1M64A

Crystal structure of q363f mutant flavocytochrome c3
Total Genus 188
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
188
sequence length
568
structure length
568
Chain Sequence
ADNLAEFHVQNQECDSCHTPDGELSNDSLTYENTQCVSCHGTLAEVAETTKHEHYNAHASHFPGEVACTSCHSAHEKSMVYCDSCHSFDFNMPYAKKWLRDEPTIAELAKDKSERQAALASAPHDTVDVVVVGSGGAGFSAAISATDSGAKVILIEKEPVIGGNAKLAAGGMNAAWTDQQKAKKITDSPELMFEDTMKGGQNINDPALVKVLSSHSKDSVDWMTAMGADLTDVGMMGGASVNRAHRPTGGAGVGAHVVQVLYDNAVKRNIDLRMNTRGIEVLKDDKGTVKGILVKGMYKGYYWVKADAVILATGGFAKNNERVAKLDPSLKGFISTNQPGAVGDGLDVAENAGGALKDMQYIFAHPTLSVKGGVMVTEAVRGNGAILVNREGKRFVNEITTRDKASAAILAQTGKSAYLIFDDSVRKSLSKIDKYIGLGVAPTADSLVKLGKMEGIDGKALTETVARYNSLVSSGKDTDFERPNLPRALNEGNYYAIEVTPGVHHTMGGVMIDTKAEVMNAKKQVIPGLYGAGEVTGGVHGANRLGGNAISDIITFGRLAGEEAAKYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Engineering water to act as an active site acid catalyst in a soluble fumarate reductase
pubmed doi rcsb
source organism Shewanella frigidimarina
molecule tags Oxidoreductase
molecule keywords flavocytochrome c3
total genus 188
structure length 568
sequence length 568
chains with identical sequence B
ec nomenclature ec 1.3.5.4: Fumarate reductase (quinol).
pdb deposition date 2002-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00890 FAD_binding_2 FAD binding domain
A PF14537 Cytochrom_c3_2 Cytochrome c3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1130.10 Mainly Alpha Orthogonal Bundle Flavocytochrome C3; Chain A, domain 2 Flavocytochrome C3; Chain A 1m64A02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1m64A03
3.90.700.10 Alpha Beta Alpha-Beta Complex Flavocytochrome C3; Chain A, domain 1 Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 1m64A01
4J2WA 1L9EA 2B9XA 3ALMA 4H4VA 1D7LA 4JN9A 3AD9B 1JNZA 1OAHA 3T37A 2BACA 3NGCX 1GERA 2TPRA 4J36A 2ZZCA 2C66A 3GRTA 4B67A 2BS4A 3E1TA 4CBQA 1IUVA 2CVJA 4C74A 1FS8A 3DJDA 1PS9A 3G5QA 1K4QA 5J60A 4EMWA 1M1QA 2I0ZA 1FECA 3P4PA 3VRAA 2H88A 2AR8A 4OPDA 1OJAA 4UDRA 1B37A 3UTEA 3GYXA 4Q5BA 1FEAA 3P4RA 4TM1A 4C3XA 3H8LA 1GOSA 1UKVG 2R4EA 2BCPA 4OPGA 4DGKA 3FO3A 4H4PA 2K3VA 1PBEA 2YVJA 1EBDA 1JNIA 3GDNA 2OA1A 3K7TA 5L46A 2C75A 2XFPA 1CJ2A 4H2RA 2Q7VA 2B9YA 2Y6RA 3GD3A 3F8DA 4YKGA 5IQ1A 1NG4A 2E5VA 1O95A 5ER0A 1Y56A 2VVLA 5GRTA 4YSHA 3K7MX 3DK9A 4HA6A 4D04A 2EQ7A 1E1NA 3GSIA 3R9UA 4EIQA 5EBKA 5FMHA 4AOSA 2JB2A 3BNUA 2B7SA 3ISHA 4Z2RA 2XFUA 4REKA 3AXBA 1CC2A 3BHFA 5KXJA 4NZHA 3AE3A 3OC4A 2E1MA 4FK1A 3QSMA 1D7YA 3B6DA 3IHMA 3AYLA 2WU2A 3UKKA 3P4QA 1FT5A 4Z24A 2BC1A 2BABA 3EANA 3SCEA 1H81A 3CNTA 1GEUA 3I6DA 3ICSA 4H50A 3SQPA 1BWCA 1H84A 1PN0A 2Q6UA 3NK1X 3P1WA 4K5RA 1DXLA 2FJEA 3FMWA 4TM4A 2YLZA 3ICRA 1PBDA 2X8HA 3BNFA 4WJYA 5BVAA 3NHOX 2YLXA 5CQFA 2X8CA 5JCLA 1K0JA 2FBWA 3V76A 2RF7A 1MO9A 2AQJA 3CNJA 3GMCA 1ZP0A 2QA1A 1GETA 4Z2UA 3UBRA 3SM8A 1PJ5A 4OPCA 2RGHA 1RYIA 2XLTA 5KVIA 1DODA 2XFNA 3PVCA 3F29A 3FG2P 5JCIA 4OPLA 1CHUA 1GRTA 1CJCA 1GRAA 1OJTA 4YXDA 3QFAA 1D5TA 4K5SA 1F8RA 3L1RA 4U2TA 4Y4MA 3BNGA 3EF6A 1B5QA 1L9DA 3LGQA 2GR2A 3QFBA 3BNHA 4C77A 2YR6A 4U8KA 3UKFA 4CNJA 2VVLG 2XLPA 3URHA 3KU9A 5HXIA 3NIXA 4J31A 1ELIA 3VR8A 2WP9A 4L3ZA 2IIDA 1SEZA 1LQUA 1LPFA 4X9MA 3JSKA 4B66A 4H4RA 2R46A 3NK0X 5HY5A 3CGDA 3NYEA 4WX1A 1PXCA 1EL9A 1B4VA 2BK4A 4YSYA 1QO8A 5HYMA 2HQMA 1DOEA 4JNQA 4NEWA 1KSUA 4TM3A 3SGLA 1VG0A 2C64A 2ZBWA 3TORA 4GDEA 1RP0A 4H4TA 2VRLA 3DGHA 4OVIA 2YLTA 2Q0KA 2AAQA 2E80A 1ZOVA 2GR1A 3LZWA 5IQ4A 1PJ6A 1GRHA 2GQWA 4H7UA 1IUSA 1GT8A 3COXA 4GF7A 3NNEA 1O94A 4PAAA 1H82A 1DOCA 1FCDA 1YKJA 2JB3A 2GR3A 2O9ZA 3CIRA 4Y4LA 1FS9A 3G5RA 1PXBA 2OLOA 1PBBA 4DNAA 2R0GA 1VQWA 3KVEA 3CPIG 4YKFA 2GQFA 4MJWA 2B7RA 4WCTA 2YM2A 2XCGA 3C96A 2FJBA 4M52A 3O0HA 3PS9A 1NHQA 4XWRA 4BJYA 5TR3A 5M10A 1BGJA 3D8XA 2WOVA 3UOXA 2CULA 4A6NA 3NKSA 2VR0A 2A8XA 4AOXA 3NN6X 5C3JA 2YG3A 3CGBA 2C72A 3CGCA 1DJQA 2BCGG 1GRBA 5KOWA 1Q1RA 2XVIA 1IUWA 3IF9A 1BGNA 3HZLA 2NVKX 3ZDNA 2VVMA 4H4YA 3RNMA 1N4UA 4H4XA 1LQTA 3AEDA 4Z44A 1Z6LA 2YG5A 4EM3A 3F8PA 3G5SA 3KLJA 1ZOYA 3KD9A 2ZO5A 3LXDA 4C5OA 4BK3A 1F8WA 1DNCA 1NENA 4GUVA 4I59A 4APNA 4OPTA 5IPYA 3FPZA 4B63A 4DSHA 4BJZA 4OPIA 1W4XA 3ALLA 1TDNA 3NK2X 5KWFA 2XLSA 3OZ2A 4Z43A 4RSLA 2C3CA 2C7GA 4TM0A 4U2SA 1JRZA 2NPXA 4D03A 1N1PA 2XVJA 4BURA 1FS7A 1VG9A 3RP7A 3FIMB 3NRNA 3UU9A 2EQ8A 2CDUA 4L38A 2QAEA 4A99A 3IWAA 1CC6A 2PYXA 3RP6A 3MMOA 3M0OA 4IV9A 4N9XA 1Q9IA 1KDGA 2EQ6A 4YTMA 2YLWA 2WQYA 3GRSA 1TDKA 3ADAB 3NLCA 1N4VA 2B76A 3CNDA 1GALA 1F8SA 2WS3A 1NG3A 1ZKQA 2X99A 4KPRA 2XYOA 3AD8B 2WPCA 1F3PA 3SFDA 4ZN0A 3UCLA 3LJPA 3NN0X 4OPUA 1BF3A 1H83A 2GAGB 3AE1A 1FT6A 1QLBA 5EB4A 2E81A 5BRTA 2GH5A 3BNMA 4U8PA 4GR1A 2WDVA 4E0VA 1P2HA 1NHPA 3VRDB 4LA1A 3GWFA 1SP3A 3L1TA 4CRTA 4U8MA 3VQRA 3UKPA 2R45A 3CPHG 2GR0A 2YWLA 5BUKA 2JK6A 2YM1A 3VRBA 4JQ9A 1ZMDA 2X50A 3UOZA 1PXAA 4U8LA 3DJEA 5FS9A 2OT4A 4B1BA 4YTNA 2BXRA 3UOVA 2WBAA 2XFOA 4EQSA 1X31B 3AEGA 1GTEA 3CNPA 4KX6A 3PO7A 3DA1A 3S7WA 2YG6A 3AD7B 4LIIA 2V61A 3I3LA 2WDQA 1LV0A 1ZK7A 4IVOB 1YQ4A 1IUUA 3LZXA 1Y0PA 1OJDA 4H4ZA 1BZLA 3BI2A 4NTCA 1IJHA 5KVHA 4U8IA 1PHHA 2GV8A 2V60A 2GVCA 2JBVA 1GXFA 3UTGA 4H2NA 1NEKA 3AE6A 1VRQB 1JRYA 2VQ7A 3LG1A 3BI4A 4EMIA 4OCGA 4UDPA 1JU2A 4TLXA 4FDCB 4USQA 1GSNA 3H4KA 2GF3A 5FS6A 2OALA 2V6OA 4H4SA 2C73A 3AE4A 1KNPA 1H6VA 3EPTA 2WU5A 3ATQA 2BS2A 3NTAA 1XANA 1JRXA 4A7AA 4NEVA 2GRTA 4ADWA 4YSXA 3EAOA 1E7PA 2YLRA 1NDAA 2RGOA 2C67A 3NTDA 4JY2A 4RG4A 4IVMB 2LFCA 2RABA 3RP8A 3ABVA 4BV6A 3D1IA 4EM4A 2OLNA 2JB1A 2X3NA 3FBSA 1B8SA 4FK1C 2VOUA 2YG7A 3BI5A 4P9SA 2WPEA 4EQWA 2RGJA 2GEWA 3ATRA 2C3DA 4H4WA 1GNDA 2ARDA 4ECHA 2WEUA 3LB8A 3OWMA 4Y4NA 1BKWA 5JCNA 4J57A 4CY8A 2R0PA 2WP6A 4GDPA 4J33A 2BYBA 4AP3A 3LOVA 3DJJA 4A6NB 4EQXA 5BULA 1DOBA 2XVEA 5U1OA 3ZYXA 4JNAA 2R4JA 2H89A 1YY5A 3K30A 1M6IA 2TMDA 2ACZA 3F8RA 5GSNA 5LV9A 3BNJA 3KKJA 1EL8A 2X8GA 4A9WA 3DMEA 1ONFA 1M1PA 2E4GA 2GMJA 5CKUA 1S2QA 4NTDA 1E1MA 3NYFA 4U8OA 5KOXA 1M1RA 3GYIA 4IA6A 4Z26A 5JCKA 2YVGA 3NG7X 1F6MA 3LADA 3AE8A 4YSZA 4BK2A 3REDA 1H86A 3DJGX 1NHSA 4UP3A 4L3YA 3AEBA 3CPJG 1TYPA 1PBFA 4J56A 1AOGA 4GCMA 2A89A 1ZX9A 1TRBA 2WPFA 4K7ZA 3UKLA 2EQ9A 4Q17A 2C70A 1JEHA 3UTFA 4CCRA 3RKHA 2JAEA 2YQUA 2WDRA 2GMHA 5FS7A 4O5QA 4YWOA 3UKAA 4YT0A 3K7QX 4DSGA 1TDFA 4L3XA 2Y6QA 2RDZA 4EIPA 1E6EA 3GWDA 1LVLA 2XVHA 1CC4A 4B64A 