1M64A

Crystal structure of q363f mutant flavocytochrome c3
Total Genus 188
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
188
sequence length
568
structure length
568
Chain Sequence
ADNLAEFHVQNQECDSCHTPDGELSNDSLTYENTQCVSCHGTLAEVAETTKHEHYNAHASHFPGEVACTSCHSAHEKSMVYCDSCHSFDFNMPYAKKWLRDEPTIAELAKDKSERQAALASAPHDTVDVVVVGSGGAGFSAAISATDSGAKVILIEKEPVIGGNAKLAAGGMNAAWTDQQKAKKITDSPELMFEDTMKGGQNINDPALVKVLSSHSKDSVDWMTAMGADLTDVGMMGGASVNRAHRPTGGAGVGAHVVQVLYDNAVKRNIDLRMNTRGIEVLKDDKGTVKGILVKGMYKGYYWVKADAVILATGGFAKNNERVAKLDPSLKGFISTNQPGAVGDGLDVAENAGGALKDMQYIFAHPTLSVKGGVMVTEAVRGNGAILVNREGKRFVNEITTRDKASAAILAQTGKSAYLIFDDSVRKSLSKIDKYIGLGVAPTADSLVKLGKMEGIDGKALTETVARYNSLVSSGKDTDFERPNLPRALNEGNYYAIEVTPGVHHTMGGVMIDTKAEVMNAKKQVIPGLYGAGEVTGGVHGANRLGGNAISDIITFGRLAGEEAAKYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords flavocytochrome c3
publication title Engineering water to act as an active site acid catalyst in a soluble fumarate reductase
pubmed doi rcsb
source organism Shewanella frigidimarina
molecule tags Oxidoreductase
total genus 188
structure length 568
sequence length 568
chains with identical sequence B
ec nomenclature ec 1.3.5.4: Fumarate reductase (quinol).
pdb deposition date 2002-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00890 FAD_binding_2 FAD binding domain
A PF14537 Cytochrom_c3_2 Cytochrome c3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1130.10 Mainly Alpha Orthogonal Bundle Flavocytochrome C3; Chain A, domain 2 Flavocytochrome C3; Chain A 1m64A02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1m64A03
3.90.700.10 Alpha Beta Alpha-Beta Complex Flavocytochrome C3; Chain A, domain 1 Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 1m64A01
4Z2RA 1IUTA 2ZZCA 2V60A 1DOBA 2YG3A 4H4UA 5GRTA 3AE8A 1JRZA 2C65A 3UP5A 4Y4NA 2WU5A 4A79A 3B3RA 4EQXA 5JCLA 1YQ4A 2ZO5A 4I59A 2YLRA 4OVIA 1VG9A 1GNDA 3PO7A 1LQTA 2RDZA 3UKAA 5EOWA 4L3ZA 3AXBA 2J3NA 5KVIA 5JCKA 4TM4A 1IUWA 2V5ZA 1GXFA 4U8IA 3AE6A 4BK1A 5KWFA 4GDEA 2EQ8A 1NG4A 3UKHA 1CF3A 3F29A 1NHPA 3GRTA 2O9ZA 3RP6A 1LTXR 4H2NA 1KF6A 1TYPA 4K2XA 1S2QA 3FMWA 3EF6A 3E1TA 1FS8A 3PVCA 1GALA 3KA7A 1NHSA 4PAAA 1FCDA 1PHHA 3KPFA 4JY3A 2HQMA 2OA1A 4BK2A 4C77A 3AECA 4EQSA 3O0HA 4UDRA 4Q5CA 3QJ4A 1OJCA 1CBOA 2WS3A 1NENA 1HYUA 2GQWA 4FK1A 1PXCA 3D8XA 3ICTA 3IWAA 4TLXA 2YLWA 2WOVA 3QFBA 3GM6A 4H2RA 4OPCA 1K4QA 1YQZA 3DK4A 5BVAA 4YSZA 3LOVA 1FL2A 5BULA 2GR0A 2R0PA 3NK2X 3GD3A 1QDBA 3UP4A 3GMCA 3WE0A 3C4AA 4PABA 2WP5A 3M12A 4RG3A 1PS9A 3NNEA 2BK5A 1H83A 4O5UA 5EBKA 1PXBA 5C3JA 3SFEA 5C2TA 1ZP0A 2C72A 3AYJA 1BGNA 2XVJA 3CN8A 2QAEA 4OPLA 1PN0A 1BWCA 3G5RA 3P1WA 5KVHA 3NN6X 1GOSA 4REKA 4YTMA 1TYTA 2BXSA 3ALJA 3NTAA 4USQA 4D03A 1OJ9A 1OJDA 2NPXA 2J7AA 2FJAA 4FDCB 4APNA 3ATQA 2RGOA 4A6NA 1DOCA 2GQFA 1DOEA 3TTBA 1ZDLA 2E4GA 4NZHA 3KLJA 4X9NA 4HA6A 4XWZA 4A6NB 3BNGA 1E7PA 4L3YA 4CCQA 3BHFA 3DGZA 4B66A 1IUVA 4Z26A 2TMDA 1M6IA 2YR6A 4A5LA 1GPEA 2UZZA 4CNKA 3BI2A 3K7QX 1H7WA 1GV4A 5HY5A 1NPXA 4EIPA 2WQYA 2K3VA 2GAHB 3BNMA 3UBRA 3P4QA 2OLOA 4XXGA 3VR8A 4U8MA 4DGKA 5M10A 1P2EA 2GMJA 2XFNA 4GCMA 4YTNA 3GDNA 4CBQA 4YWOA 1SP3A 2YLXA 3UU9A 4AP1A 2GB0A 2VVLA 1N4UA 2JK6A 3LJPA 2I0ZA 4EMWA 4C3XA 1IUXA 3CGCA 4X4JA 1YQ3A 3EANA 4YT0A 3QVRA 4Y4LA 3COXA 4JNAA 1LV0A 1FEBA 4NTEA 4YSHA 3AE5A 2R0GA 1B8SA 3AB1A 3QSSA 4M52A 2Q7VA 3CNJA 1JEHA 1LVLA 5J7XA 1FS9A 3GYJA 1TDEA 4YKFA 2XLTA 4CY6A 2VVLG 4H4WA 1K0LA 2AQJA 3UOZA 1PBDA 1DJNA 1GSNA 2YLSA 3AE2A 4C3YA 2BS3A 2X99A 1S3EA 1D7LA 3VRAA 5JCMA 4UDPA 2CDUA 2YR5A 4ECHA 4ICYA 2WHDA 2QA1A 