA 5IFMA 2CPFA 3MI7X 5DDRC 2F3JA 2MSTA 2A3JA 3CMAS 5DDOC 1VQ4S 3PIPQ 5GADU 1FHTA 2MQLA 2QEXS 2CPYA 3SDEB 3G9CA 4M5DB 1X4HA 1U1QA 1L3KA 2RQ4A 3HI9A 2M70A 3UCUP 2DHXA 2DNKA 2RNEA 2GHPA 1D8ZA 3ZZYA 2DHSA 5JVHQ 4A8XA 4EGLA 5GAGU 5ITHA 2E5GA 2DH8A 2MQOA 1WF1A 2DISA 3G6ES 4RU2A 2CPXA 2NZ4A 5LJ5Y 1YIJS 2N3LA 2CQGA 1M90T 3MD3A 2RU3A 1WEYA 1W2BR 1JJ4A 5D78A 3U1MA 1VQ7S 1KQSR 1YTYA 3MDFA 2VOOA 2CQ4A 2KXFA 2HGNA 2XS7A 1R8HA 2J8AA 2CQ3A 1WEZA 2DGOA 1WG4A 1QVFR 1VQ6S 2O3DA 5DDQC 4UQTA 2OSRA 3CCUS 2CQ1A 3UD4P 3PIOQ 1VQPS 1JJ2R 2L08A 1U1LA 3R1HA 2VOPA 3MUVP 2DNZA 4QQBA 3CCRS 1VQ5S 2M7SA 3G8TA 2DGTA 3VAFA 1YWXA 3UCZP 1VC0A 2EK1A 1YJ9S 2KH9A 1S72S 2MZSA 2M8DB 1WG1A 3IRWP 4C4WA 5MLCV 4LJMA 2KXHA 3CXCR 1P1TA 2KFYA 2V94A 3J7YU 2CQBA 2LXIA 3JB9k 4WF9Q 1WF2A 4FXVA 3CULA 1WHWA 3ZZZA 3VAGA 5HL7Q 2YTCA 1VBXA 4IOCQ 2MYFA 1K8AT 3UCGA 2M8HA 1H2VZ 2DO0A 3BO2A 4TU9A 4BS2A 1P27B 1H6KX 1OWXA 3DXBA 3NNHA 1X4DA 2MY7A
chains in the Genus database with same CATH superfamily
4KV8B 2ZUGA 4DX5A 2AP6A 3DGVA 2PEHA 4J9SA 1IKXB 5IOLA 2OFHX 2KRRA 4ELUA 1B99A 2DHAA 3PR4A 1MWZA 4EFAC 5KG1A 5D0GA 3C16B 4ED4A 4WJBA 4O4GB 4B3RF 2V4JA 2LA6A 1YJVA 4JI8F 2HVEA 2GGPB 5H9EJ 2V8PA 3DOKB 5ETQA 1WEXA 2RH3A 3C15B 2R8JA 4DV7F 4TLRA 4RLEA 2QSFA 3AOBA 1FKOB 2FC8A 3VAMA 4H4KC 1VBZA 2GVDA 1RTIA 3UN3A 1NK8A 3BO4A 5JVGQ 4KGKA 4MYUA 4R0EA 2GAHC 3TWZA 1KHWA 5G4DA 1R31A 2YNHB 3Q8YA 4BWMA 1WC1A 1K0VA 2MGZA 1SIZA 2A18A 3QFHA 4P2SA 3OFEA 4C3MA 1FFGB 1REGX 2KKHA 4NXMF 1TFWA 5L8RC 4B3TF 3OLBA 1T9TA 4NLVA 3RJMB 2OEKA 2XWYA 2V4RA 3D7SB 3OQ2A 3PX6A 5FIIA 2IBKA 4I2QB 4DR2F 1S6OA 1SC6A 4WK3A 3QRPA 3JTPA 4MK8A 1RA6A 2LQ8A 1Q16B 1OIAA 1AUDA 3D1HA 2P8IA 2EFNA 2HQFA 4OJHA 1M0SA 4QWCA 2G4BA 4NLSA 4OLOA 4IRKA 3VGUA 3DN9A 1BC6A 4IH5A 3CCWA 2OPPB 1FT8A 3R6LB 3SXLA 1MMDA 3RBDA 3H5XA 4QZVB 2ZH9A 1S6UA 4BC9A 4HTIA 2HEKA 3HSDA 2QL7B 3D9BA 3KK1A 4TY8B 4OZ2A 4Y65A 5HSPA 4HT5A 1ZBTA 4YB7A 3VALA 4IH6A 3MAHA 3UFCX 2H5EA 3M8QB 4NZ7A 2YKQA 4V1Ak 1TP7A 2JL9A 4KPCA 1VQ9S 3PO4A 3SQOP 3QZ8A 5HBMA 2ZH4A 5CA5A 1RHQB 4L74A 1IWAA 4C48A 1GMUA 2W2NP 2GIRA 3I0RA 4CO5A 1BD6A 1L3TA 4USKA 4M5KA 4NXNJ 1NK7A 4TNOA 2EPIA 3HKZD 4DV4F 4K2XA 3K8VA 4XDDA 1KOOA 2DYAA 3N5BA 3IG1A 1R7IA 2PIIA 3CCJS 2VQFJ 5GAHU 4FPRA 1KLMB 3R2CJ 7FD1A 3P3DA 3N4WA 1SQFA 2B5JA 2E29A 1KQKA 3TRGA 3GB0A 2BX6A 1I51B 4M95A 2HFSA 2QRRA 2MHNA 5J2QB 4UZBA 2LXUA 2FYXA 3HVTB 1T3NA 1U4BA 3D0GE 2GQ2A 4IRCA 3NCQA 3DU5A 5LJ3Y 3HHLD 1QJHA 2CNKB 3NWGA 4F4AA 4C8MA 1N5TA 4K59A 3WBZA 4L73A 1U1QA 2PGCA 4DR7J 2E7XA 2RNEA 3QT6A 1UJ6A 4FBUA 3SQGA 5A8KA 4Y3CA 5ITHA 3M8PB 4IG3A 3UN5A 4DLGA 2MQOA 4A8QA 4RW7B 3J81U 4LF5J 2VU5A 3OTDA 5K8NA 2XULA 1RT5B 1F1BB 1NPRA 2VOOA 4X62J 1N5VA 3W9JA 3LGHA 5CZVA 3JSMB 1AFIA 2NSCA 2O5DA 4J7CA 2DPIA 5KFPA 1VR6A 2AMCB 2W4CA 1CJKB 3M8SA 1JJ2R 1T94A 1CULA 1TKTB 2E7WA 4ILMA 4IYQA 1HR0F 4LRCA 4K4VA 3HFVA 3OTOF 3KHLA 4FXDA 3UCZP 2WB4A 1UJ5A 3W5XA 4HHHA 4OYZA 4DPYA 2R8KA 2CQBA 1NJWA 2QLFB 4QWEA 2UXDF 1H2VZ 3BO2A 2HK3A 1P27B 1XMOJ 3M6WA 2J6UA 2V50A 1SL2A 3ONQA 4IOBA 4GVBB 1UCNA 2CYYA 2OIHA 3CDAA 4UY85 3GR1A 3BKFA 2GW8A 5EX0A 4NCGB 4JP8A 1AYEA 3TZWA 1BWEA 2LDYA 4LVOP 2XI3A 4C3KA 3VV2B 3KJFB 4EEYA 3SMZA 3DLHA 3TO8A 3KK3B 3V6HA 1W25A 2HVHA 4DEZA 4GKJJ 2YNFA 3TZZA 1I1GA 1TL3B 2MDAA 4WP3A 4PXEA 1N6QB 1QSYA 2Y0BB 4ZIWA 4J5OA 1LK5A 3OXFA 3KJVA 3DRSB 1DQAA 2CQPA 2ZJPQ 1H2TZ 3HZGA 2DB1A 1FFSB 2I6WA 2KZZA 4Z7YA 5J1NA 1M1KT 4WFBQ 5L1IA 3EVOA 4URSA 3R5GA 1U1KA 1BY9A 5J1PA 3THTA 2VG6B 2ZJQQ 1DTQA 2V2QA 5GMDA 2NXEA 1HD1A 5A0YB 4CWBA 5KT5A 3PYFA 3C19A 2HW3A 4HHJA 4K4TA 5CD4H 3J7YI 4CLUA 4TKTA 3UN2A 3BQ2A 5B08A 1FDNA 4L75A 3MEDA 4KR0B 2FJWA 1IBKJ 3PM9A 4MH8A 1U26A 2ZH2A 1S77D 2HHQA 2RT3A 4TU7A 4OHZA 1HQUB 1H0HB 2DNLA 3W9IA 1JLCA 4LF9J 2WBMA 1WTFA 4OFZA 4F26A 3EMTA 2X1FA 2QE5A 2BJDA 1RSCA 2CFXA 4RU9A 1URNA 1T95A 3EUNA 3DOMB 4CO4A 3HVWA 3LO3A 2H65B 1VRTA 2DJWA 1RTHA 3G96A 3HCXA 4WU2A 1U1MA 3EZUA 2UUBJ 1KDNA 3BGRA 1IKWB 2LU2A 4PG5A 1WELA 2NPFA 2CJBA 2QJ3A 4AQYJ 3J7Z5 1KTQA 2B9XA 3OD2A 1NXIA 4TYBA 1AZSB 2VPZB 2ZC4A 3AH6A 1DTTB 4KO0B 3A8EA 3KNAA 2B6AA 2H1YA 1HWJA 2MZRA 1CC8A 4QW9A 2I0XA 1UFKA 3QLHB 3B82A 1XK8A 4WKRA 1R8PA 3H2LA 3AA8A 3VHQA 2VDIA 1T3OA 4PQAA 3FCHA 4WYWA 7AT1B 4RO0A 1HWLA 2WVDA 3PHTA 5JUMA 4ZP8A 3D66A 2G0JA 1HPZB 3JQKA 1JLGB 4ED0A 4LF4J 4OHYA 2VG7A 1NDPA 2DNPA 4PWUA 2R8GA 4OMFG 4RR5A 1OY8A 2WONA 4J9OA 1WOOA 1UVKA 2QG9B 3QT5A 3K7RA 1UJ4A 5AXLA 3FZ2A 3H2UB 3A3NB 3EPGA 2SXLA 4ECYA 2FVQA 5KFDA 3QPIA 3R8YA 1NDCA 4K7QA 4GKKJ 1OSCA 4XTTA 4CO1A 5KFXA 1TK5A 3D28A 2CQ0A 4N8NA 5KFLA 2O67A 5D15A 1M5PC 1GT8A 2C1EB 5CQGA 3IAS9 2OEJA 3R97A 3FSYA 5DDRC 2MSTA 1S1XB 4XK8C 