1D4DA 4NTEA 1KFYA 2BA9A 1MOKA 3UOYA 3QVRA 1PBCA 3B3RA 1S2YA 1GRGA 3ICTA 3GM6A 1EL7A 2V3BA 4K8DA 4Q5CA 2FJAA 1YQZA 2XLUA 4BK1A 2CFYA 2WOIA 3S5WA 1PJ7A 2FJDA 3BHKA 4Z2TA 3M13A 1JOAA 3P9UA 2XFQA 2J3NA 3AE2A 2BK3A 3IC9A 3NYCA 4U2LA 3UP5A 3VR9A 3ITJA 5C2TA 4ICYA 3WE0A 2IVDA 1LJ1A 1KSSA 4O5UA 1S3BA 3DGZA 2UZZA 1FOHA 3RHAA 1NHRA 4CY6A 3Q9TA 1K0IA 4A65A 1CJ4A 1XPQA 1V59A 5FS8A 2QA2A 2ZZ0A 3AECA 3CGEA 2JKCA 2DKIA 1CF3A 2YVFA 3AEAA 3UKHA 2VQBA 2QCUA 1REOA 4H2QA 4TLZA 2Q0LA 1GTHA 4AP1A 1XHCA 4B68A 1QDBA 3AYJA 1EL5A 1O5WA 2V3AA 2WESA 2WETA 1PDHA 2Z5XA 3S61A 3GD4A 5EOWA 3AE7A 3TTBA 4FX9A 1GV4A 1IUTA 4PABA 2IVEA 2R9ZA 3P4SA 3QJ4A 2YG4A 5HHFA 1YQ3A 2XDOA 4XXGA 4AT2A 2V5ZA 1JNRA 1ZMCA 2WHDA 3ALJA 5J7XA 2F5ZA 4Q0TA 1KNRA 1CJ3A 4GRTA 3NT6A 1TYTA 4HB9A 4UDQA 1VDCA 2GB0A 4ZCDA 4Z25A 4A79A 1E39A 1D4EA 3GDPA 2GAHB 3DK4A 1M64A 1COYA 2BXSA 2YAUA 3IHGA 1Y56B 3H8IA 4U8NA 4U8JA 3KA7A 3SXQA 3GMBA 2YLSA 1H7XA 3DK8A 2VZ2A 2W0HA 1NAAA 3Q6JA 4IA5A 4X9NA 4EMJA 2BK5A 4YTPA 3II4A 3CTYA 2WP5A 5EB5A 1ZY8A 1QJDA 1KF6A 1CL0A 1S3EA 3QVPA 2XLRA 4RG3A 2YR5A 3AB1A 2C65A 4H4QA 1K0LA 2C76A 1P2EA 1XDIA 3D1CA 1FL2A 4J34A 5DBJA 2DKHA 4ZCCA 4B65A 1BVBA 2BC0A 4X4JA 2B9WA 4CCQA 3CNSA 2ZZBA 1RSGA 3KPFA 4LU6A 1GU6A 5M0ZA 2A87A 3L8KA 3UP4A 2OAMA 1TDEA 2PHHA 3CN8A 3V3OA 3AEEA 4A5LA 1D4CA 3UTHA 4CNKA 4I58A 3QSSA 1DJNA 1MXTA 2XVFA 4H4UA 2Z5YA 3AE5A 3AEFA 5U63A 1NPXA 1GREA 1OJ9A 1N4WA 1Q1WA 3DH9A 3SFEA 4AT0A 4B69A 3C4NA 2YR4A 3AYIA 4C3YA 1GESA 1GRFA 2WOWA 1ZDLA 3QSEA 1CBOA 2R0CA 5U25A 4USRA 4H2PA 2VRMA 1L9CA 2APGA 1E1KA 4K22A 4K2XA 3M12A 1L0VA 1OJCA 1FEBA 3UKQA 1H7WA 1LTXR 4EQRA 3AWIA 3GYJA 3V3NA 4Q1OA 4XWZA 2BS3A 2J7AA 1GPEA 1HYUA 3NH3X 4JY3A 4JDRA 3C4AA 1IUXA 1E1LA 1TDOA 5JCMA 5KRQA 3AE9A 4Q4UA
chains in the Genus database with same CATH superfamily
4J2WA 1L9EA 2B9XA 3ALMA 4G73A 4H4VA 1D7LA 4JN9A 3AD9B 1JNZA 1OAHA 3T37A 2BACA 3NGCX 1GERA 2TPRA 4G9KA 2ZZCA 4J36A 2C66A 3GRTA 4B67A 2BS4A 3E1TA 4CBQA 1IUVA 2CVJA 4C74A 1FS8A 3DJDA 1PS9A 3G5QA 1K4QA 5J60A 4EMWA 1M1QA 2I0ZA 1FECA 3P4PA 3VRAA 2H88A 2AR8A 4OPDA 1OJAA 4UDRA 1B37A 3GYXA 3UTEA 4Q5BA 1FEAA 3P4RA 4TM1A 4C3XA 3H8LA 1GOSA 1UKVG 2R4EA 2BCPA 3HYVA 4OPGA 3FO3A 4H4PA 2K3VA 1PBEA 2YVJA 4G6GA 1EBDA 1JNIA 3GDNA 2OA1A 3K7TA 5L46A 2C75A 2XFPA 1CJ2A 4H2RA 2Q7VA 2B9YA 2Y6RA 3GD3A 3F8DA 4YKGA 5IQ1A 1NG4A 2E5VA 1O95A 5ER0A 1Y56A 2VVLA 5GRTA 4YSHA 3K7MX 5KMPA 3DK9A 4HA6A 4D04A 2EQ7A 1E1NA 3GSIA 3R9UA 4EIQA 5EBKA 5FMHA 4AOSA 2JB2A 3BNUA 2B7SA 3ISHA 4Z2RA 2XFUA 4REKA 3AXBA 1CC2A 3BHFA 5KXJA 4NZHA 3AE3A 3OC4A 2E1MA 4FK1A 3QSMA 1D7YA 3B6DA 3IHMA 3AYLA 2WU2A 3UKKA 3P4QA 3T14A 1FT5A 4Z24A 2BC1A 2BABA 3EANA 3SCEA 1H81A 3CNTA 1GEUA 3I6DA 3ICSA 4H50A 3SQPA 1BWCA 1H84A 1PN0A 2Q6UA 3NK1X 3P1WA 4K5RA 1DXLA 2FJEA 3FMWA 4TM4A 2YLZA 3ICRA 1PBDA 4DGKA 2X8HA 3BNFA 4WJYA 5BVAA 3NHOX 2YLXA 5CQFA 2X8CA 5JCLA 1K0JA 2FBWA 3V76A 2RF7A 1MO9A 2AQJA 3CNJA 3GMCA 3SZFA 1ZP0A 2QA1A 1GETA 4Z2UA 3UBRA 3SM8A 1PJ5A 4OPCA 2RGHA 1RYIA 2XLTA 5KVIA 1DODA 2XFNA 3PVCA 3F29A 3FG2P 5JCIA 4OPLA 1CHUA 1GRTA 1CJCA 1GRAA 1OJTA 4YXDA 3QFAA 3T2KA 1D5TA 4K5SA 1F8RA 3L1RA 4U2TA 4Y4MA 3BNGA 3EF6A 1B5QA 1L9DA 4NWZA 3LGQA 2GR2A 3QFBA 3BNHA 3KPKA 4C77A 2YR6A 4U8KA 3UKFA 4CNJA 2VVLG 2XLPA 3URHA 3KU9A 5HXIA 3NIXA 4J31A 1ELIA 3VR8A 2WP9A 4L3ZA 2IIDA 1SEZA 1LQUA 1LPFA 4X9MA 3JSKA 4B66A 4H4RA 2R46A 3NK0X 5HY5A 3CGDA 3NYEA 4WX1A 1PXCA 1EL9A 1B4VA 2BK4A 4YSYA 1QO8A 5HYMA 2HQMA 1DOEA 4JNQA 4NEWA 1KSUA 4TM3A 3SGLA 1VG0A 2C64A 2ZBWA 3TORA 4GDEA 1RP0A 4H4TA 2VRLA 3DGHA 4OVIA 2YLTA 2Q0KA 2AAQA 2E80A 1ZOVA 2GR1A 3LZWA 5IQ4A 1PJ6A 1GRHA 2GQWA 4H7UA 1IUSA 1GT8A 3COXA 4GF7A 3NNEA 1O94A 4PAAA 1H82A 1DOCA 1FCDA 1YKJA 2JB3A 2GR3A 2O9ZA 3CIRA 4Y4LA 1FS9A 3G5RA 1PXBA 2OLOA 1PBBA 4DNAA 2R0GA 1VQWA 3KVEA 3CPIG 4YKFA 2GQFA 4MJWA 2B7RA 4WCTA 2YM2A 2XCGA 3C96A 2FJBA 4M52A 3O0HA 3PS9A 1NHQA 4XWRA 4BJYA 5TR3A 5M10A 1BGJA 3D8XA 3T31A 2WOVA 3UOXA 2CULA 4A6NA 3NKSA 2VR0A 2BRAA 2A8XA 4AOXA 3NN6X 5C3JA 2YG3A 3CGBA 2C72A 3CGCA 1DJQA 2BCGG 1GRBA 5KOWA 1Q1RA 2XVIA 1IUWA 3IF9A 1BGNA 3HZLA 2NVKX 3ZDNA 2VVMA 4H4YA 3RNMA 1N4UA 4H4XA 5KMSA 5KMQA 1LQTA 3AEDA 4Z44A 1Z6LA 2YG5A 4EM3A 3F8PA 3G5SA 3T2ZA 3KLJA 1ZOYA 3KD9A 2ZO5A 3LXDA 4C5OA 4BK3A 1F8WA 1DNCA 1NENA 4GUVA 4I59A 4APNA 4OPTA 5IPYA 3FPZA 4B63A 4DSHA 4BJZA 4OPIA 1W4XA 3ALLA 1TDNA 3NK2X 5KWFA 2XLSA 3OZ2A 4Z43A 4RSLA 2C3CA 2C7GA 4TM0A 4U2SA 1JRZA 2NPXA 4D03A 1N1PA 2XVJA 4BURA 1FS7A 1VG9A 3RP7A 3FIMB 3NRNA 3UU9A 2EQ8A 2CDUA 4L38A 2QAEA 4A99A 3IWAA 1CC6A 2PYXA 3RP6A 3MMOA 3M0OA 4IV9A 4N9XA 1Q9IA 1KDGA 2EQ6A 4YTMA 2YLWA 2WQYA 3GRSA 1TDKA 3ADAB 3NLCA 1N4VA 2B76A 3CNDA 1GALA 1F8SA 2WS3A 1NG3A 1ZKQA 2X99A 4KPRA 2XYOA 3AD8B 2WPCA 1F3PA 3SFDA 4ZN0A 3UCLA 3LJPA 3NN0X 4OPUA 1BF3A 1H83A 2GAGB 3AE1A 1FT6A 1QLBA 5EB4A 2E81A 5BRTA 2GH5A 3BNMA 4U8PA 4GR1A 2WDVA 4E0VA 1P2HA 1NHPA 3VRDB 4LA1A 3GWFA 1SP3A 3L1TA 4CRTA 4U8MA 3VQRA 3UKPA 2R45A 3CPHG 2GR0A 2YWLA 5BUKA 2JK6A 2YM1A 3VRBA 4JQ9A 1ZMDA 2X50A 3UOZA 1PXAA 4U8LA 3DJEA 5FS9A 2OT4A 4B1BA 4II2A 4YTNA 2BXRA 3UOVA 2WBAA 2XFOA 4EQSA 1X31B 3AEGA 1GTEA 3CNPA 4KX6A 3PO7A 3DA1A 3S7WA 2YG6A 3AD7B 4LIIA 2V61A 3I3LA 2WDQA 1LV0A 1ZK7A 4IVOB 1YQ4A 1IUUA 3LZXA 1Y0PA 1OJDA 4H4ZA 1BZLA 3BI2A 4NTCA 1IJHA 5KVHA 4U8IA 1PHHA 2GV8A 3SZWA 2V60A 2GVCA 2JBVA 1GXFA 3UTGA 4H2NA 1NEKA 3AE6A 1VRQB 1JRYA 2VQ7A 3LG1A 3BI4A 4EMIA 4OCGA 4UDPA 1JU2A 4TLXA 3HYXA 4FDCB 4USQA 1GSNA 3H4KA 2GF3A 5FS6A 2OALA 2V6OA 4H4SA 2C73A 3AE4A 1KNPA 1H6VA 3EPTA 2WU5A 3ATQA 2BRYA 2BS2A 1XANA 1JRXA 3NTAA 4NEVA 4NNJA 2GRTA 4A7AA 4ADWA 3EAOA 1E7PA 2YLRA 1NDAA 2RGOA 2C67A 3NTDA 4JY2A 4RG4A 4IVMB 2LFCA 2RABA 3RP8A 3ABVA 4BV6A 3D1IA 4EM4A 2OLNA 2JB1A 2X3NA 3FBSA 1B8SA 4FK1C 2VOUA 2YG7A 3BI5A 4P9SA 2WPEA 4EQWA 2RGJA 2GEWA 3ATRA 2C3DA 4H4WA 1GNDA 2ARDA 4ECHA 2WEUA 3LB8A 3OWMA 4Y4NA 1BKWA 5JCNA 4J57A 4CY8A 2R0PA 2WP6A 4GDPA 4J33A 2BYBA 4AP3A 3LOVA 3DJJA 4A6NB 4EQXA 5BULA 1DOBA 2XVEA 5U1OA 3SX6A 3ZYXA 4JNAA 2R4JA 2H89A 4G74A 2CZSA 1YY5A 3K30A 1M6IA 2TMDA 2ACZA 3F8RA 5GSNA 5LV9A 3BNJA 3KKJA 1EL8A 2X8GA 4A9WA 3DMEA 1ONFA 1M1PA 2E4GA 2GMJA 5CKUA 1S2QA 4NTDA 1E1MA 3NYFA 4U8OA 5KOXA 1M1RA 3GYIA 4IA6A 3SYIA 4Z26A 2YVGA 5JCKA 3NG7X 1F6MA 3HYWA 3LADA 5KMRA 3AE8A 4YSZA 4BK2A 3CMMA 1H86A 3DJGX 3REDA 1NHSA 4UP3A 4L3YA 3AEBA 3CPJG 4II3A 4GAPA 1TYPA 1PBFA 4J56A 1AOGA 4GCMA 2A89A 