1KFYA 1QO8A 5M0ZA 4BJYA 1KNPA 1OJAA 2X8GA 3AE4A 4LA1A 4JN9A 3LGQA 3AE7A 4IV9A 3V76A 2XVHA 4U8OA 1M1RA 4A7AA 3AD7B 4RSLA 4JNQA 2JB2A 4LU6A 3NKSA 2ZZBA 4J56A 1CJ2A 2RF7A 3M13A 2APGA 2VZ2A 4OPDA 2YM2A 1VRQB 2GF3A 3H8IA 3QFAA 1NHRA 1UKVG 2X8HA 4Q4UA 3FBSA 1ZMCA 1QLBA 4NEVA 1P2HA 2EQ9A 4U2LA 1RSGA 3FG2P 2B7SA 3CTYA 1CC4A 4P9SA 2ZZ0A 3ALLA 5IQ1A 4K5RA 3GYXA 1N4WA 4BURA 1ZMDA 1B5QA 2BS2A 3AEEA 3GMBA 3VR9A 3RP8A 3CGBA 3AE9A 2X8CA 4EM3A 2BABA 3C4NA 4Z2UA 3QSEA 1E1LA 4H4RA 1GU6A 5EB4A 2GEWA 3UKFA 2JBVA 3CNTA 1GETA 1LJ1A 1DJQA 4C74A 4OPTA 1JRXA 2Y6RA 3ISHA 2WU2A 5KRQA 1M1QA 1K0IA 1EL5A 3BNJA 2YLZA 3NYCA 1E1KA 3DJDA 2RGHA 4TM3A 2BS4A 5L46A 4D04A 2XFPA 1EL7A 1ZOVA 3AE1A 1F8SA 5JCIA 2BYBA 3DA1A 1XHCA 1E6EA 3UKQA 3AE3A 1GTHA 1H82A 1H86A 1LQUA 5U1OA 4H4PA 3JSKA 3BNFA 2BC1A 2C67A 1D4EA 1L9EA 1E1MA 2R9ZA 1NEKA 2B76A 1B37A 4U8PA 1KSSA 1RYIA 2GRTA 2YAUA 1NDAA 3CNSA 2BXRA 3KD9A 3SQPA 4YSXA 3F8RA 1AOGA 2IVEA 4Z25A 2XDOA 3AD8B 1QJDA 3DJJA 5KXJA 1IJHA 4KX6A 2XFQA 2BC0A 4A65A 1VG0A 3HZLA 2GH5A 2WDVA 4H4VA 2C70A 2VVMA 2CVJA 4K5SA 4NTDA 2C66A 1PJ6A 4E0VA 1GREA 2Z5XA 3NT6A 4OPUA 1N1PA 1CHUA 1CJ4A 2JB3A 1OAHA 3CNDA 3S61A 1Q1RA 2OALA 3G5SA 3S7WA 3P9UA 3ALMA 4C5OA 2OLNA 3MMOA 1GTEA 3RHAA 2PHHA 5GSNA 2AAQA 3K7MX 4Z2TA 2LFCA 2E5VA 5HHFA 4HB9A 1ZK7A 1GESA 3UKPA 3LB8A 2WBAA 3Q6JA 3ADAB 2FJEA 3BNUA 3IHMA 4AT0A 1CJ3A 4WJYA 1H81A 4JY2A 4RG4A 3IF9A 3NYFA 4YTPA 2YM1A 1BVBA 2V6OA 2OT4A 4BJZA 1NAAA 4EMIA 3DJEA 2B9XA 4K22A 4U2TA 2DKHA 3QSMA 1F8WA 2XLRA 1GRFA 2WPCA 4DSHA 2NVKX 3P4SA 2FBWA 1O94A 2Q0KA 3NH3X 4DNAA 5BRTA 5CKUA 4CY8A 2E80A 1ZOYA 2GAGB 5FS9A 1IUSA 2C64A 2YG4A 3DK8A 2BCGG 2YVFA 4IA6A 3B6DA 5FS7A 3BNHA 2A8XA 3GSIA 1K0JA 1DXLA 2YVJA 3DGHA 1S3BA 3UTGA 4K8DA 2V3AA 1VQWA 2FJBA 4BV6A 1O5WA 2WETA 3NG7X 4DSGA 2GVCA 4WX1A 4J33A 1NG3A 1CC2A 2XFUA 3CIRA 3M0OA 1PJ5A 1BKWA 4TLZA 5IPYA 3ICSA 5FS6A 2RGJA 3L8KA 4EQRA 2C76A 2XLSA 1CJCA 2E1MA 2WESA 2GV8A 5FMHA 3NYEA 3BHKA 1S2YA 2Q6UA 3BI5A 2VRMA 1GT8A 2V61A 1CC6A 1MXTA 3LZXA 4JQ9A 3GRSA 2F5ZA 1FOHA 1Y0PA 3SM8A 2YWLA 1OJTA 2XLPA 3ATRA 2E81A 1XPQA 2XCGA 2WOIA 4X9MA 1TDKA 3UOVA 4A99A 1PBCA 1KNRA 1F6MA 1BGJA 3II4A 1TDNA 2H88A 4U8NA 4H4XA 3G5QA 4H4YA 4U8LA 2YQUA 4H2QA 3NTDA 3P4RA 1FS7A 1D7YA 1H6VA 4B64A 1PBFA 4XWRA 1JNZA 4ADWA 3BI4A 2H89A 3LZWA 2XVIA 1NHQA 4JDRA 2VR0A 1MOKA 3DJGX 2R4JA 4GDPA 1Q9IA 2GR3A 1H84A 2BA9A 3CPHG 4LIIA 4AP3A 5JCNA 3REDA 2GR1A 1E1NA 2DKIA 2WEUA 3AEBA 3Q9TA 2BK4A 5DBJA 3KKJA 2YG6A 5LV9A 1FECA 2R0CA 5HXIA 2YR4A 2BACA 4Q0TA 1GEUA 1W4XA 2YLTA 4B67A 4YXDA 5CQFA 1X31B 1D4DA 4H4ZA 4EM4A 4FK1C 3OWMA 4IVOB 1PBEA 4J2WA 1VDCA 2VRLA 3ZYXA 3UKKA 2IVDA 3I6DA 3QVPA 3SCEA 3RNMA 4B69A 3GD4A 3P4PA 2XVFA 3VRDB 3RKHA 2QA2A 3GWDA 3UKLA 5FS8A 5IQ4A 1JNIA 1CL0A 2GR2A 2XLUA 4EMJA 3H4KA 4ZCCA 3UCLA 2V3BA 2C3CA 1GRGA 4IA5A 3DMEA 2Q0LA 1ZX9A 4TM1A 2YG5A 4K7ZA 4AT2A 4A9WA 3ZDNA 4Q1OA 1EBDA 2B7RA 3S5WA 1FT5A 2ARDA 4GR1A 4GRTA 1FT6A 2XVEA 4J57A 3ICRA 4AOSA 3AEAA 1FEAA 3NRNA 3NN0X 4ZCDA 4B63A 1GRBA 4L38A 1GRAA 1PJ7A 2A89A 4H7UA 2VQ7A 4J36A 4I58A 4ZN0A 2PYXA 3NLCA 1M64A 3D1IA 2C7GA 1E39A 4NEWA 2Y6QA 1ONFA 3AEGA 3EAOA 3NHOX 4CCRA 1BF3A 2XYOA 1O95A 5U63A 1PXAA 4OPIA 3GYIA 1B4VA 3AEDA 1JRYA 2B9YA 3OC4A 3RP7A 1MO9A 3DH9A 4H4TA 1D4CA 2BCPA 3SXQA 2Z5YA 1COYA 4OCGA 4B1BA 2R4EA 2QCUA 3K30A 3LG1A 1XDIA 5KOXA 3AYLA 4H4SA 3CPIG 4UDQA 3CGEA 3SGLA 3T37A 4FX9A 2ZBWA 2X3NA 1EL8A 2WP9A 3ABVA 1D5TA 2TPRA 2A87A 1L9CA 1ELIA 5HYMA 3V3NA 4AOXA 1DNCA 4TM0A 1L0VA 2CFYA 2B9WA 4OPGA 5J60A 1PDHA 2EQ7A 4J34A 1KDGA 3NIXA 2IIDA 2WOWA 3URHA 2R46A 2R45A 1TRBA 3TORA 5TR3A 2WPEA 3CGDA 3AYIA 1DODA 