1M64A

Crystal structure of q363f mutant flavocytochrome c3
Total Genus 188
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
188
sequence length
568
structure length
568
Chain Sequence
b'ADNLAEFHVQNQECDSCHTPDGELSNDSLTYENTQCVSCHGTLAEVAETTKHEHYNAHASHFPGEVACTSCHSAHEKSMVYCDSCHSFDFNMPYAKKWLRDEPTIAELAKDKSERQAALASAPHDTVDVVVVGSGGAGFSAAISATDSGAKVILIEKEPVIGGNAKLAAGGMNAAWTDQQKAKKITDSPELMFEDTMKGGQNINDPALVKVLSSHSKDSVDWMTAMGADLTDVGMMGGASVNRAHRPTGGAGVGAHVVQVLYDNAVKRNIDLRMNTRGIEVLKDDKGTVKGILVKGMYKGYYWVKADAVILATGGFAKNNERVAKLDPSLKGFISTNQPGAVGDGLDVAENAGGALKDMQYIFAHPTLSVKGGVMVTEAVRGNGAILVNREGKRFVNEITTRDKASAAILAQTGKSAYLIFDDSVRKSLSKIDKYIGLGVAPTADSLVKLGKMEGIDGKALTETVARYNSLVSSGKDTDFERPNLPRALNEGNYYAIEVTPGVHHTMGGVMIDTKAEVMNAKKQVIPGLYGAGEVTGGVHGANRLGGNAISDIITFGRLAGEEAAKYS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords flavocytochrome c3
publication title Engineering water to act as an active site acid catalyst in a soluble fumarate reductase
pubmed doi rcsb
source organism Shewanella frigidimarina
molecule tags Oxidoreductase
total genus 188
structure length 568
sequence length 568
chains with identical sequence B
ec nomenclature ec 1.3.5.4: Fumarate reductase (quinol).
pdb deposition date 2002-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00890 FAD_binding_2 FAD binding domain
A PF14537 Cytochrom_c3_2 Cytochrome c3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1130.10 Mainly Alpha Orthogonal Bundle Flavocytochrome C3; Chain A, domain 2 Flavocytochrome C3; Chain A 1m64A02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1m64A03
3.90.700.10 Alpha Beta Alpha-Beta Complex Flavocytochrome C3; Chain A, domain 1 Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 1m64A01
2JAEA 1B8SA 2WP9A 4U8PA 1ONFA 1V59A 2EQ6A 4YSXA 3QSEA 3FO3A 3AEAA 4NTDA 2Y6QA 3ITJA 2UZZA 4U8MA 1GERA 5U25A 3UKAA 4B64A 1CBOA 3BI2A 3VR9A 1CF3A 1GSNA 3O0HA 4Z26A 1GRAA 1PXCA 2R9ZA 2XLPA 3FBSA 3QVPA 2PYXA 1NHSA 1FT5A 4X4JA 2GVCA 2XLRA 3ICRA 2GEWA 3AEEA 3IHGA 3SM8A 2XLSA 3CPIG 2YVFA 2WP5A 3NH3X 3LXDA 1GU6A 4YKGA 3UTHA 1COYA 3GYJA 2V5ZA 3F8PA 3ICTA 2RGOA 1GRFA 1Q1WA 2GR0A 3ZYXA 1GEUA 1P2EA 1NHPA 1ZOYA 2C3DA 1SP3A 2V61A 3FG2P 2TPRA 3AWIA 3K7TA 1N4UA 2BCGG 4K5SA 4NZHA 5U1OA 5JCKA 2QA1A 3M0OA 3KLJA 3UOVA 4EMWA 2EQ9A 2YR4A 5ER0A 2R0CA 2BK4A 4WCTA 4H4TA 3BI4A 3SQPA 2A87A 5JCLA 2R46A 4OPDA 3F29A 2WQYA 3QSMA 2X99A 4EIQA 3RKHA 1YQ4A 4Y4LA 4BJYA 2A89A 2C76A 3AD7B 5U63A 3V3OA 1EL5A 3S7WA 4EQRA 1QO8A 1TYTA 1H83A 2Q6UA 2IVDA 3FPZA 5IPYA 4B68A 1Y0PA 1UKVG 1H7XA 2WOWA 1GNDA 2RABA 4Z24A 2V6OA 4REKA 3UKQA 4H50A 1RYIA 2NPXA 1CJCA 2AQJA 2XLUA 3ICSA 2VZ2A 3KKJA 3AE4A 3CNJA 2OA1A 4TM0A 4YSZA 2E80A 2GR2A 5IQ1A 3ZDNA 4BJZA 3LJPA 1M6IA 1S3BA 5C3JA 3H8LA 2FJBA 4U2LA 4C5OA 2X3NA 3NYCA 5GRTA 1JOAA 4OCGA 2C67A 1E1MA 4H4RA 4OPGA 4M52A 3URHA 3GDNA 4J2WA 5FS8A 1HYUA 1M64A 4TLXA 1NHRA 3CGDA 1H86A 1YQZA 1GRHA 4RG3A 1MO9A 3I6DA 2V60A 5CQFA 1JNZA 3UKKA 2OLOA 1PBBA 2Q0KA 4U2TA 1GT8A 4H4UA 3NHOX 1NG4A 4FK1C 2WHDA 3K30A 1KNRA 3BNGA 3GMBA 5J7XA 2WDQA 5L46A 3RNMA 3VR8A 4Y4MA 3NRNA 3HZLA 5DBJA 4ZN0A 5JCIA 4L38A 1VG0A 1JU2A 2QCUA 3CTYA 1CJ3A 2C70A 2VVMA 1ELIA 2C64A 3AYIA 4OPLA 2YM1A 4A99A 4A5LA 2VR0A 2APGA 2C66A 1GRGA 3CNSA 3LADA 3LB8A 3UP4A 4BK2A 1Z6LA 4I58A 3WE0A 1M1PA 1PJ6A 3DK8A 1EBDA 4DSHA 3Q9TA 3BNUA 2BK3A 4B67A 1PDHA 3DMEA 3UKPA 3EPTA 3PS9A 3AEGA 4ZCDA 1VQWA 1NEKA 2GAHB 2JK6A 1CJ2A 3DGHA 2OLNA 1IUUA 3GSIA 3RP6A 1LTXR 1XANA 2XFUA 3CGBA 4OPCA 4CCQA 4XXGA 4A6NA 3OZ2A 1F6MA 3GYIA 4U8NA 1NAAA 3C4AA 3QJ4A 1K0JA 3AYLA 1ZMDA 3ALJA 2JKCA 2WU5A 1PBFA 1BVBA 1DNCA 2BS4A 3UCLA 2IVEA 2WPCA 4B69A 4OPTA 2FJAA 1JRXA 1N4WA 4GDPA 4KPRA 4J56A 4ECHA 2BABA 3AE8A 1P2HA 1DOEA 1XPQA 1DJQA 2LFCA 1VG9A 1FEBA 2V3BA 2E81A 1NENA 3AEDA 3GRTA 3P4QA 1KFYA 4TM1A 3DH9A 3V3NA 1OJCA 3RP7A 2B9WA 2GRTA 2XVHA 3CNTA 4H4YA 1CC6A 1TYPA 2GR3A 4APNA 4PAAA 3NG7X 4IVOB 3AD8B 2ACZA 2WDVA 5EBKA 4H4PA 3UTGA 3K7MX 1D7LA 3Q6JA 4B66A 1CC2A 2BC0A 3VRAA 3PO7A 1GTEA 3NYFA 5HY5A 1ZKQA 2BA9A 3DGZA 4Q5BA 2C7GA 2YG4A 3UOYA 4J31A 3UP5A 1BKWA 2YWLA 4U8KA 3LGQA 1BGJA 4EM3A 1D5TA 2YR6A 2X50A 4USQA 1IUWA 3NLCA 2GR1A 1FS7A 3AXBA 2AAQA 3AE6A 3REDA 2GMHA 2Q0LA 4LIIA 4AOXA 4GDEA 3ALLA 4ZCCA 4BV6A 3NK2X 1JEHA 1ZDLA 2WOVA 4Z43A 3CN8A 1PJ5A 3AE3A 4IVMB 1GETA 1IUTA 2H89A 1LPFA 3AE2A 1PXAA 2E1MA 2C73A 4L3XA 4UDPA 1F8SA 2VVLG 4B65A 1IUXA 1ZX9A 3ALMA 1FOHA 2YQUA 1L9CA 4JN9A 1GPEA 2BYBA 3IF9A 1F8WA 1YQ3A 1QDBA 4DNAA 4CNKA 1PN0A 5KWFA 2BXRA 2WEUA 1BZLA 1OJ9A 3SFDA 3LG1A 2GMJA 1SEZA 2EQ7A 4WX1A 1KSSA 4K8DA 3CIRA 3NKSA 5EOWA 4LA1A 3ATRA 1L9EA 2XVJA 3DJEA 3H4KA 4K7ZA 4YSHA 1N1PA 1N4VA 1YY5A 3GRSA 1E7PA 4CCRA 2H88A 5BVAA 1FS8A 4B63A 4L3YA 1FS9A 2B9YA 2JB1A 4WJYA 2VOUA 4TLZA 4X9MA 4K22A 3BHKA 3ABVA 4U8IA 2X8CA 3BI5A 4FDCB 2BS2A 2FJEA 4HB9A 2BC1A 1NPXA 1Y56A 4H4XA 5GSNA 4YSYA 4Z2TA 4Q17A 3IHMA 2GQWA 3AE7A 1M1QA 2C3CA 4NEVA 2XYOA 4DGKA 2WPEA 3KD9A 2BCPA 3GD4A 3AE9A 3S5WA 4YTPA 1PBEA 4J34A 4YT0A 4AP3A 5BULA 1XHCA 3G5RA 2R4JA 2WOIA 4C74A 4Q4UA 2YR5A 3SXQA 4D04A 1LV0A 4Q0TA 1H81A 4JNQA 2B7SA 1BWCA 2CFYA 4NTEA 4XWZA 2ZZBA 4EMIA 5FMHA 1ZK7A 1DOCA 1ZMCA 2GB0A 3IWAA 1BGNA 1S2YA 1D4CA 2GH5A 3NK1X 2JBVA 2QAEA 2VVLA 2DKIA 4Z2UA 2XLTA 3F8DA 2WESA 2VRLA 3AE1A 3L8KA 5HHFA 1TDEA 4NEWA 4J33A 2DKHA 4IV9A 4A7AA 4AP1A 1JNRA 1ZY8A 1K0IA 4JY3A 4OVIA 1B5QA 4Z2RA 2X8HA 1B37A 4MJWA 4Z25A 1KSUA 2GQFA 3VRDB 1GXFA 3DJDA 1D4DA 3BNJA 2YG7A 2C75A 3P4PA 5TR3A 4EIPA 1PBDA 1PBCA 1QJDA 4E0VA 1MOKA 4H4SA 4UP3A 2YG6A 2GV8A 3UKHA 4A65A 3BHFA 2AR8A 3G5QA 3UOZA 4EQXA 3RP8A 3QVRA 4BK1A 2YG3A 2CULA 2RGJA 1IUVA 4JY2A 2VQ7A 1FT6A 3P1WA 2BXSA 4DSGA 4GUVA 1TDKA 3ATQA 4EMJA 3GM6A 2V3AA 5IQ4A 1LVLA 2YLWA 2A8XA 1B4VA 2ZO5A 2WP6A 4A9WA 1JRZA 1S3EA 2OALA 3AECA 1PJ7A 1TDNA 2E5VA 4U8JA 3AYJA 3K7QX 3S61A 1ZP0A 3CPJG 3MMOA 1KNPA 3CGCA 2RF7A 3FIMB 3GDPA 1QLBA 4IA5A 3R9UA 3GD3A 3UKLA 2W0HA 1MXTA 2YM2A 4H4VA 3LZXA 4PABA 1TDOA 3NGCX 1IUSA 3AB1A 3DJGX 2PHHA 3P4RA 4FK1A 1REOA 1O5WA 1VRQB 2YLXA 2WETA 2ZBWA 4C3XA 4GCMA 3EF6A 2B7RA 3SGLA 3VQRA 3DK9A 1H84A 1K4QA 2XFQA 3KU9A 1O95A 4A6NB 3NTDA 5KXJA 1GRTA 4LU6A 4J57A 4U8OA 4CNJA 4H2QA 2Q7VA 1NHQA 3B3RA 2B9XA 4CBQA 4O5UA 4YKFA 2GF3A 2I0ZA 4CY6A 1DODA 3GWDA 2YLTA 4K5RA 4RG4A 4ADWA 4TM4A 2BK5A 2WBAA 3C4NA 1GALA 1LQTA 1L0VA 3TORA 5KOWA 2O9ZA 4B1BA 3NN6X 1D4EA 