1ZX9A 1TRBA 2WPFA 4K7ZA 3UKLA 2EQ9A 4Q17A 2C70A 1JEHA 3UTFA 4CCRA 3RKHA 2JAEA 2YQUA 2WDRA 2GMHA 5FS7A 4O5QA 4YWOA 3UKAA 4YT0A 3K7QX 4DSGA 1TDFA 4L3XA 2Y6QA 2RDZA 4EIPA 1E6EA 3GWDA 1LVLA 2XVHA 1CC4A 4B64A 1D4DA 4NTEA 1KFYA 2BA9A 1MOKA 3UOYA 3QVRA 1PBCA 3B3RA 1S2YA 1GRGA 3ICTA 3GM6A 1EL7A 2V3BA 4K8DA 4Q5CA 2FJAA 1YQZA 2XLUA 4BK1A 2CFYA 2WOIA 3S5WA 1PJ7A 2FJDA 3BHKA 4Z2TA 3M13A 1JOAA 3P9UA 2XFQA 2J3NA 3AE2A 2BK3A 3IC9A 3NYCA 4U2LA 3UP5A 3VR9A 3ITJA 5C2TA 4ICYA 3WE0A 2IVDA 1LJ1A 1KSSA 4O5UA 1S3BA 3DGZA 2UZZA 1FOHA 3RHAA 1NHRA 4CY6A 3Q9TA 1K0IA 4A65A 1CJ4A 1XPQA 1V59A 5FS8A 3T0KA 2QA2A 2ZZ0A 3AECA 3CGEA 2JKCA 2DKIA 1CF3A 2YVFA 3AEAA 3UKHA 2VQBA 2QCUA 1REOA 4H2QA 4TLZA 2Q0LA 1GTHA 4AP1A 4YSXA 1XHCA 4B68A 3SZ0A 1QDBA 3AYJA 1EL5A 1O5WA 2V3AA 2WESA 2WETA 1PDHA 2Z5XA 2C4CA 3S61A 3GD4A 5EOWA 3AE7A 3TTBA 4FX9A 1GV4A 1IUTA 4PABA 2IVEA 2R9ZA 3P4SA 3QJ4A 2YG4A 5HHFA 1YQ3A 2XDOA 4XXGA 4AT2A 2V5ZA 1JNRA 1ZMCA 2WHDA 3ALJA 5J7XA 2F5ZA 4Q0TA 1KNRA 1CJ3A 4GRTA 3NT6A 1TYTA 4HB9A 4UDQA 1VDCA 2GB0A 4ZCDA 3T2YA 4Z25A 4A79A 1E39A 1D4EA 3GDPA 2GAHB 5KNLA 3DK4A 1M64A 1COYA 2BXSA 2YAUA 3IHGA 1Y56B 3H8IA 4U8NA 4U8JA 3KA7A 3SXQA 3GMBA 2YLSA 1H7XA 3DK8A 2VZ2A 2W0HA 1NAAA 3Q6JA 4IA5A 4X9NA 4EMJA 2BK5A 4YTPA 3II4A 3CTYA 2WP5A 5EB5A 1ZY8A 1QJDA 1KF6A 1CL0A 1S3EA 3QVPA 2XLRA 4RG3A 2YR5A 3AB1A 2C65A 4H4QA 3SXIA 1K0LA 2C76A 1P2EA 3SY4A 3SZCA 1XDIA 3D1CA 1FL2A 4J34A 5DBJA 2DKHA 4ZCCA 4B65A 1BVBA 2BC0A 4X4JA 2B9WA 4CCQA 3CNSA 2ZZBA 1RSGA 3KPFA 4LU6A 1GU6A 5M0ZA 2A87A 3L8KA 3UP4A 2OAMA 1TDEA 2PHHA 3CN8A 3V3OA 3AEEA 4A5LA 1D4CA 3UTHA 4CNKA 4I58A 3QSSA 1DJNA 1MXTA 2XVFA 4H4UA 2Z5YA 3AE5A 3AEFA 5U63A 1NPXA 1GREA 1OJ9A 1N4WA 1Q1WA 3DH9A 3SFEA 4AT0A 4B69A 3C4NA 2YR4A 3AYIA 4C3YA 1GESA 1GRFA 4G6HA 2WOWA 1ZDLA 3QSEA 1CBOA 2R0CA 5U25A 4USRA 4H2PA 2VRMA 1L9CA 2APGA 1E1KA 4K22A 4K2XA 3M12A 1L0VA 1OJCA 1FEBA 3UKQA 1H7WA 1LTXR 4EQRA 4GAVA 3AWIA 3GYJA 3V3NA 4Q1OA 4XWZA 2BS3A 2J7AA 1GPEA 1HYUA 3NH3X 4JY3A 4JDRA 3C4AA 1IUXA 1E1LA 1TDOA 5JCMA 5KRQA 3AE9A 4Q4UA
chains in the Genus database with same CATH topology
4J2WA 1L9EA 2B9XA 3ALMA 4G73A 4H4VA 1D7LA 4JN9A 3AD9B 1JNZA 1OAHA 3T37A 2BACA 3NGCX 1GERA 2TPRA 4G9KA 2ZZCA 4J36A 2C66A 3GRTA 4B67A 2BS4A 3E1TA 4CBQA 1IUVA 2CVJA 4C74A 1FS8A 3DJDA 1PS9A 3G5QA 1K4QA 5J60A 4EMWA 1M1QA 2I0ZA 1FECA 3P4PA 3VRAA 2H88A 2AR8A 4OPDA 1OJAA 4UDRA 1B37A 3GYXA 3UTEA 4Q5BA 1FEAA 3P4RA 4TM1A 4C3XA 3H8LA 1GOSA 1UKVG 2R4EA 2BCPA 3HYVA 4OPGA 3FO3A 4H4PA 2K3VA 1PBEA 2YVJA 4G6GA 1EBDA 1JNIA 3GDNA 2OA1A 3K7TA 5L46A 2C75A 2XFPA 1CJ2A 4H2RA 2Q7VA 2B9YA 2Y6RA 3GD3A 3F8DA 4YKGA 5IQ1A 1NG4A 2E5VA 1O95A 5ER0A 1Y56A 2VVLA 5GRTA 4YSHA 3K7MX 5KMPA 3DK9A 4HA6A 4D04A 2EQ7A 1E1NA 3GSIA 3R9UA 4EIQA 5EBKA 5FMHA 4AOSA 2JB2A 3BNUA 2B7SA 3ISHA 4Z2RA 2XFUA 4REKA 3AXBA 1CC2A 3BHFA 5KXJA 4NZHA 3AE3A 3OC4A 2E1MA 4FK1A 3QSMA 1D7YA 3B6DA 3IHMA 3AYLA 2WU2A 3UKKA 3P4QA 3T14A 1FT5A 4Z24A 2BC1A 2BABA 3EANA 3SCEA 1H81A 3CNTA 1GEUA 3I6DA 3ICSA 4H50A 3SQPA 1BWCA 1H84A 1PN0A 2Q6UA 3NK1X 3P1WA 4K5RA 1DXLA 2FJEA 3FMWA 4TM4A 2YLZA 3ICRA 1PBDA 4DGKA 2X8HA 3BNFA 4WJYA 5BVAA 3NHOX 2YLXA 5CQFA 2X8CA 5JCLA 1K0JA 2FBWA 3V76A 2RF7A 1MO9A 2AQJA 3CNJA 3GMCA 3SZFA 1ZP0A 2QA1A 1GETA 4Z2UA 3UBRA 3SM8A 1PJ5A 4OPCA 2RGHA 1RYIA 2XLTA 5KVIA 1DODA 2XFNA 3PVCA 3F29A 3FG2P 5JCIA 4OPLA 1CHUA 1GRTA 1CJCA 1GRAA 1OJTA 4YXDA 3QFAA 3T2KA 1D5TA 4K5SA 1F8RA 3L1RA 4U2TA 4Y4MA 3BNGA 3EF6A 1B5QA 1L9DA 4NWZA 3LGQA 2GR2A 3QFBA 3BNHA 3KPKA 4C77A 2YR6A 4U8KA 3UKFA 4CNJA 2VVLG 2XLPA 3URHA 3KU9A 5HXIA 3NIXA 4J31A 1ELIA 3VR8A 2WP9A 4L3ZA 2IIDA 1SEZA 1LQUA 1LPFA 4X9MA 3JSKA 4B66A 4H4RA 2R46A 3NK0X 5HY5A 3CGDA 3NYEA 4WX1A 1PXCA 1EL9A 1B4VA 2BK4A 4YSYA 1QO8A 5HYMA 2HQMA 1DOEA 4JNQA 4NEWA 1KSUA 4TM3A 3SGLA 1VG0A 2C64A 2ZBWA 3TORA 4GDEA 1RP0A 4H4TA 2VRLA 3DGHA 4OVIA 2YLTA 2Q0KA 2AAQA 2E80A 1ZOVA 2GR1A 3LZWA 5IQ4A 1PJ6A 1GRHA 2GQWA 4H7UA 1IUSA 1GT8A 3COXA 4GF7A 3NNEA 1O94A 4PAAA 1H82A 1DOCA 1FCDA 1YKJA 2JB3A 2GR3A 2O9ZA 3CIRA 4Y4LA 1FS9A 3G5RA 1PXBA 2OLOA 1PBBA 4DNAA 2R0GA 1VQWA 3KVEA 3CPIG 4YKFA 2GQFA 4MJWA 2B7RA 4WCTA 2YM2A 2XCGA 3C96A 2FJBA 4M52A 3O0HA 3PS9A 1NHQA 4XWRA 4BJYA 5TR3A 5M10A 1BGJA 3D8XA 3T31A 2WOVA 3UOXA 2CULA 4A6NA 3NKSA 2VR0A 2BRAA 2A8XA 4AOXA 3NN6X 5C3JA 2YG3A 3CGBA 2C72A 3CGCA 1DJQA 2BCGG 1GRBA 5KOWA 1Q1RA 2XVIA 1IUWA 3IF9A 1BGNA 3HZLA 2NVKX 3ZDNA 2VVMA 4H4YA 3RNMA 1N4UA 4H4XA 5KMSA 5KMQA 1LQTA 3AEDA 4Z44A 1Z6LA 2YG5A 4EM3A 3F8PA 3G5SA 3T2ZA 3KLJA 1ZOYA 3KD9A 2ZO5A 3LXDA 4C5OA 4BK3A 1F8WA 1DNCA 1NENA 4GUVA 4I59A 4APNA 4OPTA 5IPYA 3FPZA 4B63A 4DSHA 4BJZA 4OPIA 1W4XA 3ALLA 1TDNA 3NK2X 5KWFA 2XLSA 3OZ2A 4Z43A 4RSLA 2C3CA 2C7GA 4TM0A 4U2SA 1JRZA 2NPXA 4D03A 1N1PA 2XVJA 4BURA 1FS7A 1VG9A 3RP7A 3FIMB 3NRNA 3UU9A 2EQ8A 2CDUA 4L38A 2QAEA 4A99A 3IWAA 1CC6A 2PYXA 3RP6A 3MMOA 3M0OA 4IV9A 4N9XA 1Q9IA 1KDGA 2EQ6A 4YTMA 2YLWA 2WQYA 3GRSA 1TDKA 3ADAB 3NLCA 1N4VA 2B76A 3CNDA 1GALA 1F8SA 2WS3A 1NG3A 1ZKQA 2X99A 4KPRA 2XYOA 3AD8B 2WPCA 1F3PA 3SFDA 4ZN0A 3UCLA 3LJPA 3NN0X 4OPUA 1BF3A 1H83A 2GAGB 3AE1A 1FT6A 1QLBA 5EB4A 2E81A 5BRTA 2GH5A 3BNMA 4U8PA 4GR1A 2WDVA 4E0VA 1P2HA 1NHPA 3VRDB 4LA1A 3GWFA 1SP3A 3L1TA 4CRTA 4U8MA 3VQRA 3UKPA 2R45A 3CPHG 2GR0A 2YWLA 5BUKA 2JK6A 2YM1A 3VRBA 4JQ9A 1ZMDA 2X50A 3UOZA 1PXAA 4U8LA 3DJEA 5FS9A 2OT4A 4B1BA 4II2A 4YTNA 2BXRA 3UOVA 2WBAA 2XFOA 4EQSA 1X31B 3AEGA 1GTEA 3CNPA 4KX6A 3PO7A 3DA1A 3S7WA 2YG6A 3AD7B 4LIIA 2V61A 3I3LA 2WDQA 1LV0A 1ZK7A 4IVOB 1YQ4A 1IUUA 3LZXA 1Y0PA 1OJDA 4H4ZA 1BZLA 3BI2A 4NTCA 1IJHA 5KVHA 4U8IA 1PHHA 2GV8A 3SZWA 2V60A 2GVCA 2JBVA 1GXFA 3UTGA 4H2NA 1NEKA 3AE6A 1VRQB 1JRYA 2VQ7A 3LG1A 3BI4A 4EMIA 4OCGA 4UDPA 1JU2A 4TLXA 3HYXA 4FDCB 4USQA 1GSNA 3H4KA 2GF3A 5FS6A 2OALA 2V6OA 4H4SA 2C73A 3AE4A 1KNPA 1H6VA 3EPTA 2WU5A 3ATQA 2BRYA 2BS2A 1XANA 1JRXA 3NTAA 4NEVA 4NNJA 2GRTA 4A7AA 4ADWA 3EAOA 1E7PA 2YLRA 1NDAA 2RGOA 2C67A 3NTDA 4JY2A 4RG4A 4IVMB 2LFCA 2RABA 3RP8A 3ABVA 4BV6A 3D1IA 4EM4A 2OLNA 2JB1A 2X3NA 3FBSA 1B8SA 4FK1C 2VOUA 2YG7A 3BI5A 4P9SA 2WPEA 4EQWA 2RGJA 2GEWA 3ATRA 2C3DA 4H4WA 1GNDA 2ARDA 4ECHA 2WEUA 3LB8A 3OWMA 4Y4NA 1BKWA 5JCNA 4J57A 4CY8A 2R0PA 2WP6A 4GDPA 4J33A 2BYBA 4AP3A 3LOVA 3DJJA 4A6NB 4EQXA 5BULA 1DOBA 2XVEA 5U1OA 3SX6A 3ZYXA 4JNAA 2R4JA 2H89A 4G74A 1YY5A 3K30A 1M6IA 2TMDA 2ACZA 3F8RA 5GSNA 5LV9A 3BNJA 3KKJA 1EL8A 2X8GA 4A9WA 3DMEA 