3KVEA 4NTCA 5U25A 4IVMB 4H2PA 4CNJA 1N4VA 2JAEA 3F8PA 1JOAA 1Y56A 2CULA 1F8RA 3IC9A 3CPJG 1L9DA 3LXDA 4KPRA 4USRA 1JNRA 4YSYA 1RP0A 1Y56B 1IUUA 3NK1X 3F8DA 2RABA 4BK3A 2JB1A 2C75A 3L1RA 3ITJA 4Z43A 1TDOA 1YKJA 4L3XA 2XFOA 1JU2A 4O5QA 2C3DA 1GRHA 2VQBA 1LPFA 2YG7A 4U8JA 4Z44A 2BK3A 4B68A 2OAMA 2C73A 1M1PA 3D1CA 1PBBA 3PS9A 4Z24A 2VOUA 3AD9B 1ZKQA 2EQ6A 1ZY8A 2JKCA 3C96A 3UTHA 2FJDA 2X50A 4EQWA 2GMHA 3UTEA 4YKGA 4MJWA 1Q1WA 1SEZA 3I3LA 1TDFA 3V3OA 3DK9A 1V59A 1YY5A 3L1TA 3CNPA 2AR8A 3VRBA 4H50A 1KSUA 3H8LA 4N9XA 4U2SA 1H7XA 3UTFA 4B65A 5EB5A 1GRTA 1XANA 3FPZA 4J31A 3AEFA 4CRTA 1EL9A 4EIQA 5KOWA 3UOXA 2ACZA 4H4QA 3FO3A 5ER0A 3VQRA 3K7TA 4Q5BA 3AWIA 4GUVA 1REOA 3KU9A 3GWFA 1Z6LA 2YVGA 3GDPA 3IHGA 3SFDA 3OZ2A 4Y4MA 1BZLA 4GF7A 4UP3A 1GERA 4Q17A 3FIMB 2W0HA 3R9UA 2WP6A 3LADA 3NGCX 4U8KA 3NK0X 4WCTA 5BUKA 2WDRA 3EPTA 2WPFA 3UOYA 2WDQA 1F3PA
chains in the Genus database with same CATH superfamily
4Z2RA 1IUTA 2ZZCA 2V60A 1DOBA 2YG3A 4H4UA 5GRTA 3AE8A 1JRZA 2C65A 3UP5A 4Y4NA 2WU5A 4A79A 3B3RA 4EQXA 5JCLA 1YQ4A 2ZO5A 4I59A 2YLRA 4OVIA 1VG9A 1GNDA 3PO7A 1LQTA 2RDZA 3UKAA 5EOWA 4L3ZA 3AXBA 2J3NA 5KVIA 5JCKA 4TM4A 1IUWA 2V5ZA 1GXFA 4U8IA 3AE6A 4II2A 3T2KA 4BK1A 5KWFA 4GDEA 2EQ8A 1NG4A 3UKHA 1CF3A 3F29A 1NHPA 3GRTA 2O9ZA 3RP6A 1LTXR 4H2NA 1KF6A 1TYPA 4K2XA 1S2QA 3FMWA 3EF6A 3E1TA 1FS8A 3PVCA 1GALA 3KA7A 1NHSA 4PAAA 1FCDA 1PHHA 3KPFA 4JY3A 2HQMA 2OA1A 4BK2A 4C77A 3AECA 4II3A 4EQSA 3O0HA 4UDRA 4Q5CA 3QJ4A 1OJCA 4YT0A 1CBOA 2WS3A 1NENA 1HYUA 2GQWA 4FK1A 1PXCA 3D8XA 3ICTA 3IWAA 4TLXA 2YLWA 2BRAA 2WOVA 3QFBA 3GM6A 4H2RA 4OPCA 1K4QA 1YQZA 3DK4A 5BVAA 4YSZA 3LOVA 1FL2A 5BULA 2GR0A 2R0PA 3NK2X 3GD3A 1QDBA 3UP4A 3GMCA 3WE0A 3C4AA 4PABA 5KMQA 2WP5A 3M12A 4RG3A 1PS9A 3NNEA 2BK5A 1H83A 4O5UA 5EBKA 1PXBA 5C3JA 3SFEA 5C2TA 1ZP0A 2C72A 3AYJA 1BGNA 2XVJA 3CN8A 2QAEA 4OPLA 1PN0A 1BWCA 3G5RA 3P1WA 5KVHA 3NN6X 1GOSA 4REKA 4G73A 4YTMA 1TYTA 2BXSA 3ALJA 3NTAA 4USQA 4D03A 1OJ9A 1OJDA 2NPXA 2J7AA 2FJAA 4FDCB 4APNA 3ATQA 2RGOA 4A6NA 1DOCA 2GQFA 1DOEA 3TTBA 1ZDLA 2E4GA 4NZHA 3KLJA 4X9NA 4HA6A 4XWZA 4A6NB 3BNGA 1E7PA 4L3YA 4CCQA 3BHFA 3DGZA 4B66A 1IUVA 4Z26A 2TMDA 1M6IA 2YR6A 4A5LA 1GPEA 2UZZA 4CNKA 3BI2A 3K7QX 1H7WA 1GV4A 3SZFA 5HY5A 1NPXA 4EIPA 2WQYA 2K3VA 2GAHB 3BNMA 3UBRA 3P4QA 2OLOA 4XXGA 3VR8A 4U8MA 4DGKA 5M10A 1P2EA 2GMJA 2XFNA 4GCMA 4YTNA 3GDNA 4CBQA 4YWOA 1SP3A 2YLXA 3UU9A 4AP1A 2GB0A 2VVLA 1N4UA 2JK6A 4NWZA 3LJPA 2I0ZA 4EMWA 4C3XA 1IUXA 3CGCA 4X4JA 1YQ3A 2CZSA 3EANA 3QVRA 4Y4LA 3COXA 4JNAA 1LV0A 1FEBA 4NTEA 4YSHA 3AE5A 2R0GA 1B8SA 3AB1A 3QSSA 4M52A 2Q7VA 3CNJA 1JEHA 1LVLA 5J7XA 1FS9A 3GYJA 1TDEA 4YKFA 2XLTA 4CY6A 2VVLG 4H4WA 1K0LA 2AQJA 5KMPA 3UOZA 1PBDA 1DJNA 1GSNA 2YLSA 3AE2A 4C3YA 2BS3A 2X99A 1S3EA 1D7LA 3VRAA 5JCMA 4UDPA 2CDUA 2YR5A 4ECHA 4ICYA 2WHDA 2QA1A 1KFYA 1QO8A 5M0ZA 4BJYA 1KNPA 1OJAA 2X8GA 3AE4A 4LA1A 4JN9A 3LGQA 3AE7A 4IV9A 3V76A 2XVHA 4U8OA 1M1RA 4A7AA 3AD7B 4RSLA 4JNQA 2JB2A 4LU6A 3NKSA 2ZZBA 4J56A 1CJ2A 2RF7A 3M13A 2APGA 2VZ2A 4OPDA 2YM2A 1VRQB 2GF3A 3H8IA 3QFAA 1NHRA 1UKVG 2X8HA 4Q4UA 3FBSA 1ZMCA 1QLBA 4NEVA 1P2HA 2EQ9A 4U2LA 1RSGA 3FG2P 2B7SA 3CTYA 1CC4A 3GYXA 2ZZ0A 3ALLA 4P9SA 4K5RA 5IQ1A 1N4WA 4BURA 1ZMDA 1B5QA 2BS2A 3AEEA 3GMBA 3VR9A 3RP8A 3CGBA 3KPKA 3AE9A 2X8CA 4EM3A 2BABA 3C4NA 4Z2UA 3QSEA 1E1LA 4H4RA 1GU6A 5EB4A 2GEWA 3T0KA 3UKFA 2JBVA 3CNTA 1GETA 1LJ1A 1DJQA 3HYXA 4C74A 4OPTA 1JRXA 2Y6RA 3ISHA 2WU2A 5KRQA 1M1QA 1K0IA 1EL5A 3BNJA 3SY4A 2YLZA 3NYCA 1E1KA 3DJDA 2RGHA 4TM3A 2BS4A 5L46A 4D04A 2XFPA 1EL7A 1ZOVA 3AE1A 1F8SA 5JCIA 2BYBA 3DA1A 1XHCA 1E6EA 3UKQA 3AE3A 