1H7WA 3GMCA 3CNDA 2HQMA 3OWMA 1F8RA 1TDFA 3NT6A 4TM3A 3QSSA 2B76A 4U2SA 4YWOA 1PXBA 3NYEA 4U8LA 4UDRA 3CGEA 4EQSA 4YXDA 4OPIA 4J36A 3E1TA 5JCNA 3FMWA 1RSGA 2NVKX 1DXLA 1E1NA 3NK0X 2C65A 5EB4A 2YLZA 2OT4A 4X9NA 1XDIA 1S2QA 1CJ4A 1GRBA 1KDGA 2WPFA 1CHUA 1EL7A 1GREA 1GV4A 3D8XA 3KVEA 3DA1A 2ZZCA 4H2PA 3H8IA 3II4A 2XFNA 4NTCA 4AT0A 1ZOVA 1M1RA 2QA2A 2E4GA 3L1TA 4H4WA 5EB5A 1H82A 3T37A 3BNMA 2XDOA 2YVJA 4BURA 1DJNA 3M12A 3D1CA 2IIDA 3VRBA 4C3YA 1Q1RA 2F5ZA 1VDCA 5JCMA 3DK4A 5C2TA 4CY8A 3UBRA 3BNHA 1OJAA 3AE5A 1L9DA 3B6DA 1OAHA 2GAGB 2X8GA 2K3VA 3BNFA 3SCEA 3RHAA 4GRTA 3UTEA 5BRTA 3QFBA 1PHHA 2VQBA 5HYMA 1TRBA 4UDQA 4K2XA 3UTFA 4Z44A 2TMDA 1E6EA 5HXIA 2Z5XA 4H2RA 3KA7A 4O5QA 1NDAA 5FS7A 1O94A 3TTBA 3F8RA 1W4XA 4ICYA 5KVIA 2YVGA 2WU2A 2YLSA 4H4ZA 3UOXA 1FEAA 2ZZ0A 4H7UA 3I3LA 2XFPA 3IC9A 2FJDA 2XVEA 1LJ1A 3KPFA 4HA6A 5LV9A 4Q1OA 4EQWA 5KVHA 3P4SA 4BK3A 2XCGA 5CKUA 2WDRA 1GESA 2CDUA 1YKJA 4YTNA 2ARDA 1OJTA 1Q9IA 2FBWA 2R45A 3EANA 3D1IA 2YG5A 2OAMA 4GR1A 1FL2A 1H6VA 2RDZA 2YLRA 3M13A 3NIXA 1Y56B 4H4QA 4I59A 1OJDA 2XVIA 3DJJA 2J7AA 4L3ZA 1NG3A 2JB3A 1K0LA 4USRA 1AOGA 4IA6A 4YTMA 2Y6RA 3L1RA 5KRQA 2EQ8A 3LOVA 3AD9B 1CC4A 3CNPA 1CL0A 3JSKA 1GTHA 2CVJA 2R0GA 3AEFA 3OC4A 2J3NA 5J60A 4N9XA 5M0ZA 3ADAB 4C77A 3C96A 1E39A 1LQUA 1X31B 3PVCA 4RSLA 1EL8A 3V76A 1PS9A 3NTAA 5M10A 2JB2A 2R0PA 4CRTA 4JNAA 2BACA 2YAUA 3EAOA 4JDRA 3CPHG 4AOSA 1EL9A 5FS6A 2XFOA 4AT2A 1JRYA 3AEBA 3SFEA 4D03A 3ISHA 3COXA 4EM4A 1KF6A 4FX9A 3NN0X 2Z5YA 2VRMA 4H2NA 2WS3A 2XVFA 4Q5CA 1E1KA 4XWRA 2BS3A 3GWFA 1FCDA 1E1LA 3LZWA 4Y4NA 3P9UA 1BF3A 5KOXA 1IJHA 4P9SA 5FS9A 1JNIA 3UKFA 1RP0A 1GOSA 2R4EA 3NNEA 2RGHA 3G5SA 4OPUA 2C72A 3QFAA 4JQ9A 4A79A 1DOBA 5BUKA 4KX6A 3UU9A 3GYXA 1FECA 1D7YA 1F3PA 4GF7A
chains in the Genus database with same CATH superfamily
2JAEA 1B8SA 2WP9A 4U8PA 1ONFA 1V59A 2EQ6A 4YSXA 3QSEA 3FO3A 3AEAA 4NTDA 2Y6QA 3ITJA 2UZZA 4U8MA 1GERA 5U25A 3UKAA 4B64A 1CBOA 2BRYA 3BI2A 3VR9A 1CF3A 1GSNA 3O0HA 4Z26A 1GRAA 1PXCA 2R9ZA 2XLPA 3FBSA 3QVPA 2PYXA 1NHSA 1FT5A 4X4JA 2GVCA 2XLRA 3ICRA 2GEWA 3AEEA 3IHGA 3SM8A 2XLSA 3CPIG 2YVFA 2WP5A 3NH3X 3LXDA 1GU6A 4YKGA 3UTHA 1COYA 3GYJA 2V5ZA 3F8PA 3ICTA 2RGOA 1GRFA 1Q1WA 2GR0A 3ZYXA 1GEUA 1P2EA 1NHPA 1ZOYA 2C3DA 1SP3A 2V61A 3FG2P 2TPRA 3AWIA 3K7TA 1N4UA 2BCGG 4K5SA 4NZHA 5U1OA 5JCKA 2QA1A 3M0OA 3KLJA 3UOVA 4EMWA 2EQ9A 2YR4A 5ER0A 2R0CA 2BK4A 4WCTA 4H4TA 3BI4A 3SQPA 2A87A 5JCLA 2R46A 4OPDA 3F29A 2WQYA 3QSMA 2X99A 4EIQA 4G73A 3RKHA 3SZ0A 1YQ4A 4Y4LA 4BJYA 2A89A 2C76A 3AD7B 5U63A 3V3OA 1EL5A 3S7WA 4EQRA 1QO8A 1TYTA 1H83A 2Q6UA 2IVDA 3FPZA 5IPYA 4B68A 1Y0PA 1UKVG 1H7XA 2WOWA 1GNDA 2RABA 4Z24A 2V6OA 4REKA 3UKQA 4H50A 1RYIA 2NPXA 1CJCA 2AQJA 2XLUA 3ICSA 2VZ2A 3KKJA 3AE4A 3CNJA 2OA1A 4TM0A 4YSZA 2E80A 2GR2A 5IQ1A 3ZDNA 4BJZA 3LJPA 1M6IA 3SXIA 1S3BA 5C3JA 3H8LA 2FJBA 4U2LA 4C5OA 2X3NA 3NYCA 5GRTA 1JOAA 4OCGA 2C67A 1E1MA 4H4RA 4OPGA 4M52A 3URHA 3GDNA 4GAVA 4J2WA 5FS8A 1HYUA 1M64A 4TLXA 1NHRA 3CGDA 1H86A 1YQZA 1GRHA 4RG3A 1MO9A 3I6DA 2V60A 5CQFA 1JNZA 3UKKA 2OLOA 1PBBA 2Q0KA 4U2TA 1GT8A 4H4UA 3NHOX 1NG4A 4FK1C 2WHDA 3K30A 1KNRA 3BNGA 3GMBA 5J7XA 2WDQA 5L46A 3RNMA 3VR8A 4Y4MA 3NRNA 3HZLA 5DBJA 4ZN0A 5JCIA 4L38A 1VG0A 1JU2A 2QCUA 3CTYA 1CJ3A 2C70A 2VVMA 1ELIA 2C64A 3AYIA 4OPLA 2YM1A 4A99A 4A5LA 2VR0A 2APGA 2C66A 1GRGA 3CNSA 3LADA 3LB8A 3UP4A 4BK2A 1Z6LA 4I58A 3WE0A 1M1PA 1PJ6A 3DK8A 1EBDA 4DSHA 4II3A 3Q9TA 3BNUA 2BK3A 4B67A 1PDHA 3DMEA 3UKPA 3EPTA 3PS9A 5KNLA 3AEGA 4ZCDA 1VQWA 1NEKA 2GAHB 2JK6A 1CJ2A 3DGHA 2OLNA 1IUUA 3GSIA 3RP6A 1LTXR 1XANA 2XFUA 3CGBA 4OPCA 4CCQA 4XXGA 4A6NA 3OZ2A 1F6MA 3GYIA 4U8NA 1NAAA 3C4AA 3QJ4A 1K0JA 3AYLA 1ZMDA 3ALJA 2JKCA 2WU5A 1PBFA 1BVBA 1DNCA 2BS4A 3UCLA 2IVEA 2WPCA 4B69A 3SZCA 3SZFA 4OPTA 2FJAA 1JRXA 1N4WA 4GDPA 4KPRA 4J56A 4ECHA 2BABA 3AE8A 1P2HA 1DOEA 1XPQA 1DJQA 2LFCA 1VG9A 1FEBA 2V3BA 2E81A 4G6HA 1NENA 3AEDA 3GRTA 3P4QA 1KFYA 3T2YA 4G74A 4TM1A 3DH9A 3V3NA 1OJCA 4G9KA 2B9WA 3RP7A 2GRTA 2XVHA 3CNTA 4H4YA 1CC6A 1TYPA 2GR3A 4APNA 5KMSA 4PAAA 3NG7X 4IVOB 3AD8B 2ACZA 2WDVA 5EBKA 4H4PA 3UTGA 3K7MX 1D7LA 3Q6JA 4B66A 1CC2A 3HYWA 2BC0A 3VRAA 3PO7A 1GTEA 3NYFA 5HY5A 1ZKQA 2BA9A 3DGZA 4Q5BA 2C7GA 2YG4A 3UOYA 4J31A 3UP5A 1BKWA 2YWLA 4U8KA 3LGQA 1BGJA 4EM3A 1D5TA 2YR6A 2X50A 4USQA 1IUWA 3NLCA 2GR1A 1FS7A 3AXBA 2AAQA 3AE6A 3REDA 2GMHA 2Q0LA 4LIIA 4AOXA 4GDEA 3ALLA 4ZCCA 4BV6A 3NK2X 1JEHA 1ZDLA 2WOVA 4Z43A 3CN8A 1PJ5A 3AE3A 4IVMB 1GETA 1IUTA 2H89A 1LPFA 3AE2A 1PXAA 2E1MA 2C73A 4L3XA 4UDPA 1F8SA 2VVLG 4B65A 1IUXA 1ZX9A 3ALMA 1FOHA 2YQUA 4G6GA 1L9CA 3KPKA 1GPEA 2BYBA 3IF9A 1F8WA 1YQ3A 1QDBA 4JN9A 4CNKA 4DNAA 1PN0A 3SZWA 5KWFA 2BXRA 2WEUA 1BZLA 1OJ9A 3SFDA 3LG1A 2GMJA 1SEZA 2EQ7A 4WX1A 1KSSA 4K8DA 3CIRA 3NKSA 5KMQA 5EOWA 4LA1A 3ATRA 3SY4A 1L9EA 2XVJA 3DJEA 3H4KA 4K7ZA 4YSHA 1N1PA 1N4VA 1YY5A 3GRSA 1E7PA 4CCRA 2H88A 5BVAA 1FS8A 4B63A 4L3YA 1FS9A 2B9YA 2JB1A 4WJYA 2VOUA 4TLZA 4X9MA 4GAPA 4K22A 3BHKA 3ABVA 4U8IA 2X8CA 3BI5A 4FDCB 2BS2A 2FJEA 4HB9A 2BC1A 1NPXA 1Y56A 4H4XA 5GSNA 4YSYA 4Z2TA 4Q17A 3IHMA 2GQWA 3AE7A 1M1QA 2C3CA 4NEVA 2XYOA 4DGKA 2WPEA 3KD9A 2BCPA 3GD4A 3AE9A 3S5WA 4YTPA 1PBEA 4J34A 4YT0A 4AP3A 5BULA 1XHCA 3G5RA 2R4JA 2WOIA 4C74A 4Q4UA 2YR5A 3SXQA 4D04A 1LV0A 4Q0TA 1H81A 4JNQA 2B7SA 1BWCA 2CFYA 4NTEA 4XWZA 2ZZBA 4EMIA 5FMHA 1ZK7A 1DOCA 1ZMCA 2GB0A 3IWAA 1BGNA 1S2YA 1D4CA 2GH5A 3NK1X 2JBVA 2QAEA 2VVLA 2DKIA 4Z2UA 4II2A 2XLTA 3F8DA 2WESA 3T2KA 2VRLA 3AE1A 3L8KA 5HHFA 1TDEA 4NEWA 4J33A 2DKHA 4IV9A 4A7AA 4AP1A 1JNRA 1ZY8A 1K0IA 4JY3A 4OVIA 1B5QA 4Z2RA 2X8HA 3CMMA 1B37A 4MJWA 4Z25A 1KSUA 2GQFA 3VRDB 1GXFA 3DJDA 1D4DA 3BNJA 2YG7A 2C75A 3P4PA 5TR3A 4EIPA 1PBDA 1PBCA 1QJDA 4E0VA 1MOKA 4H4SA 4UP3A 2YG6A 2GV8A 3UKHA 4A65A 3HYXA 3BHFA 2AR8A 3G5QA 3UOZA 4EQXA 3RP8A 3QVRA 4BK1A 2YG3A 2CULA 2RGJA 1IUVA 4JY2A 2VQ7A 1FT6A 3P1WA 2BXSA 4DSGA 4GUVA 1TDKA 3ATQA 4EMJA 3GM6A 2V3AA 5IQ4A 1LVLA 3SX6A 2YLWA 2A8XA 3T31A 1B4VA 2ZO5A 2WP6A 4A9WA 1JRZA 1S3EA 2OALA 3AECA 1PJ7A 1TDNA 2E5VA 4U8JA 3AYJA 3K7QX 3S61A 1ZP0A 3CPJG 3MMOA 1KNPA 3CGCA 2RF7A 3FIMB 3GDPA 1QLBA 4IA5A 3R9UA 3GD3A 3UKLA 2W0HA 1MXTA 2YM2A 4H4VA 3LZXA 2BRAA 4PABA 1TDOA 3NGCX 1IUSA 3AB1A 3DJGX 2PHHA 3P4RA 4FK1A 1REOA 1O5WA 1VRQB 2YLXA 2WETA 2ZBWA 4C3XA 4GCMA 3EF6A 2B7RA 3SGLA 3VQRA 3DK9A 1H84A 1K4QA 2XFQA 3KU9A 1O95A 4A6NB 3NTDA 3T0KA 5KXJA 