1M63A

Crystal structure of calcineurin-cyclophilin-cyclosporin shows common but distinct recognition of immunophilin-drug complexes
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
372
structure length
372
Chain Sequence
MSEPKAIDPKLSTTDRVVKAVPFPPSHRLTAKEVFDNDGKPRVDILKAHLMKEGRLEESVALRIITEGASILRQEKNLLDIDAPVTVCGDIHGQFFDLMKLFEVGGSPANTRYLFLGDYVDRGYFSIECVLYLWALKILYPKTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMDAFDCLPLAALMNQQFLCVHGGLSPEINTLDDIRKLDRFKEPPAYGPMCDILWSDPLEDFGNEKTQEHFTHNTVRGCSYFYSYPAVCEFLQHNNLLSILRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLNIC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Calcineurin-Cyclophilin-Cyclosporin Shows Common But Distinct Recognition of Immunophilin-Drug Complexes
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/isomerase/immunosuppressant
molecule keywords SERINE/THREONINE PROTEIN PHOSPHATASE 2B CATALYTIC SUBUNIT, A
total genus 104
structure length 372
sequence length 372
chains with identical sequence E
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2002-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 1m63A00
1KBPA 4F0ZA 2ZBMA 3EGGA 1HP1A 3IVEA 2P6BA 2IE3C 3C5WC 3THOB 4I5NC 4H2GA 4NZVA 1MF8A 4WWLA 2QJCA 4TUGA 2NPPC 4M0VA 4JA7A 1IT6A 4UT3A 4UWQA 3DW8C 3JYFA 2GJUA 4YKEA 2BDXA 5GTUA 4KBPA 1OIDA 1T71A 3V4YA 4Q7FA 2DFJA 2QFRA 1Z2WA 4DHLA 3DSDA 1W24A 1JK7A 4O24A 1XM7A 2BQ8X 5EQVA 4H2BA 4UT2A 1WARA 4UT3B 4V0WA 2JOGA 5J28A 3E7BA 3H64A 3FGAC 3HVQA 3RL4A 3C9FA 5INBA 3H60A 4TUIA 1HO5A 1V73A 4B2OA 3P71C 2WDDA 1UTEA 1HPUA 3H66A 4H2FA 3IB8A 2IE4C 3RQZA 2O8GA 2WDCA 4J6OA 4O43A 4H1SA 3GVEA 3ICFA 2HY1A 1M63A 2HYPA 4FBQA 4IYPC 3ZTVA 5IOHA 1AUIA 3LL8A 4FBWA 2NYMC 2NXFA 1S3NA 3E7AA 5HPEA 3H61A 4FCXA 5DNYA 4V0VA 3QFNA 3T1IA 4LACC 3AV0A 1S70A 4ZVZA 1OIEA 3CK2A 5JJTA 1S95A 4O4KA 3H63A 2YVTA 1WAO1 3KBPA 3QFOA 2BCDA 3K7VC 3EGHA 1NNWA 3IB7A 3RL5A 1S3LA 3QFKA 2A22A 4MOVA 2HYOA 3PSNA 1II7A 1S8EA 2Z72A 3ZU0A 4HD0A 4XPNA 1QHWA 2WDFA 2Q8UA 1QFCA 2IAEC 3H69A 4I5LC 4LTYA 4KKZA 1T70A 3H67A 4MOYA 3N5UA 5JPEA 4H2IA 2Z1AA 2O8AA 4FBKA 2XMOA 4IL1A 5B8IA 4DT2A 1OI8A 2CV9A 4ORCA 4ORAA 3K7WC 4MP0A 4H1YP 2QFPA 2USHA 4JA9A 3TGHA 4V0XA 1SU1A 4ORBA 4ZX2A 2NYLC 1UF3A 3H62B 3QFMA 2Z06A 3AUZA 3RL3A 3QG5C 5F3WA 1U32A 3IVDA 2AHDA 1G5BA 1Z2XA 4G9JA 3DSCA 3H68A 2WDEA 2R17A 1FJMA 4O5GA 1USHA 5JPFA 1S3MA 1TCOA 2KKNA 1XZWA 4OR9A 3PSOA 4LU9A 4DSYA 5C1VA 3THNA