1JNZB 3H5SA 1B7YB 2HHWA 2VZ9A 2EFGA 4HACB 2JJ4D 3D0HE 4BCAA 3R6GB 3VGTA 3FVYA 2WB1D 4CO2A 4Q2MA 1O6XA 3MPYA 3L7PA 3KLHA 2UVRA 4NASA 5AJ3J 2DXFA 1S9GA 1NH8A 3HHEA 3L09A 4MAKA 2QLXA 3PXGa 4C3LA 3LF0A 2L48A 1LWFB 1RDRA 2FLOA 3R1HA 1CEZA 2DNZA 4C0BA 5D4NA 3VAFA 1GFWB 4M94A 1VRQC 3X3UA 1Q1KA 3PYGA 4JI0F 3LGMA 3HHLA 3FSXA 2ZH8A 1WF2A 5KFEA 1T05B 1SQGA 4OZNA 2ZVSA 4IOCQ 1XJWB 3R7SB 1NK0A 5HLFA 3NLCA 2Z8QA 3FFIB 5DETA 3ISND 5B0AA 4OQJA 4E2FB 3CNQP 3J80U 2XO7A 1R0CB 5LOQA 1RT7A 3FC9A 4EO6A 3G71S 3W1YC 4DG1A 2GV1A 1OO0B 1VMBA 2ZH5A 1TELA 3CCVS 3VZIA 2EC0A 3BN4A 3DRXA 3QGGA 5IC4B 4HDHA 1QAXA 3QO9B 3PW7A 3GLJA 5KFKA 4YR2A 1N34F 5LMUJ 1EHWA 1L3SA 1NHUA 3GQCA 1WD6A 2UP1A 3D1QA 2KN4A 1B4SA 2AEJA 5KFYA 2FJBB 2YQ0A 1EETB 4ZPCA 3RGIA 3ADAC 1RWNB 5BXIA 5DJBA 5E3PA 1QAJA 2IC3A 4OZ0A 3DDNA 3GCWP 5AT1B 4QYZK 1UWBA 4USTA 2FJVA 2JWNA 2ZBIA 1VQNS 4L3KA 1U47A 5KFHA 5L9XA 2Z2ZA 4XDCA 4I7FA 2RJZA 3GYXB 3V6DB 4YOEA 1BQNB 4MK7A 3HD2A 3D67A 1OMSA 1RWUA 4I1TA 4CT9A 5LXRA 2VF3A 3RRGA 1VJQA 2XI2A 5KG4A 1FKPB 3BEGB 4XIUA 3NOCA 3QMQA 3VF0B 4QW8A 4N7TA 3U02A 4Y2MA 1FDAA 1NMEB 4ALZA 1F60B 2HNZA 5IM0B 3MAQA 2QL9B 1K1QA 4Q44A 1N8RT 3MEEA 2FDNA 2BACA 2HFUA 3TUIC 2HHHF 2ILZA 3IXQA 1QSLA 3CVKA 3F0NA 5HO4A 3N0VA 4ES1A 2EI5A 4YB6A 3DYAA 2E7VA 4ZDNA 5KFQA 1OQ3A 4AL6A 2DXEA 3KJNB 2DGVA 4OX7A 2OD4A 2VH7A 4KGZB 3W63A 4LSNA 2I9SA 4WZQA 4DQSA 2VV5A 4FKYA 1LW2A 1X5OA 1RAIB 3RB0A 4DU8A 4U7UK 4RL1A 1YITS 3Q2TC 3G87A 1HNIA 5L1JA 2GHWA 3A8JA 3W66A 3RBXA 2D7SA 5G0RB 4N41A 1TKZB 2YWKA 2J0WA 2YWFA 4TVAB 1MROB 3C6UB 2GMJA 4QPTA 4JYAF 5CXTA 4OI0A 5F8HA 2AX0A 3NWRA 1SJFA 1T03A 2A6OA 1XMQJ 3JSYA 3KG4A 3CCES 1XMBA 4PXCA 1N32F 4M5MA 5A8RA 2AX1A 5C2GA 5C24B 1ZZNA 1TL1A 5ETPA 1YVFA 3HPOA 1HQEA 5LXYA 4OI2A 3MCSA 2F65A 3CCTA 2YKAA 4U95A 1S48A 2F7VA 2OJ3A 4I56A 2VD3A 2FQQB 3CJ2A 1IR2A 3TUPA 4ZK7M 2DCUB 1TKXB 1B64A 3PEJA 4FYWB 3JAMU 1FRKA 1S4FA 4G1QA 3EYZA 4ZCLA 4YY3F 3MFHA 5KFCA 4LFAJ 4QR0A 2CZ4A 2EFVA 5HI7A 3M30B 3SV4A 3NS7B 2PFDA 2GHPA 1YJRA 5E0OA 3ZZYA 1NK5A 3L9ZA 3DHWC 4DUZF 3MM7B 3MECA 2V4QA 1Y5NB 4F3OA 4H4OA 3KOAA 2R4FA 3U1MA 3QRRA 2KJVA 2X3DA 3CIZA 4Q45A 1S49A 1Y5LB 5K14B 2FLPA 2HNDB 2WVCA 2VOPA 4LR9A 4DR4J 3SCIE 2CNNB 5A8WA 1K44A 4IFYA 3T1HJ 2MZSA 4ATNA 2FHMA 4TYAA 5IS2A 3MTJA 2UXBF 1HMVA 2KDOA 5BYSA 1FKAF 3KWMA 4X4SA 3NCPA 4ECRA 3D1OA 1WJ9A 2Q66A 4NA1A 2IM0A 3BYPA 2EEYA 1YJTA 2BUNA 4C8ZA 3GYNA 1FXRA 1CJUA 3P5BP 4K2JA 4BHQA 3CCQS 2ZH3A 3S01A 3KG0A 2DIVA 2NXCA 4OX6A 4KH0B 5DS7A 2MY8A 2R2SA 1DBDA 4B02A 2DIUA 3POTB 3KUEA 2IA6A 2AIRB 3B78A 3MOZA 3T5HA 4OL8A 5T7LA 3G4SS 5CHCB 3DGPB 3U7JA 3A1YG 4P2FA 3IN5A 2EKYA 1T11A 2RRNA 5ETKA 4MTPA 2HWIA 1SV5B 4B3SJ 3BBCA 2H4YB 2BYCA 1P8GA 4F36A 3PO5A 4OJ1A 4RNOA 3P6YC 2VBWA 1DURA 1GX6A 1N52B 3MEGB 1HW8A 3HF5A 4HDGA 1L5UA 2MQPA 4K0KJ 2NXUA 5F0WA 5H9FK 1NH7A 4PR6A 2PFFB 2M2BA 3BSOA 2FB0A 2YXLA 2F8EX 3ELHA 3FNNA 3OR2A 2G0IA 1U8SA 3AFGA 1FA0A 3GFHA 4DV5J 1IBLJ 1NJXA 3R3TA 4J9NA 2BQUA 2XWXA 2EVZA 2DGWA 5KAKA 2ZM6F 3CEDA 1SKWA 4UY8T 3HO1A 4A8YA 2OLWA 4PRFA 1UZDA 2E5HA 3UNYA 2HNYB 3C6TA 1HNWF 4QU6A 4AXIA 2QA4G 2IAJA 2DBBA 4YB5A 1YBTA 2ROEA 2XTJP 1NJZA 3OUYB 2W1BA 2AGQA 2GMLA 2K8GA 1O5JA 4PWDB 2HHVA 1J27A 1S9EA 2ACYA 3ENVA 1N5QA 4O3OA 4HI1A 4ZP6A 3BQ1A 1U48A 1NKCA 4W4MA 1L3UA 1F2GA 5L38A 2EKNA 2DVIA 2MSSA 2HHPA 3RG6A 1X31C 4JI6F 3OVBA 1JX4A 5HMZA 1QUVA 3BS9A 4DR6J 3BYRA 2VA2A 4YDXA 1WDTA 5DRKA 1NKBA 3WHIA 2NXJA 1YDLA 1QDUB 1EKRA 2RKIB 3CMES 3EGNA 2X1AA 2K1RA 3CJ0A 4ANEA 2AGOA 1VK3A 4DBQA 4Y28C 2Z0GA 1TTHB 1P9YA 1JWWA 3GFXA 5KFWA 4CLKA 1M1HA 2YNIA 1VQ8S 1S1VB 1R6VA 1WDDA 2DGUA 3KXDA 1SVDA 2CPDA 1RT2B 1M5VC 3MR6A 3RB4A 2RQKA 2J0QD 1VC6A 4RW6B 4DR3J 1IUJA 4HHUA 2JC0A 2B7CB 2BJ3A 1YHQS 4Q5VA 3ZTQA 3ZZPA 3A8KA 4X64J 3ICLA 3MM6B 2YWEA 4PUOA 4UF4A 4R8UA 1SKSA 3DRRB 4Y00A 5A2QU 4YS2A 1FJGF 4DV3J 2UXCJ 4V19X 1RWOB 4R25A 3KDOA 2DTJA 4W92B 5L1LA 2KI2A 4J90A 4B08A 3R2DJ 4GC7A 3C14B 3GFYA 1RWPB 5T14A 2R9LA 1TK8A 1JLEA 4DL4A 4DV6J 2R2RA 4ZMMA 1Q5YA 3J7ZT 1X4FA 2ZD1A 2UV8G 2GIFA 2GNKA 2JC1A 5KG7A 1S0NA 2HG4A 1JLQB 2A6MA 1XR5A 1KFDA 2CPYA 3GCXP 1Q95G 4Q8EA 2KJWA 2DHXA 3CD7A 2J9DA 3MMBB 1CBKA 2DXDA 4M5JA 2HFNA 4F4WA 1JXLA 2ZEJA 3KK2B 2DISA 5AXNA 1JLFA 2DRAA 2RHQB 4JBCA 4CP5A 2OELA 1SUQA 2PI4A 2XS7A 4F4YA 3D3BJ 3V6JA 3I0SA 3C46A 4U6PA 3UPFA 4RKUC 1OPZA 3RRKA 4EBCA 3DLJA 5BR8J 3N6LA 4BBYA 1V5VA 5FD1A 2IMWP 2H48B 3X1LB 2FIUA 1NBEB 1I6JA 5J1EB 1HWKA 1S72S 2IMOA 4QPXA 1P1TA 2Z57B 3AHPA 4OZJA 3J7YU 3MR7A 3TANA 4IQXA 2RU9A 3M1VB 3ET6B 1Y3KA 4PG8A 2ATCB 2XYGB 4TU9A 3ZNUA 1RI7A 2AEMA 4X66J 3M8RA 3AB2B 1NRKA 3PYEA 4Y2AA 2V6AA 4LFBJ 1WC3A 4IDKB 4OJGA 5D3GB 5KFBA 2IJFA 4FF1A 5M2UA 