1GRTA 4LU6A 4J57A 4U8OA 4CNJA 4H2QA 2Q7VA 1NHQA 3B3RA 2B9XA 4CBQA 4O5UA 4YKFA 2GF3A 2I0ZA 4CY6A 1DODA 3GWDA 2YLTA 4K5RA 4RG4A 4ADWA 4TM4A 2BK5A 2WBAA 3C4NA 1GALA 1LQTA 1L0VA 3TORA 5KOWA 2O9ZA 4B1BA 3NN6X 1D4EA 1H7WA 3GMCA 3CNDA 2HQMA 2CZSA 2C4CA 3OWMA 1F8RA 1TDFA 3NT6A 4TM3A 3QSSA 2B76A 4U2SA 4YWOA 1PXBA 3NYEA 4U8LA 4UDRA 3CGEA 4EQSA 4YXDA 4OPIA 4J36A 3E1TA 5JCNA 3FMWA 1RSGA 2NVKX 1DXLA 5KMRA 1E1NA 3NK0X 2C65A 5EB4A 2YLZA 2OT4A 4X9NA 1XDIA 1S2QA 1CJ4A 1GRBA 1KDGA 2WPFA 1CHUA 1EL7A 1GREA 1GV4A 3D8XA 3KVEA 3DA1A 2ZZCA 4H2PA 3H8IA 3II4A 2XFNA 4NTCA 4AT0A 1ZOVA 1M1RA 2QA2A 2E4GA 3L1TA 4H4WA 5EB5A 1H82A 3T37A 3BNMA 2XDOA 2YVJA 4BURA 1DJNA 3M12A 3D1CA 2IIDA 3VRBA 4C3YA 1Q1RA 2F5ZA 1VDCA 5JCMA 3DK4A 5C2TA 4CY8A 3UBRA 3BNHA 1OJAA 3AE5A 1L9DA 3B6DA 3T14A 1OAHA 2GAGB 2X8GA 2K3VA 3BNFA 3SCEA 3HYVA 3RHAA 4GRTA 3UTEA 5BRTA 3QFBA 1PHHA 2VQBA 5HYMA 1TRBA 4UDQA 5KMPA 4K2XA 3UTFA 4Z44A 2TMDA 1E6EA 5HXIA 2Z5XA 4H2RA 3KA7A 4O5QA 1NDAA 5FS7A 1O94A 3TTBA 3F8RA 1W4XA 4ICYA 5KVIA 2YVGA 2WU2A 2YLSA 4H4ZA 3UOXA 1FEAA 2ZZ0A 4H7UA 3I3LA 2XFPA 3IC9A 2FJDA 2XVEA 1LJ1A 3KPFA 4HA6A 5LV9A 4Q1OA 4EQWA 5KVHA 3P4SA 4BK3A 2XCGA 5CKUA 2WDRA 1GESA 2CDUA 1YKJA 4YTNA 2ARDA 1OJTA 1Q9IA 2FBWA 2R45A 3EANA 3D1IA 2YG5A 2OAMA 4GR1A 1FL2A 1H6VA 2RDZA 2YLRA 3M13A 3NIXA 1Y56B 4H4QA 4I59A 1OJDA 2XVIA 3DJJA 2J7AA 4L3ZA 1NG3A 2JB3A 1K0LA 4USRA 3SYIA 1AOGA 4IA6A 4YTMA 2Y6RA 3L1RA 5KRQA 2EQ8A 3LOVA 3AD9B 1CC4A 3CNPA 1CL0A 3JSKA 1GTHA 2CVJA 2R0GA 3AEFA 3OC4A 2J3NA 5J60A 4N9XA 5M0ZA 3ADAB 4C77A 3C96A 1E39A 1LQUA 1X31B 3PVCA 4NWZA 4RSLA 1EL8A 3V76A 1PS9A 3NTAA 5M10A 2JB2A 2R0PA 4CRTA 4JNAA 2BACA 2YAUA 3EAOA 4JDRA 3CPHG 4AOSA 1EL9A 5FS6A 2XFOA 4AT2A 1JRYA 3AEBA 3SFEA 4D03A 3ISHA 3COXA 4EM4A 1KF6A 4FX9A 3NN0X 2Z5YA 2VRMA 4H2NA 3T2ZA 2WS3A 2XVFA 4Q5CA 1E1KA 4XWRA 2BS3A 3GWFA 1FCDA 1E1LA 3LZWA 4NNJA 4Y4NA 3P9UA 1BF3A 5KOXA 1IJHA 4P9SA 5FS9A 1JNIA 3UKFA 1RP0A 1GOSA 2R4EA 3NNEA 2RGHA 3G5SA 4OPUA 2C72A 3QFAA 4JQ9A 4A79A 1DOBA 5BUKA 4KX6A 3UU9A 3GYXA 1FECA 1D7YA 1F3PA 4GF7A
chains in the Genus database with same CATH topology
2JAEA 1B8SA 2WP9A 4U8PA 1ONFA 1V59A 2EQ6A 4YSXA 3QSEA 3FO3A 3AEAA 4NTDA 2Y6QA 3ITJA 2UZZA 4U8MA 1GERA 5U25A 3UKAA 4B64A 1CBOA 2BRYA 3BI2A 3VR9A 1CF3A 1GSNA 3O0HA 4Z26A 1GRAA 1PXCA 2R9ZA 2XLPA 3FBSA 3QVPA 2PYXA 1NHSA 1FT5A 4X4JA 2GVCA 2XLRA 3ICRA 2GEWA 3AEEA 3IHGA 3SM8A 2XLSA 3CPIG 2YVFA 2WP5A 3NH3X 3LXDA 1GU6A 4YKGA 3UTHA 1COYA 3GYJA 2V5ZA 3F8PA 3ICTA 2RGOA 1GRFA 1Q1WA 2GR0A 3ZYXA 1GEUA 1P2EA 1NHPA 1ZOYA 2C3DA 1SP3A 2V61A 3FG2P 2TPRA 3AWIA 3K7TA 1N4UA 2BCGG 4K5SA 4NZHA 5U1OA 5JCKA 2QA1A 3M0OA 3KLJA 3UOVA 4EMWA 2EQ9A 2YR4A 5ER0A 2R0CA 2BK4A 4WCTA 4H4TA 3BI4A 3SQPA 2A87A 5JCLA 2R46A 4OPDA 3F29A 2WQYA 3QSMA 2X99A 4EIQA 4G73A 3RKHA 3SZ0A 1YQ4A 4Y4LA 4BJYA 2A89A 2C76A 3AD7B 5U63A 3V3OA 1EL5A 3S7WA 4EQRA 1QO8A 1TYTA 1H83A 2Q6UA 2IVDA 3FPZA 5IPYA 4B68A 1Y0PA 1UKVG 1H7XA 2WOWA 1GNDA 2RABA 4Z24A 2V6OA 4REKA 3UKQA 4H50A 1RYIA 2NPXA 1CJCA 2AQJA 2XLUA 3ICSA 2VZ2A 3KKJA 3AE4A 3CNJA 2OA1A 4TM0A 4YSZA 2E80A 2GR2A 5IQ1A 3ZDNA 4BJZA 3LJPA 1M6IA 3SXIA 1S3BA 5C3JA 3H8LA 2FJBA 4U2LA 4C5OA 2X3NA 3NYCA 5GRTA 1JOAA 4OCGA 2C67A 1E1MA 4H4RA 4OPGA 4M52A 3URHA 3GDNA 4GAVA 4J2WA 5FS8A 1HYUA 1M64A 4TLXA 1NHRA 3CGDA 1H86A 1YQZA 1GRHA 4RG3A 1MO9A 3I6DA 2V60A 5CQFA 1JNZA 3UKKA 2OLOA 1PBBA 2Q0KA 4U2TA 1GT8A 4H4UA 3NHOX 1NG4A 4FK1C 2WHDA 3K30A 1KNRA 3BNGA 3GMBA 5J7XA 2WDQA 5L46A 3RNMA 3VR8A 4Y4MA 3NRNA 3HZLA 5DBJA 4ZN0A 5JCIA 4L38A 1VG0A 1JU2A 2QCUA 3CTYA 1CJ3A 2C70A 2VVMA 1ELIA 2C64A 3AYIA 4OPLA 2YM1A 4A99A 4A5LA 2VR0A 2APGA 2C66A 1GRGA 3CNSA 3LADA 3LB8A 3UP4A 4BK2A 1Z6LA 4I58A 3WE0A 1M1PA 1PJ6A 3DK8A 1EBDA 4DSHA 4II3A 3Q9TA 3BNUA 2BK3A 4B67A 1PDHA 3DMEA 3UKPA 3EPTA 3PS9A 5KNLA 3AEGA 4ZCDA 1VQWA 1NEKA 2GAHB 2JK6A 1CJ2A 3DGHA 2OLNA 1IUUA 3GSIA 3RP6A 1LTXR 1XANA 2XFUA 3CGBA 4OPCA 4CCQA 4XXGA 4A6NA 3OZ2A 1F6MA 3GYIA 4U8NA 1NAAA 3C4AA 3QJ4A 1K0JA 3AYLA 1ZMDA 3ALJA 2JKCA 2WU5A 1PBFA 1BVBA 1DNCA 2BS4A 3UCLA 2IVEA 2WPCA 4B69A 3SZCA 3SZFA 4OPTA 2FJAA 1JRXA 1N4WA 4GDPA 4KPRA 4J56A 4ECHA 2BABA 3AE8A 1P2HA 1DOEA 1XPQA 1DJQA 2LFCA 1VG9A 1FEBA 2V3BA 2E81A 4G6HA 1NENA 3AEDA 3GRTA 3P4QA 1KFYA 3T2YA 4G74A 4TM1A 3DH9A 3V3NA 1OJCA 4G9KA 2B9WA 3RP7A 2GRTA 2XVHA 3CNTA 4H4YA 1CC6A 1TYPA 2GR3A 4APNA 5KMSA 4PAAA 3NG7X 4IVOB 3AD8B 2ACZA 2WDVA 5EBKA 4H4PA 3UTGA 3K7MX 1D7LA 3Q6JA 4B66A 1CC2A 3HYWA 2BC0A 3VRAA 3PO7A 1GTEA 3NYFA 5HY5A 1ZKQA 2BA9A 3DGZA 4Q5BA 2C7GA 2YG4A 3UOYA 4J31A 3UP5A 1BKWA 2YWLA 4U8KA 3LGQA 1BGJA 4EM3A 1D5TA 2YR6A 2X50A 4USQA 1IUWA 3NLCA 2GR1A 1FS7A 3AXBA 2AAQA 3AE6A 3REDA 2GMHA 2Q0LA 4LIIA 4AOXA 4GDEA 3ALLA 4ZCCA 4BV6A 3NK2X 1JEHA 1ZDLA 2WOVA 4Z43A 3CN8A 1PJ5A 3AE3A 4IVMB 1GETA 1IUTA 2H89A 1LPFA 3AE2A 1PXAA 2E1MA 2C73A 4L3XA 4UDPA 1F8SA 2VVLG 4B65A 1IUXA 1ZX9A 3ALMA 1FOHA 2YQUA 4G6GA 1L9CA 3KPKA 1GPEA 2BYBA 3IF9A 1F8WA 1YQ3A 1QDBA 4JN9A 4CNKA 4DNAA 1PN0A 3SZWA 5KWFA 2BXRA 2WEUA 1BZLA 1OJ9A 3SFDA 3LG1A 2GMJA 1SEZA 2EQ7A 4WX1A 1KSSA 4K8DA 3CIRA 3NKSA 5KMQA 5EOWA 4LA1A 3ATRA 3SY4A 1L9EA 2XVJA 3DJEA 3H4KA 4K7ZA 4YSHA 1N1PA 1N4VA 1YY5A 3GRSA 1E7PA 4CCRA 2H88A 5BVAA 1FS8A 4B63A 4L3YA 1FS9A 2B9YA 2JB1A 4WJYA 2VOUA 4TLZA 4X9MA 4GAPA 4K22A 3BHKA 3ABVA 4U8IA 2X8CA 3BI5A 4FDCB 2BS2A 2FJEA 4HB9A 2BC1A 1NPXA 1Y56A 4H4XA 5GSNA 4YSYA 4Z2TA 4Q17A 3IHMA 2GQWA 3AE7A 1M1QA 2C3CA 4NEVA 2XYOA 4DGKA 2WPEA 3KD9A 2BCPA 3GD4A 3AE9A 3S5WA 4YTPA 1PBEA 4J34A 4YT0A 4AP3A 5BULA 1XHCA 3G5RA 2R4JA 2WOIA 4C74A 4Q4UA 2YR5A 3SXQA 4D04A 1LV0A 4Q0TA 1H81A 4JNQA 2B7SA 1BWCA 2CFYA 4NTEA 4XWZA 2ZZBA 4EMIA 5FMHA 1ZK7A 1DOCA 1ZMCA 2GB0A 3IWAA 1BGNA 1S2YA 1D4CA 2GH5A 3NK1X 2JBVA 2QAEA 2VVLA 2DKIA 4Z2UA 4II2A 2XLTA 3F8DA 2WESA 3T2KA 2VRLA 3AE1A 3L8KA 5HHFA 1TDEA 4NEWA 4J33A 2DKHA 4IV9A 4A7AA 4AP1A 1JNRA 1ZY8A 1K0IA 4JY3A 4OVIA 1B5QA 4Z2RA 2X8HA 3CMMA 1B37A 4MJWA 4Z25A 1KSUA 2GQFA 3VRDB 1GXFA 3DJDA 1D4DA 3BNJA 2YG7A 2C75A 3P4PA 5TR3A 4EIPA 1PBDA 1PBCA 1QJDA 4E0VA 1MOKA 4H4SA 4UP3A 2YG6A 2GV8A 3UKHA 4A65A 3HYXA 3BHFA 2AR8A 3G5QA 3UOZA 4EQXA 3RP8A 3QVRA 4BK1A 2YG3A 2CULA 2RGJA 1IUVA 4JY2A 2VQ7A 1FT6A 3P1WA 2BXSA 4DSGA 4GUVA 1TDKA 3ATQA 4EMJA 3GM6A 2V3AA 5IQ4A 1LVLA 3SX6A 2YLWA 2A8XA 3T31A 1B4VA 2ZO5A 2WP6A 4A9WA 1JRZA 1S3EA 2OALA 3AECA 1PJ7A 1TDNA 2E5VA 4U8JA 3AYJA 3K7QX 3S61A 1ZP0A 3CPJG 3MMOA 1KNPA 3CGCA 2RF7A 