1ONFA 1M1PA 2E4GA 2GMJA 5CKUA 1S2QA 4NTDA 1E1MA 3NYFA 4U8OA 5KOXA 1M1RA 3GYIA 4IA6A 3SYIA 4Z26A 2YVGA 5JCKA 3NG7X 1F6MA 3HYWA 3LADA 5KMRA 3AE8A 4YSZA 4BK2A 3CMMA 1H86A 3DJGX 3REDA 1NHSA 4UP3A 4L3YA 3AEBA 3CPJG 4II3A 4GAPA 1TYPA 1PBFA 4J56A 1AOGA 4GCMA 2A89A 1ZX9A 1TRBA 2WPFA 4K7ZA 3UKLA 2EQ9A 4Q17A 2C70A 1JEHA 3UTFA 4CCRA 3RKHA 2JAEA 2YQUA 2WDRA 2GMHA 5FS7A 4O5QA 4YWOA 3UKAA 4YT0A 3K7QX 4DSGA 1TDFA 4L3XA 2Y6QA 2RDZA 4EIPA 1E6EA 3GWDA 1LVLA 2XVHA 1CC4A 4B64A 1D4DA 4NTEA 1KFYA 2BA9A 1MOKA 3UOYA 3QVRA 1PBCA 3B3RA 1S2YA 1GRGA 3ICTA 3GM6A 1EL7A 2V3BA 4K8DA 4Q5CA 2FJAA 1YQZA 2XLUA 4BK1A 2CFYA 2WOIA 3S5WA 1PJ7A 2FJDA 3BHKA 4Z2TA 3M13A 1JOAA 3P9UA 2XFQA 2J3NA 3AE2A 2BK3A 3IC9A 3NYCA 4U2LA 3UP5A 3VR9A 3ITJA 5C2TA 4ICYA 3WE0A 2IVDA 1LJ1A 1KSSA 4O5UA 1S3BA 3DGZA 2UZZA 1FOHA 3RHAA 1NHRA 4CY6A 3Q9TA 1K0IA 4A65A 1CJ4A 1XPQA 1V59A 5FS8A 3T0KA 2QA2A 2ZZ0A 3AECA 3CGEA 2JKCA 2DKIA 1CF3A 2YVFA 3AEAA 3UKHA 2VQBA 2QCUA 1REOA 4H2QA 4TLZA 2Q0LA 1GTHA 4AP1A 4YSXA 1XHCA 4B68A 3SZ0A 1QDBA 3AYJA 1EL5A 1O5WA 2V3AA 2WESA 2WETA 1PDHA 2Z5XA 2C4CA 3S61A 3GD4A 5EOWA 3AE7A 3TTBA 4FX9A 1GV4A 1IUTA 4PABA 2IVEA 2R9ZA 3P4SA 3QJ4A 2YG4A 5HHFA 1YQ3A 2XDOA 4XXGA 4AT2A 2V5ZA 1JNRA 1ZMCA 2WHDA 3ALJA 5J7XA 2F5ZA 4Q0TA 1KNRA 1CJ3A 4GRTA 3NT6A 1TYTA 4HB9A 4UDQA 1VDCA 2GB0A 4ZCDA 3T2YA 4Z25A 4A79A 1E39A 1D4EA 3GDPA 2GAHB 5KNLA 3DK4A 1M64A 1COYA 2BXSA 2YAUA 3IHGA 1Y56B 3H8IA 4U8NA 4U8JA 3KA7A 3SXQA 3GMBA 2YLSA 1H7XA 3DK8A 2VZ2A 2W0HA 1NAAA 3Q6JA 4IA5A 4X9NA 4EMJA 2BK5A 4YTPA 3II4A 3CTYA 2WP5A 5EB5A 1ZY8A 1QJDA 1KF6A 1CL0A 1S3EA 3QVPA 2XLRA 4RG3A 2YR5A 3AB1A 2C65A 4H4QA 3SXIA 1K0LA 2C76A 1P2EA 3SY4A 3SZCA 1XDIA 3D1CA 1FL2A 4J34A 5DBJA 2DKHA 4ZCCA 4B65A 1BVBA 2BC0A 4X4JA 2B9WA 4CCQA 3CNSA 2ZZBA 1RSGA 3KPFA 4LU6A 1GU6A 5M0ZA 2A87A 3L8KA 3UP4A 2OAMA 1TDEA 2PHHA 3CN8A 3V3OA 3AEEA 4A5LA 1D4CA 3UTHA 4CNKA 4I58A 3QSSA 1DJNA 1MXTA 2XVFA 4H4UA 2Z5YA 3AE5A 3AEFA 5U63A 1NPXA 1GREA 1OJ9A 1N4WA 1Q1WA 3DH9A 3SFEA 4AT0A 4B69A 3C4NA 2YR4A 3AYIA 4C3YA 1GESA 1GRFA 4G6HA 2WOWA 1ZDLA 3QSEA 1CBOA 2R0CA 5U25A 4USRA 4H2PA 2VRMA 1L9CA 2APGA 1E1KA 4K22A 4K2XA 3M12A 1L0VA 1OJCA 1FEBA 3UKQA 1H7WA 1LTXR 4EQRA 4GAVA 3AWIA 3GYJA 3V3NA 4Q1OA 4XWZA 2BS3A 2J7AA 1GPEA 1HYUA 3NH3X 4JY3A 4JDRA 3C4AA 1IUXA 1E1LA 1TDOA 5JCMA 5KRQA 3AE9A 4Q4UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J2W A;  1L9E A;  2B9X A;  3ALM A;  4H4V A;  1D7L A;  4JN9 A;  3AD9 B;  1JNZ A;  1OAH A;  3T37 A;  2BAC A;  3NGC X;  1GER A;  2TPR A;  4J36 A;  2ZZC A;  2C66 A;  3GRT A;  4B67 A;  2BS4 A;  3E1T A;  4CBQ A;  1IUV A;  2CVJ A;  4C74 A;  1FS8 A;  3DJD A;  1PS9 A;  3G5Q A;  1K4Q A;  5J60 A;  4EMW A;  1M1Q A;  2I0Z A;  1FEC A;  3P4P A;  3VRA A;  2H88 A;  2AR8 A;  4OPD A;  1OJA A;  4UDR A;  1B37 A;  3UTE A;  3GYX A;  4Q5B A;  1FEA A;  3P4R A;  4TM1 A;  4C3X A;  3H8L A;  1GOS A;  1UKV G;  2R4E A;  2BCP A;  4OPG A;  4DGK A;  3FO3 A;  4H4P A;  2K3V A;  1PBE A;  2YVJ A;  1EBD A;  1JNI A;  3GDN A;  2OA1 A;  3K7T A;  5L46 A;  2C75 A;  2XFP A;  1CJ2 A;  4H2R A;  2Q7V A;  2B9Y A;  2Y6R A;  3GD3 A;  3F8D A;  4YKG A;  5IQ1 A;  1NG4 A;  2E5V A;  1O95 A;  5ER0 A;  1Y56 A;  2VVL A;  5GRT A;  4YSH A;  3K7M X;  3DK9 A;  4HA6 A;  4D04 A;  2EQ7 A;  1E1N A;  3GSI A;  3R9U A;  4EIQ A;  5EBK A;  5FMH A;  4AOS A;  2JB2 A;  3BNU A;  2B7S A;  3ISH A;  4Z2R A;  2XFU A;  4REK A;  3AXB A;  1CC2 A;  3BHF A;  5KXJ A;  4NZH A;  3AE3 A;  3OC4 A;  2E1M A;  4FK1 A;  3QSM A;  1D7Y A;  3B6D A;  3IHM A;  3AYL A;  2WU2 A;  3UKK A;  3P4Q A;  1FT5 A;  4Z24 A;  2BC1 A;  2BAB A;  3EAN A;  3SCE A;  1H81 A;  3CNT A;  1GEU A;  3I6D A;  3ICS A;  4H50 A;  3SQP A;  1BWC A;  1H84 A;  1PN0 A;  2Q6U A;  3NK1 X;  3P1W A;  4K5R A;  1DXL A;  2FJE A;  3FMW A;  4TM4 A;  2YLZ A;  3ICR A;  1PBD A;  2X8H A;  3BNF A;  4WJY A;  5BVA A;  3NHO X;  2YLX A;  5CQF A;  2X8C A;  5JCL A;  1K0J A;  2FBW A;  3V76 A;  2RF7 A;  1MO9 A;  2AQJ A;  3CNJ A;  3GMC A;  1ZP0 A;  2QA1 A;  1GET A;  4Z2U A;  3UBR A;  3SM8 A;  1PJ5 A;  4OPC A;  2RGH A;  1RYI A;  2XLT A;  5KVI A;  1DOD A;  2XFN A;  3PVC A;  3F29 A;  3FG2 P;  5JCI A;  4OPL A;  1CHU A;  1GRT A;  1CJC A;  1GRA A;  1OJT A;  4YXD A;  3QFA A;  1D5T A;  4K5S A;  1F8R A;  3L1R A;  4U2T A;  4Y4M A;  3BNG A;  3EF6 A;  1B5Q A;  1L9D A;  3LGQ A;  2GR2 A;  3QFB A;  3BNH A;  4C77 A;  2YR6 A;  4U8K A;  3UKF A;  4CNJ A;  2VVL G;  2XLP A;  3URH A;  3KU9 A;  5HXI A;  3NIX A;  4J31 A;  1ELI A;  3VR8 A;  2WP9 A;  4L3Z A;  2IID A;  1SEZ A;  1LQU A;  1LPF A;  4X9M A;  3JSK A;  4B66 A;  4H4R A;  2R46 A;  3NK0 X;  5HY5 A;  3CGD A;  3NYE A;  4WX1 A;  1PXC A;  1EL9 A;  1B4V A;  2BK4 A;  4YSY A;  1QO8 A;  5HYM A;  2HQM A;  1DOE A;  4JNQ A;  4NEW A;  1KSU A;  4TM3 A;  3SGL A;  1VG0 A;  2C64 A;  2ZBW A;  3TOR A;  4GDE A;  1RP0 A;  4H4T A;  2VRL A;  3DGH A;  4OVI A;  2YLT A;  2Q0K A;  2AAQ A;  2E80 A;  1ZOV A;  2GR1 A;  3LZW A;  5IQ4 A;  1PJ6 A;  1GRH A;  2GQW A;  4H7U A;  1IUS A;  1GT8 A;  3COX A;  4GF7 A;  3NNE A;  1O94 A;  4PAA A;  1H82 A;  1DOC A;  1FCD A;  1YKJ A;  2JB3 A;  2GR3 A;  2O9Z A;  3CIR A;  4Y4L A;  1FS9 A;  3G5R A;  1PXB A;  2OLO A;  1PBB A;  4DNA A;  2R0G A;  1VQW A;  3KVE A;  3CPI G;  4YKF A;  2GQF A;  4MJW A;  2B7R A;  4WCT A;  2YM2 A;  2XCG A;  3C96 A;  2FJB A;  4M52 A;  3O0H A;  3PS9 A;  1NHQ A;  4XWR A;  4BJY A;  5TR3 A;  5M10 A;  1BGJ A;  3D8X A;  2WOV A;  3UOX A;  2CUL A;  4A6N A;  3NKS A;  2VR0 A;  2A8X A;  4AOX A;  3NN6 X;  5C3J A;  2YG3 A;  3CGB A;  2C72 A;  3CGC A;  1DJQ A;  2BCG G;  1GRB A;  5KOW A;  1Q1R A;  2XVI A;  1IUW A;  3IF9 A;  1BGN A;  3HZL A;  2NVK X;  3ZDN A;  2VVM A;  4H4Y A;  3RNM A;  1N4U A;  4H4X A;  1LQT A;  3AED A;  4Z44 A;  1Z6L A;  2YG5 A;  4EM3 A;  3F8P A;  3G5S A;  3KLJ A;  1ZOY A;  3KD9 A;  2ZO5 A;  3LXD A;  4C5O A;  4BK3 A;  1F8W A;  1DNC A;  1NEN A;  4GUV A;  4I59 A;  4APN A;  4OPT A;  5IPY A;  3FPZ A;  4B63 A;  4DSH A;  4BJZ A;  4OPI A;  1W4X A;  3ALL A;  1TDN A;  3NK2 X;  5KWF A;  2XLS A;  3OZ2 A;  4Z43 A;  4RSL A;  2C3C A;  2C7G A;  4TM0 A;  4U2S A;  1JRZ A;  2NPX A;  4D03 A;  1N1P A;  2XVJ A;  4BUR A;  1FS7 A;  1VG9 A;  3RP7 A;  3FIM B;  3NRN A;  3UU9 A;  2EQ8 A;  2CDU A;  4L38 A;  2QAE A;  4A99 A;  3IWA A;  1CC6 A;  2PYX A;  3RP6 A;  3MMO A;  3M0O A;  4IV9 A;  4N9X A;  1Q9I A;  