1FK9B 3WC2A 1DQ9A 3AJDA 2KVQE 4NLOA 1HNXF 2W2PP 4UW2A 2V2VA 5IQ6A 3IMQJ 2DNGA 2IM1A 2RRBA 1AROP 3MPDA 2LU1A 3KLIA 1RTZA 4B3RJ 4CLLA 2KT2A 2AYEA 3QSIA 2YQ3A 3FEXB 3GIIA 4JV0A 1JLAA 2XHCA 1VC5A 3F44A 2AD9A 1Q7LB 2AF6A 1DZ5A 3G86A 1G4CA 1OQ6A 2BANA 2HHTA 3T1YF 3M8YA 3Q8UA 2UUAF 4XO0A 2HWHA 1M5SA 3JQJA 4YB1P 1S1WA 2R7TA 4A47A 4A8KA 4TN2A 2V4JB 4CH0S 2HPUA 3TA1A 2ZKTA 4UOGA 3F41A 4KRWA 3MR5A 1Y3JA 3THPA 2ZNZA 5H9FJ 3TR5A 3CJ8A 3ZXWA 1MN9A 4Q0BA 2E9RX 3KLEA 4ES2A 1BQMA 2ZHAA 2P5VA 3HJVA 3MMAB 4IFVA 1S7HA 3RBEA 4QWBA 1A0OB 4B3TJ 4CYUA 1RTIB 2F5GA 2E5LJ 1OY6A 3N28A 1Q81T 4GRSA 4ETZA 3UVJB 1TL7A 3NMRA 4DR2J 3CDWA 1LWCA 1QE1A 4CTAA 2HIQA 3TNVA 4F0MA 2HQ3A 4KGVB 3EGVA 5SUHA 4I6WA 1O51A 3H2VE 2HURA 3A4TA 4NLQA 2VJUA 3G6VA 1JIHA 2DY9A 1YJWS 5IWAF 3W2VB 1RHKB 4OHWA 4EYHB 1DLOA 4LRBA 2VFRA 4LVNP 4H4KA 2ADBA 1V9OA 3L95X 1NDLA 3CJTA 3B4DA 3K5PA 1X4EA 3AA9A 5B7WA 2FVSA 2MZ1A 1RCXB 3IRXA 3ILJA 2J9CA 3IWNC 4O3PA 2BQ3A 3W3SA 3K2YA 3R27A 3MM9A 1MU2A 2RQCA 4LRFA 4A46A 1FESA 2OFGX 2XSFA 3FBBA 4DS5A 2DNHA 3TQ1A 3ENQA 3CC4S 2CPIA 4MKYA 4DCOB 1X60A 7FDRA 3BSCA 4DV4J 1FJCA 3CT9A 4M5DA 1F9FA 4O0NA 1J5EJ 2GHVC 1SL0A 1RBLA 3E01A 3E51A 3TEHB 1M1GA 3AD8C 3M6XA 2F9JA 2JDJA 5KFNA 2N4DA 2D3UA 1LQ9A 5F8MA 2MQ8A 4RWXA 2FUG9 4F4ZA 1VIOA 2F40A 4PABA 3TAMB 2C2ZB 4FS2A 1URRA 2DHHA 3IG1B 3RAMA 2QEXS 4LIWA 3CDEA 4NCAA 3IR6B 2DNKA 3V2UC 2B5JB 2DHSA 5JVHQ 1PG5B 4CLYA 3HZEA 2GVZA 4OYAA 4NMXA 1C0TA 4B9TA 2ILYA 2NZ4A 1Q8IA 2N3LA 2HFVA 1M90T 4JV1A 4MMOA 3I96A 1KSPA 1KQSR 4B9NA 5K8OA 4A8MP 1QAYA 5DZ7A 3TJAA 4ICLB 3HDSA 3CWJA 1JXEA 1NPKA 2QIFA 2AGPA 2DRDA 3M2UA 4PPDA 1VQPS 4ZJLA 4EYIB 1Q8LA 2JLGA 2HHXA 4P2XA 3DRPA 3AOAA 1RTDB 3T6BA 1HR0J 3GV8B 4C11A 5A8KB 4R5PB 3IRWP 4K4YA 1T0TV 3CXCR 3QGHA 4IG3B 3OTOJ 2IDEA 3K5LA 5C42A 2IVYA 2ROPA 2MLXA 5EUHA 5M2RA 3V4IB 1HBMB 3NNHA 1EP4A 2PN6A 3G2XA 3WIVA 2MY7A 2UXDJ 2B8QA 2DEIA 2BR0A 2J6TA 2GCFA 3KDNA 5B0BA 2LP4A 3CJSA 4ZHRA 2BW7A 2N3OA 2C2DA 2HGMA 3NAIA 1HARA 3BZQA 5KFJA 4O0IA 5I3UA 2GX8A 5ETVA 2FJEB 3BGFA 2JFDA 2LEBA 2RMLA 2QYCA 4KSEB 2XO6A 3GV5B 2VIHA 4ZVGA 5A76A 5EX3A 5DGBA 5C5JA 3GIMA 1U0HA 3H4DA 1KBRA 1VJWA 2IA0A 4JI2F 1ITPA 4KV8A 5HATA 2XSJB 3FRZA 1RWVB 4ZPDA 2B0GA 1HKAA 2QYGA 2R3VA 4QIEA 1UMJA 3T5KA 1HIYA 1X4GA 2DITA 2WSFC 2LVWA 4USHA 2YNFB 1KVIA 2KYXA 4WBFA 4N5SA 1OSDA 2RE1A 2NR0A 4DL7A 4YDDB 2BKOA 1RQ0A 1UAWA 3BSAA 3C16A 1VQMS 4O4GA 1SBRA 3KJVB 3QAUA 2GZOA 4D3HA 3OHBA 2VHGA 3TVYA 2GGPA 4KPYA 3CC7S 3R5CA 3I5AA 1JNRB 3T3FA 3LPEA 3DOKA 1AXQA 2ZOFA 3MOJB 1ZTTA 3C15A 4IO9Q 1NPPA 2V8VA 4ZITA 2R2TA 4HYKA 1YSJA 2AKWB 4NZ6A 3H8YA 4YHHF 3OVSA 3GJQB 1F0XA 4C98A 4FYXB 2LKZA 4DS4A 4CO3A 3F73A 2ZZNA 3EXYA 3PV8A 3PX4A 1JLCB 4USMA 5DG7A 5IV4A 3I82A 1TK0A 3AXMA 1VDHA 4ZN3A 2CPEA 2OPSA 1R27B 4KIAA 3OSPA 2MJUA 3D4JA 4WE1B 3FDSA 4I2QA 1VRTB 4MFBB 3NGDA 4DR1F 3BGLA 5J2NA 3SBMA 3ZZ0A 1RYRA 3DMJB 4ZVHA 3M8ZA 2BRKA 3W5YA 2NCKL 4URQU 4JI3J 1HBOA 4QYRA 5KOXA 3KLGA 4WXOA 5CCMA 2HBQB 3ISNC 3KFWX 2DGXA 2B6AB 1I94J 3UDLA 1PO6A 2IVMA 2XGPA 4TU8A 1FCAA 4NYOA 2C2EA 1FDBA 5K9FA 4TY8A 3T5LA 2JSXA 1F6TA 2V8GA 2ZH7A 2RDIA 1CG2A 3HFKA 2HAIA 4K5RA 2N7CA 3M8QA 3QQCD 2ZBPA 4QCLA 2C3UA 2QSWA 3PFOA 5HVGA 1GX5A 3GR0A 2Q6BA 1AFJA 2QLBB 2VG7B 5DDOC 4EWTA 5H9EK 3I4PA 2HQCA 4PYDA 2WONB 4CDIA 2FJXA 2CZVC 2R7OA 5D4LA 2DR7A 4TXSA 2ZKUA 3EDRB 4BLGA 2NQPA 3C3LA 3G6ES 1PBUA 2MEWA 2XHWA 1U6ZA 2RU3A 3GONA 1W2BR 1WC5A 1KLMA 2ZWPA 3TVKA 2K2PA 1FNOA 3AD9C 2CJXB 3BN7A 1B0TA 1QVFR 4YR3A 5DDQC 4UOHA 3HVTA 3IBWA 4F0HA 1B0PA 3IM8A 2D74B 4USWA 2J0XA 1RCOB 3GV7B 2QMUB 2VQFF 2AZ1A 3LTOA 5K20B 2VG5B 1OYDA 1A6LA 5KFGA 4JI0J 3P4UB 2AJ2A 3K58A 3KLHB 4RW9B 5T41A 3D6TB 4PG6A 2YKNA 2I5JB 4JI1F 2EFPA 1ZTWA 1VQYA 4F4XA 3BDPA 4DV0J 2YX1A 4K4WA 1HW9A 2V67A 3IR5B 1XR7A 5K8PA 5HVFA 3KMSA 3KHHA 3QRQA 1H3DA 3CMQA 2OPQB 3KLVA 4R0JA 4PXBA 4DR7F 1TKTA 1NEEA 4DV1F 4J9PA 4YR0A 3LOUA 3ENAA 2UUCJ 1SJ3P 3GJSB 4CNZA 3GZ7A 4EI2A 1XERA 2E5JA 1RAOA 3I87A 4Z2XA 5CAAA 3DC2A 1TMMA 5HQ8A 3NEKA 2AHOB 2OI2A 3Q8VA 2KXNB 4F3MA 3A3OB 3G82A 3LGNA 4OIXA 1GXTA 2CKWA 1RT7B 3JAMY 3V4MA 4ETXA 1XBWA 1S0MA 4GVBA 5H1SV 5LMNF 1ZPVA 2VPYB 1WHVA 2AJ0A 5L1KA 2QC3A 4NCGA 3M05A 3EZ5A 2HMIB 1HLWA 4WFXA 2HVZA 4E0DA 3NS6A 2NYHA 4P71A 1FJEB 2XB2D 1W2IA 5F8GA 1Q7YT 1T9VA 4FYYB 3EGZA 1TVRB 5C7PA 4NA2A 3O1LA 1YI2S 2NS1B 3W2WA 2M3DA 2J76E 1N6QA 2IC3B 5AXKA 2X51A 1BMQB 2XMTA 4CO0A 3BQ0A 3DRSA 3TZYA 2WOMA 2LMIA 1LW0B 3TI0A 3MPVA 4Z37A 4GKJF 3VQSA 2DH9A 1OPIA 2HHHJ 2YNGB 1D9FA 1NK6A 5HQMA 2M0GB 3PFEA 5CZXA 4PG4A 3BO3A 3V6KA 3MCMA 5HP1A 2BM0A 1U1PA 2IY5B 3W5ZA 1MLAA 1EB0A 4NPOA 4OX8A 1SJ4P 4KAIA 1S59A 3I9V9 3GG1A 3TW0A 1PJ5A 3ZTOA 3MD1A 4F02A 