3FIMB 3GDPA 1QLBA 4IA5A 3R9UA 3GD3A 3UKLA 2W0HA 1MXTA 2YM2A 4H4VA 3LZXA 2BRAA 4PABA 1TDOA 3NGCX 1IUSA 3AB1A 3DJGX 2PHHA 3P4RA 4FK1A 1REOA 1O5WA 1VRQB 2YLXA 2WETA 2ZBWA 4C3XA 4GCMA 3EF6A 2B7RA 3SGLA 3VQRA 3DK9A 1H84A 1K4QA 2XFQA 3KU9A 1O95A 4A6NB 3NTDA 3T0KA 5KXJA 1GRTA 4LU6A 4J57A 4U8OA 4CNJA 4H2QA 2Q7VA 1NHQA 3B3RA 2B9XA 4CBQA 4O5UA 4YKFA 2GF3A 2I0ZA 4CY6A 1DODA 3GWDA 2YLTA 4K5RA 4RG4A 4ADWA 4TM4A 2BK5A 2WBAA 3C4NA 1GALA 1LQTA 1L0VA 3TORA 5KOWA 2O9ZA 4B1BA 3NN6X 1D4EA 1H7WA 3GMCA 3CNDA 2HQMA 2C4CA 3OWMA 1F8RA 1TDFA 3NT6A 4TM3A 3QSSA 2B76A 4U2SA 4YWOA 1PXBA 3NYEA 4U8LA 4UDRA 3CGEA 4EQSA 4YXDA 4OPIA 4J36A 3E1TA 5JCNA 3FMWA 1RSGA 2NVKX 1DXLA 5KMRA 1E1NA 3NK0X 2C65A 5EB4A 2YLZA 2OT4A 4X9NA 1XDIA 1S2QA 1CJ4A 1GRBA 1KDGA 2WPFA 1CHUA 1EL7A 1GREA 1GV4A 3D8XA 3KVEA 3DA1A 2ZZCA 4H2PA 3H8IA 3II4A 2XFNA 4NTCA 4AT0A 1ZOVA 1M1RA 2QA2A 2E4GA 3L1TA 4H4WA 5EB5A 1H82A 3T37A 3BNMA 2XDOA 2YVJA 4BURA 1DJNA 3M12A 3D1CA 2IIDA 3VRBA 4C3YA 1Q1RA 2F5ZA 1VDCA 5JCMA 3DK4A 5C2TA 4CY8A 3UBRA 3BNHA 1OJAA 3AE5A 1L9DA 3B6DA 3T14A 1OAHA 2GAGB 2X8GA 2K3VA 3BNFA 3SCEA 3HYVA 3RHAA 4GRTA 3UTEA 5BRTA 3QFBA 1PHHA 2VQBA 5HYMA 1TRBA 4UDQA 5KMPA 4K2XA 3UTFA 4Z44A 2TMDA 1E6EA 5HXIA 2Z5XA 4H2RA 3KA7A 4O5QA 1NDAA 5FS7A 1O94A 3TTBA 3F8RA 1W4XA 4ICYA 5KVIA 2YVGA 2WU2A 2YLSA 4H4ZA 3UOXA 1FEAA 2ZZ0A 4H7UA 3I3LA 2XFPA 3IC9A 2FJDA 2XVEA 1LJ1A 3KPFA 4HA6A 5LV9A 4Q1OA 4EQWA 5KVHA 3P4SA 4BK3A 2XCGA 5CKUA 2WDRA 1GESA 2CDUA 1YKJA 4YTNA 2ARDA 1OJTA 1Q9IA 2FBWA 2R45A 3EANA 3D1IA 2YG5A 2OAMA 4GR1A 1FL2A 1H6VA 2RDZA 2YLRA 3M13A 3NIXA 1Y56B 4H4QA 4I59A 1OJDA 2XVIA 3DJJA 2J7AA 4L3ZA 1NG3A 2JB3A 1K0LA 4USRA 3SYIA 1AOGA 4IA6A 4YTMA 2Y6RA 3L1RA 5KRQA 2EQ8A 3LOVA 3AD9B 1CC4A 3CNPA 1CL0A 3JSKA 1GTHA 2CVJA 2R0GA 3AEFA 3OC4A 2J3NA 5J60A 4N9XA 5M0ZA 3ADAB 4C77A 3C96A 1E39A 1LQUA 1X31B 3PVCA 4NWZA 4RSLA 1EL8A 3V76A 1PS9A 3NTAA 5M10A 2JB2A 2R0PA 4CRTA 4JNAA 2BACA 2YAUA 3EAOA 4JDRA 3CPHG 4AOSA 1EL9A 5FS6A 2XFOA 4AT2A 1JRYA 3AEBA 3SFEA 4D03A 3ISHA 3COXA 4EM4A 1KF6A 4FX9A 3NN0X 2Z5YA 2VRMA 4H2NA 3T2ZA 2WS3A 2XVFA 4Q5CA 1E1KA 4XWRA 2BS3A 3GWFA 1FCDA 1E1LA 3LZWA 4NNJA 4Y4NA 3P9UA 1BF3A 5KOXA 1IJHA 4P9SA 5FS9A 1JNIA 3UKFA 1RP0A 1GOSA 2R4EA 3NNEA 2RGHA 3G5SA 4OPUA 2C72A 3QFAA 4JQ9A 4A79A 1DOBA 5BUKA 4KX6A 3UU9A 3GYXA 1FECA 1D7YA 1F3PA 4GF7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JAE A;  1B8S A;  2WP9 A;  4U8P A;  1ONF A;  1V59 A;  2EQ6 A;  4YSX A;  3QSE A;  3FO3 A;  3AEA A;  4NTD A;  2Y6Q A;  3ITJ A;  2UZZ A;  4U8M A;  1GER A;  5U25 A;  3UKA A;  4B64 A;  1CBO A;  3BI2 A;  3VR9 A;  1CF3 A;  1GSN A;  3O0H A;  4Z26 A;  1GRA A;  1PXC A;  2R9Z A;  2XLP A;  3FBS A;  3QVP A;  2PYX A;  1NHS A;  1FT5 A;  4X4J A;  2GVC A;  2XLR A;  3ICR A;  2GEW A;  3AEE A;  3IHG A;  3SM8 A;  2XLS A;  3CPI G;  2YVF A;  2WP5 A;  3NH3 X;  3LXD A;  1GU6 A;  4YKG A;  3UTH A;  1COY A;  3GYJ A;  2V5Z A;  3F8P A;  3ICT A;  2RGO A;  1GRF A;  1Q1W A;  2GR0 A;  3ZYX A;  1GEU A;  1P2E A;  1NHP A;  1ZOY A;  2C3D A;  1SP3 A;  2V61 A;  3FG2 P;  2TPR A;  3AWI A;  3K7T A;  1N4U A;  2BCG G;  4K5S A;  4NZH A;  5U1O A;  5JCK A;  2QA1 A;  3M0O A;  3KLJ A;  3UOV A;  4EMW A;  2EQ9 A;  2YR4 A;  5ER0 A;  2R0C A;  2BK4 A;  4WCT A;  4H4T A;  3BI4 A;  3SQP A;  2A87 A;  5JCL A;  2R46 A;  4OPD A;  3F29 A;  2WQY A;  3QSM A;  2X99 A;  4EIQ A;  3RKH A;  1YQ4 A;  4Y4L A;  4BJY A;  2A89 A;  2C76 A;  3AD7 B;  5U63 A;  3V3O A;  1EL5 A;  3S7W A;  4EQR A;  1QO8 A;  1TYT A;  1H83 A;  2Q6U A;  2IVD A;  3FPZ A;  5IPY A;  4B68 A;  1Y0P A;  1UKV G;  1H7X A;  2WOW A;  1GND A;  2RAB A;  4Z24 A;  2V6O A;  4REK A;  3UKQ A;  4H50 A;  1RYI A;  2NPX A;  1CJC A;  2AQJ A;  2XLU A;  3ICS A;  2VZ2 A;  3KKJ A;  3AE4 A;  3CNJ A;  2OA1 A;  4TM0 A;  4YSZ A;  2E80 A;  2GR2 A;  5IQ1 A;  3ZDN A;  4BJZ A;  3LJP A;  1M6I A;  1S3B A;  5C3J A;  3H8L A;  2FJB A;  4U2L A;  4C5O A;  2X3N A;  3NYC A;  5GRT A;  1JOA A;  4OCG A;  2C67 A;  1E1M A;  4H4R A;  4OPG A;  4M52 A;  3URH A;  3GDN A;  4J2W A;  5FS8 A;  1HYU A;  1M64 A;  4TLX A;  1NHR A;  3CGD A;  1H86 A;  1YQZ A;  1GRH A;  4RG3 A;  1MO9 A;  3I6D A;  2V60 A;  5CQF A;  1JNZ A;  3UKK A;  2OLO A;  1PBB A;  2Q0K A;  4U2T A;  1GT8 A;  4H4U A;  3NHO X;  1NG4 A;  4FK1 C;  2WHD A;  3K30 A;  1KNR A;  3BNG A;  3GMB A;  5J7X A;  2WDQ A;  5L46 A;  3RNM A;  3VR8 A;  4Y4M A;  3NRN A;  3HZL A;  5DBJ A;  4ZN0 A;  5JCI A;  4L38 A;  1VG0 A;  1JU2 A;  2QCU A;  3CTY A;  1CJ3 A;  2C70 A;  2VVM A;  1ELI A;  2C64 A;  3AYI A;  4OPL A;  2YM1 A;  4A99 A;  4A5L A;  2VR0 A;  2APG A;  2C66 A;  1GRG A;  3CNS A;  3LAD A;  3LB8 A;  3UP4 A;  4BK2 A;  1Z6L A;  4I58 A;  3WE0 A;  1M1P A;  1PJ6 A;  3DK8 A;  1EBD A;  4DSH A;  3Q9T A;  3BNU A;  2BK3 A;  4B67 A;  1PDH A;  3DME A;  3UKP A;  3EPT A;  3PS9 A;  3AEG A;  4ZCD A;  1VQW A;  1NEK A;  2GAH B;  2JK6 A;  1CJ2 A;  3DGH A;  2OLN A;  1IUU A;  3GSI A;  3RP6 A;  1LTX R;  1XAN A;  2XFU A;  3CGB A;  4OPC A;  4CCQ A;  4XXG A;  4A6N A;  3OZ2 A;  1F6M A;  3GYI A;  4U8N A;  1NAA A;  3C4A A;  3QJ4 A;  1K0J A;  3AYL A;  1ZMD A;  3ALJ A;  2JKC A;  2WU5 A;  1PBF A;  1BVB A;  1DNC A;  2BS4 A;  3UCL A;  2IVE A;  2WPC A;  4B69 A;  4OPT A;  2FJA A;  1JRX A;  1N4W A;  4GDP A;  4KPR A;  4J56 A;  4ECH A;  2BAB A;  3AE8 A;  1P2H A;  1DOE A;  1XPQ A;  1DJQ A;  2LFC A;  1VG9 A;  1FEB A;  2V3B A;  2E81 A;  1NEN A;  3AED A;  3GRT A;  3P4Q A;  1KFY A;  4TM1 A;  3DH9 A;  3V3N A;  1OJC A;  3RP7 A;  2B9W A;  2GRT A;  2XVH A;  3CNT A;  4H4Y A;  1CC6 A;  1TYP A;  2GR3 A;  4APN A;  4PAA A;  3NG7 X;  4IVO B;  3AD8 B;  2ACZ A;  2WDV A;  5EBK A;  4H4P A;  3UTG A;  3K7M X;  1D7L A;  3Q6J A;  4B66 A;  1CC2 A;  2BC0 A;  3VRA A;  3PO7 A;  1GTE A;  3NYF A;  5HY5 A;  1ZKQ A;  2BA9 A;  3DGZ A;  4Q5B A;  2C7G A;  2YG4 A;  3UOY A;  4J31 A;  3UP5 A;  1BKW A;  2YWL A;  4U8K A;  3LGQ A;  1BGJ A;  4EM3 A;  1D5T A;  2YR6 A;  2X50 A;  4USQ A;  1IUW A;  3NLC A;  2GR1 A;  1FS7 A;  3AXB A;  2AAQ A;  3AE6 A;  3RED A;  2GMH A;  2Q0L A;  4LII A;  4AOX A;  4GDE A;  3ALL A;  4ZCC A;  4BV6 A;  3NK2 X;  1JEH A;  1ZDL A;  2WOV A;  4Z43 A;  3CN8 A;  1PJ5 A;  3AE3 A;  4IVM B;  1GET A;  1IUT A;  2H89 A;  1LPF A;  3AE2 A;  1PXA A;  2E1M A;  2C73 A;  4L3X A;  4UDP A;  1F8S A;  2VVL G;  4B65 A;  1IUX A;  1ZX9 A;  3ALM A;  1FOH A;  2YQU A;  1L9C