chains in the Genus database with same CATH superfamily
1KBPA 2DXNA 2ZBMA 3EGGA 1HP1A 4F0ZA 3IVEA 2P6BA 2IE3C 3C5WC 3THOB 4I5NC 4H2GA 4NZVA 1MF8A 4WWLA 2QJCA 4TUGA 2NPPC 4M0VA 3E0JA 4JA7A 1IT6A 4UT3A 4UWQA 3DW8C 3JYFA 2GJUA 4YKEA 2BDXA 5GTUA 4KBPA 1OIDA 1T71A 3V4YA 4Q7FA 2DFJA 2QFRA 1Z2WA 4DHLA 3DSDA 1W24A 1JK7A 4O24A 1XM7A 2BQ8X 5EQVA 4H2BA 4UT2A 1WARA 4UT3B 4V0WA 2DXLA 2JOGA 5J28A 3E7BA 3H64A 3FGAC 3HVQA 3RL4A 3C9FA 5INBA 3H60A 4TUIA 1HO5A 1V73A 4B2OA 3P71C 2WDDA 1UTEA 1HPUA 3H66A 4H2FA 3IB8A 2IE4C 3RQZA 2O8GA 2WDCA 4J6OA 4O43A 4H1SA 3GVEA 3ICFA 2HY1A 1M63A 2HYPA 4FBQA 4IYPC 3ZTVA 5IOHA 1AUIA 3LL8A 4FBWA 2NYMC 2NXFA 1S3NA 3E7AA 5HPEA 3FLOA 3H61A 4FCXA 5DNYA 4V0VA 3QFNA 3T1IA 2ZOAA 3AV0A 4LACC 1S70A 4ZVZA 1OIEA 3CK2A 5JJTA 1S95A 4O4KA 3H63A 2YVTA 1WAO1 3KBPA 3QFOA 2BCDA 3K7VC 3EGHA 1NNWA 3IB7A 3RL5A 1S3LA 3QFKA 2A22A 4MOVA 2HYOA 3PSNA 1II7A 1S8EA 2Z72A 3D03A 3ZU0A 4HD0A 4XPNA 1QHWA 2WDFA 2YEQA 2Q8UA 1QFCA 2IAEC 3H69A 4I5LC 4LTYA 4KKZA 1T70A 3H67A 4MOYA 3N5UA 5JPEA 4H2IA 2Z1AA 2O8AA 4FBKA 2XMOA 4IL1A 5B8IA 4DT2A 1OI8A 2CV9A 4ORCA 4ORAA 3K7WC 4MP0A 4H1YP 2QFPA 2USHA 4JA9A 3TGHA 2ZO9B 4V0XA 1SU1A 4ORBA 4ZX2A 2NYLC 1UF3A 3H62B 3QFMA 2Z06A 3AUZA 3RL3A 3QG5C 5F3WA 1U32A 3IVDA 2AHDA 1G5BA 1Z2XA 4G9JA 3DSCA 3H68A 2WDEA 2R17A 1FJMA 4O5GA 1USHA 5JPFA 1S3MA 1TCOA 2KKNA 1XZWA 4OR9A 3PSOA 4LU9A 4DSYA 5C1VA 3THNA
chains in the Genus database with same CATH topology
1KBPA 2DXNA 2ZBMA 3EGGA 1HP1A 4F0ZA 3IVEA 2P6BA 2IE3C 3C5WC 3THOB 4I5NC 4H2GA 4NZVA 1MF8A 4WWLA 2QJCA 4TUGA 2NPPC 4M0VA 3E0JA 4JA7A 1IT6A 4UT3A 4UWQA 3DW8C 3JYFA 2GJUA 4YKEA 2BDXA 5GTUA 4KBPA 1OIDA 1T71A 3V4YA 4Q7FA 2DFJA 2QFRA 1Z2WA 4DHLA 3DSDA 1W24A 1JK7A 4O24A 1XM7A 2BQ8X 5EQVA 4H2BA 4UT2A 1WARA 4UT3B 4V0WA 2DXLA 2JOGA 5J28A 3E7BA 3H64A 3FGAC 3HVQA 3RL4A 3C9FA 5INBA 3H60A 4TUIA 1HO5A 1V73A 4B2OA 3P71C 2WDDA 1UTEA 1HPUA 3H66A 4H2FA 3IB8A 2IE4C 3RQZA 2O8GA 2WDCA 4J6OA 4O43A 4H1SA 3GVEA 3ICFA 2HY1A 1M63A 2HYPA 4FBQA 4IYPC 3ZTVA 5IOHA 1AUIA 3LL8A 4FBWA 2NYMC 2NXFA 1S3NA 3E7AA 5HPEA 3FLOA 3H61A 4FCXA 5DNYA 4V0VA 