1GTHA 1H82A 1H86A 1LQUA 5U1OA 4H4PA 3JSKA 3BNFA 2BC1A 2C67A 1D4EA 1L9EA 1E1MA 2R9ZA 1NEKA 2B76A 1B37A 4U8PA 1KSSA 1RYIA 2GRTA 2YAUA 1NDAA 3CNSA 2BXRA 3KD9A 3SQPA 4YSXA 3F8RA 4GAPA 1AOGA 3SYIA 2IVEA 4Z25A 2XDOA 3AD8B 1QJDA 3DJJA 5KXJA 1IJHA 4KX6A 2XFQA 2BC0A 4A65A 1VG0A 3HZLA 2GH5A 2WDVA 4H4VA 2C70A 2VVMA 2CVJA 4K5SA 4NTDA 2C66A 1PJ6A 4E0VA 1GREA 2Z5XA 3NT6A 4OPUA 1N1PA 1CHUA 1CJ4A 2JB3A 1OAHA 3CNDA 3S61A 1Q1RA 2OALA 3G5SA 3S7WA 3P9UA 3ALMA 4C5OA 2OLNA 3MMOA 1GTEA 3RHAA 2PHHA 5GSNA 2AAQA 3K7MX 4Z2TA 2LFCA 2E5VA 5HHFA 4HB9A 1ZK7A 1GESA 3UKPA 3LB8A 2WBAA 3Q6JA 3ADAB 2FJEA 3BNUA 3IHMA 4AT0A 1CJ3A 4WJYA 1H81A 4JY2A 4RG4A 3IF9A 3NYFA 3T14A 2YM1A 1BVBA 2V6OA 2OT4A 3HYVA 4BJZA 1NAAA 4EMIA 3DJEA 2B9XA 4K22A 4U2TA 2DKHA 3QSMA 1F8WA 2XLRA 1GRFA 2WPCA 4DSHA 2C4CA 2NVKX 3P4SA 2FBWA 1O94A 2Q0KA 4G9KA 3NH3X 4DNAA 5BRTA 5CKUA 4CY8A 2E80A 2BRYA 1ZOYA 2GAGB 5FS9A 1IUSA 2C64A 2YG4A 3DK8A 2BCGG 5KNLA 2YVFA 4IA6A 3B6DA 5FS7A 3BNHA 2A8XA 3GSIA 1K0JA 1DXLA 2YVJA 3DGHA 1S3BA 3UTGA 4K8DA 2V3AA 1VQWA 2FJBA 4BV6A 1O5WA 2WETA 3NG7X 4DSGA 2GVCA 4WX1A 4J33A 1NG3A 1CC2A 2XFUA 3CIRA 3M0OA 1PJ5A 1BKWA 4TLZA 5IPYA 3ICSA 5FS6A 2RGJA 3L8KA 4EQRA 2C76A 2XLSA 1CJCA 2E1MA 2WESA 2GV8A 5FMHA 3NYEA 3BHKA 1S2YA 2Q6UA 3BI5A 4G6GA 2VRMA 1GT8A 2V61A 1CC6A 1MXTA 3LZXA 4JQ9A 4YTPA 3GRSA 2F5ZA 1FOHA 1Y0PA 3SM8A 2YWLA 1OJTA 2XLPA 3ATRA 2E81A 1XPQA 2XCGA 2WOIA 4GAVA 1TDKA 4X9MA 3UOVA 1PBCA 1KNRA 1F6MA 1BGJA 3II4A 1TDNA 2H88A 4U8NA 4H4XA 3G5QA 4H4YA 4U8LA 2YQUA 4H2QA 3NTDA 3P4RA 1FS7A 1D7YA 1H6VA 4B64A 1PBFA 4XWRA 1JNZA 4ADWA 3BI4A 2H89A 3LZWA 2XVIA 1NHQA 4JDRA 2VR0A 1MOKA 3DJGX 2R4JA 3CMMA 4GDPA 1Q9IA 2GR3A 4A99A 1H84A 2BA9A 3CPHG 4LIIA 4AP3A 5JCNA 3REDA 2GR1A 1E1NA 2DKIA 2WEUA 3AEBA 3Q9TA 2BK4A 5DBJA 3KKJA 2YG6A 5LV9A 1FECA 2R0CA 5HXIA 2YR4A 2BACA 4G74A 4Q0TA 1GEUA 1W4XA 2YLTA 4B67A 4YXDA 5CQFA 1X31B 1D4DA 4H4ZA 4EM4A 4FK1C 3OWMA 4IVOB 1PBEA 4J2WA 1VDCA 2VRLA 3ZYXA 3SZWA 2IVDA 3UKKA 3I6DA 3QVPA 3SCEA 3RNMA 4B69A 3GD4A 3P4PA 2XVFA 3VRDB 3RKHA 2QA2A 3GWDA 3UKLA 5FS8A 5IQ4A 1JNIA 1CL0A 2GR2A 2XLUA 4EMJA 3H4KA 4ZCCA 3T2YA 3UCLA 2V3BA 2C3CA 1GRGA 4IA5A 3DMEA 2Q0LA 1ZX9A 4TM1A 2YG5A 4K7ZA 4AT2A 4A9WA 3ZDNA 4Q1OA 1EBDA 2B7RA 3S5WA 1FT5A 2ARDA 4GR1A 4GRTA 1FT6A 2XVEA 4J57A 3ICRA 4AOSA 3AEAA 1FEAA 3NRNA 3NN0X 4ZCDA 4B63A 1GRBA 4L38A 1GRAA 1PJ7A 2A89A 4H7UA 2VQ7A 4J36A 4I58A 4ZN0A 2PYXA 3NLCA 1M64A 3D1IA 2C7GA 1E39A 4NEWA 2Y6QA 1ONFA 3AEGA 3EAOA 3NHOX 4CCRA 1BF3A 2XYOA 1O95A 5U63A 1PXAA 4OPIA 3GYIA 1B4VA 3AEDA 1JRYA 2B9YA 3OC4A 3RP7A 1MO9A 3DH9A 4NNJA 4H4TA 1D4CA 2BCPA 3SXQA 2Z5YA 1COYA 4OCGA 5KMRA 4B1BA 2R4EA 2QCUA 3K30A 3LG1A 1XDIA 5KOXA 3AYLA 4H4SA 3CPIG 4UDQA 3CGEA 3SGLA 3T37A 4FX9A 2ZBWA 2X3NA 1EL8A 2WP9A 3ABVA 1D5TA 3T31A 3SX6A 2TPRA 2A87A 1L9CA 1ELIA 5HYMA 3V3NA 4AOXA 1DNCA 4TM0A 1L0VA 2CFYA 2B9WA 4OPGA 5J60A 1PDHA 5KMSA 2EQ7A 4J34A 1KDGA 3NIXA 2IIDA 2WOWA 3URHA 2R46A 2R45A 1TRBA 3TORA 5TR3A 3SXIA 2WPEA 3CGDA 3AYIA 1DODA 3KVEA 4NTCA 5U25A 4IVMB 4H2PA 4CNJA 1N4VA 2JAEA 3F8PA 1JOAA 1Y56A 3HYWA 2CULA 1F8RA 3IC9A 3CPJG 1L9DA 3LXDA 4KPRA 4USRA 3T2ZA 1JNRA 4YSYA 1RP0A 1Y56B 1IUUA 4G6HA 3NK1X 3F8DA 2RABA 4BK3A 2JB1A 2C75A 3L1RA 3ITJA 4Z43A 1TDOA 1YKJA 4L3XA 2XFOA 1JU2A 4O5QA 2C3DA 1GRHA 2VQBA 1LPFA 2YG7A 4U8JA 4Z44A 2BK3A 4B68A 2OAMA 2C73A 1M1PA 3D1CA 1PBBA 3PS9A 4Z24A 2VOUA 3AD9B 1ZKQA 2EQ6A 1ZY8A 2JKCA 3C96A 3UTHA 2FJDA 2X50A 4EQWA 2GMHA 3UTEA 4YKGA 4MJWA 1Q1WA 1SEZA 3I3LA 1TDFA 3V3OA 3DK9A 1V59A 1YY5A 3L1TA 3CNPA 2AR8A 3VRBA 4H50A 1KSUA 3H8LA 4N9XA 4U2SA 1H7XA 3UTFA 4B65A 5EB5A 1GRTA 1XANA 3FPZA 4J31A 3AEFA 4CRTA 1EL9A 4EIQA 5KOWA 3UOXA 3SZ0A 2ACZA 4H4QA 3FO3A 3SZCA 5ER0A 3VQRA 3K7TA 4Q5BA 3AWIA 4GUVA 1REOA 3KU9A 3GWFA 1Z6LA 2YVGA 3GDPA 3IHGA 3SFDA 3OZ2A 4Y4MA 1BZLA 4GF7A 4UP3A 1GERA 4Q17A 3FIMB 2W0HA 3R9UA 2WP6A 3LADA 3NGCX 4U8KA 3NK0X 4WCTA 5BUKA 2WDRA 3EPTA 2WPFA 3UOYA 2WDQA 1F3PA