A;  4JN9 A;  1GPE A;  2BYB A;  3IF9 A;  1F8W A;  1YQ3 A;  1QDB A;  4DNA A;  4CNK A;  1PN0 A;  5KWF A;  2BXR A;  2WEU A;  1BZL A;  1OJ9 A;  3SFD A;  3LG1 A;  2GMJ A;  1SEZ A;  2EQ7 A;  4WX1 A;  1KSS A;  4K8D A;  3CIR A;  3NKS A;  5EOW A;  4LA1 A;  3ATR A;  1L9E A;  2XVJ A;  3DJE A;  3H4K A;  4K7Z A;  4YSH A;  1N1P A;  1N4V A;  1YY5 A;  3GRS A;  1E7P A;  4CCR A;  2H88 A;  5BVA A;  1FS8 A;  4B63 A;  4L3Y A;  1FS9 A;  2B9Y A;  2JB1 A;  4WJY A;  2VOU A;  4TLZ A;  4X9M A;  4K22 A;  3BHK A;  3ABV A;  4U8I A;  2X8C A;  3BI5 A;  4FDC B;  2BS2 A;  2FJE A;  4HB9 A;  2BC1 A;  1NPX A;  1Y56 A;  4H4X A;  5GSN A;  4YSY A;  4Z2T A;  4Q17 A;  3IHM A;  2GQW A;  3AE7 A;  1M1Q A;  2C3C A;  4NEV A;  2XYO A;  4DGK A;  2WPE A;  3KD9 A;  2BCP A;  3GD4 A;  3AE9 A;  3S5W A;  4YTP A;  1PBE A;  4J34 A;  4YT0 A;  4AP3 A;  5BUL A;  1XHC A;  3G5R A;  2R4J A;  2WOI A;  4C74 A;  4Q4U A;  2YR5 A;  3SXQ A;  4D04 A;  1LV0 A;  4Q0T A;  1H81 A;  4JNQ A;  2B7S A;  1BWC A;  2CFY A;  4NTE A;  4XWZ A;  2ZZB A;  4EMI A;  5FMH A;  1ZK7 A;  1DOC A;  1ZMC A;  2GB0 A;  3IWA A;  1BGN A;  1S2Y A;  1D4C A;  2GH5 A;  3NK1 X;  2JBV A;  2QAE A;  2VVL A;  2DKI A;  4Z2U A;  2XLT A;  3F8D A;  2WES A;  2VRL A;  3AE1 A;  3L8K A;  5HHF A;  1TDE A;  4NEW A;  4J33 A;  2DKH A;  4IV9 A;  4A7A A;  4AP1 A;  1JNR A;  1ZY8 A;  1K0I A;  4JY3 A;  4OVI A;  1B5Q A;  4Z2R A;  2X8H A;  1B37 A;  4MJW A;  4Z25 A;  1KSU A;  2GQF A;  3VRD B;  1GXF A;  3DJD A;  1D4D A;  3BNJ A;  2YG7 A;  2C75 A;  3P4P A;  5TR3 A;  4EIP A;  1PBD A;  1PBC A;  1QJD A;  4E0V A;  1MOK A;  4H4S A;  4UP3 A;  2YG6 A;  2GV8 A;  3UKH A;  4A65 A;  3BHF A;  2AR8 A;  3G5Q A;  3UOZ A;  4EQX A;  3RP8 A;  3QVR A;  4BK1 A;  2YG3 A;  2CUL A;  2RGJ A;  1IUV A;  4JY2 A;  2VQ7 A;  1FT6 A;  3P1W A;  2BXS A;  4DSG A;  4GUV A;  1TDK A;  3ATQ A;  4EMJ A;  3GM6 A;  2V3A A;  5IQ4 A;  1LVL A;  2YLW A;  2A8X A;  1B4V A;  2ZO5 A;  2WP6 A;  4A9W A;  1JRZ A;  1S3E A;  2OAL A;  3AEC A;  1PJ7 A;  1TDN A;  2E5V A;  4U8J A;  3AYJ A;  3K7Q X;  3S61 A;  1ZP0 A;  3CPJ G;  3MMO A;  1KNP A;  3CGC A;  2RF7 A;  3FIM B;  3GDP A;  1QLB A;  4IA5 A;  3R9U A;  3GD3 A;  3UKL A;  2W0H A;  1MXT A;  2YM2 A;  4H4V A;  3LZX A;  4PAB A;  1TDO A;  3NGC X;  1IUS A;  3AB1 A;  3DJG X;  2PHH A;  3P4R A;  4FK1 A;  1REO A;  1O5W A;  1VRQ B;  2YLX A;  2WET A;  2ZBW A;  4C3X A;  4GCM A;  3EF6 A;  2B7R A;  3SGL A;  3VQR A;  3DK9 A;  1H84 A;  1K4Q A;  2XFQ A;  3KU9 A;  1O95 A;  4A6N B;  3NTD A;  5KXJ A;  1GRT A;  4LU6 A;  4J57 A;  4U8O A;  4CNJ A;  4H2Q A;  2Q7V A;  1NHQ A;  3B3R A;  2B9X A;  4CBQ A;  4O5U A;  4YKF A;  2GF3 A;  2I0Z A;  4CY6 A;  1DOD A;  3GWD A;  2YLT A;  4K5R A;  4RG4 A;  4ADW A;  4TM4 A;  2BK5 A;  2WBA A;  3C4N A;  1GAL A;  1LQT A;  1L0V A;  3TOR A;  5KOW A;  2O9Z A;  4B1B A;  3NN6 X;  1D4E A;  1H7W A;  3GMC A;  3CND A;  2HQM A;  3OWM A;  1F8R A;  1TDF A;  3NT6 A;  4TM3 A;  3QSS A;  2B76 A;  4U2S A;  4YWO A;  1PXB A;  3NYE A;  4U8L A;  4UDR A;  3CGE A;  4EQS A;  4YXD A;  4OPI A;  4J36 A;  3E1T A;  5JCN A;  3FMW A;  1RSG A;  2NVK X;  1DXL A;  1E1N A;  3NK0 X;  2C65 A;  5EB4 A;  2YLZ A;  2OT4 A;  4X9N A;  1XDI A;  1S2Q A;  1CJ4 A;  1GRB A;  1KDG A;  2WPF A;  1CHU A;  1EL7 A;  1GRE A;  1GV4 A;  3D8X A;  3KVE A;  3DA1 A;  2ZZC A;  4H2P A;  3H8I A;  3II4 A;  2XFN A;  4NTC A;  4AT0 A;  1ZOV A;  1M1R A;  2QA2 A;  2E4G A;  3L1T A;  4H4W A;  5EB5 A;  1H82 A;  3T37 A;  3BNM A;  2XDO A;  2YVJ A;  4BUR A;  1DJN A;  3M12 A;  3D1C A;  2IID A;  3VRB A;  4C3Y A;  1Q1R A;  2F5Z A;  1VDC A;  5JCM A;  3DK4 A;  5C2T A;  4CY8 A;  3UBR A;  3BNH A;  1OJA A;  3AE5 A;  1L9D A;  3B6D A;  1OAH A;  2GAG B;  2X8G A;  2K3V A;  3BNF A;  3SCE A;  3RHA A;  4GRT A;  3UTE A;  5BRT A;  3QFB A;  1PHH A;  2VQB A;  5HYM A;  1TRB A;  4UDQ A;  4K2X A;  3UTF A;  4Z44 A;  2TMD A;  1E6E A;  5HXI A;  2Z5X A;  4H2R A;  3KA7 A;  4O5Q A;  1NDA A;  5FS7 A;  1O94 A;  3TTB A;  3F8R A;  1W4X A;  4ICY A;  5KVI A;  2YVG A;  2WU2 A;  2YLS A;  4H4Z A;  3UOX A;  1FEA A;  2ZZ0 A;  4H7U A;  3I3L A;  2XFP A;  3IC9 A;  2FJD A;  2XVE A;  1LJ1 A;  3KPF A;  4HA6 A;  5LV9 A;  4Q1O A;  4EQW A;  5KVH A;  3P4S A;  4BK3 A;  2XCG A;  5CKU A;  2WDR A;  1GES A;  2CDU A;  1YKJ A;  4YTN A;  2ARD A;  1OJT A;  1Q9I A;  2FBW A;  2R45 A;  3EAN A;  3D1I A;  2YG5 A;  2OAM A;  4GR1 A;  1FL2 A;  1H6V A;  2RDZ A;  2YLR A;  3M13 A;  3NIX A;  1Y56 B;  4H4Q A;  4I59 A;  1OJD A;  2XVI A;  3DJJ A;  2J7A A;  4L3Z A;  1NG3 A;  2JB3 A;  1K0L A;  4USR A;  1AOG A;  4IA6 A;  4YTM A;  2Y6R A;  3L1R A;  5KRQ A;  2EQ8 A;  3LOV A;  3AD9 B;  1CC4 A;  3CNP A;  1CL0 A;  3JSK A;  1GTH A;  2CVJ A;  2R0G A;  3AEF A;  3OC4 A;  2J3N A;  5J60 A;  4N9X A;  5M0Z A;  3ADA B;  4C77 A;  3C96 A;  1E39 A;  1LQU A;  1X31 B;  3PVC A;  4RSL A;  1EL8 A;  3V76 A;  1PS9 A;  3NTA A;  5M10 A;  2JB2 A;  2R0P A;  4CRT A;  4JNA A;  2BAC A;  2YAU A;  3EAO A;  4JDR A;  3CPH G;  4AOS A;  1EL9 A;  5FS6 A;  2XFO A;  4AT2 A;  1JRY A;  3AEB A;  3SFE A;  4D03 A;  3ISH A;  3COX A;  4EM4 A;  1KF6 A;  4FX9 A;  3NN0 X;  2Z5Y A;  2VRM A;  4H2N A;  2WS3 A;  2XVF A;  4Q5C A;  1E1K A;  4XWR A;  2BS3 A;  3GWF A;  1FCD A;  1E1L A;  3LZW A;  4Y4N A;  3P9U A;  1BF3 A;  5KOX A;  1IJH A;  4P9S A;  5FS9 A;  1JNI A;  3UKF A;  1RP0 A;  1GOS A;  2R4E A;  3NNE A;  2RGH A;  3G5S A;  4OPU A;  2C72 A;  3QFA A;  4JQ9 A;  4A79 A;  1DOB A;  5BUK A;  4KX6 A;  3UU9 A;  3GYX A;  1FEC A;  1D7Y A;  1F3P A;  4GF7 A; 
#chains in the Genus database with same CATH topology