3QFNA 3T1IA 2ZOAA 3AV0A 4LACC 1S70A 4ZVZA 1OIEA 3CK2A 5JJTA 1S95A 4O4KA 3H63A 2YVTA 1WAO1 3KBPA 3QFOA 2BCDA 3K7VC 3EGHA 1NNWA 3IB7A 3RL5A 1S3LA 3QFKA 2A22A 4MOVA 2HYOA 3PSNA 1II7A 1S8EA 2Z72A 3D03A 3ZU0A 4HD0A 4XPNA 1QHWA 2WDFA 2YEQA 2Q8UA 1QFCA 2IAEC 3H69A 4I5LC 4LTYA 4KKZA 1T70A 3H67A 4MOYA 3N5UA 5JPEA 4H2IA 2Z1AA 2O8AA 4FBKA 2XMOA 4IL1A 5B8IA 4DT2A 1OI8A 2CV9A 4ORCA 4ORAA 3K7WC 4MP0A 4H1YP 2QFPA 2USHA 4JA9A 3TGHA 2ZO9B 4V0XA 1SU1A 4ORBA 4ZX2A 2NYLC 1UF3A 3H62B 3QFMA 2Z06A 3AUZA 3RL3A 3QG5C 5F3WA 1U32A 3IVDA 2AHDA 1G5BA 1Z2XA 4G9JA 3DSCA 3H68A 2WDEA 2R17A 1FJMA 4O5GA 1USHA 5JPFA 1S3MA 1TCOA 2KKNA 1XZWA 4OR9A 3PSOA 4LU9A 4DSYA 5C1VA 3THNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KBP A;  4F0Z A;  2ZBM A;  3EGG A;  1HP1 A;  3IVE A;  2P6B A;  2IE3 C;  3C5W C;  3THO B;  4I5N C;  4H2G A;  4NZV A;  1MF8 A;  4WWL A;  2QJC A;  4TUG A;  2NPP C;  4M0V A;  4JA7 A;  1IT6 A;  4UT3 A;  4UWQ A;  3DW8 C;  3JYF A;  2GJU A;  4YKE A;  2BDX A;  5GTU A;  4KBP A;  1OID A;  1T71 A;  3V4Y A;  4Q7F A;  2DFJ A;  2QFR A;  1Z2W A;  4DHL A;  3DSD A;  1W24 A;  1JK7 A;  4O24 A;  1XM7 A;  2BQ8 X;  5EQV A;  4H2B A;  4UT2 A;  1WAR A;  4UT3 B;  4V0W A;  2JOG A;  5J28 A;  3E7B A;  3H64 A;  3FGA C;  3HVQ A;  3RL4 A;  3C9F A;  5INB A;  3H60 A;  4TUI A;  1HO5 A;  1V73 A;  4B2O A;  3P71 C;  2WDD A;  1UTE A;  1HPU A;  3H66 A;  4H2F A;  3IB8 A;  2IE4 C;  3RQZ A;  2O8G A;  2WDC A;  4J6O A;  4O43 A;  4H1S A;  3GVE A;  3ICF A;  2HY1 A;  1M63 A;  2HYP A;  4FBQ A;  4IYP C;  3ZTV A;  5IOH A;  1AUI A;  3LL8 A;  4FBW A;  2NYM C;  2NXF A;  1S3N A;  3E7A A;  5HPE A;  3H61 A;  4FCX A;  5DNY A;  4V0V A;  3QFN A;  3T1I A;  4LAC C;  3AV0 A;  1S70 A;  4ZVZ A;  1OIE A;  3CK2 A;  5JJT A;  1S95 A;  4O4K A;  3H63 A;  2YVT A;  1WAO 1;  3KBP A;  3QFO A;  2BCD A;  3K7V C;  3EGH A;  1NNW A;  3IB7 A;  3RL5 A;  1S3L A;  3QFK A;  2A22 A;  4MOV A;  2HYO A;  3PSN A;  1II7 A;  1S8E A;  2Z72 A;  3ZU0 A;  4HD0 A;  4XPN A;  1QHW A;  2WDF A;  2Q8U A;  1QFC A;  2IAE C;  3H69 A;  4I5L C;  4LTY A;  4KKZ A;  1T70 A;  3H67 A;  4MOY A;  3N5U A;  5JPE A;  4H2I A;  2Z1A A;  2O8A A;  4FBK A;  2XMO A;  4IL1 A;  5B8I A;  4DT2 A;  1OI8 A;  2CV9 A;  4ORC A;  4ORA A;  3K7W C;  4MP0 A;  4H1Y P;  2QFP