chains in the Genus database with same CATH topology
4Z2RA 1IUTA 2ZZCA 2V60A 1DOBA 2YG3A 4H4UA 5GRTA 3AE8A 1JRZA 2C65A 3UP5A 4Y4NA 2WU5A 4A79A 3B3RA 4EQXA 5JCLA 1YQ4A 2ZO5A 4I59A 2YLRA 4OVIA 1VG9A 1GNDA 3PO7A 1LQTA 2RDZA 3UKAA 5EOWA 4L3ZA 3AXBA 2J3NA 5KVIA 5JCKA 4TM4A 1IUWA 2V5ZA 1GXFA 4U8IA 3AE6A 4II2A 3T2KA 4BK1A 5KWFA 4GDEA 2EQ8A 1NG4A 3UKHA 1CF3A 3F29A 1NHPA 3GRTA 2O9ZA 3RP6A 1LTXR 4H2NA 1KF6A 1TYPA 4K2XA 1S2QA 3FMWA 3EF6A 3E1TA 1FS8A 3PVCA 1GALA 3KA7A 1NHSA 4PAAA 1FCDA 1PHHA 3KPFA 4JY3A 2HQMA 2OA1A 4BK2A 4C77A 3AECA 4II3A 4EQSA 3O0HA 4UDRA 4Q5CA 3QJ4A 1OJCA 1CBOA 2WS3A 1NENA 1HYUA 2GQWA 4FK1A 1PXCA 3D8XA 3ICTA 3IWAA 4TLXA 2YLWA 2BRAA 2WOVA 3QFBA 3GM6A 4H2RA 4OPCA 1K4QA 1YQZA 3DK4A 5BVAA 4YSZA 3LOVA 1FL2A 5BULA 2GR0A 2R0PA 3NK2X 3GD3A 1QDBA 3UP4A 3GMCA 3WE0A 3C4AA 4PABA 5KMQA 2WP5A 3M12A 4RG3A 1PS9A 3NNEA 2BK5A 1H83A 4O5UA 5EBKA 1PXBA 5C3JA 3SFEA 5C2TA 1ZP0A 2C72A 3AYJA 1BGNA 2XVJA 3CN8A 2QAEA 4OPLA 1PN0A 1BWCA 3G5RA 3P1WA 5KVHA 3NN6X 1GOSA 4REKA 4G73A 4YTMA 1TYTA 2BXSA 3ALJA 3NTAA 4USQA 4D03A 1OJ9A 1OJDA 2NPXA 2J7AA 2FJAA 4FDCB 4APNA 3ATQA 2RGOA 4A6NA 1DOCA 2GQFA 1DOEA 3TTBA 1ZDLA 2E4GA 4NZHA 3KLJA 4X9NA 4HA6A 4XWZA 4A6NB 3BNGA 1E7PA 4L3YA 4CCQA 3BHFA 3DGZA 4B66A 1IUVA 4Z26A 2TMDA 1M6IA 2YR6A 4A5LA 1GPEA 2UZZA 4CNKA 3BI2A 3K7QX 1H7WA 1GV4A 3SZFA 5HY5A 1NPXA 4EIPA 2WQYA 2K3VA 2GAHB 3BNMA 3UBRA 3P4QA 2OLOA 4XXGA 3VR8A 4U8MA 4DGKA 5M10A 1P2EA 2GMJA 2XFNA 4GCMA 4YTNA 3GDNA 4CBQA 4YWOA 1SP3A 2YLXA 3UU9A 4AP1A 2GB0A 2VVLA 1N4UA 2JK6A 4NWZA 3LJPA 2I0ZA 4EMWA 4C3XA 1IUXA 3CGCA 4X4JA 1YQ3A 3EANA 4YT0A 3QVRA 4Y4LA 3COXA 4JNAA 1LV0A 1FEBA 4NTEA 4YSHA 3AE5A 2R0GA 1B8SA 3AB1A 3QSSA 4M52A 2Q7VA 3CNJA 1JEHA 1LVLA 5J7XA 1FS9A 3GYJA 1TDEA 4YKFA 2XLTA 4CY6A 2VVLG 4H4WA 1K0LA 2AQJA 5KMPA 3UOZA 1PBDA 1DJNA 1GSNA 2YLSA 3AE2A 4C3YA 2BS3A 2X99A 1S3EA 1D7LA 3VRAA 5JCMA 4UDPA 2CDUA 2YR5A 4ECHA 4ICYA 2WHDA 2QA1A 1KFYA 1QO8A 5M0ZA 4BJYA 1KNPA 1OJAA 2X8GA 3AE4A 4LA1A 4JN9A 3LGQA 3AE7A 4IV9A 3V76A 2XVHA 4U8OA 1M1RA 4A7AA 3AD7B 4RSLA 4JNQA 2JB2A 4LU6A 3NKSA 2ZZBA 4J56A 1CJ2A 2RF7A 3M13A 2APGA 2VZ2A 4OPDA 2YM2A 1VRQB 2GF3A 3H8IA 3QFAA 1NHRA 1UKVG 2X8HA 4Q4UA 3FBSA 1ZMCA 1QLBA 4NEVA 1P2HA 2EQ9A 4U2LA 1RSGA 3FG2P 2B7SA 3CTYA 1CC4A 3GYXA 2ZZ0A 3ALLA 4P9SA 4K5RA 5IQ1A 1N4WA 4BURA 1ZMDA 1B5QA 2BS2A 3AEEA 3GMBA 3VR9A 3RP8A 3CGBA 3KPKA 3AE9A 2X8CA 4EM3A 2BABA 3C4NA 4Z2UA 3QSEA 1E1LA 4H4RA 1GU6A 5EB4A 2GEWA 3T0KA 3UKFA 2JBVA 3CNTA 1GETA 1LJ1A 1DJQA 3HYXA 4C74A 4OPTA 1JRXA 2Y6RA 3ISHA 2WU2A 5KRQA 1M1QA 1K0IA 1EL5A 3BNJA 3SY4A 2YLZA 3NYCA 1E1KA 3DJDA 2RGHA 4TM3A 2BS4A 5L46A 4D04A 2XFPA 1EL7A 1ZOVA 3AE1A 1F8SA 5JCIA 2BYBA 3DA1A 1XHCA 1E6EA 3UKQA 3AE3A 1GTHA 1H82A 1H86A 1LQUA 5U1OA 4H4PA 3JSKA 3BNFA 2BC1A 2C67A 1D4EA 1L9EA 1E1MA 2R9ZA 1NEKA 2B76A 1B37A 4U8PA 1KSSA 1RYIA 2GRTA 2YAUA 1NDAA 3CNSA 2BXRA 3KD9A 3SQPA 4YSXA 3F8RA 4GAPA 1AOGA 3SYIA 2IVEA 4Z25A 2XDOA 3AD8B 1QJDA 3DJJA 5KXJA 1IJHA 4KX6A 2XFQA 2BC0A 4A65A 1VG0A 3HZLA 2GH5A 2WDVA 4H4VA 2C70A 2VVMA 2CVJA 4K5SA 4NTDA 2C66A 1PJ6A 4E0VA 1GREA 2Z5XA 3NT6A 4OPUA 1N1PA 1CHUA 1CJ4A 2JB3A 1OAHA 3CNDA 3S61A 1Q1RA 2OALA 3G5SA 3S7WA 3P9UA 3ALMA 4C5OA 2OLNA 3MMOA 1GTEA 3RHAA 2PHHA 5GSNA 2AAQA 3K7MX 4Z2TA 2LFCA 2E5VA 5HHFA 4HB9A 1ZK7A 1GESA 3UKPA 3LB8A 2WBAA 3Q6JA 3ADAB 