3DDKA 4OV1A 3OFGA 3TX0A 1FRMA 3MEEB 1IKVB 4AL7A 2BE2B 4RX6A 4QWAA 4W90B 2OUGA 4WK1A 4FDFA 5L9NA 4AL5A 3C66A 5EWFA 1HQUA 4O44B 4ECSA 2W9AA 4LF2A 2PDAA 3GG0A 2YVSA 4DL0C 1LOUA 4N77A 3KTQA 5KFIA 4CLFA 4FS1A 4NZ0A 2EW9A 1R6YA 4AE5A 3DOMA 5GVQA 2J0SD 3Q2SC 2Z30B 2VPXB 2V8HA 2FZCB 2Z2MA 4JI5F 4LSNB 2VC0A 4DL3A 2O66A 3PR5B 1WC6A 4JYAJ 1LW2B 2W8LA 1QAIA 4DJBA 3SDEA 4YEAA 2CWXA 5U47A 1QUPA 1N32J 2CWKA 2ZZTA 2J7KA 3MR2A 2JVRA 2RUSA 4KO0A 3EX7B 4PAAA 1G7CB 3MR3A 4ECXA 3R5JB 4XAKA 3GE9A 3FQKA 4WCEQ 4USVA 1QSSA 4QOTA 2DNOA 1HNVA 3MFIA 2CPFA 2WHOA 3W61A 4B17A 1T03B 4C8KA 1T7PA 2A3JA 5L39A 3T9NA 2C3PA 6FDRA 1KKHA 5A8RB 4B3MF 1WKJA 4JV5J 1MMLA 2ZZMA 1TL1B 4ANCA 1BLUA 4EGLA 2IFXA 4ZLLA 4LQ9A 3D6FB 2FJDB 4QR2A 1WEYA 2EFQA 5D78A 2P9CA 4PQUB 5F8IA 1PAEX 1LXJA 4G1QB 1K0TA 3CJKA 1XR6A 4DN0A 2VBXA 3ETMA 2D41A 2MLYA 5ETSA 1WACA 2VKZG 1YJ7A 2VL1A 5HJXA 2KFYA 4DF8A 3PX0A 1ICEB 3CIMA 2UXBJ 2MYFA 1RLDA 2M8HA 2V9KA 1N33F 1D8YA 2VUGA 2L9NA 3AXKA 5I42B 3R1LA 1ZPWX 5A8WB 3IAM9 4IFYB 1N48A 1CVJA 3U27A 2QA4S 4RBUA 3LP2A 1Y5IB 3I5BA 3DHXA 3FQLA 3THVA 3P45B 4FP9A 3JXOA 1JMTA 2YH1A 3DDIA 2W9BB 1F3FA 1PKUA 2NPIA 2KRBA 1CJTB 5D4PA 4DZDA 5IXUA 5IQQA 4DX8H 3VZHA 2E1RA 3MUTP 2VICA 5GAGI 2XMJA 1PAUB 2CRLA 4C8YA 4I6YA 4Q43A 1LXNA 1NSPA 2ZJRQ 1R0AA 3OXLA 3GIJA 4FNIA 4NLPA 1YX2A 3D6HB 3RW6A 2ZH6A 1EQMA 3NNAA 2XGQA 4JV2A 2G0CA 2FHOB 4TQRA 3IO1A 1RUSA 1GMVA 4EZ6A 1GK8A 4J91A 1E6VB 2YQ1A 1SIWB 4B9SA 1YQHA 4DOZA 3VAJA 2ZM6J 3AY0A 3NY0A 2AYGA 4TY9A 4IUFA 3UD5A 2DHGA 3RAQA 1K9MT 3RUBL 1B0VA 1D3WA 1HNWJ 3GILA 4KKOA 4YMEA 2EFOA 4KGMA 4RW4A 3IA0A 4YP3A 1S5ZA 4C7QA 5KFAA 3LP1B 3G8SA 4NLXA 1KTVA 2P9GA 2J8SA 3RR8A 1REVA 2HK2A 3WZ0A 1X5TA 2HZAA 2UVUA 2Y8YA 2A2CA 3E3XA 1FRJA 1UEKA 3R7BB 3AAWB 1BQNA 3DLBA 2V68A 1WKLA 2M4MA 4LRDA 3KLFB 5LSOA 1H7WA 2AU0A 2MKIA 5I3QA 4F2SA 2E1MC 1JKHB 4H4MA 2N4CA 2ACMA 3WQPA 2NSBA 2MKCA 5E3CA 3G6XA 1UEUA 1ZS6A 3CSKA 1TQLA 4F0KA 2KT3A 1NHVA 3DLEB 4OX9F 4OYMA 2DGQA 1TZ0A 1H2UX 2Q3PA 3IS9B 5CCLA 3HVRA 4MKAA 2BZ2A 2EBGA 1YRXA 4HR2A 1QLNA 4B3OA 5HN0A 2IJNA 3LA0A 1UP1A 2E1CA 1B70B 3EVMA 2K1RB 1EAYC 3QIPA 3JYTA 4X84A 1KOHA 2FZGB 3QZ7A 2YNIB 4ZS6A 2CQIA 1DHMA 1KS2A 2MMYA 2RVJA 2IYIA 3OTEA 1FJGJ 1HBNB 4DDFA 2K7KA 4ZLPA 2GC8A 2LCWA 2AT1B 4ZVPB 1HYSB 4C2MA 2H5IB 2V2KA 1RT4A 5C25A 4H54A 2F3JA 4W98A 1VS3A 5G0RA 5SZTA 5GADU 3MGJA 1FWPA 4WFYA 2Z2YB 4I67A 4ZVFA 1MWQA 1CQMA 1PBAA 1MROA 4QR1A 1F9EB 3C6UA 3FJ2A 4P10A 4X4UA 4U8YA 4A8XA 2E5GA 2HRTA 3B8HA 2DR9A 3P8BB 1U49A 1WF1A 3BPDA 2D69A 1NHKL 3JTNA 2ZFHA 1S6PA 4ILRA 2JEIA 1P1LA 1R8HA 2J8AA 1CJVB 1AB8A 2ZD1B 4C6AA 4B9UA 2FVRA 5CYQA 1KQGB 1DJ0A 2AJ1A 3MUVP 2XYHB 2KZMA 3CCRS 2BA9A 4DN9A 1TKXA 1S9FA 3VGSA 2C2KB 2XCPA 4X4PA 4U7UD 3T9ZA 1EARA 4LJMA 3FK4A 1DAXA 1S0OA 2W25A 2RQMA 1RHUB 4DLEA 3QGPA 1YK9A 4X4RA 1IXKA 3VAGA 3NL0A 3OHAA 1C1BB 6FD1A 3M30A 4DXLA 2XMAA 3UCGA 4JB8B 3PW2A 1S10A 3HX9A 1LFPA 1Q79A 5B0EA 4M5IA 2W9CB 4KJIA 3VR1A 4L6V3 3OL6A 1YLXA 4ID5B 2MKYA 4KT0C 4LFAF 5J2PB 1X9MA 3BGOP 1N5SA 5K14A 1GTHA 3WX4A 1ZH5A 2OAUA 4FKXA 1RAAB 3OLAA 2IBOA 1JJCB 3CCZA 4RW8A 2KFNA 1HNXJ 3VVTA 4DZ6A 4RUBA 4ZP7A 1KC8T 2CJ9A 3NGTA 1ZZFA 3VTIA 1Y0HA 2IHR1 5KG0A 3PRBA 3I56S 4A4JA 3PDNA 4N47A 3HXMA 3EZOA 4QIFA 2G2ZA 2ADCA 2F4FA 3O44A 2C3OA 3CO0P 3DLGB 1YBAA 4OZ3A 1JXVA 4FYDA 3M2RA 1GEHA 4USUA 2YWHA 4JI4J 4P6QA 3BDEA 3HJFA 2UUAJ 5D8HB 3T1HF 1F9HA 2UZAA 4ZVEA 2EK6A 3MURP 4YN3B 2O1PA 1FXLA 3POTA 3KLIB 1FX2A 1VISA 3ZFVA 3LPYA 4DV2F 2XNQA 5HQLA 2C2OB 4U67Q 2BKNA 1YJNS 1JLAB 5IV3A 1F5BA 4RUCA 4EUVA 1G3OA 3N79A 1WOSA 3DGPA 3M32B 5HMXA 3S8SA 2M88A 4C8NA 4G65A 3UDEA 1TFYA 2XY6A 3MPWA 1U8WA 2QL5B 3P49B 2B56A 4LF8F 3Q0AA 1BXNA 4NCBA 3GJTB 3J7AN 2OGUA 1WG5A 1GMWD 1WSRA 1S99A 2DNRA 4C8LA 2QFIA 3BH7B 1IJFB 2PC6A 3DI6B 2IM3A 1C0UB 2HZCA 1DY3A 2CQ2A 4Q0BB 2Z58B 3QWPA 3UQSA 4L72B 1E6YA 4FF3A 4IFVB 3H98A 5K8MA 4JI7J 3PNIA 3K5MA 5IT9U 1WHXA 2VQEJ 2DNYA 2YKOA 1O0PA 2ZUAA 2W4PA 5KFZA 2HNYA 1X5SA 2Y1IA 1QE1B 1VFJA 4MKVA 2K7JA 3IWXA 2ZBRA 1APSA 1TUGB 2W01A 4DV5F 2CPJA 2V8DA 3OUYA 4CLWA 2C2NA 4LSLA 3D5MA 2BJ9A 1IBMJ 1I5OB 4NRTA 1UZHA 3FEZA 1XEZA 1SKRA 4ES3A 3OSNA 1DLOB 1IJEB 2ZWOA 4UUWA 4FXWA 4ITSA 3KKFA 5KG2A 3SSQA 3VVUA 4ZVTB 1HHTP 1NJYA 3EDQB 1YRUA 4ZPBA 2MXYA 3RW7A 2D3ZA 1S6QA 2DNNA 2POKA 4DR5J 3MM9B 4ZPVR 2AQ4A 2FJAB 2DNQA 1S1UA 2RILA 3NS5A 4F04B 3D3CJ 5D0HA 2WTFA 1Q8BA 1FF2A 1R8AA 4NWBA 4M63A 5KG5A 1XNQF 3PIPQ 4DSJA 4M5DB 5ETMA 1V3SA 4P52A 3HI9A 2E9TA 3E01B 2JLEA 3MMJA 4WYLA 1HNZF 3BB5A 2EG1A 4RU2A 1YIJS 5KFTA 4DX7A 3GSIA 1WKKA 2CQ4A 3R5DA 2IRXA 4DR3F 1WEZA 2DGOA 1VQ6S 1HI0P 2V5HG 3PY8A 4ZJOA 3CCUS 3C14A 3PIOQ 2Y1RI 1VRUA 1RXOB 2HFZA 1U25A 3O6QA 