1KDG A;  2EQ6 A;  4YTM A;  2YLW A;  2WQY A;  3GRS A;  1TDK A;  3ADA B;  3NLC A;  1N4V A;  2B76 A;  3CND A;  1GAL A;  1F8S A;  2WS3 A;  1NG3 A;  1ZKQ A;  2X99 A;  4KPR A;  2XYO A;  3AD8 B;  2WPC A;  1F3P A;  3SFD A;  4ZN0 A;  3UCL A;  3LJP A;  3NN0 X;  4OPU A;  1BF3 A;  1H83 A;  2GAG B;  3AE1 A;  1FT6 A;  1QLB A;  5EB4 A;  2E81 A;  5BRT A;  2GH5 A;  3BNM A;  4U8P A;  4GR1 A;  2WDV A;  4E0V A;  1P2H A;  1NHP A;  3VRD B;  4LA1 A;  3GWF A;  1SP3 A;  3L1T A;  4CRT A;  4U8M A;  3VQR A;  3UKP A;  2R45 A;  3CPH G;  2GR0 A;  2YWL A;  5BUK A;  2JK6 A;  2YM1 A;  3VRB A;  4JQ9 A;  1ZMD A;  2X50 A;  3UOZ A;  1PXA A;  4U8L A;  3DJE A;  5FS9 A;  2OT4 A;  4B1B A;  4YTN A;  2BXR A;  3UOV A;  2WBA A;  2XFO A;  4EQS A;  1X31 B;  3AEG A;  1GTE A;  3CNP A;  4KX6 A;  3PO7 A;  3DA1 A;  3S7W A;  2YG6 A;  3AD7 B;  4LII A;  2V61 A;  3I3L A;  2WDQ A;  1LV0 A;  1ZK7 A;  4IVO B;  1YQ4 A;  1IUU A;  3LZX A;  1Y0P A;  1OJD A;  4H4Z A;  1BZL A;  3BI2 A;  4NTC A;  1IJH A;  5KVH A;  4U8I A;  1PHH A;  2GV8 A;  2V60 A;  2GVC A;  2JBV A;  1GXF A;  3UTG A;  4H2N A;  1NEK A;  3AE6 A;  1VRQ B;  1JRY A;  2VQ7 A;  3LG1 A;  3BI4 A;  4EMI A;  4OCG A;  4UDP A;  1JU2 A;  4TLX A;  4FDC B;  4USQ A;  1GSN A;  3H4K A;  2GF3 A;  5FS6 A;  2OAL A;  2V6O A;  4H4S A;  2C73 A;  3AE4 A;  1KNP A;  1H6V A;  3EPT A;  2WU5 A;  3ATQ A;  2BS2 A;  3NTA A;  1XAN A;  1JRX A;  4A7A A;  4NEV A;  2GRT A;  4ADW A;  4YSX A;  3EAO A;  1E7P A;  2YLR A;  1NDA A;  2RGO A;  2C67 A;  3NTD A;  4JY2 A;  4RG4 A;  4IVM B;  2LFC A;  2RAB A;  3RP8 A;  3ABV A;  4BV6 A;  3D1I A;  4EM4 A;  2OLN A;  2JB1 A;  2X3N A;  3FBS A;  1B8S A;  4FK1 C;  2VOU A;  2YG7 A;  3BI5 A;  4P9S A;  2WPE A;  4EQW A;  2RGJ A;  2GEW A;  3ATR A;  2C3D A;  4H4W A;  1GND A;  2ARD A;  4ECH A;  2WEU A;  3LB8 A;  3OWM A;  4Y4N A;  1BKW A;  5JCN A;  4J57 A;  4CY8 A;  2R0P A;  2WP6 A;  4GDP A;  4J33 A;  2BYB A;  4AP3 A;  3LOV A;  3DJJ A;  4A6N B;  4EQX A;  5BUL A;  1DOB A;  2XVE A;  5U1O A;  3ZYX A;  4JNA A;  2R4J A;  2H89 A;  1YY5 A;  3K30 A;  1M6I A;  2TMD A;  2ACZ A;  3F8R A;  5GSN A;  5LV9 A;  3BNJ A;  3KKJ A;  1EL8 A;  2X8G A;  4A9W A;  3DME A;  1ONF A;  1M1P A;  2E4G A;  2GMJ A;  5CKU A;  1S2Q A;  4NTD A;  1E1M A;  3NYF A;  4U8O A;  5KOX A;  1M1R A;  3GYI A;  4IA6 A;  4Z26 A;  5JCK A;  2YVG A;  3NG7 X;  1F6M A;  3LAD A;  3AE8 A;  4YSZ A;  4BK2 A;  3RED A;  1H86 A;  3DJG X;  1NHS A;  4UP3 A;  4L3Y A;  3AEB A;  3CPJ G;  1TYP A;  1PBF A;  4J56 A;  1AOG A;  4GCM A;  2A89 A;  1ZX9 A;  1TRB A;  2WPF A;  4K7Z A;  3UKL A;  2EQ9 A;  4Q17 A;  2C70 A;  1JEH A;  3UTF A;  4CCR A;  3RKH A;  2JAE A;  2YQU A;  2WDR A;  2GMH A;  5FS7 A;  4O5Q A;  4YWO A;  3UKA A;  4YT0 A;  3K7Q X;  4DSG A;  1TDF A;  4L3X A;  2Y6Q A;  2RDZ A;  4EIP A;  1E6E A;  3GWD A;  1LVL A;  2XVH A;  1CC4 A;  4B64 A;  1D4D A;  4NTE A;  1KFY A;  2BA9 A;  1MOK A;  3UOY A;  3QVR A;  1PBC A;  3B3R A;  1S2Y A;  1GRG A;  3ICT A;  3GM6 A;  1EL7 A;  2V3B A;  4K8D A;  4Q5C A;  2FJA A;  1YQZ A;  2XLU A;  4BK1 A;  2CFY A;  2WOI A;  3S5W A;  1PJ7 A;  2FJD A;  3BHK A;  4Z2T A;  3M13 A;  1JOA A;  3P9U A;  2XFQ A;  2J3N A;  3AE2 A;  2BK3 A;  3IC9 A;  3NYC A;  4U2L A;  3UP5 A;  3VR9 A;  3ITJ A;  5C2T A;  4ICY A;  3WE0 A;  2IVD A;  1LJ1 A;  1KSS A;  4O5U A;  1S3B A;  3DGZ A;  2UZZ A;  1FOH A;  3RHA A;  1NHR A;  4CY6 A;  3Q9T A;  1K0I A;  4A65 A;  1CJ4 A;  1XPQ A;  1V59 A;  5FS8 A;  2QA2 A;  2ZZ0 A;  3AEC A;  3CGE A;  2JKC A;  2DKI A;  1CF3 A;  2YVF A;  3AEA A;  3UKH A;  2VQB A;  2QCU A;  1REO A;  4H2Q A;  4TLZ A;  2Q0L A;  1GTH A;  4AP1 A;  1XHC A;  4B68 A;  1QDB A;  3AYJ A;  1EL5 A;  1O5W A;  2V3A A;  2WES A;  2WET A;  1PDH A;  2Z5X A;  3S61 A;  3GD4 A;  5EOW A;  3AE7 A;  3TTB A;  4FX9 A;  1GV4 A;  1IUT A;  4PAB A;  2IVE A;  2R9Z A;  3P4S A;  3QJ4 A;  2YG4 A;  5HHF A;  1YQ3 A;  2XDO A;  4XXG A;  4AT2 A;  2V5Z A;  1JNR A;  1ZMC A;  2WHD A;  3ALJ A;  5J7X A;  2F5Z A;  4Q0T A;  1KNR A;  1CJ3 A;  4GRT A;  3NT6 A;  1TYT A;  4HB9 A;  4UDQ A;  1VDC A;  2GB0 A;  4ZCD A;  4Z25 A;  4A79 A;  1E39 A;  1D4E A;  3GDP A;  2GAH B;  3DK4 A;  1M64 A;  1COY A;  2BXS A;  2YAU A;  3IHG A;  1Y56 B;  3H8I A;  4U8N A;  4U8J A;  3KA7 A;  3SXQ A;  3GMB A;  2YLS A;  1H7X A;  3DK8 A;  2VZ2 A;  2W0H A;  1NAA A;  3Q6J A;  4IA5 A;  4X9N A;  4EMJ A;  2BK5 A;  4YTP A;  3II4 A;  3CTY A;  2WP5 A;  5EB5 A;  1ZY8 A;  1QJD A;  1KF6 A;  1CL0 A;  1S3E A;  3QVP A;  2XLR A;  4RG3 A;  2YR5 A;  3AB1 A;  2C65 A;  4H4Q A;  1K0L A;  2C76 A;  1P2E A;  1XDI A;  3D1C A;  1FL2 A;  4J34 A;  5DBJ A;  2DKH A;  4ZCC A;  4B65 A;  1BVB A;  2BC0 A;  4X4J A;  2B9W A;  4CCQ A;  3CNS A;  2ZZB A;  1RSG A;  3KPF A;  4LU6 A;  1GU6 A;  5M0Z A;  2A87 A;  3L8K A;  3UP4 A;  2OAM A;  1TDE A;  2PHH A;  3CN8 A;  3V3O A;  3AEE A;  4A5L A;  1D4C A;  3UTH A;  4CNK A;  4I58 A;  3QSS A;  1DJN A;  1MXT A;  2XVF A;  4H4U A;  2Z5Y A;  3AE5 A;  3AEF A;  5U63 A;  1NPX A;  1GRE A;  1OJ9 A;  1N4W A;  1Q1W A;  3DH9 A;  3SFE A;  4AT0 A;  4B69 A;  3C4N A;  2YR4 A;  3AYI A;  4C3Y A;  1GES A;  1GRF A;  2WOW A;  1ZDL A;  3QSE A;  1CBO A;  2R0C A;  5U25 A;  4USR A;  4H2P A;  2VRM A;  1L9C A;  2APG A;  1E1K A;  4K22 A;  4K2X A;  3M12 A;  1L0V A;  1OJC A;  1FEB A;  3UKQ A;  1H7W A;  1LTX R;  4EQR A;  3AWI A;  3GYJ A;  3V3N A;  4Q1O A;  4XWZ A;  2BS3 A;  2J7A A;  1GPE A;  1HYU A;  3NH3 X;  4JY3 A;  4JDR A;  3C4A A;  1IUX A;  1E1L A;  1TDO A;  5JCM A;  5KRQ A;  3AE9 A;  4Q4U A; 
#chains in the Genus database with same CATH topology