2FJEA 3BNUA 3IHMA 4AT0A 1CJ3A 4WJYA 1H81A 4JY2A 4RG4A 3IF9A 3NYFA 3T14A 2YM1A 1BVBA 2V6OA 2OT4A 3HYVA 4BJZA 1NAAA 4EMIA 3DJEA 2B9XA 4K22A 4U2TA 2DKHA 3QSMA 1F8WA 2XLRA 1GRFA 2WPCA 4DSHA 2C4CA 2NVKX 3P4SA 2FBWA 1O94A 2Q0KA 4G9KA 3NH3X 4DNAA 5BRTA 5CKUA 4CY8A 2E80A 2BRYA 1ZOYA 2GAGB 5FS9A 1IUSA 2C64A 2YG4A 3DK8A 2BCGG 5KNLA 2YVFA 4IA6A 3B6DA 5FS7A 3BNHA 2A8XA 3GSIA 1K0JA 1DXLA 2YVJA 3DGHA 1S3BA 3UTGA 4K8DA 2V3AA 1VQWA 2FJBA 4BV6A 1O5WA 2WETA 3NG7X 4DSGA 2GVCA 4WX1A 4J33A 1NG3A 1CC2A 2XFUA 3CIRA 3M0OA 1PJ5A 1BKWA 4TLZA 5IPYA 3ICSA 5FS6A 2RGJA 3L8KA 4EQRA 2C76A 2XLSA 1CJCA 2E1MA 2WESA 2GV8A 5FMHA 3NYEA 3BHKA 1S2YA 2Q6UA 3BI5A 4G6GA 2VRMA 1GT8A 2V61A 1CC6A 1MXTA 3LZXA 4JQ9A 4YTPA 3GRSA 2F5ZA 1FOHA 1Y0PA 3SM8A 2YWLA 1OJTA 2XLPA 3ATRA 2E81A 1XPQA 2XCGA 2WOIA 4GAVA 1TDKA 4X9MA 3UOVA 1PBCA 1KNRA 1F6MA 1BGJA 3II4A 1TDNA 2H88A 4U8NA 4H4XA 3G5QA 4H4YA 4U8LA 2YQUA 4H2QA 3NTDA 3P4RA 1FS7A 1D7YA 1H6VA 4B64A 1PBFA 4XWRA 1JNZA 4ADWA 3BI4A 2H89A 3LZWA 2XVIA 1NHQA 4JDRA 2VR0A 1MOKA 3DJGX 2R4JA 3CMMA 4GDPA 1Q9IA 2GR3A 4A99A 1H84A 2BA9A 3CPHG 4LIIA 4AP3A 5JCNA 3REDA 2GR1A 1E1NA 2DKIA 2WEUA 3AEBA 3Q9TA 2BK4A 5DBJA 3KKJA 2YG6A 5LV9A 1FECA 2R0CA 5HXIA 2YR4A 2BACA 4G74A 4Q0TA 1GEUA 1W4XA 2YLTA 4B67A 4YXDA 5CQFA 1X31B 1D4DA 4H4ZA 4EM4A 4FK1C 3OWMA 4IVOB 1PBEA 4J2WA 1VDCA 2VRLA 3ZYXA 3SZWA 2IVDA 3UKKA 3I6DA 3QVPA 3SCEA 3RNMA 4B69A 3GD4A 3P4PA 2XVFA 3VRDB 3RKHA 2QA2A 3GWDA 3UKLA 5FS8A 5IQ4A 1JNIA 1CL0A 2GR2A 2XLUA 4EMJA 3H4KA 4ZCCA 3T2YA 3UCLA 2V3BA 2C3CA 1GRGA 4IA5A 3DMEA 2Q0LA 1ZX9A 4TM1A 2YG5A 4K7ZA 4AT2A 4A9WA 3ZDNA 4Q1OA 1EBDA 2B7RA 3S5WA 1FT5A 2ARDA 4GR1A 4GRTA 1FT6A 2XVEA 4J57A 3ICRA 4AOSA 3AEAA 1FEAA 3NRNA 3NN0X 4ZCDA 4B63A 1GRBA 4L38A 1GRAA 1PJ7A 2A89A 4H7UA 2VQ7A 4J36A 4I58A 4ZN0A 2PYXA 3NLCA 1M64A 3D1IA 2C7GA 1E39A 4NEWA 2Y6QA 1ONFA 3AEGA 3EAOA 3NHOX 4CCRA 1BF3A 2XYOA 1O95A 5U63A 1PXAA 4OPIA 3GYIA 1B4VA 3AEDA 1JRYA 2B9YA 3OC4A 3RP7A 1MO9A 3DH9A 4NNJA 4H4TA 1D4CA 2BCPA 3SXQA 2Z5YA 1COYA 4OCGA 5KMRA 4B1BA 2R4EA 2QCUA 3K30A 3LG1A 1XDIA 5KOXA 3AYLA 4H4SA 3CPIG 4UDQA 3CGEA 3SGLA 3T37A 4FX9A 2ZBWA 2X3NA 1EL8A 2WP9A 3ABVA 1D5TA 3T31A 3SX6A 2TPRA 2A87A 1L9CA 1ELIA 5HYMA 3V3NA 4AOXA 1DNCA 4TM0A 1L0VA 2CFYA 2B9WA 4OPGA 5J60A 1PDHA 5KMSA 2EQ7A 4J34A 1KDGA 3NIXA 2IIDA 2WOWA 3URHA 2R46A 2R45A 1TRBA 3TORA 5TR3A 3SXIA 2WPEA 3CGDA 3AYIA 1DODA 3KVEA 4NTCA 5U25A 4IVMB 4H2PA 4CNJA 1N4VA 2JAEA 3F8PA 1JOAA 1Y56A 3HYWA 2CULA 1F8RA 3IC9A 3CPJG 1L9DA 3LXDA 4KPRA 4USRA 3T2ZA 1JNRA 4YSYA 1RP0A 1Y56B 1IUUA 4G6HA 3NK1X 3F8DA 2RABA 4BK3A 2JB1A 2C75A 3L1RA 3ITJA 4Z43A 1TDOA 1YKJA 4L3XA 2XFOA 1JU2A 4O5QA 2C3DA 1GRHA 2VQBA 1LPFA 2YG7A 4U8JA 4Z44A 2BK3A 4B68A 2OAMA 2C73A 1M1PA 3D1CA 1PBBA 3PS9A 4Z24A 2VOUA 3AD9B 1ZKQA 2EQ6A 1ZY8A 2JKCA 3C96A 3UTHA 2FJDA 2X50A 4EQWA 2GMHA 3UTEA 4YKGA 4MJWA 1Q1WA 1SEZA 3I3LA 1TDFA 3V3OA 3DK9A 1V59A 1YY5A 3L1TA 3CNPA 2AR8A 3VRBA 4H50A 1KSUA 3H8LA 4N9XA 4U2SA 1H7XA 3UTFA 4B65A 5EB5A 1GRTA 1XANA 3FPZA 4J31A 3AEFA 4CRTA 1EL9A 4EIQA 5KOWA 3UOXA 3SZ0A 2ACZA 4H4QA 3FO3A 3SZCA 5ER0A 3VQRA 3K7TA 4Q5BA 3AWIA 4GUVA 1REOA 3KU9A 3GWFA 1Z6LA 2YVGA 3GDPA 3IHGA 3SFDA 3OZ2A 4Y4MA 1BZLA 4GF7A 4UP3A 1GERA 4Q17A 3FIMB 2W0HA 3R9UA 2WP6A 3LADA 3NGCX 4U8KA 3NK0X 4WCTA 5BUKA 2WDRA 3EPTA 2WPFA 3UOYA 2WDQA 1F3PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z2R A;  1IUT A;  2ZZC A;  2V60 A;  1DOB A;  2YG3 A;  4H4U A;  5GRT A;  3AE8 A;  1JRZ A;  2C65 A;  3UP5 A;  4Y4N A;  2WU5 A;  4A79 A;  3B3R A;  4EQX A;  5JCL A;  1YQ4 A;  2ZO5 A;  4I59 A;  2YLR A;  4OVI A;  1VG9 A;  1GND A;  3PO7 A;  