4ILLA 2EG2A 2XQCA 1MNEA 2UVWA 2H51B 2HLUA 2GVZB 2KXHA 1N56A 1RT1A 4ZN1A 1C0TB 5HK4A 5F8NA 2UXCF 2XY5A 1VIXA 1UEVA 2YTCA 2HIYA 4MIWA 3IC1A 1X0PA 2GJ2A 4KHRA 2C22A 3GMGA 1FRIA 3LW5C 3KK2A 1FRHA 5E33A 2OEMA 4PEOA 3DRPB 1NK4A 4NLDA 5HVHA 4ECTA 1Q78A 3V5RA 3WX8A 2PE8A 2CDRB 4IR9A 4CLPA 4K4XA 4WWSA 2XBPA 4M5GA 3QYYA 3LAKA 5J1EA 2HHUA 3MMCA 4RNMA 3UE2A 1EP4B 4Y34A 3N01A 2AJFE 5LL6d 1HL6A 1PC5A 2OHDA 3QSYB 1SL1A 3PKMA 2VFTA 3TA0A 2GS8A 4YFUA 2R7QA 2DR6A 5DQGA 1NNDA 3ZZRA 1PYOB 3TA2A 4DX6A 1UPMB 5C2CA 4GO7X 2R8HA 3FMWA 2QGFB 4M1KA 4JI2J 2DPJA 1HWIA 5J2MA 1SH3A 5D3GA 4ERDA 3DM2A 4OI3A 8AT1B 3PRVA 4PKDB 3UR3C 4WIIA 3KG1A 2KYZA 2ZE2A 2CVEA 2BW2A 4X66F 3RZAA 2PT0A 3PACA 1X9WA 3SCKE 2RUGA 1TAUA 5E3AA 5HJYA 2P6TA 3OBIA 1U2FA 9ATCB 1GNKA 1G6BA 2W8KA 3FGVA 2XG8A 4Y0FA 3S1TA 1S1TB 1HWUA 1N88A 3AQPA 3O2IA 2HSEB 5F3TA 4X2BA 4LR8A 1HQ2A 4NLYA 5HROB 4Y2CA 5FLXY 5KFOA 4XPCA 4J9VA 1Q53A 2GJIA 5RUBA 2BKPA 3NBPA 2MZJA 3MEKA 3AJ1A 5AE1A 4FBTA 2JHEA 3U1LA 2A0FB 5M2PA 2RRAA 5HAOA 4YHHJ 2PMHA 1NK9A 2QO3A 1UVNA 5GAEI 2F4VJ 2IDLA 1RLCL 3HULA 3AB4B 4DWIA 4ZA1A 3OFHA 2CJKA 1KD1T 2H54B 3DCAA 1RWWB 1M5KC 5EHHA 5E7OB 5BJRA 1HBUA 2B43A 4KHPF 3MMAA 3JSBA 5CYMB 2JFKA 2RS2A 2AJ4A 4YUDA 2BOPA 1JLBB 2C3YA 2ZH1A 1WI6A 1PC4A 4PYAA 4OHVA 1J2VA 3UVJA 1FVSA 2BJEA 1GMWA 3H42A 5DGAA 5L46A 4DR1J 1CLFA 4IR1A 1IR1A 5JMNA 4ZLJA 3D6MB 4DSIA 5E5NA 3W8PA 4NOHA 2XS5A 2Y8WA 3ZNJ1 5DO2A 3KNGA 2VBYA 4DMZA 1NZ8A 2NLWA 2ASLA 2E5LF 2OPSB 4UUXA 2WSCC 1HA1A 3ENWA 3W2VA 5LSLA 4LT6A 2KG0A 1GXLA 5KOWA 1W26A 3AOCA 2CQCA 5J2NB 5DQHA 3BV8A 2DH7A 1HBOB 5ETRA 1RT6A 3EE3A 3MPUB 3KLGB 3R5AA 4FPIA 5DG9A 4ID8A 3M9OB 2I1RA 5ETNA 1TUVA 2RQ4A 3PZPA 1FVQA 2LQJA 2F1FA 4ENOA 5GAGU 3QIDA 3ZO7A 3G6YA 1ACMB 4O3RA 1FX4A 4O3QA 4IG0B 2G1HA 5LJ5Y 4ZIVA 2CQGA 4I6AA 4DI6A 4ZJQA 4B9VA 2IYGA 3A3PB 5IT0A 5KFUA 1LFWA 3Q86A 1U0SA 1AUSL 2C2MB 4NL5A 1IBCB 1P9QC 4S0MA 3UD4P 3H4BA 3W65A 3T19A 2M7SA 3H40A 2BXJA 2HWTA 2IPOB 1LKZA 1XIQA 1VC0A 2EK1A 3GFZA 1XNRF 1HI1A 3TAMA 2V94A 4NE9C 4RNNA 3PJWA 5GMEA 1J5EF 5B0FA 3I32A 1VBXA 1K8AT 1S57A 4BS2A 3I4HX 3DXBA 1TL5A 1KQFB 2W2MP 4ED3A 3EJMA 4X4NA 3H25A 3TYTA 4C0OC 3AD7C 2RF2A 2XLJA 4LBPA 5I3PA 2YKMB 3MM5B 4JI1J 4NI2A 1TAQA 4ICLA 1RTJA 4L76A 1Q86T 1K1SA 2B4PA 2QMXA 3M2VA 3Q8PB 2A2DA 2QTWA 3VGVA 1NO8A 1XQIA 4ECUA 4WTYA 2BDPA 1IWGA 1N54B 2H4WB 1RTDA 1IQTA 1TMJA 1YG0A 3CD5A 3M9NB 4DV1J 4R5PA 4GC6A 1Q82T 4HKQA 2YKNB 1SKUB 1G2EA 4ZPWR 2L9WA 4V19J 1SQEA 1U24A 2W4DA 2MKSA 3QJJA 4OYIA 5KT3A 2AEFA 3V4IA 1N5YB 1HBMA 1Z2LA 4RNFA 4LSZB 3RAXA 3FRYA 2ERRA 3HHKA 4DPXA 3K17A 4DQQA 4LR7A 2GMHA 3RRHA 1Q5VA 3R7NB 3HVAA 4ANDA 5LMNJ 4DSEA 4A8OA 4DL6A 2P6SA 3KUGA 2PSZA 2V63A 4BDPA 4KBIA 4LFCJ 3PW5A 1T9UA 3ETOA 4ZVSB 4U7CA 3UDVA 4UQGA 3NG8A 3M8WA 3G82B 1RADB 1YJUA 3J81j 3HKWA 2OD6A 3ITHA 1UVIA 3CCMS 2VPWB 3DLKB 1U1OA 1ZOTA 1FE4A 3VAHA 4I2PA 2D9PA 1BGXT 5LM7E 1VHFA 1PJ6A 4NX9A 3CO9A 1VOMA 2XSJA 2M9KA 3DLLQ 4OI1A 3ZZTA 3K59A 4O23A 2Y3YA 3NGKA 1UPPA 3A13A 3CUNA 2RDDA 2HVIA 3BM7A 3PEHA 4DCPB 1RJJA 2PO4A 1IR0A 1Y7PA 3W2WB 5DG8A 2V34A 1PGZA 3LP0A 1WF0A 1RGVA 1T9XA 2V0NA 2LA4A 5A6WA 5F9NA 1KFSA 2HQGA 3SSSA 3US5A 2WOMB 4WIQA 2BJ1A 4LF7F 4DPWA 3DOLA 2OMLA 1GTEA 2HVDA 3ZC4A 5D4OA 2A1BA 2CUYA 3CGIA 2LQ5A 1EIYB 4KHMA 4CIOA 3H0PA 4BWJA 5HP1B 1Z4UA 3K89A 3MM8A 4MIBA 1C1CA 5CH7B 1LWEB 3OR1A 1Q8KA 3O3LA 1RWMB 1MWYA 3RBZA 3FEYB 1EJ7L 4JI5J 3T5JA 3MCOA 2D3OR 3N9UC 1NSKL 1RBOB 2R8IA 2LYVA 3GJRB 2XNRA 2QV6A 2YH0A 4WPAA 1S7IA 2MKHA 2Z2LA 2OPRA 2RIJA 4RNHA 1IKYA 1IQZA 3IBFB 3MAAA 2GIQA 4WE1A 4MFBA 2BRLA 5IFMA 4NLGA 3FZBA 1IVZA 4CT8A 4NEZA 3RB3A 2FLLA 2R7VA 2LDIA 2JEGA 1RU2A 1FHTA 3DMJA 3SDEB 2XMWA 4X4TA 3NRBA 2M70A 1U45A 1D8ZA 2NZCA 4B3MJ 1EKSA 3W8GA 3DFEA 1LWXA 1CS4A 2CPXA 5D6GA 1FEEA 4JI8J 4RZRA 1VQ7S 3T6JA 1PJ7A 3PYDA 1HNVB 2CQ3A 2B4UA 3BSNA 4J9RA 5F8JA 4JI3F 3IP0A 5DLFA 2BE7D 4DV7J 3NCRA 3VCDA 3DXSX 1EZZB 4FYVB 1DQ8A 3K8WA 1I94F 4C4WA 1I3OB 3W60A 4GMKA 2HS0A 4WF9Q 3V81A 4DUYF 4XPEA 1KLNA 2FGCA 3J81Y 2OO4A 4ZCKA 2C3MA 2HS4A 3H5YA 1PYTA 1FD8A 1UTAA 2X3GA 1X4DA 2WZ1A 4NXMJ 1N33J 1U09A 1UFLA 3AT1B 3CJKB 3Q8RB 3LH2S 2W2OP 1S97A 2GVDB 3EXCX 2DGSA 4Q7AA 1FEHA 2AZ3A 3QFWA 1KP6A 3CD6S 3F56A 4ZVUB 4TQSA 1X8DA 4DQIA 5CD4A 1XN9A 2DY1A 4D3GA 2JNJA 2X1BA 1RHMB 2G1DA 3CCSS 2MGZB 3CB4A 1RT3A 2CPHA 2DT9A 2UU9F 3AJ2A 3NNCA 4Q8FA 2MKJA 3DU6A 1U02A 2WVFA 2VC1A 2M5YA 2L3MA 3SV3A 2QA2A 1MN7A 4J9KA 1SC1B 4CLSA 2VG5A 2B3TB 2CG8A 2HHSA 3PJXA 2QMWA 3WDOA 2CNLB 1CQNA 3L7UA 3QWUA 4RW9A 2XZDB 2KT5A 3LP2B 2HBZB 3M6VA 3RU0A 2B51A 2I5JA 2CVIA 5DDPC 2B9WA 1F2HA 3A8IA 3H90A 1CSJA 4U96A 2GO9A 2IVFB 5LT5A 2WRMA 3HSJA 2OPQA 3ISZA 2R42A 5KT7A 4MYTA 