 4J2W A;  1L9E A;  2B9X A;  3ALM A;  4G73 A;  4H4V A;  1D7L A;  4JN9 A;  3AD9 B;  1JNZ A;  1OAH A;  3T37 A;  2BAC A;  3NGC X;  1GER A;  2TPR A;  4G9K A;  2ZZC A;  4J36 A;  2C66 A;  3GRT A;  4B67 A;  2BS4 A;  3E1T A;  4CBQ A;  1IUV A;  2CVJ A;  4C74 A;  1FS8 A;  3DJD A;  1PS9 A;  3G5Q A;  1K4Q A;  5J60 A;  4EMW A;  1M1Q A;  2I0Z A;  1FEC A;  3P4P A;  3VRA A;  2H88 A;  2AR8 A;  4OPD A;  1OJA A;  4UDR A;  1B37 A;  3GYX A;  3UTE A;  4Q5B A;  1FEA A;  3P4R A;  4TM1 A;  4C3X A;  3H8L A;  1GOS A;  1UKV G;  2R4E A;  2BCP A;  3HYV A;  4OPG A;  3FO3 A;  4H4P A;  2K3V A;  1PBE A;  2YVJ A;  4G6G A;  1EBD A;  1JNI A;  3GDN A;  2OA1 A;  3K7T A;  5L46 A;  2C75 A;  2XFP A;  1CJ2 A;  4H2R A;  2Q7V A;  2B9Y A;  2Y6R A;  3GD3 A;  3F8D A;  4YKG A;  5IQ1 A;  1NG4 A;  2E5V A;  1O95 A;  5ER0 A;  1Y56 A;  2VVL A;  5GRT A;  4YSH A;  3K7M X;  5KMP A;  3DK9 A;  4HA6 A;  4D04 A;  2EQ7 A;  1E1N A;  3GSI A;  3R9U A;  4EIQ A;  5EBK A;  5FMH A;  4AOS A;  2JB2 A;  3BNU A;  2B7S A;  3ISH A;  4Z2R A;  2XFU A;  4REK A;  3AXB A;  1CC2 A;  3BHF A;  5KXJ A;  4NZH A;  3AE3 A;  3OC4 A;  2E1M A;  4FK1 A;  3QSM A;  1D7Y A;  3B6D A;  3IHM A;  3AYL A;  2WU2 A;  3UKK A;  3P4Q A;  3T14 A;  1FT5 A;  4Z24 A;  2BC1 A;  2BAB A;  3EAN A;  3SCE A;  1H81 A;  3CNT A;  1GEU A;  3I6D A;  3ICS A;  4H50 A;  3SQP A;  1BWC A;  1H84 A;  1PN0 A;  2Q6U A;  3NK1 X;  3P1W A;  4K5R A;  1DXL A;  2FJE A;  3FMW A;  4TM4 A;  2YLZ A;  3ICR A;  1PBD A;  4DGK A;  2X8H A;  3BNF A;  4WJY A;  5BVA A;  3NHO X;  2YLX A;  5CQF A;  2X8C A;  5JCL A;  1K0J A;  2FBW A;  3V76 A;  2RF7 A;  1MO9 A;  2AQJ A;  3CNJ A;  3GMC A;  3SZF A;  1ZP0 A;  2QA1 A;  1GET A;  4Z2U A;  3UBR A;  3SM8 A;  1PJ5 A;  4OPC A;  2RGH A;  1RYI A;  2XLT A;  5KVI A;  1DOD A;  2XFN A;  3PVC A;  3F29 A;  3FG2 P;  5JCI A;  4OPL A;  1CHU A;  1GRT A;  1CJC A;  1GRA A;  1OJT A;  4YXD A;  3QFA A;  3T2K A;  1D5T A;  4K5S A;  1F8R A;  3L1R A;  4U2T A;  4Y4M A;  3BNG A;  3EF6 A;  1B5Q A;  1L9D A;  4NWZ A;  3LGQ A;  2GR2 A;  3QFB A;  3BNH A;  3KPK A;  4C77 A;  2YR6 A;  4U8K A;  3UKF A;  4CNJ A;  2VVL G;  2XLP A;  3URH A;  3KU9 A;  5HXI A;  3NIX A;  4J31 A;  1ELI A;  3VR8 A;  2WP9 A;  4L3Z A;  2IID A;  1SEZ A;  1LQU A;  1LPF A;  4X9M A;  3JSK A;  4B66 A;  4H4R A;  2R46 A;  3NK0 X;  5HY5 A;  3CGD A;  3NYE A;  4WX1 A;  1PXC A;  1EL9 A;  1B4V A;  2BK4 A;  4YSY A;  1QO8 A;  5HYM A;  2HQM A;  1DOE A;  4JNQ A;  4NEW A;  1KSU A;  4TM3 A;  3SGL A;  1VG0 A;  2C64 A;  2ZBW A;  3TOR A;  4GDE A;  1RP0 A;  4H4T A;  2VRL A;  3DGH A;  4OVI A;  2YLT A;  2Q0K A;  2AAQ A;  2E80 A;  1ZOV A;  2GR1 A;  3LZW A;  5IQ4 A;  1PJ6 A;  1GRH A;  2GQW A;  4H7U A;  1IUS A;  1GT8 A;  3COX A;  4GF7 A;  3NNE A;  1O94 A;  4PAA A;  1H82 A;  1DOC A;  1FCD A;  1YKJ A;  2JB3 A;  2GR3 A;  2O9Z A;  3CIR A;  4Y4L A;  1FS9 A;  3G5R A;  1PXB A;  2OLO A;  1PBB A;  4DNA A;  2R0G A;  1VQW A;  3KVE A;  3CPI G;  4YKF A;  2GQF A;  4MJW A;  2B7R A;  4WCT A;  2YM2 A;  2XCG A;  3C96 A;  2FJB A;  4M52 A;  3O0H A;  3PS9 A;  1NHQ A;  4XWR A;  4BJY A;  5TR3 A;  5M10 A;  1BGJ A;  3D8X A;  3T31 A;  2WOV A;  3UOX A;  2CUL A;  4A6N A;  3NKS A;  2VR0 A;  2BRA A;  2A8X A;  4AOX A;  3NN6 X;  5C3J A;  2YG3 A;  3CGB A;  2C72 A;  3CGC A;  1DJQ A;  2BCG G;  1GRB A;  5KOW A;  1Q1R A;  2XVI A;  1IUW A;  3IF9 A;  1BGN A;  3HZL A;  2NVK X;  3ZDN A;  2VVM A;  4H4Y A;  3RNM A;  1N4U A;  4H4X A;  5KMS A;  5KMQ A;  1LQT A;  3AED A;  4Z44 A;  1Z6L A;  2YG5 A;  4EM3 A;  3F8P A;  3G5S A;  3T2Z A;  3KLJ A;  1ZOY A;  3KD9 A;  2ZO5 A;  3LXD A;  4C5O A;  4BK3 A;  1F8W A;  1DNC A;  1NEN A;  4GUV A;  4I59 A;  4APN A;  4OPT A;  5IPY A;  3FPZ A;  4B63 A;  4DSH A;  4BJZ A;  4OPI A;  1W4X A;  3ALL A;  1TDN A;  3NK2 X;  5KWF A;  2XLS A;  3OZ2 A;  4Z43 A;  4RSL A;  2C3C A;  2C7G A;  4TM0 A;  4U2S A;  1JRZ A;  2NPX A;  4D03 A;  1N1P A;  2XVJ A;  4BUR A;  1FS7 A;  1VG9 A;  3RP7 A;  3FIM B;  3NRN A;  3UU9 A;  2EQ8 A;  2CDU A;  4L38 A;  2QAE A;  4A99 A;  3IWA A;  1CC6 A;  2PYX A;  3RP6 A;  3MMO A;  3M0O A;  4IV9 A;  4N9X A;  1Q9I A;  1KDG A;  2EQ6 A;  4YTM A;  2YLW A;  2WQY A;  3GRS A;  1TDK A;  3ADA B;  3NLC A;  1N4V A;  2B76 A;  3CND A;  1GAL A;  1F8S A;  2WS3 A;  1NG3 A;  1ZKQ A;  2X99 A;  4KPR A;  2XYO A;  3AD8 B;  2WPC A;  1F3P A;  3SFD A;  4ZN0 A;  3UCL A;  3LJP A;  3NN0 X;  4OPU A;  1BF3 A;  1H83 A;  2GAG B;  3AE1 A;  1FT6 A;  1QLB A;  5EB4 A;  2E81 A;  5BRT A;  2GH5 A;  3BNM A;  4U8P A;  4GR1 A;  2WDV A;  4E0V A;  1P2H A;  1NHP A;  3VRD B;  4LA1 A;  3GWF A;  1SP3 A;  3L1T A;  4CRT A;  4U8M A;  3VQR A;  3UKP A;  2R45 A;  3CPH G;  2GR0 A;  2YWL A;  5BUK A;  2JK6 A;  2YM1 A;  3VRB A;  4JQ9 A;  1ZMD A;  2X50 A;  3UOZ A;  1PXA A;  4U8L A;  3DJE A;  5FS9 A;  2OT4 A;  4B1B A;  4II2 A;  4YTN A;  2BXR A;  3UOV A;  2WBA A;  2XFO A;  4EQS A;  1X31 B;  3AEG A;  1GTE A;  3CNP A;  4KX6 A;  3PO7 A;  3DA1 A;  3S7W A;  2YG6 A;  3AD7 B;  4LII A;  2V61 A;  3I3L A;  2WDQ A;  1LV0 A;  1ZK7 A;  4IVO B;  1YQ4 A;  1IUU A;  3LZX A;  1Y0P A;  1OJD A;  4H4Z A;  1BZL A;  3BI2 A;  4NTC A;  1IJH A;  5KVH A;  4U8I A;  1PHH A;  2GV8 A;  3SZW A;  2V60 A;  2GVC A;  2JBV A;  1GXF A;  3UTG A;  4H2N A;  1NEK A;  3AE6 A;  1VRQ B;  1JRY A;  2VQ7 A;  3LG1 A;  3BI4 A;  4EMI A;  4OCG A;  4UDP A;  1JU2 A;  4TLX A;  3HYX A;  4FDC B;  4USQ A;  1GSN A;  3H4K A;  2GF3 A;  5FS6 A;  2OAL A;  2V6O A;  4H4S A;  2C73 A;  3AE4 A;  1KNP A;  1H6V A;  3EPT A;  2WU5 A;  3ATQ A;  2BRY A;  2BS2 A;  1XAN A;  1JRX A;  3NTA A;  4NEV A;  4NNJ A;  2GRT A;  4A7A A;  4ADW A;  3EAO A;  1E7P A;  2YLR A;  1NDA A;  2RGO A;  2C67 A;  3NTD A;  4JY2 A;  4RG4 A;  4IVM B;  2LFC A;  2RAB A;  3RP8 A;  3ABV A;  4BV6 A;  3D1I A;  4EM4 A;  2OLN A;  2JB1 A;  2X3N A;  3FBS A;  1B8S A;  4FK1 C;  2VOU A;  2YG7 A;  3BI5 A;  4P9S A;  2WPE A;  4EQW A;  2RGJ A;  2GEW A;  3ATR A;  2C3D A;  4H4W A;  1GND A;  2ARD A;  4ECH A;  2WEU A;  3LB8 A;  3OWM A;  4Y4N A;  1BKW A;  5JCN A;  4J57 A;  4CY8 A;  2R0P A;  2WP6 A;  4GDP A;  4J33 A;  2BYB A;  4AP3 A;  3LOV A;  3DJJ A;  4A6N B;  4EQX A;  5BUL A;  1DOB A;  2XVE A;  5U1O A;  3SX6 A;  3ZYX A;  4JNA A;  2R4J A;  2H89 A;  4G74 A;  2CZS A;  1YY5 A;  3K30 A;  1M6I A;  2TMD A;  2ACZ A;  3F8R A;  5GSN A;  5LV9 A;  3BNJ A;  3KKJ A;  1EL8 A;  2X8G A;  4A9W A;  3DME A;  1ONF A;  1M1P A;  2E4G A;  2GMJ A;  5CKU A;  1S2Q A;  4NTD A;  1E1M A;  3NYF A;  4U8O A;  5KOX A;  1M1R A;  3GYI A;  4IA6 A;  3SYI A;  4Z26 A;  2YVG A;  5JCK A;  3NG7 X;  1F6M A;  3HYW A;  3LAD A;  5KMR A;  3AE8 A;  4YSZ A;  4BK2 A;  3CMM A;  1H86 A;  3DJG X;  3RED A;  1NHS A;  4UP3 A;  4L3Y A;  3AEB A;  3CPJ G;  4II3 A;  4GAP A;  1TYP A;  1PBF A;  4J56 A;  1AOG A;  4GCM A;  2A89 A;  1ZX9 A;  1TRB A;  2WPF A;  4K7Z A;  3UKL A;  2EQ9 A;  4Q17 A;  2C70 A;  1JEH A;  3UTF A;  4CCR A;  3RKH A;  2JAE A;  2YQU A;  2WDR A;  2GMH A;  5FS7 A;  4O5Q A;  4YWO A;  3UKA A;  4YT0 A;  3K7Q X;  4DSG A;  1TDF A;  4L3X A;  2Y6Q A;  2RDZ A;  4EIP A;  1E6E A;  3GWD A;  1LVL A;  2XVH A;  1CC4 A;  4B64 A;  1D4D A;  4NTE A;  