1LQT A;  2RDZ A;  3UKA A;  5EOW A;  4L3Z A;  3AXB A;  2J3N A;  5KVI A;  5JCK A;  4TM4 A;  1IUW A;  2V5Z A;  1GXF A;  4U8I A;  3AE6 A;  4BK1 A;  5KWF A;  4GDE A;  2EQ8 A;  1NG4 A;  3UKH A;  1CF3 A;  3F29 A;  1NHP A;  3GRT A;  2O9Z A;  3RP6 A;  1LTX R;  4H2N A;  1KF6 A;  1TYP A;  4K2X A;  1S2Q A;  3FMW A;  3EF6 A;  3E1T A;  1FS8 A;  3PVC A;  1GAL A;  3KA7 A;  1NHS A;  4PAA A;  1FCD A;  1PHH A;  3KPF A;  4JY3 A;  2HQM A;  2OA1 A;  4BK2 A;  4C77 A;  3AEC A;  4EQS A;  3O0H A;  4UDR A;  4Q5C A;  3QJ4 A;  1OJC A;  1CBO A;  2WS3 A;  1NEN A;  1HYU A;  2GQW A;  4FK1 A;  1PXC A;  3D8X A;  3ICT A;  3IWA A;  4TLX A;  2YLW A;  2WOV A;  3QFB A;  3GM6 A;  4H2R A;  4OPC A;  1K4Q A;  1YQZ A;  3DK4 A;  5BVA A;  4YSZ A;  3LOV A;  1FL2 A;  5BUL A;  2GR0 A;  2R0P A;  3NK2 X;  3GD3 A;  1QDB A;  3UP4 A;  3GMC A;  3WE0 A;  3C4A A;  4PAB A;  2WP5 A;  3M12 A;  4RG3 A;  1PS9 A;  3NNE A;  2BK5 A;  1H83 A;  4O5U A;  5EBK A;  1PXB A;  5C3J A;  3SFE A;  5C2T A;  1ZP0 A;  2C72 A;  3AYJ A;  1BGN A;  2XVJ A;  3CN8 A;  2QAE A;  4OPL A;  1PN0 A;  1BWC A;  3G5R A;  3P1W A;  5KVH A;  3NN6 X;  1GOS A;  4REK A;  4YTM A;  1TYT A;  2BXS A;  3ALJ A;  3NTA A;  4USQ A;  4D03 A;  1OJ9 A;  1OJD A;  2NPX A;  2J7A A;  2FJA A;  4FDC B;  4APN A;  3ATQ A;  2RGO A;  4A6N A;  1DOC A;  2GQF A;  1DOE A;  3TTB A;  1ZDL A;  2E4G A;  4NZH A;  3KLJ A;  4X9N A;  4HA6 A;  4XWZ A;  4A6N B;  3BNG A;  1E7P A;  4L3Y A;  4CCQ A;  3BHF A;  3DGZ A;  4B66 A;  1IUV A;  4Z26 A;  2TMD A;  1M6I A;  2YR6 A;  4A5L A;  1GPE A;  2UZZ A;  4CNK A;  3BI2 A;  3K7Q X;  1H7W A;  1GV4 A;  5HY5 A;  1NPX A;  4EIP A;  2WQY A;  2K3V A;  2GAH B;  3BNM A;  3UBR A;  3P4Q A;  2OLO A;  4XXG A;  3VR8 A;  4U8M A;  4DGK A;  5M10 A;  1P2E A;  2GMJ A;  2XFN A;  4GCM A;  4YTN A;  3GDN A;  4CBQ A;  4YWO A;  1SP3 A;  2YLX A;  3UU9 A;  4AP1 A;  2GB0 A;  2VVL A;  1N4U A;  2JK6 A;  3LJP A;  2I0Z A;  4EMW A;  4C3X A;  1IUX A;  3CGC A;  4X4J A;  1YQ3 A;  3EAN A;  4YT0 A;  3QVR A;  4Y4L A;  3COX A;  4JNA A;  1LV0 A;  1FEB A;  4NTE A;  4YSH A;  3AE5 A;  2R0G A;  1B8S A;  3AB1 A;  3QSS A;  4M52 A;  2Q7V A;  3CNJ A;  1JEH A;  1LVL A;  5J7X A;  1FS9 A;  3GYJ A;  1TDE A;  4YKF A;  2XLT A;  4CY6 A;  2VVL G;  4H4W A;  1K0L A;  2AQJ A;  3UOZ A;  1PBD A;  1DJN A;  1GSN A;  2YLS A;  3AE2 A;  4C3Y A;  2BS3 A;  2X99 A;  1S3E A;  1D7L A;  3VRA A;  5JCM A;  4UDP A;  2CDU A;  2YR5 A;  4ECH A;  4ICY A;  2WHD A;  2QA1 A;  1KFY A;  1QO8 A;  5M0Z A;  4BJY A;  1KNP A;  1OJA A;  2X8G A;  3AE4 A;  4LA1 A;  4JN9 A;  3LGQ A;  3AE7 A;  4IV9 A;  3V76 A;  2XVH A;  4U8O A;  1M1R A;  4A7A A;  3AD7 B;  4RSL A;  4JNQ A;  2JB2 A;  4LU6 A;  3NKS A;  2ZZB A;  4J56 A;  1CJ2 A;  2RF7 A;  3M13 A;  2APG A;  2VZ2 A;  4OPD A;  2YM2 A;  1VRQ B;  2GF3 A;  3H8I A;  3QFA A;  1NHR A;  1UKV G;  2X8H A;  4Q4U A;  3FBS A;  1ZMC A;  1QLB A;  4NEV A;  1P2H A;  2EQ9 A;  4U2L A;  1RSG A;  3FG2 P;  2B7S A;  3CTY A;  1CC4 A;  4P9S A;  2ZZ0 A;  3ALL A;  5IQ1 A;  4K5R A;  3GYX A;  1N4W A;  4BUR A;  1ZMD A;  1B5Q A;  2BS2 A;  3AEE A;  3GMB A;  3VR9 A;  3RP8 A;  3CGB A;  3AE9 A;  2X8C A;  4EM3 A;  2BAB A;  3C4N A;  4Z2U A;  3QSE A;  1E1L A;  4H4R A;  1GU6 A;  5EB4 A;  2GEW A;  3UKF A;  2JBV A;  3CNT A;  1GET A;  1LJ1 A;  1DJQ A;  4C74 A;  4OPT A;  1JRX A;  2Y6R A;  3ISH A;  2WU2 A;  5KRQ A;  1M1Q A;  1K0I A;  1EL5 A;  3BNJ A;  2YLZ A;  3NYC A;  1E1K A;  3DJD A;  2RGH A;  4TM3 A;  2BS4 A;  5L46 A;  4D04 A;  2XFP A;  1EL7 A;  1ZOV A;  3AE1 A;  1F8S A;  5JCI A;  2BYB A;  3DA1 A;  1XHC A;  1E6E A;  3UKQ A;  3AE3 A;  1GTH