 2JAE A;  1B8S A;  2WP9 A;  4U8P A;  1ONF A;  1V59 A;  2EQ6 A;  4YSX A;  3QSE A;  3FO3 A;  3AEA A;  4NTD A;  2Y6Q A;  3ITJ A;  2UZZ A;  4U8M A;  1GER A;  5U25 A;  3UKA A;  4B64 A;  1CBO A;  2BRY A;  3BI2 A;  3VR9 A;  1CF3 A;  1GSN A;  3O0H A;  4Z26 A;  1GRA A;  1PXC A;  2R9Z A;  2XLP A;  3FBS A;  3QVP A;  2PYX A;  1NHS A;  1FT5 A;  4X4J A;  2GVC A;  2XLR A;  3ICR A;  2GEW A;  3AEE A;  3IHG A;  3SM8 A;  2XLS A;  3CPI G;  2YVF A;  2WP5 A;  3NH3 X;  3LXD A;  1GU6 A;  4YKG A;  3UTH A;  1COY A;  3GYJ A;  2V5Z A;  3F8P A;  3ICT A;  2RGO A;  1GRF A;  1Q1W A;  2GR0 A;  3ZYX A;  1GEU A;  1P2E A;  1NHP A;  1ZOY A;  2C3D A;  1SP3 A;  2V61 A;  3FG2 P;  2TPR A;  3AWI A;  3K7T A;  1N4U A;  2BCG G;  4K5S A;  4NZH A;  5U1O A;  5JCK A;  2QA1 A;  3M0O A;  3KLJ A;  3UOV A;  4EMW A;  2EQ9 A;  2YR4 A;  5ER0 A;  2R0C A;  2BK4 A;  4WCT A;  4H4T A;  3BI4 A;  3SQP A;  2A87 A;  5JCL A;  2R46 A;  4OPD A;  3F29 A;  2WQY A;  3QSM A;  2X99 A;  4EIQ A;  4G73 A;  3RKH A;  3SZ0 A;  1YQ4 A;  4Y4L A;  4BJY A;  2A89 A;  2C76 A;  3AD7 B;  5U63 A;  3V3O A;  1EL5 A;  3S7W A;  4EQR A;  1QO8 A;  1TYT A;  1H83 A;  2Q6U A;  2IVD A;  3FPZ A;  5IPY A;  4B68 A;  1Y0P A;  1UKV G;  1H7X A;  2WOW A;  1GND A;  2RAB A;  4Z24 A;  2V6O A;  4REK A;  3UKQ A;  4H50 A;  1RYI A;  2NPX A;  1CJC A;  2AQJ A;  2XLU A;  3ICS A;  2VZ2 A;  3KKJ A;  3AE4 A;  3CNJ A;  2OA1 A;  4TM0 A;  4YSZ A;  2E80 A;  2GR2 A;  5IQ1 A;  3ZDN A;  4BJZ A;  3LJP A;  1M6I A;  3SXI A;  1S3B A;  5C3J A;  3H8L A;  2FJB A;  4U2L A;  4C5O A;  2X3N A;  3NYC A;  5GRT A;  1JOA A;  4OCG A;  2C67 A;  1E1M A;  4H4R A;  4OPG A;  4M52 A;  3URH A;  3GDN A;  4GAV A;  4J2W A;  5FS8 A;  1HYU A;  1M64 A;  4TLX A;  1NHR A;  3CGD A;  1H86 A;  1YQZ A;  1GRH A;  4RG3 A;  1MO9 A;  3I6D A;  2V60 A;  5CQF A;  1JNZ A;  3UKK A;  2OLO A;  1PBB A;  2Q0K A;  4U2T A;  1GT8 A;  4H4U A;  3NHO X;  1NG4 A;  4FK1 C;  2WHD A;  3K30 A;  1KNR A;  3BNG A;  3GMB A;  5J7X A;  2WDQ A;  5L46 A;  3RNM A;  3VR8 A;  4Y4M A;  3NRN A;  3HZL A;  5DBJ A;  4ZN0 A;  5JCI A;  4L38 A;  1VG0 A;  1JU2 A;  2QCU A;  3CTY A;  1CJ3 A;  2C70 A;  2VVM A;  1ELI A;  2C64 A;  3AYI A;  4OPL A;  2YM1 A;  4A99 A;  4A5L A;  2VR0 A;  2APG A;  2C66 A;  1GRG A;  3CNS A;  3LAD A;  3LB8 A;  3UP4 A;  4BK2 A;  1Z6L A;  4I58 A;  3WE0 A;  1M1P A;  1PJ6 A;  3DK8 A;  1EBD A;  4DSH A;  4II3 A;  3Q9T A;  3BNU A;  2BK3 A;  4B67 A;  1PDH A;  3DME A;  3UKP A;  3EPT A;  3PS9 A;  5KNL A;  3AEG A;  4ZCD A;  1VQW A;  1NEK A;  2GAH B;  2JK6 A;  1CJ2 A;  3DGH A;  2OLN A;  1IUU A;  3GSI A;  3RP6 A;  1LTX R;  1XAN A;  2XFU A;  3CGB A;  4OPC A;  4CCQ A;  4XXG A;  4A6N A;  3OZ2 A;  1F6M A;  3GYI A;  4U8N A;  1NAA A;  3C4A A;  3QJ4 A;  1K0J A;  3AYL A;  1ZMD A;  3ALJ A;  2JKC A;  2WU5 A;  1PBF A;  1BVB A;  1DNC A;  2BS4 A;  3UCL A;  2IVE A;  2WPC A;  4B69 A;  3SZC A;  3SZF A;  4OPT A;  2FJA A;  1JRX A;  1N4W A;  4GDP A;  4KPR A;  4J56 A;  4ECH A;  2BAB A;  3AE8 A;  1P2H A;  1DOE A;  1XPQ A;  1DJQ A;  2LFC A;  1VG9 A;  1FEB A;  2V3B A;  2E81 A;  4G6H A;  1NEN A;  3AED A;  3GRT A;  3P4Q A;  1KFY A;  3T2Y A;  4G74 A;  4TM1 A;  3DH9 A;  3V3N A;  1OJC A;  4G9K A;  2B9W A;  3RP7 A;  2GRT A;  2XVH A;  3CNT A;  4H4Y A;  1CC6 A;  1TYP A;  2GR3 A;  4APN A;  5KMS A;  4PAA A;  3NG7 X;  4IVO B;  3AD8 B;  2ACZ A;  2WDV A;  5EBK A;  4H4P A;  3UTG A;  3K7M X;  1D7L A;  3Q6J A;  4B66 A;  1CC2 A;  3HYW A;  2BC0 A;  3VRA A;  3PO7 A;  1GTE A;  3NYF A;  5HY5 A;  1ZKQ A;  2BA9 A;  3DGZ A;  4Q5B A;  2C7G A;  2YG4 A;  3UOY A;  4J31 A;  3UP5 A;  1BKW A;  2YWL A;  4U8K A;  3LGQ A;  1BGJ A;  4EM3 A;  1D5T A;  2YR6 A;  2X50 A;  4USQ A;  1IUW A;  3NLC A;  2GR1 A;  1FS7 A;  3AXB A;  2AAQ A;  3AE6 A;  3RED A;  2GMH A;  2Q0L A;  4LII A;  4AOX A;  4GDE A;  3ALL A;  4ZCC A;  4BV6 A;  3NK2 X;  1JEH A;  1ZDL A;  2WOV A;  4Z43 A;  3CN8 A;  1PJ5 A;  3AE3 A;  4IVM B;  1GET A;  1IUT A;  2H89 A;  1LPF A;  3AE2 A;  1PXA A;  2E1M A;  2C73 A;  4L3X A;  4UDP A;  1F8S A;  2VVL G;  4B65 A;  1IUX A;  1ZX9 A;  3ALM A;  1FOH A;  2YQU A;  4G6G A;  1L9C A;  3KPK A;  1GPE A;  2BYB A;  3IF9 A;  1F8W A;  1YQ3 A;  1QDB A;  4JN9 A;  4CNK A;  4DNA A;  1PN0 A;  3SZW A;  5KWF A;  2BXR A;  2WEU A;  1BZL A;  1OJ9 A;  3SFD A;  3LG1 A;  2GMJ A;  1SEZ A;  2EQ7 A;  4WX1 A;  1KSS A;  4K8D A;  3CIR A;  3NKS A;  5KMQ A;  5EOW A;  4LA1 A;  3ATR A;  3SY4 A;  1L9E A;  2XVJ A;  3DJE A;  3H4K A;  4K7Z A;  4YSH A;  1N1P A;  1N4V A;  1YY5 A;  3GRS A;  1E7P A;  4CCR A;  2H88 A;  5BVA A;  1FS8 A;  4B63 A;  4L3Y A;  1FS9 A;  2B9Y A;  2JB1 A;  4WJY A;  2VOU A;  4TLZ A;  4X9M A;  4GAP A;  4K22 A;  3BHK A;  3ABV A;  4U8I A;  2X8C A;  3BI5 A;  4FDC B;  2BS2 A;  2FJE A;  4HB9 A;  2BC1 A;  1NPX A;  1Y56 A;  4H4X A;  5GSN A;  4YSY A;  4Z2T A;  4Q17 A;  3IHM A;  2GQW A;  3AE7 A;  1M1Q A;  2C3C A;  4NEV A;  2XYO A;  4DGK A;  2WPE A;  3KD9 A;  2BCP A;  3GD4 A;  3AE9 A;  3S5W A;  4YTP A;  1PBE A;  4J34 A;  4YT0 A;  4AP3 A;  5BUL A;  1XHC A;  3G5R A;  2R4J A;  2WOI A;  4C74 A;  4Q4U A;  2YR5 A;  3SXQ A;  4D04 A;  1LV0 A;  4Q0T A;  1H81 A;  4JNQ A;  2B7S A;  1BWC A;  2CFY A;  4NTE A;  4XWZ A;  2ZZB A;  4EMI A;  5FMH A;  1ZK7 A;  1DOC A;  1ZMC A;  2GB0 A;  3IWA A;  1BGN A;  1S2Y A;  1D4C A;  2GH5 A;  3NK1 X;  2JBV A;  2QAE A;  2VVL A;  2DKI A;  4Z2U A;  4II2 A;  2XLT A;  3F8D A;  2WES A;  3T2K A;  2VRL A;  3AE1 A;  3L8K A;  5HHF A;  1TDE A;  4NEW A;  4J33 A;  2DKH A;  4IV9 A;  4A7A A;  4AP1 A;  1JNR A;  1ZY8 A;  1K0I A;  4JY3 A;  4OVI A;  1B5Q A;  4Z2R A;  2X8H A;  3CMM A;  1B37 A;  4MJW A;  4Z25 A;  1KSU A;  2GQF A;  3VRD B;  1GXF A;  3DJD A;  1D4D A;  3BNJ A;  2YG7 A;  2C75 A;  3P4P A;  5TR3 A;  4EIP A;  1PBD A;  1PBC A;  1QJD A;  4E0V A;  1MOK A;  4H4S A;  4UP3 A;  2YG6 A;  2GV8 A;  3UKH A;  4A65 A;  3HYX A;  3BHF A;  2AR8 A;  3G5Q A;  3UOZ A;  4EQX A;  3RP8 A;  3QVR A;  4BK1 A;  2YG3 A;  2CUL A;  2RGJ A;  1IUV A;  4JY2 A;  2VQ7 A;  1FT6 A;  3P1W A;  2BXS A;  4DSG A;  4GUV A;  1TDK A;  3ATQ A;  4EMJ A;  3GM6 A;  2V3A A;  5IQ4 A;  1LVL A;  3SX6 A;  2YLW A;  2A8X A;  3T31 A;  1B4V A;  2ZO5 A;  2WP6 A;  4A9W A;  1JRZ A;  1S3E A;  2OAL A;  3AEC A;  1PJ7 A;  1TDN A;  2E5V A;  4U8J A;  3AYJ A;  3K7Q X;  3S61 A;  1ZP0 A;  3CPJ G;  3MMO A;  1KNP A;  3CGC A;  2RF7 A;  3FIM B;  3GDP A;  1QLB A;  4IA5 A;  3R9U A;  3GD3 A;  3UKL A;  2W0H A;  1MXT A;  2YM2 A;  4H4V A;  3LZX A;  2BRA A;  4PAB A;  1TDO A;  3NGC X;  1IUS A;  3AB1 A;  3DJG X;  2PHH A;  3P4R A;  4FK1 A;  1REO A;  1O5W A;  1VRQ B;  2YLX A;  2WET A;  2ZBW A;  4C3X A;  4GCM A;  3EF6 A;  2B7R A;  3SGL A;  3VQR A;  3DK9 A;  1H84 A;  1K4Q A;  2XFQ A;  3KU9 A;  1O95 A;  4A6N B;  3NTD A;  3T0K A;  5KXJ A;  1GRT A;  4LU6 A;  4J57 A;  4U8O A;  4CNJ A;  4H2Q A;  2Q7V A;  1NHQ A;  3B3R A;  2B9X A;  4CBQ A;  4O5U A;  4YKF A;  2GF3 A;  2I0Z A;  4CY6 A;  1DOD A;  3GWD A;  2YLT A;  4K5R A;  4RG4 A;  4ADW A;  4TM4 A;  2BK5 A;  2WBA A;  3C4N A;  1GAL A;  1LQT A;  1L0V A;  3TOR A;  5KOW A;  2O9Z A;  4B1B A;  3NN6 X;  1D4E A;  1H7W A;  3GMC