4U8VA 3N6NA 5EWGA 2AYMA 4LREA 1KWMA 4DV0F 1R0AB 4KE5A 1KN6A 4KFBA 3KK1B 5GMKa 4A8WA 3PG9A 2BOAA 4WFNQ 4QBUA 2F8MA 4ZPAA 5HBMB 2ZDPA 2UUCF 3HHNB 3I0RB 5EGYA 3HK2A 1LV5A 4RPFA 3PJ9A 3IGVA 4X65F 2CQHA 4EBDA 2HMIA 2RAQA 4E98A 5CYJA 4QWDA 2YPYA 1YGYA 4KB7A 1RKJA 3OVAA 2MQNA 4OYBA 1TVRA 4KKOB 3GTYX 1X7VA 4RW4B 5FDLA 3CJ5A 3QJLA 3HT3A 1W7WA 1QVGR 3BJYA 2ZHBA 1N36F 1REVB 1J5OA 4G6VB 1KHVA 1WUUA 2EXUA 2J7UA 1LW0A 4DF4A 4OJ3A 2BE9B 3IWLA 5DZ6A 4OX9J 3WIUA 1FDDA 2YNGA 1T9YA 3EVWA 4KC5A 1FNXH 3SQGB 4EK2A 3CDUA 5KFMA 3HLUA 2AV5A 1RHJB 4H4MB 1F3VA 2FVPA 1WNEA 3CJ4A 4A8FA 4ELVA 3FSIA 3CPWR 2ASDA 1TV6A 2HBYB 3BBBA 4MIAA 1IKVA 3M4XA 2BE2A 2H5JB 3MXHP 5F0UA 3H59A 4B9LA 4ZVRB 1CULB 4O44A 4B3OB 1LK7A 5D0EA 2FPHX 1R8CA 4LF6F 3Q23A 5AXMA 1S0VA 3KUHA 1K47A 3QIPB 3JYTB 3GIKA 1V6HA 2H3EB 1GXUA 3OL9A 3UCUP 5B0CA 3QBCA 1NSQA 1D1UA 1VI7A 2CZ9A 3D54A 1ELOA 2YWWA 3I31A 9RUBA 1O8BA 1RAHB 2PMZD 3N5FA 2HGNA 5C25B 1RT4B 1WOPA 2O3DA 4FNHA 3MCNA 1HFEL 2ZBQA 3TEGA 2XZTB 1F5CA 2GQCA 2L08A 1U1LA 1H7XA 4QQBA 3AODA 3B6BA 4DPUA 1IKXA 3G8TA 3LAMA 3OL7A 5IT9Y 1FI4A 5MLCV 1ZM2A 3BBFA 2RB7A 3Q24A 1RU1A 2G13A 1S6PB 2NXNA 2LXFA 1H6KX 1OWXA 2FLNA 2FY8A 5KFRA 3GP9A 2VONA 1X0FA 5A6PA 5CYQB 4FF4A 4PG7A 1G1XA 1KONA 2D9OA 2JZ5A 2WW8A 2MHEA 4CRJA 2EBEA 4KYZA 4PQUA 1RBAA 4P9SA 3EM1A 1DTQB 2COLA 2WK4A 4G3IA 1UW9A 4JV5F 1FKOA 4WFZA 1NU4A 2HFOA 1U2CA 2RS8A 2W2QP 1FD2A 2XCAA 2FZKB 3W9HA 2JX2A 3K57A 1NM2A 5GAEU 2D3O1 3ZTSA 3ZTRA 2VFUA 3MEDB 1TU0B 3NGUA 3EWGA 3VAIA 2YNHA 3JTOA 3GYGA 3SCJE 2CG4A 2OTJS 3D2WA 1GH8A 3J80Y 3OXGA 2JEJA 1WC0A 4WKYA 2VJVA 4ECZA 3E8OA 3Q83A 4AFFA 1RAFB 5I42A 2BV3A 3T41A 2MZTA 4WTOB 2AWZA 1NB7A 4OYOA 1Y00A 4RW8B 5HMWA 1LNQA 1RTHB 2E1AA 4DCJB 2M52A 2OTLS 2H9ZA 3BGRB 1UWAA 2LQBA 4C0HA 3M6UA 2W9BA 4DUTA 2K06A 2R7WA 1K73T 4DV2J 3GU0A 3K5OA 4M5HA 1RB0A 1CJTA 2W24A 1B7FA 1SB6A 3M2RB 4HEA9 4RUAA 1XWLA 2OPPA 3TARA 3PKYA 3LWMA 4QIWD 1PILA 4OYPA 4LMZA 4LF8J 2ZDOA 2XMKA 2QT7A 4AD6A 1R89A 5DM6Q 4BC7A 1VQKS 1R0BG 4FF2A 4IRDA 2LECA 2XEXA 2YY3A 3Q8QB 4WFAQ 4DQRA 1RISA 3GWCA 4CCHA 1SJQA 2FGOA 2Y9HA 1NJIT 1QTNB 3BH6B 1E6VA 3HP6A 5EN1A 3FMBA 2CAJA 2B8PA 2BVZA 3UD3P 1RAEB 3EGWB 1R3NA 2GAGC 3LANA 2VODA 3HMJG 3JS9A 5HMYA 4DU7A 4EBEA 4ED5A 1H38A 3NKYA 2GFFA 3OW2R 2G2YA 4NXNF 4F67A 1BE4A 1E6YB 5J2QA 4LF1A 3LP1A 1DFDA 4QYZJ 4I64A 4ER8A 2CQDA 2L41A 1QY7A 3I55S 3MUMP 4N8OA 1SC4B 2PEBA 3KLFA 1U6FA 1S9GB 2XZWA 1NSAA 5JXSA 4WP9A 4QU7A 3M8PA 5BYRA 2CJAA 1FFWB 4LSLB 1JKHA 5KFVA 4DPOA 4RW7A 4NEYA 4IOAQ 1RT5A 5F41A 1V3RA 3D68A 3JSMA 2EWHA 3DLEA 2FHKA 2HQIA 1JJHA 3MI7X 3VWSA 3HHLB 3OT9A 1YKWA 1CJKA 1VQ4S 3IS9A 2R7SA 4F4KA 1L3KA 1XNQJ 3BGUA 1S6QB 5HLFB 5AE3A 4FN5A 3LUYA 2FVCA 4LF5F 3H5UA 2O01C 2HRUA 4X62F 3TAPA 3MD3A 4OZ5A 1HNZJ 1N34J 1S1UB 2Y1JA 4U9RA 1UKUA 4AYBD 4MKBA 1BHNA 3RB6A 5ETOA 5B0GA 2B9EA 4PXDA 1HBNA 1KRPA 3SEOA 3OTCA 4UTGA 3KMQA 2D1CA 1VQ5S 2BJ7A 4DG1B 1HYSA 4DHVA 3CE8A 5ETLA 3PW4A 1YJ9S 4E8UA 1FXDA 1ZM3A 1H98A 4Z7CA 1SJ1A 4RUHA 1RKIA 4FXVA 3CULA 1ZA2B 4CM0A 2LEPA 3KK3A 1XMOF 4J9UE 2ABYA 2ZITA 1ZAWA 2FD2A 1NUEA 2DO0A 2OP5A 1YBUA 4MT1A 3IGNA 3RYLA 1TL3A 1QM9A 3I5CA 2MQQA 1VRUB 1UWBB 1WHYA 2NREA 4CZCA 1UL3A 5E2QA 1C4AA 2YBVA 2APOA 1CJVA 1P6TA 1PYSB 1RT1B 4I7FB 4IO1A 5D0RA 2QZ8A 2MPUA 4K5SA 2XMMA 3MZIA 3AQOA 4I68A 4TLQA 4URGA 2EC2A 1ULRA 3Q89A 4IKAA 2VG6A 1Q0NA 4PPZA 5A0YA 4F2RA 4C8OA 2HNZB 1C1BA 1WTBA 4ED7A 4OLPA 4EU0A 1SH0A 2NYIA 1RAJA 1RAGB 2ZC3A 4WP8A 4EZ9A 2ATLA 3FBFA 4HLBA 5K5MA 1UVJA 2C28A 1GQEA 2E66A 2W9CA 4CH1A 2MQMA 2E9ZA 4ID5A 1AA1B 3MMCB 1UVMA 3DYAB 3MHYA 3P96A 5J2PA 2CPZA 2V9WA 2Y1LB 2MB0B 2AYBA 4USJC 2E1PA 3HT0A 3CTRA 5E3RA 1N0VC 2FHJD 4F8RA 2BABA 2KO1A 1IBKF 1H74A 1RHRB 1UFWA 3C8YA 2CJYB 1WSVA 4HVZA 2BEFA 4DSLA 3ILOA 2R2UA 3HHDA 2V69A 1IKWA 1FRLA 1VYAA 4LF9F 2DNMA 5J2MB 1M5OC 4Q2LA 1AZSA 3DLGA 1DTTA 1V5IB 1HNIB 1C4CA 1QD1A 1A7GE 1DARA 3DM2B 3PRDA 3EICA 1X4BA 3L3CA 2J9EA 3M7VA 1RK8A 2ZE2B 4ECQA 1AW0A 3O8WA 2UUBF 1Y4ZB 3QLHA 5ADZA 1ZYQA 4O3SA 4OI6A 2YPZA 3H7HB 2KG1A 2XM3A 4AQYF 2UVVA 2B4VA 1KVJA 1RE1B 2HQDA 1FNMA 4ED8A 4YY3J 1S12A 2J9DE 1FE0A 3DKDA 3FBCA 1HPZA 1HQEB 4F3QA 1U1NA 3UWTA 4LUBA 4JI4F 3M32A 3IBCB 3G8QA 1JLGA 2RHSB 4ZP9A 2JLFA 1NLKL 3SIPB 8ATCB 1JK9B 4DUZJ 2WCXA 4P73A 3NBPB 4KHPJ 5DLGA 2HBRB 3VAKA 1UETA 3I6PA 2DRBA 2XS2A 3DNCA 4LBHA 4ZVOB 1S79A 1PIEA 2QX0A 3K5NA 2J6SA 2XLKA 3DI6A 4LF4F 3J7A1 5IC6B 1C0UA 3IFEA 2WBRA 3ZZOA 4DL5A 1S1XA 3MECB 4FZVA 1HBUB 4AT1B 1SPBP 2N7YA 1ZETA 4HTJA 4H4OB 2Y0SD 4M5NA 5THWA 2WAQD 3FCWA 4QIVA 3HHLC 1KNZA 4HACA 3T1AA 1ZAVA 3TJ8A 3W64A 1T02A 4HL9A 4K8RA 5KG6A 1VQOS 1F5AA 2B4OA 1T8EA 2KVIA 4GKKF 4P7VA 1XC9A 4FVCA 2DKOB 3S7RA 