1KFY A;  2BA9 A;  1MOK A;  3UOY A;  3QVR A;  1PBC A;  3B3R A;  1S2Y A;  1GRG A;  3ICT A;  3GM6 A;  1EL7 A;  2V3B A;  4K8D A;  4Q5C A;  2FJA A;  1YQZ A;  2XLU A;  4BK1 A;  2CFY A;  2WOI A;  3S5W A;  1PJ7 A;  2FJD A;  3BHK A;  4Z2T A;  3M13 A;  1JOA A;  3P9U A;  2XFQ A;  2J3N A;  3AE2 A;  2BK3 A;  3IC9 A;  3NYC A;  4U2L A;  3UP5 A;  3VR9 A;  3ITJ A;  5C2T A;  4ICY A;  3WE0 A;  2IVD A;  1LJ1 A;  1KSS A;  4O5U A;  1S3B A;  3DGZ A;  2UZZ A;  1FOH A;  3RHA A;  1NHR A;  4CY6 A;  3Q9T A;  1K0I A;  4A65 A;  1CJ4 A;  1XPQ A;  1V59 A;  5FS8 A;  3T0K A;  2QA2 A;  2ZZ0 A;  3AEC A;  3CGE A;  2JKC A;  2DKI A;  1CF3 A;  2YVF A;  3AEA A;  3UKH A;  2VQB A;  2QCU A;  1REO A;  4H2Q A;  4TLZ A;  2Q0L A;  1GTH A;  4AP1 A;  4YSX A;  1XHC A;  4B68 A;  3SZ0 A;  1QDB A;  3AYJ A;  1EL5 A;  1O5W A;  2V3A A;  2WES A;  2WET A;  1PDH A;  2Z5X A;  2C4C A;  3S61 A;  3GD4 A;  5EOW A;  3AE7 A;  3TTB A;  4FX9 A;  1GV4 A;  1IUT A;  4PAB A;  2IVE A;  2R9Z A;  3P4S A;  3QJ4 A;  2YG4 A;  5HHF A;  1YQ3 A;  2XDO A;  4XXG A;  4AT2 A;  2V5Z A;  1JNR A;  1ZMC A;  2WHD A;  3ALJ A;  5J7X A;  2F5Z A;  4Q0T A;  1KNR A;  1CJ3 A;  4GRT A;  3NT6 A;  1TYT A;  4HB9 A;  4UDQ A;  1VDC A;  2GB0 A;  4ZCD A;  3T2Y A;  4Z25 A;  4A79 A;  1E39 A;  1D4E A;  3GDP A;  2GAH B;  5KNL A;  3DK4 A;  1M64 A;  1COY A;  2BXS A;  2YAU A;  3IHG A;  1Y56 B;  3H8I A;  4U8N A;  4U8J A;  3KA7 A;  3SXQ A;  3GMB A;  2YLS A;  1H7X A;  3DK8 A;  2VZ2 A;  2W0H A;  1NAA A;  3Q6J A;  4IA5 A;  4X9N A;  4EMJ A;  2BK5 A;  4YTP A;  3II4 A;  3CTY A;  2WP5 A;  5EB5 A;  1ZY8 A;  1QJD A;  1KF6 A;  1CL0 A;  1S3E A;  3QVP A;  2XLR A;  4RG3 A;  2YR5 A;  3AB1 A;  2C65 A;  4H4Q A;  3SXI A;  1K0L A;  2C76 A;  1P2E A;  3SY4 A;  3SZC A;  1XDI A;  3D1C A;  1FL2 A;  4J34 A;  5DBJ A;  2DKH A;  4ZCC A;  4B65 A;  1BVB A;  2BC0 A;  4X4J A;  2B9W A;  4CCQ A;  3CNS A;  2ZZB A;  1RSG A;  3KPF A;  4LU6 A;  1GU6 A;  5M0Z A;  2A87 A;  3L8K A;  3UP4 A;  2OAM A;  1TDE A;  2PHH A;  3CN8 A;  3V3O A;  3AEE A;  4A5L A;  1D4C A;  3UTH A;  4CNK A;  4I58 A;  3QSS A;  1DJN A;  1MXT A;  2XVF A;  4H4U A;  2Z5Y A;  3AE5 A;  3AEF A;  5U63 A;  1NPX A;  1GRE A;  1OJ9 A;  1N4W A;  1Q1W A;  3DH9 A;  3SFE A;  4AT0 A;  4B69 A;  3C4N A;  2YR4 A;  3AYI A;  4C3Y A;  1GES A;  1GRF A;  4G6H A;  2WOW A;  1ZDL A;  3QSE A;  1CBO A;  2R0C A;  5U25 A;  4USR A;  4H2P A;  2VRM A;  1L9C A;  2APG A;  1E1K A;  4K22 A;  4K2X A;  3M12 A;  1L0V A;  1OJC A;  1FEB A;  3UKQ A;  1H7W A;  1LTX R;  4EQR A;  4GAV A;  3AWI A;  3GYJ A;  3V3N A;  4Q1O A;  4XWZ A;  2BS3 A;  2J7A A;  1GPE A;  1HYU A;  3NH3 X;  4JY3 A;  4JDR A;  3C4A A;  1IUX A;  1E1L A;  1TDO A;  5JCM A;  5KRQ A;  3AE9 A;  4Q4U A; 
#chains in the Genus database with same CATH homology
 4J2W A;  1L9E A;  2B9X A;  3ALM A;  4G73 A;  4H4V A;  1D7L A;  4JN9 A;  3AD9 B;  1JNZ A;  1OAH A;  3T37 A;  2BAC A;  3NGC X;  1GER A;  2TPR A;  4G9K A;  2ZZC A;  4J36 A;  2C66 A;  3GRT A;  4B67 A;  2BS4 A;  3E1T A;  4CBQ A;  1IUV A;  2CVJ A;  4C74 A;  1FS8 A;  3DJD A;  1PS9 A;  3G5Q A;  1K4Q A;  5J60 A;  4EMW A;  1M1Q A;  2I0Z A;  1FEC A;  3P4P A;  3VRA A;  2H88 A;  2AR8 A;  4OPD A;  1OJA A;  4UDR A;  1B37 A;  3GYX A;  3UTE A;  4Q5B A;  1FEA A;  3P4R A;  4TM1 A;  4C3X A;  3H8L A;  1GOS A;  1UKV G;  2R4E A;  2BCP A;  3HYV A;  4OPG A;  3FO3 A;  4H4P A;  2K3V A;  1PBE A;  2YVJ A;  4G6G A;  1EBD A;  1JNI A;  3GDN A;  2OA1 A;  3K7T A;  5L46 A;  2C75 A;  2XFP A;  1CJ2 A;  4H2R A;  2Q7V A;  2B9Y A;  2Y6R A;  3GD3 A;  3F8D A;  4YKG A;  5IQ1 A;  1NG4 A;  2E5V A;  1O95 A;  5ER0 A;  1Y56 A;  2VVL A;  5GRT A;  4YSH A;  3K7M X;  5KMP A;  3DK9 A;  4HA6 A;  4D04 A;  2EQ7 A;  1E1N A;  3GSI A;  3R9U A;  4EIQ A;  5EBK A;  5FMH A;  4AOS A;  2JB2 A;  3BNU A;  2B7S A;  3ISH A;  4Z2R A;  2XFU A;  4REK A;  3AXB A;  1CC2 A;  3BHF A;  5KXJ A;  4NZH A;  3AE3 A;  3OC4 A;  2E1M A;  4FK1 A;  3QSM A;  1D7Y A;  3B6D A;  3IHM A;  3AYL A;  2WU2 A;  3UKK A;  3P4Q A;  3T14 A;  1FT5 A;  4Z24 A;  2BC1 A;  2BAB A;  3EAN A;  3SCE A;  1H81 A;  3CNT A;  1GEU A;  3I6D A;  3ICS A;  4H50 A;  3SQP A;  1BWC A;  1H84 A;  1PN0 A;  2Q6U A;  3NK1 X;  3P1W A;  4K5R A;  1DXL A;  2FJE A;  3FMW A;  4TM4 A;  2YLZ A;  3ICR A;  1PBD A;  4DGK A;  2X8H A;  3BNF A;  4WJY A;  5BVA A;  3NHO X;  2YLX A;  5CQF A;  2X8C A;  5JCL A;  1K0J A;  2FBW A;  3V76 A;  2RF7 A;  1MO9 A;  2AQJ A;  3CNJ A;  3GMC A;  3SZF A;  1ZP0 A;  2QA1 A;  1GET A;  4Z2U A;  3UBR A;  3SM8 A;  1PJ5 A;  4OPC A;  2RGH A;  1RYI A;  2XLT A;  5KVI A;  1DOD A;  2XFN A;  3PVC A;  3F29 A;  3FG2 P;  5JCI A;  4OPL A;  1CHU A;  1GRT A;  1CJC A;  1GRA A;  1OJT A;  4YXD A;  3QFA A;  3T2K A;  1D5T A;  4K5S A;  1F8R A;  3L1R A;  4U2T A;  4Y4M A;  3BNG A;  3EF6 A;  1B5Q A;  1L9D A;  4NWZ A;  3LGQ A;  2GR2 A;  3QFB A;  3BNH A;  3KPK A;  4C77 A;  2YR6 A;  4U8K A;  3UKF A;  4CNJ A;  2VVL G;  2XLP A;  3URH A;  3KU9 A;  5HXI A;  3NIX A;  4J31 A;  1ELI A;  3VR8 A;  2WP9 A;  4L3Z A;  2IID A;  1SEZ A;  1LQU A;  1LPF A;  4X9M A;  3JSK A;  4B66 A;  4H4R A;  2R46 A;  3NK0 X;  5HY5 A;  3CGD A;  3NYE A;  4WX1 A;  1PXC A;  1EL9 A;  1B4V A;  2BK4 A;  4YSY A;  1QO8 A;  5HYM A;  2HQM A;  1DOE A;  4JNQ A;  4NEW A;  1KSU A;  4TM3 A;  3SGL A;  1VG0 A;  2C64 A;  2ZBW A;  3TOR A;  4GDE A;  1RP0 A;  4H4T A;  2VRL A;  3DGH A;  4OVI A;  2YLT A;  2Q0K A;  2AAQ A;  2E80 A;  1ZOV A;  2GR1 A;  3LZW A;  5IQ4 A;  1PJ6 A;  1GRH A;  2GQW A;  4H7U A;  1IUS A;  1GT8 A;  3COX A;  4GF7 A;  3NNE A;  1O94 A;  4PAA A;  1H82 A;  1DOC A;  1FCD A;  1YKJ A;  2JB3 A;  2GR3 A;  2O9Z A;  3CIR A;  4Y4L A;  1FS9 A;  3G5R A;  1PXB A;  2OLO A;  1PBB A;  4DNA A;  2R0G A;  1VQW A;  3KVE A;  3CPI G;  4YKF A;  2GQF A;  4MJW A;  2B7R A;  4WCT A;  2YM2 A;  2XCG A;  3C96 A;  2FJB A;  4M52 A;  3O0H A;  3PS9 A;  1NHQ A;  4XWR A;  4BJY A;  5TR3 A;  5M10 A;  1BGJ A;  3D8X A;  3T31 A;  2WOV A;  3UOX A;  2CUL A;  4A6N A;  3NKS A;  2VR0 A;  2BRA A;  2A8X A;  4AOX A;  3NN6 X;  5C3J A;  2YG3 A;  3CGB A;  2C72 A;  3CGC A;  1DJQ A;  2BCG G;  1GRB A;  5KOW A;  1Q1R A;  2XVI A;  1IUW A;  3IF9 A;  1BGN A;  3HZL A;  2NVK X;  3ZDN A;  2VVM A;  4H4Y A;  3RNM A;  1N4U A;  4H4X A;  5KMS A;  5KMQ A;  1LQT A;  3AED A;  4Z44 A;  1Z6L A;  2YG5 A;  4EM3 A;  3F8P A;  3G5S A;  3T2Z A;  