A;  3CND A;  2HQM A;  2CZS A;  2C4C A;  3OWM A;  1F8R A;  1TDF A;  3NT6 A;  4TM3 A;  3QSS A;  2B76 A;  4U2S A;  4YWO A;  1PXB A;  3NYE A;  4U8L A;  4UDR A;  3CGE A;  4EQS A;  4YXD A;  4OPI A;  4J36 A;  3E1T A;  5JCN A;  3FMW A;  1RSG A;  2NVK X;  1DXL A;  5KMR A;  1E1N A;  3NK0 X;  2C65 A;  5EB4 A;  2YLZ A;  2OT4 A;  4X9N A;  1XDI A;  1S2Q A;  1CJ4 A;  1GRB A;  1KDG A;  2WPF A;  1CHU A;  1EL7 A;  1GRE A;  1GV4 A;  3D8X A;  3KVE A;  3DA1 A;  2ZZC A;  4H2P A;  3H8I A;  3II4 A;  2XFN A;  4NTC A;  4AT0 A;  1ZOV A;  1M1R A;  2QA2 A;  2E4G A;  3L1T A;  4H4W A;  5EB5 A;  1H82 A;  3T37 A;  3BNM A;  2XDO A;  2YVJ A;  4BUR A;  1DJN A;  3M12 A;  3D1C A;  2IID A;  3VRB A;  4C3Y A;  1Q1R A;  2F5Z A;  1VDC A;  5JCM A;  3DK4 A;  5C2T A;  4CY8 A;  3UBR A;  3BNH A;  1OJA A;  3AE5 A;  1L9D A;  3B6D A;  3T14 A;  1OAH A;  2GAG B;  2X8G A;  2K3V A;  3BNF A;  3SCE A;  3HYV A;  3RHA A;  4GRT A;  3UTE A;  5BRT A;  3QFB A;  1PHH A;  2VQB A;  5HYM A;  1TRB A;  4UDQ A;  5KMP A;  4K2X A;  3UTF A;  4Z44 A;  2TMD A;  1E6E A;  5HXI A;  2Z5X A;  4H2R A;  3KA7 A;  4O5Q A;  1NDA A;  5FS7 A;  1O94 A;  3TTB A;  3F8R A;  1W4X A;  4ICY A;  5KVI A;  2YVG A;  2WU2 A;  2YLS A;  4H4Z A;  3UOX A;  1FEA A;  2ZZ0 A;  4H7U A;  3I3L A;  2XFP A;  3IC9 A;  2FJD A;  2XVE A;  1LJ1 A;  3KPF A;  4HA6 A;  5LV9 A;  4Q1O A;  4EQW A;  5KVH A;  3P4S A;  4BK3 A;  2XCG A;  5CKU A;  2WDR A;  1GES A;  2CDU A;  1YKJ A;  4YTN A;  2ARD A;  1OJT A;  1Q9I A;  2FBW A;  2R45 A;  3EAN A;  3D1I A;  2YG5 A;  2OAM A;  4GR1 A;  1FL2 A;  1H6V A;  2RDZ A;  2YLR A;  3M13 A;  3NIX A;  1Y56 B;  4H4Q A;  4I59 A;  1OJD A;  2XVI A;  3DJJ A;  2J7A A;  4L3Z A;  1NG3 A;  2JB3 A;  1K0L A;  4USR A;  3SYI A;  1AOG A;  4IA6 A;  4YTM A;  2Y6R A;  3L1R A;  5KRQ A;  2EQ8 A;  3LOV A;  3AD9 B;  1CC4 A;  3CNP A;  1CL0 A;  3JSK A;  1GTH A;  2CVJ A;  2R0G A;  3AEF A;  3OC4 A;  2J3N A;  5J60 A;  4N9X A;  5M0Z A;  3ADA B;  4C77 A;  3C96 A;  1E39 A;  1LQU A;  1X31 B;  3PVC A;  4NWZ A;  4RSL A;  1EL8 A;  3V76 A;  1PS9 A;  3NTA A;  5M10 A;  2JB2 A;  2R0P A;  4CRT A;  4JNA A;  2BAC A;  2YAU A;  3EAO A;  4JDR A;  3CPH G;  4AOS A;  1EL9 A;  5FS6 A;  2XFO A;  4AT2 A;  1JRY A;  3AEB A;  3SFE A;  4D03 A;  3ISH A;  3COX A;  4EM4 A;  1KF6 A;  4FX9 A;  3NN0 X;  2Z5Y A;  2VRM A;  4H2N A;  3T2Z A;  2WS3 A;  2XVF A;  4Q5C A;  1E1K A;  4XWR A;  2BS3 A;  3GWF A;  1FCD A;  1E1L A;  3LZW A;  4NNJ A;  4Y4N A;  3P9U A;  1BF3 A;  5KOX A;  1IJH A;  4P9S A;  5FS9 A;  1JNI A;  3UKF A;  1RP0 A;  1GOS A;  2R4E A;  3NNE A;  2RGH A;  3G5S A;  4OPU A;  2C72 A;  3QFA A;  4JQ9 A;  4A79 A;  1DOB A;  5BUK A;  4KX6 A;  3UU9 A;  3GYX A;  1FEC A;  1D7Y A;  1F3P A;  4GF7 A; 
#chains in the Genus database with same CATH homology
 2JAE A;  1B8S A;  2WP9 A;  4U8P A;  1ONF A;  1V59 A;  2EQ6 A;  4YSX A;  3QSE A;  3FO3 A;  3AEA A;  4NTD A;  2Y6Q A;  3ITJ A;  2UZZ A;  4U8M A;  1GER A;  5U25 A;  3UKA A;  4B64 A;  1CBO A;  2BRY A;  3BI2 A;  3VR9 A;  1CF3 A;  1GSN A;  3O0H A;  4Z26 A;  1GRA A;  1PXC A;  2R9Z A;  2XLP A;  3FBS A;  3QVP A;  2PYX A;  1NHS A;  1FT5 A;  4X4J A;  2GVC A;  2XLR A;  3ICR A;  2GEW A;  3AEE A;  3IHG A;  3SM8 A;  2XLS A;  3CPI G;  2YVF A;  2WP5 A;  3NH3 X;  3LXD A;  1GU6 A;  4YKG A;  3UTH A;  1COY A;  3GYJ A;  2V5Z A;  3F8P A;  3ICT A;  2RGO A;  1GRF A;  1Q1W A;  2GR0 A;  3ZYX A;  1GEU A;  1P2E A;  1NHP A;  1ZOY A;  2C3D A;  1SP3 A;  2V61 A;  3FG2 P;  2TPR A;  3AWI A;  3K7T A;  1N4U A;  2BCG G;  4K5S A;  4NZH A;  5U1O A;  5JCK A;  2QA1 A;  3M0O A;  3KLJ A;  3UOV A;  4EMW A;  2EQ9 A;  2YR4 A;  5ER0 A;  2R0C A;  2BK4 A;  4WCT A;  4H4T A;  3BI4 A;  3SQP A;  2A87 A;  5JCL A;  2R46 A;  4OPD A;  3F29 A;  2WQY A;  3QSM A;  2X99 A;  4EIQ A;  4G73 A;  3RKH A;  3SZ0 A;  1YQ4 A;  4Y4L A;  4BJY A;  2A89 A;  2C76 A;  3AD7 B;  5U63 A;  3V3O A;  1EL5 A;  3S7W A;  4EQR A;  1QO8 A;  1TYT A;  1H83 A;  2Q6U A;  2IVD A;  3FPZ A;  5IPY A;  4B68 A;  1Y0P A;  1UKV G;  1H7X A;  2WOW A;  1GND A;  2RAB A;  4Z24 A;  2V6O A;  4REK A;  3UKQ A;  4H50 A;  1RYI A;  2NPX A;  1CJC A;  2AQJ A;  2XLU A;  3ICS A;  2VZ2 A;  3KKJ A;  3AE4 A;  3CNJ A;  2OA1 A;  4TM0 A;  4YSZ A;  2E80 A;  2GR2 A;  5IQ1 A;  3ZDN A;  4BJZ A;  3LJP A;  1M6I A;  3SXI A;  1S3B A;  5C3J A;  3H8L A;  2FJB A;  4U2L A;  4C5O A;  2X3N A;  3NYC A;  5GRT A;  1JOA A;  4OCG A;  2C67 A;  1E1M A;  4H4R A;  4OPG A;  4M52 A;  3URH A;  3GDN A;  4GAV A;  4J2W A;  5FS8 A;  1HYU A;  1M64 A;  4TLX A;  1NHR A;  3CGD A;  1H86 A;  1YQZ A;  1GRH A;  4RG3 A;  1MO9 A;  3I6D A;  2V60 A;  5CQF A;  1JNZ A;  3UKK A;  2OLO A;  1PBB A;  2Q0K A;  4U2T A;  1GT8 A;  4H4U A;  3NHO X;  1NG4 A;  4FK1 C;  2WHD A;  3K30 A;  1KNR A;  3BNG A;  3GMB A;  5J7X A;  2WDQ A;  5L46 A;  3RNM A;  3VR8 A;  4Y4M A;  3NRN A;  3HZL A;  5DBJ A;  4ZN0 A;  5JCI A;  4L38 A;  1VG0 A;  1JU2 A;  2QCU A;  3CTY A;  1CJ3 A;  2C70 A;  2VVM A;  1ELI A;  2C64 A;  3AYI A;  4OPL A;  2YM1 A;  4A99 A;  4A5L A;  2VR0 A;  2APG A;  2C66 A;  1GRG A;  3CNS A;  3LAD A;  3LB8 A;  3UP4 A;  4BK2 A;  1Z6L A;  4I58 A;  3WE0 A;  1M1P A;  1PJ6 A;  3DK8 A;  1EBD A;  4DSH A;  4II3 A;  3Q9T A;  3BNU A;  2BK3 A;  4B67 A;  1PDH A;  3DME A;  3UKP A;  3EPT A;  3PS9 A;  5KNL A;  3AEG A;  4ZCD A;  1VQW A;  1NEK A;  2GAH B;  2JK6 A;  1CJ2 A;  3DGH A;  2OLN A;  1IUU A;  3GSI A;  3RP6 A;  1LTX R;  1XAN A;  2XFU A;  3CGB A;  4OPC A;  4CCQ A;  4XXG A;  4A6N A;  3OZ2 A;  1F6M A;  3GYI A;  4U8N A;  1NAA A;  3C4A A;  3QJ4 A;  1K0J A;  3AYL A;  1ZMD A;  3ALJ A;  2JKC A;  2WU5 A;  1PBF A;  1BVB A;  1DNC A;  2BS4 A;  3UCL A;  2IVE A;  2WPC A;  4B69 A;  3SZC A;  3SZF A;  4OPT A;  2FJA A;  1JRX A;  1N4W A;  4GDP A;  4KPR A;  4J56 A;  4ECH A;  2BAB A;  3AE8 A;  1P2H A;  1DOE A;  1XPQ A;  1DJQ A;  2LFC A;  1VG9 A;  1FEB A;  2V3B A;  2E81 A;  4G6H A;  1NEN A;  3AED A;  3GRT A;  3P4Q A;  1KFY A;  3T2Y A;  4G74 A;  4TM1 A;  3DH9 A;  3V3N A;  1OJC A;  4G9K A;  2B9W A;  3RP7 A;  2GRT A;  2XVH A;  3CNT A;  4H4Y A;  1CC6 A;  1TYP A;  2GR3 A;  4APN A;  5KMS A;  4PAA A;  3NG7 X;  4IVO B;  3AD8 B;  2ACZ A;  2WDV A;  5EBK A;  4H4P A;  3UTG A;  3K7M X;  1D7L A;  3Q6J A;  4B66 A;  1CC2 A;  3HYW A;  2BC0 A;  3VRA A;  3PO7 A;  1GTE A;  3NYF A;  5HY5 A;  1ZKQ A;  2BA9 A;  3DGZ A;  4Q5B A;  