2BJ8A 2F9DA 3BF4A 5B09A 2HGLA 2U1AA 2B7BB 3CMAS 4JI7F 1HMVB 2XMUA 1LWFA 4P74A 4N56A 4RBVA 2HKEA 2KL8A 2VQEF 1OJ4A 5A2QY 2VDHA 4P75A 4JOUA 4KQZA 3NMAA 2DH8A 4Y6IA 4B9MA 4QIGA 1CJUB 4QJVA 5AJ3F 3FCVA 1T05A 4OYXA 5KFSA 5EDWA 2WW4A 4NYZA 1RT6B 1X9SA 1S76D 2VB6A 3N6MA 1BWVA 1IBMF 2C42A 4ZVQB 1WG4A 2OSRA 1D0EA 4WU3A 5HANA 3UNGC 3FFIA 4GVLA 1PSDA 4LQ3A 3NOGA 3OJUA 2BQRA 5T7LB 2DGTA 1N4LA 3FKBA 3OFFA 4X4VA 4EMDA 1Y10A 1HI8A 2ROGA 2AJQA 5JJBA 4DPTA 1NDKA 2QLWA 4KY3A 1XNRJ 1U2RA 5HL7Q 4O3NA 2Z56B 3PVXA 3OTBA 4KGXB 4DR5F 2IRUA 4I0WA 3QO9A 5LSRA 5GAHI 4OV6A 1C2PA 4OZLA 3ULHA 3UO0A 3UW1A 5D77A 4NLTA 3TX8A 2VA3A 3L7OA 4LIRA 3OR2B 2XY7A 4MK9A 4A8SA 4NMLA 1VQLS 3SI8A 1IM4A 1EETA 1RABB 1SCJB 2RD5C 3TVZA 2K3IA 2P2CB 4FVMA 1SJRA 3LALA 1FWLA 3JSRA 4WXWA 3S6EA 5LMUF 1X4AA 2QFJA 2KM8B 2BM1A 3SFGA 3C6TB 3V6DA 3HSZA 2FY1A 2RF2B 4JI6J 3QNWB 2I38A 3MTKA 4AUKA 2IAJB 1CC7A 4NI2B 2CDQA 3SYZA 1FKPA 1MMNA 1U6BA 2CNOB 3FBEA 1RTJB 4PZVA 3NXZA 4HI2A 1MSWD 2LQ9A 2MZQA 1FO1A 4UOFA 2ASJA 3M2VB 5DQIA 1S9EB 4CQ1A 5IM0A 2G9OA 3TOQA 2PA8D 5I4MA 3TUJC 1D9DA 4NLUA 1A9NB 3UI3A 1NZAA 4J9QA 2W7PA 1SXLA 2HAFA 4ZPTR 3QJPA 3Q22A 2CIMA 2ASYA 2ZVIA 2HYIB 2JOQA 5KG3A 2XYPB 3NP5A 4Y2KA 2CJQA 3PTWA 3NAHA 1RP5A 4ED2A 2VASA 4F50A 1WORA 5ETTA 1B3TA 2FC9A 4USIA 3CJQA 4PCQA 1R8BA 3KJQB 3BREA 2YX7A 2RSQA 4RBTA 2CA9A 3L4BC 2UUTA 4K50A 4NA3A 5IZHA 3BKTA 5KT2A 3OL8A 3OJSA 4J37A 4MJKA 1WC4A 1D09B 2X1GA 3WC0A 1KR4A 5GADI 4DL2A 4PUOB 3W7BA 2MJNA 1Q4RA 1LEOA 2K3KA 4R8UB 2J7WA 3LWLA 3ITHB 1TKZA 2X7IA 4I2PB 1UW4A 2FHJA 2DK2A 4UZCA 2MTLA 3A12A 1ZA1B 3OPKA 4G1PA 3CF5Q 1S1TA 3ILLA 3EPIA 3QATA 3CDBA 4LF7J 1JLEB 2QA1A 3QT7A 5C24A 5HROA 1OS5A 2L9DA 5BYQA 4M8LA 1ZM4A 2DO4A 1FJ7A 1VCTA 1MW7A 4NLWA 3LP0B 2NUHA 1AT1B 1SI9A 1XMQF 1NCLA 5E41A 4NLRA 5E3QA 1JLFB 1CPZA 2JVOA 3DOLB 1HD0A 4UOCA 6AT1B 2WVEA 3KYLA 2DR8A 2KHCA 2KB2A 1U7LA 4M5LA 1D9AA 1SUQB 1ZM9A 1WI8A 3I0SB 1VBKA 2VKRA 4KH1B 3MM7A 5DM7Q 1FERA 1BUXA 1L3VA 2OKQA 5KTQA 2CXEA 3TUZC 5KT6A 2Q79A 5CYMA 3R9LA 3MM8B 3TJ9A 4HT7A 1C1CB 1VLOA 1JLBA 3KHRA 3QGIA 3K0JA 3OR1B 2PA3A 2J5AA 4G1IA 2F4VF 4J9LA 2PI5A 1FTCA 2HNDA 2YWGA 3G9CA 1X4HA 2HS3A 3HFZB 1RACB 3GSDA 3CD0A 4DFKA 2OPRB 2JEFA 2DR5A 2OH2A 4ZCIA 3BKUA 1JB0C 2BMBA 2ALZA 1IKYB 2ZOGA 3B54A 2MLZA 3MDFA 3MAAB 2UUWA 2AW0A 2PMWA 1T9WA 1OY9A 3FUYA 4ZCMA 4DR4F 4CH7A 2WSEC 2CQ1A 3T1YJ 3SZ2A 3R5BA 3M9MB 2M8DB 4JUZA 2OMOA 1WG1A 4I4BA 4PWWA 1TUWA 2LXIA 3JB9k 1CS4B 4CLZA 1VGYA 1WHWA 2NUUG 1RWKB 1H73A 1YRTA 3GPAA 1R43A 2Q6CA 2KFZA 4DUYJ 2ZOMA 4X4OA 4X4QA 2BANB 4ED1A 1SV5A 4ED6A 4IG0A 2PD1A 1FTRA 1X4CA 1JQGA 1S1WB 4GO5X 4ZOSA 4Y2IA 2KM8C 5IT4A 2UV8A 1XTZA 2B9YA 5EWEA 2I8EA 2V2ZA 4F7VA 3MEGA 5FJ4A 2KTQA 4KTQA 4CLTA 1TKDA 2OSQA 3V81B 1EX8A 3BR9A 3RTVA 4K4SA 2E44A 2A10A 5F3ZA 1DRZA 1IM6A 4C97A 4ECVA 2KU7A 4B3SF 3HSGA 3KLEB 2CADA 2UU9J 5AE2A 3CCLS 1YZ7A 1BQMB 3Q8SB 4CYUB 3O5TB 1IN0A 2JRSA 1RWXB 4K0KF 5IWAJ 1FWKA 2HRYA 3P5TL 1TL7B 1Y9OA 1LWCB 3CJ3A 5F8LA 1WWHA 1RT3B 2YX4A 4J9MA 4CTAB 3KHGA 5FLXU 2ALYB 2YKMA 3MM5A 2N82B 1KVKA 4EO8A 2RDJA 1IBLF 2LFVA 2Z4PA 2VFVA 3LQVA 2BBEA 4PWDA 4DSKA 1SC3B 4CNYA 3HD1A 5KFFA 1Y11A 3NGRA 3TP2A 3IM9A 4DFPA 2E5IA 2F8HA 4IQMA 4AXJA 1QTMA 2GA7A 1U1RA 4LRAA 3CJRA 2P9EA 2JH3A 1EQ0A 4YQWA 1MG7A 1UA0A 2HLTA 1SH2A 3IRXB 3U1NA 2XMVA 1PCAA 2RKIA 2LEAA 5MAOA 2XLIA 4K4UA 1N5YA 1MU2B 1TL4A 2KHDA 4NRUA 2QLJB 2MKKA 5F9LA 1ZAXA 2W7AA 1VLYA 4L3NA 1NB2A 3VQTA 1S1VA 2DEJA 4K4ZA 3PCOB 1RT2A 3H20A 3SCLE 4DR6F 1X5PA 4X65J 4RW6A 1NKEA 4KFBB 3B4MA 1KEKA 5B0DA 2DCLA 2W7OA 3IR7B 4ZKAA 1H72C 2U2FA 4P72A 3E2EA 2DD8S 3MM6A 2G2OA 1BQXA 4OHXA 2YKPA 3DRRA 2WVBA 2ZHOA 3DLKA 4O4RA 4I69A 4CI0B 4RWWA 1TR0A 3PHEA 2FTRA 3C2PA 3I9ZA 2QN6B 4LFCF 4ZLNA 1M5HA 1N36J 4ELTA 4NYPA 4WZMA 4C9DA 1VBYA 4F25A 3CC2S 2Q43A 4P2MA 4OZ1A 1UA1A 4X64F 3HM9A 4DFJA 5KT4A 3JQMA 2Q1LA 1OYEA 1JLQA 4ECWA 3CW2C 4DV3F 2ZBCA 4UT4A 5FDLB 2XC9A 4LBIA 2IJRA 1FRXA 4HH1A 3MMBA 1J5OB 3BPSP 2R7RA 4OYWA 2GO8A 3UR0A 2GJFA 3M2UB 2I2YA 1YZ6A 4DV6F 3NGSA 2F63A 8RUCA 1RYSA 4P7TA 4IH7A 2VBZA 1Z1ZA 4RJVA 4HH0A 5CABA 4C11B 2IRYA 3SSRA 2IM2A 3SFUA 4LF6J 1N0UA 2MQLA 3OV7A 5C42B 3UDCA 4CM2A 2HZVA 1LWEA 3BR8A 2VFSA 2GQQA 1GAOA 1TV6B 3MWBA 1S4EA 1HHSA 3D0IE 3MF5A 4OI4A 3QT8A 1RZMA 2R7UA 1NAQA 3M1VA 1JJ4A 3ET6A 2ZNYA 1YTYA 1ROFA 2KXFA 2C2RA 1VHIA 5BR8F 1V3ZA 4DFMA 4ZHRB 4UQTA 3QAEA 3ZZUA 1RA7A 3ILIA 2R7XA 4IDKA 1UVLA 2LLZA 5I3UB 3TZXA 1Z2ZA 1YWXA 3GIRA 3PW0A 2KH9A 1FK9A 1VK8A 1VQSA 3TAQA 4DQPA 3W62A 4A48A 3ZTPA 1HHQA 3ZZZA 4DSFA 3RR7A 3TQEA 4N76A 3DRYA 1U0HB 2IIHA 4LFBF
chains in the Genus database with same CATH topology