A;  2USH A;  4JA9 A;  3TGH A;  4V0X A;  1SU1 A;  4ORB A;  4ZX2 A;  2NYL C;  1UF3 A;  3H62 B;  3QFM A;  2Z06 A;  3AUZ A;  3RL3 A;  3QG5 C;  5F3W A;  1U32 A;  3IVD A;  2AHD A;  1G5B A;  1Z2X A;  4G9J A;  3DSC A;  3H68 A;  2WDE A;  2R17 A;  1FJM A;  4O5G A;  1USH A;  5JPF A;  1S3M A;  1TCO A;  2KKN A;  1XZW A;  4OR9 A;  3PSO A;  4LU9 A;  4DSY A;  5C1V A;  3THN A; 
#chains in the Genus database with same CATH topology
 1KBP A;  2DXN A;  2ZBM A;  3EGG A;  1HP1 A;  4F0Z A;  3IVE A;  2P6B A;  2IE3 C;  3C5W C;  3THO B;  4I5N C;  4H2G A;  4NZV A;  1MF8 A;  4WWL A;  2QJC A;  4TUG A;  2NPP C;  4M0V A;  3E0J A;  4JA7 A;  1IT6 A;  4UT3 A;  4UWQ A;  3DW8 C;  3JYF A;  2GJU A;  4YKE A;  2BDX A;  5GTU A;  4KBP A;  1OID A;  1T71 A;  3V4Y A;  4Q7F A;  2DFJ A;  2QFR A;  1Z2W A;  4DHL A;  3DSD A;  1W24 A;  1JK7 A;  4O24 A;  1XM7 A;  2BQ8 X;  5EQV A;  4H2B A;  4UT2 A;  1WAR A;  4UT3 B;  4V0W A;  2DXL A;  2JOG A;  5J28 A;  3E7B A;  3H64 A;  3FGA C;  3HVQ A;  3RL4 A;  3C9F A;  5INB A;  3H60 A;  4TUI A;  1HO5 A;  1V73 A;  4B2O A;  3P71 C;  2WDD A;  1UTE A;  1HPU A;  3H66 A;  4H2F A;  3IB8 A;  2IE4 C;  3RQZ A;  2O8G A;  2WDC A;  4J6O A;  4O43 A;  4H1S A;  3GVE A;  3ICF A;  2HY1 A;  1M63 A;  2HYP A;  4FBQ A;  4IYP C;  3ZTV A;  5IOH A;  1AUI A;  3LL8 A;  4FBW A;  2NYM C;  2NXF A;  1S3N A;  3E7A A;  5HPE A;  3FLO A;  3H61 A;  4FCX A;  5DNY A;  4V0V A;  3QFN A;  3T1I A;  2ZOA A;  3AV0 A;  4LAC C;  1S70 A;  4ZVZ A;  1OIE A;  3CK2 A;  5JJT A;  1S95 A;  4O4K A;  3H63 A;  2YVT A;  1WAO 1;  3KBP A;  3QFO A;  2BCD A;  3K7V C;  3EGH A;  1NNW A;  3IB7 A;  3RL5 A;  1S3L A;  3QFK A;  2A22 A;  4MOV A;  2HYO A;  3PSN A;  1II7 A;  1S8E A;  2Z72 A;  3D03 A;  3ZU0 A;  4HD0 A;  4XPN A;  1QHW A;  2WDF A;  2YEQ A;  2Q8U A;  1QFC A;  2IAE C;  3H69 A;  4I5L C;  4LTY A;  4KKZ A;  1T70 A;  3H67 A;  4MOY A;  3N5U A;  5JPE A;  4H2I A;  2Z1A A;  2O8A A;  4FBK A;  2XMO A;  4IL1 A;  5B8I A;  4DT2 A;  1OI8 A;  2CV9 A;  4ORC A;  4ORA A;  3K7W C;  4MP0 A;  4H1Y P;  2QFP A;  2USH A;  4JA9 A;  3TGH A;  2ZO9 B;  4V0X A;  1SU1 A;  4ORB A;  4ZX2 A;  2NYL C;  1UF3 A;  3H62 B;  3QFM A;  2Z06 A;  3AUZ A;  3RL3 A;  3QG5 C;  5F3W A;  1U32 A;  3IVD A;  2AHD A;  1G5B A;  1Z2X A;  4G9J A;  3DSC A;  3H68 A;  2WDE A;  2R17 A;  1FJM A;  4O5G A;  1USH A;  5JPF A;  1S3M A;  1TCO A;  2KKN A;  1XZW A;  4OR9 A;  3PSO A;  4LU9 A;  4DSY A;  5C1V A;  3THN A; 