3KLJ A;  1ZOY A;  3KD9 A;  2ZO5 A;  3LXD A;  4C5O A;  4BK3 A;  1F8W A;  1DNC A;  1NEN A;  4GUV A;  4I59 A;  4APN A;  4OPT A;  5IPY A;  3FPZ A;  4B63 A;  4DSH A;  4BJZ A;  4OPI A;  1W4X A;  3ALL A;  1TDN A;  3NK2 X;  5KWF A;  2XLS A;  3OZ2 A;  4Z43 A;  4RSL A;  2C3C A;  2C7G A;  4TM0 A;  4U2S A;  1JRZ A;  2NPX A;  4D03 A;  1N1P A;  2XVJ A;  4BUR A;  1FS7 A;  1VG9 A;  3RP7 A;  3FIM B;  3NRN A;  3UU9 A;  2EQ8 A;  2CDU A;  4L38 A;  2QAE A;  4A99 A;  3IWA A;  1CC6 A;  2PYX A;  3RP6 A;  3MMO A;  3M0O A;  4IV9 A;  4N9X A;  1Q9I A;  1KDG A;  2EQ6 A;  4YTM A;  2YLW A;  2WQY A;  3GRS A;  1TDK A;  3ADA B;  3NLC A;  1N4V A;  2B76 A;  3CND A;  1GAL A;  1F8S A;  2WS3 A;  1NG3 A;  1ZKQ A;  2X99 A;  4KPR A;  2XYO A;  3AD8 B;  2WPC A;  1F3P A;  3SFD A;  4ZN0 A;  3UCL A;  3LJP A;  3NN0 X;  4OPU A;  1BF3 A;  1H83 A;  2GAG B;  3AE1 A;  1FT6 A;  1QLB A;  5EB4 A;  2E81 A;  5BRT A;  2GH5 A;  3BNM A;  4U8P A;  4GR1 A;  2WDV A;  4E0V A;  1P2H A;  1NHP A;  3VRD B;  4LA1 A;  3GWF A;  1SP3 A;  3L1T A;  4CRT A;  4U8M A;  3VQR A;  3UKP A;  2R45 A;  3CPH G;  2GR0 A;  2YWL A;  5BUK A;  2JK6 A;  2YM1 A;  3VRB A;  4JQ9 A;  1ZMD A;  2X50 A;  3UOZ A;  1PXA A;  4U8L A;  3DJE A;  5FS9 A;  2OT4 A;  4B1B A;  4II2 A;  4YTN A;  2BXR A;  3UOV A;  2WBA A;  2XFO A;  4EQS A;  1X31 B;  3AEG A;  1GTE A;  3CNP A;  4KX6 A;  3PO7 A;  3DA1 A;  3S7W A;  2YG6 A;  3AD7 B;  4LII A;  2V61 A;  3I3L A;  2WDQ A;  1LV0 A;  1ZK7 A;  4IVO B;  1YQ4 A;  1IUU A;  3LZX A;  1Y0P A;  1OJD A;  4H4Z A;  1BZL A;  3BI2 A;  4NTC A;  1IJH A;  5KVH A;  4U8I A;  1PHH A;  2GV8 A;  3SZW A;  2V60 A;  2GVC A;  2JBV A;  1GXF A;  3UTG A;  4H2N A;  1NEK A;  3AE6 A;  1VRQ B;  1JRY A;  2VQ7 A;  3LG1 A;  3BI4 A;  4EMI A;  4OCG A;  4UDP A;  1JU2 A;  4TLX A;  3HYX A;  4FDC B;  4USQ A;  1GSN A;  3H4K A;  2GF3 A;  5FS6 A;  2OAL A;  2V6O A;  4H4S A;  2C73 A;  3AE4 A;  1KNP A;  1H6V A;  3EPT A;  2WU5 A;  3ATQ A;  2BRY A;  2BS2 A;  1XAN A;  1JRX A;  3NTA A;  4NEV A;  4NNJ A;  2GRT A;  4A7A A;  4ADW A;  3EAO A;  1E7P A;  2YLR A;  1NDA A;  2RGO A;  2C67 A;  3NTD A;  4JY2 A;  4RG4 A;  4IVM B;  2LFC A;  2RAB A;  3RP8 A;  3ABV A;  4BV6 A;  3D1I A;  4EM4 A;  2OLN A;  2JB1 A;  2X3N A;  3FBS A;  1B8S A;  4FK1 C;  2VOU A;  2YG7 A;  3BI5 A;  4P9S A;  2WPE A;  4EQW A;  2RGJ A;  2GEW A;  3ATR A;  2C3D A;  4H4W A;  1GND A;  2ARD A;  4ECH A;  2WEU A;  3LB8 A;  3OWM A;  4Y4N A;  1BKW A;  5JCN A;  4J57 A;  4CY8 A;  2R0P A;  2WP6 A;  4GDP A;  4J33 A;  2BYB A;  4AP3 A;  3LOV A;  3DJJ A;  4A6N B;  4EQX A;  5BUL A;  1DOB A;  2XVE A;  5U1O A;  3SX6 A;  3ZYX A;  4JNA A;  2R4J A;  2H89 A;  4G74 A;  1YY5 A;  3K30 A;  1M6I A;  2TMD A;  2ACZ A;  3F8R A;  5GSN A;  5LV9 A;  3BNJ A;  3KKJ A;  1EL8 A;  2X8G A;  4A9W A;  3DME A;  1ONF A;  1M1P A;  2E4G A;  2GMJ A;  5CKU A;  1S2Q A;  4NTD A;  1E1M A;  3NYF A;  4U8O A;  5KOX A;  1M1R A;  3GYI A;  4IA6 A;  3SYI A;  4Z26 A;  2YVG A;  5JCK A;  3NG7 X;  1F6M A;  3HYW A;  3LAD A;  5KMR A;  3AE8 A;  4YSZ A;  4BK2 A;  3CMM A;  1H86 A;  3DJG X;  3RED A;  1NHS A;  4UP3 A;  4L3Y A;  3AEB A;  3CPJ G;  4II3 A;  4GAP A;  1TYP A;  1PBF A;  4J56 A;  1AOG A;  4GCM A;  2A89 A;  1ZX9 A;  1TRB A;  2WPF A;  4K7Z A;  3UKL A;  2EQ9 A;  4Q17 A;  2C70 A;  1JEH A;  3UTF A;  4CCR A;  3RKH A;  2JAE A;  2YQU A;  2WDR A;  2GMH A;  5FS7 A;  4O5Q A;  4YWO A;  3UKA A;  4YT0 A;  3K7Q X;  4DSG A;  1TDF A;  4L3X A;  2Y6Q A;  2RDZ A;  4EIP A;  1E6E A;  3GWD A;  1LVL A;  2XVH A;  1CC4 A;  4B64 A;  1D4D A;  4NTE A;  1KFY A;  2BA9 A;  1MOK A;  3UOY A;  3QVR A;  1PBC A;  3B3R A;  1S2Y A;  1GRG A;  3ICT A;  3GM6 A;  1EL7 A;  2V3B A;  4K8D A;  4Q5C A;  2FJA A;  1YQZ A;  2XLU A;  4BK1 A;  2CFY A;  2WOI A;  3S5W A;  1PJ7 A;  2FJD A;  3BHK A;  4Z2T A;  3M13 A;  1JOA A;  3P9U A;  2XFQ A;  2J3N A;  3AE2 A;  2BK3 A;  3IC9 A;  3NYC A;  4U2L A;  3UP5 A;  3VR9 A;  3ITJ A;  5C2T A;  4ICY A;  3WE0 A;  2IVD A;  1LJ1 A;  1KSS A;  4O5U A;  1S3B A;  3DGZ A;  2UZZ A;  1FOH A;  3RHA A;  1NHR A;  4CY6 A;  3Q9T A;  1K0I A;  4A65 A;  1CJ4 A;  1XPQ A;  1V59 A;  5FS8 A;  3T0K A;  2QA2 A;  2ZZ0 A;  3AEC A;  3CGE A;  2JKC A;  2DKI A;  1CF3 A;  2YVF A;  3AEA A;  3UKH A;  2VQB A;  2QCU A;  1REO A;  4H2Q A;  4TLZ A;  2Q0L A;  1GTH A;  4AP1 A;  4YSX A;  1XHC A;  4B68 A;  3SZ0 A;  1QDB A;  3AYJ A;  1EL5 A;  1O5W A;  2V3A A;  2WES A;  2WET A;  1PDH A;  2Z5X A;  2C4C A;  3S61 A;  3GD4 A;  5EOW A;  3AE7 A;  3TTB A;  4FX9 A;  1GV4 A;  1IUT A;  4PAB A;  2IVE A;  2R9Z A;  3P4S A;  3QJ4 A;  2YG4 A;  5HHF A;  1YQ3 A;  2XDO A;  4XXG A;  4AT2 A;  2V5Z A;  1JNR A;  1ZMC A;  2WHD A;  3ALJ A;  5J7X A;  2F5Z A;  4Q0T A;  1KNR A;  1CJ3 A;  4GRT A;  3NT6 A;  1TYT A;  4HB9 A;  4UDQ A;  1VDC A;  2GB0 A;  4ZCD A;  3T2Y A;  4Z25 A;  4A79 A;  1E39 A;  1D4E A;  3GDP A;  2GAH B;  5KNL A;  3DK4 A;  1M64 A;  1COY A;  2BXS A;  2YAU A;  3IHG A;  1Y56 B;  3H8I A;  4U8N A;  4U8J A;  3KA7 A;  3SXQ A;  3GMB A;  2YLS A;  1H7X A;  3DK8 A;  2VZ2 A;  2W0H A;  1NAA A;  3Q6J A;  4IA5 A;  4X9N A;  4EMJ A;  2BK5 A;  4YTP A;  3II4 A;  3CTY A;  2WP5 A;  5EB5 A;  1ZY8 A;  1QJD A;  1KF6 A;  1CL0 A;  1S3E A;  3QVP A;  2XLR A;  4RG3 A;  2YR5 A;  3AB1 A;  2C65 A;  4H4Q A;  3SXI A;  1K0L A;  2C76 A;  1P2E A;  3SY4 A;  3SZC A;  1XDI A;  3D1C A;  1FL2 A;  4J34 A;  5DBJ A;  2DKH A;  4ZCC A;  4B65 A;  1BVB A;  2BC0 A;  4X4J A;  2B9W A;  4CCQ A;  3CNS A;  2ZZB A;  1RSG A;  3KPF A;  4LU6 A;  1GU6 A;  5M0Z A;  2A87 A;  3L8K A;  3UP4 A;  2OAM A;  1TDE A;  2PHH A;  3CN8 A;  3V3O A;  3AEE A;  4A5L A;  1D4C A;  3UTH A;  4CNK A;  4I58 A;  3QSS A;  1DJN A;  1MXT A;  2XVF A;  4H4U A;  2Z5Y A;  3AE5 A;  3AEF A;  5U63 A;  1NPX A;  1GRE A;  1OJ9 A;  1N4W A;  1Q1W A;  3DH9 A;  3SFE A;  4AT0 A;  4B69 A;  3C4N A;  2YR4 A;  3AYI A;  4C3Y A;  1GES A;  1GRF A;  4G6H A;  2WOW A;  1ZDL A;  3QSE A;  1CBO A;  2R0C A;  5U25 A;  4USR A;  4H2P A;  2VRM A;  1L9C A;  2APG A;  1E1K A;  4K22 A;  4K2X A;  3M12 A;  1L0V A;  1OJC A;  1FEB A;  3UKQ A;  1H7W A;  1LTX R;  4EQR A;  4GAV A;  3AWI A;  3GYJ A;  3V3N A;  4Q1O A;  4XWZ A;  2BS3 A;  2J7A A;  1GPE A;  1HYU A;  3NH3 X;  4JY3 A;  4JDR A;  3C4A A;  1IUX A;  1E1L A;  1TDO A;  5JCM A;  5KRQ A;  3AE9 A;  4Q4U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...