3M8RA 2VONA 1X0FA 4KV8B 1Q79A 3AB2B 5A6PA 5B0EA 5CYQB 4FF4A 1NRKA 4PG7A 4Y2AA 2ZUGA 1G1XA 2W9CB 2AP6A 1KONA 4IDKB 4OJGA 2PEHA 5D3GB 4J9SA 2D9OA 4KJIA 1IKXB 2JZ5A 4L6V3 2IJFA 3VR1A 5KFBA 4FF1A 2OFHX 2KRRA 2WW8A 2MHEA 3OL6A 4ELUA 2EBEA 4ID5B 5M2UA 2DHAA 4PQUA 4KT0C 1FK9B 3WC2A 4LFAF 5J2PB 1DTQB 2COLA 1DQ9A 1X9MA 3PR4A 2WK4A 1N5SA 4G3IA 1MWZA 1GTHA 5K14A 4EFAC 4NLOA 4JV5F 3WX4A 1HNXF 1ZH5A 1FKOA 4WFZA 1NU4A 2HFOA 5KG1A 2OAUA 4UW2A 5IQ6A 3OLAA 2IBOA 2RS8A 2DNGA 1FD2A 2XCAA 3CCZA 4RW8A 4WJBA 2KFNA 4O4GB 2IM1A 2RRBA 2JX2A 4B3RF 2V4JA 3K57A 5GAEU 2LA6A 1AROP 4ZP7A 1KC8T 2LU1A 2VFUA 2CJ9A 3KLIA 3MEDB 1ZZFA 1YJVA 4JI8F 3VTIA 1Y0HA 2IHR1 2KT2A 3PRBA 5KG0A 3I56S 2AYEA 4A4JA 3PDNA 4N47A 3VAIA 2YQ3A 3FEXB 2GGPB 2YNHA 3GIIA 3HXMA 3JTOA 4JV0A 4QIFA 1JLAA 2ADCA 3SCJE 1VC5A 5H9EJ 3F44A 3O44A 2CG4A 2C3OA 2AD9A 1Q7LB 2OTJS 2AF6A 1DZ5A 3D2WA 3DLGB 3DOKB 1GH8A 3J80Y 1YBAA 1WEXA 3G86A 3OXGA 1OQ6A 2JEJA 2BANA 2HHTA 4WKYA 2RH3A 3T1YF 2R8JA 4DV7F 2UUAF 4ECZA 3E8OA 4XO0A 3M2RA 4FYDA 2HWHA 4TLRA 2YWHA 4RLEA 4P6QA 1M5SA 4AFFA 2QSFA 1FKOB 2FC8A 4YB1P 3VAMA 3BDEA 4H4KC 1VBZA 3HJFA 5I42A 2BV3A 1S1WA 2MZTA 1RTIA 2AWZA 2R7TA 4A47A 3T1HF 1NB7A 4A8KA 4TN2A 5D8HB 1Y00A 1NK8A 2UZAA 3BO4A 4RW8B 5HMWA 4KGKA 5JVGQ 4ZVEA 2EK6A 4MYUA 3MURP 2V4JB 4R0EA 4CH0S 2HPUA 3TA1A 1RTHB 2O1PA 2ZKTA 1FXLA 2E1AA 3POTA 1KHWA 2M52A 3KLIB 5G4DA 2OTLS 2H9ZA 3F41A 3ZFVA 4KRWA 3MR5A 3BGRB 1Y3JA 1R31A 3THPA 2ZNZA 3LPYA 2LQBA 4C0HA 2YNHB 4DV2F 4BWMA 2XNQA 1K0VA 2MGZA 1SIZA 4U67Q 3M6UA 1YJNS 2A18A 1JLAB 5H9FJ 1F5BA 4RUCA 4EUVA 2W9BA 1G3OA 3N79A 4P2SA 3TR5A 3OFEA 4C3MA 2R7WA 1K73T 2KKHA 3DGPA 4NXMF 3M32B 1TFWA 5HMXA 3K5OA 2E9RX 4Q0BA 3KLEA 3S8SA 2M88A 5L8RC 4ES2A 2W24A 4B3TF 1B7FA 3OLBA 1SB6A 3M2RB 4C8NA 4HEA9 4NLVA 1BQMA 2ZHAA 1TFYA 2P5VA 3MMAB 2XWYA 2V4RA 2XY6A 4RUAA 3MPWA 1XWLA 4IFVA 1S7HA 2OPPA 3TARA 4QWBA 3RBEA 3P49B 2B56A 1RTIB 3PKYA 4LF8F 3Q0AA 3LWMA 3OQ2A 4NCBA 3PX6A 5FIIA 2IBKA 4I2QB 4QIWD 1PILA 1WG5A 4DR2F 4LMZA 1S99A 3N28A 2ZDOA 2DNRA 2QT7A 2XMKA 1Q81T 4ETZA 1R89A 1S6OA 5DM6Q 1SC6A 4C8LA 4BC7A 4WK3A 1VQKS 3NMRA 3JTPA 4MK8A 1RA6A 3CDWA 4FF2A 1LWCA 4IRDA 2LECA 1IJFB 2PC6A 1QE1A 4CTAA 2HIQA 3TNVA 1Q16B 1OIAA 3DI6B 2IM3A 2HQ3A 1AUDA 1C0UB 3D1HA 2XEXA 2YY3A 2HZCA 5SUHA 2EFNA 3Q8QB 4I6WA 2CQ2A 4OJHA 4Q0BB 1O51A 4WFAQ 1M0SA 4QWCA 4DQRA 1RISA 4NLSA 2G4BA 4OLOA 3H2VE 3QWPA 3GWCA 4IRKA 3DN9A 4NLQA 3UQSA 4L72B 1BC6A 4CCHA 1E6YA 4IH5A 3G6VA 1SJQA 1JIHA 3CCWA 4FF3A 2FGOA 4IFVB 3H98A 2OPPB 5K8MA 1NJIT 1FT8A 1YJWS 5IWAF 3W2VB 4EYHB 1E6VA 4OHWA 3SXLA 1DLOA 1MMDA 3PNIA 3HP6A 3K5MA 5EN1A 3RBDA 3FMBA 3H5XA 2VFRA 4QZVB 2ZH9A 1S6UA 4LVNP 4H4KA 2ADBA 1V9OA 1WHXA 2DNYA 2BVZA 2YKOA 3L95X 4BC9A 1O0PA 4HTIA 3UD3P 2W4PA 5KFZA 3EGWB 2HNYA 3B4DA 1R3NA 3KK1A 3K5PA 4TY8B 3LANA 1X4EA 1X5SA 3AA9A 2VODA 5B7WA 2Y1IA 2FVSA 4Y65A 2MZ1A 1QE1B 4HT5A 1ZBTA 1VFJA 4YB7A 3VALA 3HMJG 4IH6A 2K7JA 3MAHA 3UFCX 2H5EA 3IRXA 3M8QB 4NZ7A 5HMYA 2YKQA 3IWXA 4EBEA 2J9CA 3IWNC 4O3PA 2BQ3A 1APSA 4ED5A 1H38A 3W3SA 3NKYA 1TP7A 2CPJA 2JL9A 4DV5F 2GFFA 2V8DA 3K2YA 3OW2R 1VQ9S 3R27A 3OUYA 3MM9A 1MU2A 3PO4A 3QZ8A 4NXNF 4LSLA 4F67A 5HBMA 2RQCA 2ZH4A 3D5MA 5CA5A 1E6YB 5J2QA 3I0RA 2GIRA 3LP1A 4NRTA 4CO5A 4A46A 1BD6A 1L3TA 3FEZA 1XEZA 1SKRA 4ES3A 1FESA 3OSNA 1DLOB 1NK7A 2OFGX 4TNOA 1DFDA 4QYZJ 2XSFA 4DS5A 1IJEB 2EPIA 2DNHA 3HKZD 4DV4F 3TQ1A 4K2XA 3ENQA 4FXWA 4UUWA 4I64A 3K8VA 4ITSA 4XDDA 3CC4S 2CPIA 4MKYA 2CQDA 1KOOA 3KKFA 2L41A 1QY7A 3I55S 3MUMP 5KG2A 3N5BA 3IG1A 4N8OA 3SSQA 1R7IA 7FDRA 3BSCA 1HHTP 2PIIA 3CCJS 3CT9A 1FJCA 4M5DA 1F9FA 1NJYA 5GAHU 4FPRA 1YRUA 1KLMB 4ZPBA 2MXYA 3RW7A 7FD1A 2D3ZA 3KLFA 2GHVC 3P3DA 3N4WA 1U6FA 1SL0A 1S6QA 2B5JA 2E29A 3E01A 3E51A 1S9GB 2DNNA 1KQKA 3TRGA 2XZWA 5JXSA 2POKA 3GB0A 4QU7A 3M8PA 5BYRA 4M95A 3M6XA 3MM9B 4ZPVR 2CJAA 2F9JA 4LSLB 1JKHA 5KFVA 2JDJA 5KFNA 4DPOA 2QRRA 4RW7A 2MHNA 2N4DA 2AQ4A 5J2QB 2FJAB 1T3NA 2LXUA 3HVTB 2D3UA 1LQ9A 2DNQA 1S1UA 1RT5A 5F8MA 2RILA 4IOAQ 5F41A 1U4BA 1V3RA 3D0GE 3NS5A 4RWXA 2GQ2A 4IRCA 3JSMA 3NCQA 2EWHA 3DU5A 2FUG9 2WTFA 5LJ3Y 3HHLD 1QJHA 4F4ZA 3DLEA 1VIOA 2FHKA 2HQIA 1JJHA 2F40A 1Q8BA 1FF2A 1R8AA 3MI7X 3TAMB 3VWSA 4NWBA 3HHLB 4M63A 3NWGA 5KG5A 4FS2A 1XNQF 4C8MA 1VQ4S 1URRA 3PIPQ 3IG1B 3RAMA 2QEXS 1N5TA 3IS9A 4K59A 4LIWA 4DSJA 2R7SA 3WBZA 4M5DB 4F4KA 1U1QA 1V3SA 3CDEA 4NCAA 2PGCA 1L3KA 3HI9A 2E9TA 3IR6B 2DNKA 3V2UC 3BGUA 1S6QB 2E7XA 2B5JB 2RNEA 5AE3A 5HLFB 3E01B 4FN5A 2DHSA 5JVHQ 1UJ6A 2JLEA 3LUYA 3MMJA 4FBUA 3SQGA 2FVCA 5A8KA 4WYLA 4Y3CA 5ITHA 3HZEA 4LF5F 3M8PB 3H5UA 4IG3A 1HNZF 3BB5A 1C0TA 4DLGA 2MQOA 4B9TA 2O01C 2EG1A 2HRUA 4A8QA 4RU2A 2ILYA 2NZ4A 4X62F 4RW7B 1YIJS 1Q8IA 2N3LA 5KFTA 3TAPA 3OTDA 1M90T 3MD3A 4OZ5A