2C7G A;  2YG4 A;  3UOY A;  4J31 A;  3UP5 A;  1BKW A;  2YWL A;  4U8K A;  3LGQ A;  1BGJ A;  4EM3 A;  1D5T A;  2YR6 A;  2X50 A;  4USQ A;  1IUW A;  3NLC A;  2GR1 A;  1FS7 A;  3AXB A;  2AAQ A;  3AE6 A;  3RED A;  2GMH A;  2Q0L A;  4LII A;  4AOX A;  4GDE A;  3ALL A;  4ZCC A;  4BV6 A;  3NK2 X;  1JEH A;  1ZDL A;  2WOV A;  4Z43 A;  3CN8 A;  1PJ5 A;  3AE3 A;  4IVM B;  1GET A;  1IUT A;  2H89 A;  1LPF A;  3AE2 A;  1PXA A;  2E1M A;  2C73 A;  4L3X A;  4UDP A;  1F8S A;  2VVL G;  4B65 A;  1IUX A;  1ZX9 A;  3ALM A;  1FOH A;  2YQU A;  4G6G A;  1L9C A;  3KPK A;  1GPE A;  2BYB A;  3IF9 A;  1F8W A;  1YQ3 A;  1QDB A;  4JN9 A;  4CNK A;  4DNA A;  1PN0 A;  3SZW A;  5KWF A;  2BXR A;  2WEU A;  1BZL A;  1OJ9 A;  3SFD A;  3LG1 A;  2GMJ A;  1SEZ A;  2EQ7 A;  4WX1 A;  1KSS A;  4K8D A;  3CIR A;  3NKS A;  5KMQ A;  5EOW A;  4LA1 A;  3ATR A;  3SY4 A;  1L9E A;  2XVJ A;  3DJE A;  3H4K A;  4K7Z A;  4YSH A;  1N1P A;  1N4V A;  1YY5 A;  3GRS A;  1E7P A;  4CCR A;  2H88 A;  5BVA A;  1FS8 A;  4B63 A;  4L3Y A;  1FS9 A;  2B9Y A;  2JB1 A;  4WJY A;  2VOU A;  4TLZ A;  4X9M A;  4GAP A;  4K22 A;  3BHK A;  3ABV A;  4U8I A;  2X8C A;  3BI5 A;  4FDC B;  2BS2 A;  2FJE A;  4HB9 A;  2BC1 A;  1NPX A;  1Y56 A;  4H4X A;  5GSN A;  4YSY A;  4Z2T A;  4Q17 A;  3IHM A;  2GQW A;  3AE7 A;  1M1Q A;  2C3C A;  4NEV A;  2XYO A;  4DGK A;  2WPE A;  3KD9 A;  2BCP A;  3GD4 A;  3AE9 A;  3S5W A;  4YTP A;  1PBE A;  4J34 A;  4YT0 A;  4AP3 A;  5BUL A;  1XHC A;  3G5R A;  2R4J A;  2WOI A;  4C74 A;  4Q4U A;  2YR5 A;  3SXQ A;  4D04 A;  1LV0 A;  4Q0T A;  1H81 A;  4JNQ A;  2B7S A;  1BWC A;  2CFY A;  4NTE A;  4XWZ A;  2ZZB A;  4EMI A;  5FMH A;  1ZK7 A;  1DOC A;  1ZMC A;  2GB0 A;  3IWA A;  1BGN A;  1S2Y A;  1D4C A;  2GH5 A;  3NK1 X;  2JBV A;  2QAE A;  2VVL A;  2DKI A;  4Z2U A;  4II2 A;  2XLT A;  3F8D A;  2WES A;  3T2K A;  2VRL A;  3AE1 A;  3L8K A;  5HHF A;  1TDE A;  4NEW A;  4J33 A;  2DKH A;  4IV9 A;  4A7A A;  4AP1 A;  1JNR A;  1ZY8 A;  1K0I A;  4JY3 A;  4OVI A;  1B5Q A;  4Z2R A;  2X8H A;  3CMM A;  1B37 A;  4MJW A;  4Z25 A;  1KSU A;  2GQF A;  3VRD B;  1GXF A;  3DJD A;  1D4D A;  3BNJ A;  2YG7 A;  2C75 A;  3P4P A;  5TR3 A;  4EIP A;  1PBD A;  1PBC A;  1QJD A;  4E0V A;  1MOK A;  4H4S A;  4UP3 A;  2YG6 A;  2GV8 A;  3UKH A;  4A65 A;  3HYX A;  3BHF A;  2AR8 A;  3G5Q A;  3UOZ A;  4EQX A;  3RP8 A;  3QVR A;  4BK1 A;  2YG3 A;  2CUL A;  2RGJ A;  1IUV A;  4JY2 A;  2VQ7 A;  1FT6 A;  3P1W A;  2BXS A;  4DSG A;  4GUV A;  1TDK A;  3ATQ A;  4EMJ A;  3GM6 A;  2V3A A;  5IQ4 A;  1LVL A;  3SX6 A;  2YLW A;  2A8X A;  3T31 A;  1B4V A;  2ZO5 A;  2WP6 A;  4A9W A;  1JRZ A;  1S3E A;  2OAL A;  3AEC A;  1PJ7 A;  1TDN A;  2E5V A;  4U8J A;  3AYJ A;  3K7Q X;  3S61 A;  1ZP0 A;  3CPJ G;  3MMO A;  1KNP A;  3CGC A;  2RF7 A;  3FIM B;  3GDP A;  1QLB A;  4IA5 A;  3R9U A;  3GD3 A;  3UKL A;  2W0H A;  1MXT A;  2YM2 A;  4H4V A;  3LZX A;  2BRA A;  4PAB A;  1TDO A;  3NGC X;  1IUS A;  3AB1 A;  3DJG X;  2PHH A;  3P4R A;  4FK1 A;  1REO A;  1O5W A;  1VRQ B;  2YLX A;  2WET A;  2ZBW A;  4C3X A;  4GCM A;  3EF6 A;  2B7R A;  3SGL A;  3VQR A;  3DK9 A;  1H84 A;  1K4Q A;  2XFQ A;  3KU9 A;  1O95 A;  4A6N B;  3NTD A;  3T0K A;  5KXJ A;  1GRT A;  4LU6 A;  4J57 A;  4U8O A;  4CNJ A;  4H2Q A;  2Q7V A;  1NHQ A;  3B3R A;  2B9X A;  4CBQ A;  4O5U A;  4YKF A;  2GF3 A;  2I0Z A;  4CY6 A;  1DOD A;  3GWD A;  2YLT A;  4K5R A;  4RG4 A;  4ADW A;  4TM4 A;  2BK5 A;  2WBA A;  3C4N A;  1GAL A;  1LQT A;  1L0V A;  3TOR A;  5KOW A;  2O9Z A;  4B1B A;  3NN6 X;  1D4E A;  1H7W A;  3GMC A;  3CND A;  2HQM A;  2C4C A;  3OWM A;  1F8R A;  1TDF A;  3NT6 A;  4TM3 A;  3QSS A;  2B76 A;  4U2S A;  4YWO A;  1PXB A;  3NYE A;  4U8L A;  4UDR A;  3CGE A;  4EQS A;  4YXD A;  4OPI A;  4J36 A;  3E1T A;  5JCN A;  3FMW A;  1RSG A;  2NVK X;  1DXL A;  5KMR A;  1E1N A;  3NK0 X;  2C65 A;  5EB4 A;  2YLZ A;  2OT4 A;  4X9N A;  1XDI A;  1S2Q A;  1CJ4 A;  1GRB A;  1KDG A;  2WPF A;  1CHU A;  1EL7 A;  1GRE A;  1GV4 A;  3D8X A;  3KVE A;  3DA1 A;  2ZZC A;  4H2P A;  3H8I A;  3II4 A;  2XFN A;  4NTC A;  4AT0 A;  1ZOV A;  1M1R A;  2QA2 A;  2E4G A;  3L1T A;  4H4W A;  5EB5 A;  1H82 A;  3T37 A;  3BNM A;  2XDO A;  2YVJ A;  4BUR A;  1DJN A;  3M12 A;  3D1C A;  2IID A;  3VRB A;  4C3Y A;  1Q1R A;  2F5Z A;  1VDC A;  5JCM A;  3DK4 A;  5C2T A;  4CY8 A;  3UBR A;  3BNH A;  1OJA A;  3AE5 A;  1L9D A;  3B6D A;  3T14 A;  1OAH A;  2GAG B;  2X8G A;  2K3V A;  3BNF A;  3SCE A;  3HYV A;  3RHA A;  4GRT A;  3UTE A;  5BRT A;  3QFB A;  1PHH A;  2VQB A;  5HYM A;  1TRB A;  4UDQ A;  5KMP A;  4K2X A;  3UTF A;  4Z44 A;  2TMD A;  1E6E A;  5HXI A;  2Z5X A;  4H2R A;  3KA7 A;  4O5Q A;  1NDA A;  5FS7 A;  1O94 A;  3TTB A;  3F8R A;  1W4X A;  4ICY A;  5KVI A;  2YVG A;  2WU2 A;  2YLS A;  4H4Z A;  3UOX A;  1FEA A;  2ZZ0 A;  4H7U A;  3I3L A;  2XFP A;  3IC9 A;  2FJD A;  2XVE A;  1LJ1 A;  3KPF A;  4HA6 A;  5LV9 A;  4Q1O A;  4EQW A;  5KVH A;  3P4S A;  4BK3 A;  2XCG A;  5CKU A;  2WDR A;  1GES A;  2CDU A;  1YKJ A;  4YTN A;  2ARD A;  1OJT A;  1Q9I A;  2FBW A;  2R45 A;  3EAN A;  3D1I A;  2YG5 A;  2OAM A;  4GR1 A;  1FL2 A;  1H6V A;  2RDZ A;  2YLR A;  3M13 A;  3NIX A;  1Y56 B;  4H4Q A;  4I59 A;  1OJD A;  2XVI A;  3DJJ A;  2J7A A;  4L3Z A;  1NG3 A;  2JB3 A;  1K0L A;  4USR A;  3SYI A;  1AOG A;  4IA6 A;  4YTM A;  2Y6R A;  3L1R A;  5KRQ A;  2EQ8 A;  3LOV A;  3AD9 B;  1CC4 A;  3CNP A;  1CL0 A;  3JSK A;  1GTH A;  2CVJ A;  2R0G A;  3AEF A;  3OC4 A;  2J3N A;  5J60 A;  4N9X A;  5M0Z A;  3ADA B;  4C77 A;  3C96 A;  1E39 A;  1LQU A;  1X31 B;  3PVC A;  4NWZ A;  4RSL A;  1EL8 A;  3V76 A;  1PS9 A;  3NTA A;  5M10 A;  2JB2 A;  2R0P A;  4CRT A;  4JNA A;  2BAC A;  2YAU A;  3EAO A;  4JDR A;  3CPH G;  4AOS A;  1EL9 A;  5FS6 A;  2XFO A;  4AT2 A;  1JRY A;  3AEB A;  3SFE A;  4D03 A;  3ISH A;  3COX A;  4EM4 A;  1KF6 A;  4FX9 A;  3NN0 X;  2Z5Y A;  2VRM A;  4H2N A;  3T2Z A;  2WS3 A;  2XVF A;  4Q5C A;  1E1K A;  4XWR A;  2BS3 A;  3GWF A;  1FCD A;  1E1L A;  3LZW A;  4NNJ A;  4Y4N A;  3P9U A;  1BF3 A;  5KOX A;  1IJH A;  4P9S A;  5FS9 A;  1JNI A;  3UKF A;  1RP0 A;  1GOS A;  2R4E A;  3NNE A;  2RGH A;  3G5S A;  4OPU A;  2C72 A;  3QFA A;  4JQ9 A;  4A79 A;  1DOB A;  5BUK A;  4KX6 A;  3UU9 A;  3GYX A;  1FEC A;  1D7Y A;  1F3P A;  4GF7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...