#chains in the Genus database with same CATH homology
 1KBP A;  2DXN A;  2ZBM A;  3EGG A;  1HP1 A;  4F0Z A;  3IVE A;  2P6B A;  2IE3 C;  3C5W C;  3THO B;  4I5N C;  4H2G A;  4NZV A;  1MF8 A;  4WWL A;  2QJC A;  4TUG A;  2NPP C;  4M0V A;  3E0J A;  4JA7 A;  1IT6 A;  4UT3 A;  4UWQ A;  3DW8 C;  3JYF A;  2GJU A;  4YKE A;  2BDX A;  5GTU A;  4KBP A;  1OID A;  1T71 A;  3V4Y A;  4Q7F A;  2DFJ A;  2QFR A;  1Z2W A;  4DHL A;  3DSD A;  1W24 A;  1JK7 A;  4O24 A;  1XM7 A;  2BQ8 X;  5EQV A;  4H2B A;  4UT2 A;  1WAR A;  4UT3 B;  4V0W A;  2DXL A;  2JOG A;  5J28 A;  3E7B A;  3H64 A;  3FGA C;  3HVQ A;  3RL4 A;  3C9F A;  5INB A;  3H60 A;  4TUI A;  1HO5 A;  1V73 A;  4B2O A;  3P71 C;  2WDD A;  1UTE A;  1HPU A;  3H66 A;  4H2F A;  3IB8 A;  2IE4 C;  3RQZ A;  2O8G A;  2WDC A;  4J6O A;  4O43 A;  4H1S A;  3GVE A;  3ICF A;  2HY1 A;  1M63 A;  2HYP A;  4FBQ A;  4IYP C;  3ZTV A;  5IOH A;  1AUI A;  3LL8 A;  4FBW A;  2NYM C;  2NXF A;  1S3N A;  3E7A A;  5HPE A;  3FLO A;  3H61 A;  4FCX A;  5DNY A;  4V0V A;  3QFN A;  3T1I A;  2ZOA A;  3AV0 A;  4LAC C;  1S70 A;  4ZVZ A;  1OIE A;  3CK2 A;  5JJT A;  1S95 A;  4O4K A;  3H63 A;  2YVT A;  1WAO 1;  3KBP A;  3QFO A;  2BCD A;  3K7V C;  3EGH A;  1NNW A;  3IB7 A;  3RL5 A;  1S3L A;  3QFK A;  2A22 A;  4MOV A;  2HYO A;  3PSN A;  1II7 A;  1S8E A;  2Z72 A;  3D03 A;  3ZU0 A;  4HD0 A;  4XPN A;  1QHW A;  2WDF A;  2YEQ A;  2Q8U A;  1QFC A;  2IAE C;  3H69 A;  4I5L C;  4LTY A;  4KKZ A;  1T70 A;  3H67 A;  4MOY A;  3N5U A;  5JPE A;  4H2I A;  2Z1A A;  2O8A A;  4FBK A;  2XMO A;  4IL1 A;  5B8I A;  4DT2 A;  1OI8 A;  2CV9 A;  4ORC A;  4ORA A;  3K7W C;  4MP0 A;  4H1Y P;  2QFP A;  2USH A;  4JA9 A;  3TGH A;  2ZO9 B;  4V0X A;  1SU1 A;  4ORB A;  4ZX2 A;  2NYL C;  1UF3 A;  3H62 B;  3QFM A;  2Z06 A;  3AUZ A;  3RL3 A;  3QG5 C;  5F3W A;  1U32 A;  3IVD A;  2AHD A;  1G5B A;  1Z2X A;  4G9J A;  3DSC A;  3H68 A;  2WDE A;  2R17 A;  1FJM A;  4O5G A;  1USH A;  5JPF A;  1S3M A;  1TCO A;  2KKN A;  1XZW A;  4OR9 A;  3PSO A;  4LU9 A;  4DSY A;  5C1V A;  3THN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...