A;  1H82 A;  1H86 A;  1LQU A;  5U1O A;  4H4P A;  3JSK A;  3BNF A;  2BC1 A;  2C67 A;  1D4E A;  1L9E A;  1E1M A;  2R9Z A;  1NEK A;  2B76 A;  1B37 A;  4U8P A;  1KSS A;  1RYI A;  2GRT A;  2YAU A;  1NDA A;  3CNS A;  2BXR A;  3KD9 A;  3SQP A;  4YSX A;  3F8R A;  1AOG A;  2IVE A;  4Z25 A;  2XDO A;  3AD8 B;  1QJD A;  3DJJ A;  5KXJ A;  1IJH A;  4KX6 A;  2XFQ A;  2BC0 A;  4A65 A;  1VG0 A;  3HZL A;  2GH5 A;  2WDV A;  4H4V A;  2C70 A;  2VVM A;  2CVJ A;  4K5S A;  4NTD A;  2C66 A;  1PJ6 A;  4E0V A;  1GRE A;  2Z5X A;  3NT6 A;  4OPU A;  1N1P A;  1CHU A;  1CJ4 A;  2JB3 A;  1OAH A;  3CND A;  3S61 A;  1Q1R A;  2OAL A;  3G5S A;  3S7W A;  3P9U A;  3ALM A;  4C5O A;  2OLN A;  3MMO A;  1GTE A;  3RHA A;  2PHH A;  5GSN A;  2AAQ A;  3K7M X;  4Z2T A;  2LFC A;  2E5V A;  5HHF A;  4HB9 A;  1ZK7 A;  1GES A;  3UKP A;  3LB8 A;  2WBA A;  3Q6J A;  3ADA B;  2FJE A;  3BNU A;  3IHM A;  4AT0 A;  1CJ3 A;  4WJY A;  1H81 A;  4JY2 A;  4RG4 A;  3IF9 A;  3NYF A;  4YTP A;  2YM1 A;  1BVB A;  2V6O A;  2OT4 A;  4BJZ A;  1NAA A;  4EMI A;  3DJE A;  2B9X A;  4K22 A;  4U2T A;  2DKH A;  3QSM A;  1F8W A;  2XLR A;  1GRF A;  2WPC A;  4DSH A;  2NVK X;  3P4S A;  2FBW A;  1O94 A;  2Q0K A;  3NH3 X;  4DNA A;  5BRT A;  5CKU A;  4CY8 A;  2E80 A;  1ZOY A;  2GAG B;  5FS9 A;  1IUS A;  2C64 A;  2YG4 A;  3DK8 A;  2BCG G;  2YVF A;  4IA6 A;  3B6D A;  5FS7 A;  3BNH A;  2A8X A;  3GSI A;  1K0J A;  1DXL A;  2YVJ A;  3DGH A;  1S3B A;  3UTG A;  4K8D A;  2V3A A;  1VQW A;  2FJB A;  4BV6 A;  1O5W A;  2WET A;  3NG7 X;  4DSG A;  2GVC A;  4WX1 A;  4J33 A;  1NG3 A;  1CC2 A;  2XFU A;  3CIR A;  3M0O A;  1PJ5 A;  1BKW A;  4TLZ A;  5IPY A;  3ICS A;  5FS6 A;  2RGJ A;  3L8K A;  4EQR A;  2C76 A;  2XLS A;  1CJC A;  2E1M A;  2WES A;  2GV8 A;  5FMH A;  3NYE A;  3BHK A;  1S2Y A;  2Q6U A;  3BI5 A;  2VRM A;  1GT8 A;  2V61 A;  1CC6 A;  1MXT A;  3LZX A;  4JQ9 A;  3GRS A;  2F5Z A;  1FOH A;  1Y0P A;  3SM8 A;  2YWL A;  1OJT A;  2XLP A;  3ATR A;  2E81 A;  1XPQ A;  2XCG A;  2WOI A;  4X9M A;  1TDK A;  3UOV A;  4A99 A;  1PBC A;  1KNR A;  1F6M A;  1BGJ A;  3II4 A;  1TDN A;  2H88 A;  4U8N A;  4H4X A;  3G5Q A;  4H4Y A;  4U8L A;  2YQU A;  4H2Q A;  3NTD A;  3P4R A;  1FS7 A;  1D7Y A;  1H6V A;  4B64 A;  1PBF A;  4XWR A;  1JNZ A;  4ADW A;  3BI4 A;  2H89 A;  3LZW A;  2XVI A;  1NHQ A;  4JDR A;  2VR0 A;  1MOK A;  3DJG X;  2R4J A;  4GDP A;  1Q9I A;  2GR3 A;  1H84 A;  2BA9 A;  3CPH G;  4LII A;  4AP3 A;  5JCN A;  3RED A;  2GR1 A;  1E1N A;  2DKI A;  2WEU A;  3AEB A;  3Q9T A;  2BK4 A;  5DBJ A;  3KKJ A;  2YG6 A;  5LV9 A;  1FEC A;  2R0C A;  5HXI A;  2YR4 A;  2BAC A;  4Q0T A;  1GEU A;  1W4X A;  2YLT A;  4B67 A;  4YXD A;  5CQF A;  1X31 B;  1D4D A;  4H4Z A;  4EM4 A;  4FK1 C;  3OWM A;  4IVO B;  1PBE A;  4J2W A;  1VDC A;  2VRL A;  3ZYX A;  3UKK A;  2IVD A;  3I6D A;  3QVP A;  3SCE A;  3RNM A;  4B69 A;  3GD4 A;  3P4P A;  2XVF A;  3VRD B;  3RKH A;  2QA2 A;  3GWD A;  3UKL A;  5FS8 A;  5IQ4 A;  1JNI A;  1CL0 A;  2GR2 A;  2XLU A;  4EMJ A;  3H4K A;  4ZCC A;  3UCL A;  2V3B A;  2C3C A;  1GRG A;  4IA5 A;  3DME A;  2Q0L A;  1ZX9 A;  4TM1 A;  2YG5 A;  4K7Z A;  4AT2 A;  4A9W A;  3ZDN A;  4Q1O A;  1EBD A;  2B7R A;  3S5W A;  1FT5 A;  2ARD A;  4GR1 A;  4GRT A;  1FT6 A;  2XVE A;  4J57 A;  3ICR A;  4AOS A;  3AEA A;  1FEA A;  3NRN A;  3NN0 X;  4ZCD A;  4B63 A;  1GRB A;  4L38 A;  1GRA A;  1PJ7 A;  2A89 A;  4H7U A;  2VQ7 A;  4J36 A;  4I58 A;  4ZN0 A;  2PYX A;  3NLC A;  1M64 A;  3D1I A;  2C7G A;  1E39 A;  4NEW A;  2Y6Q A;  1ONF A;  3AEG A;  3EAO A;  3NHO X;  4CCR A;  1BF3 A;  2XYO A;  1O95 A;  5U63 A;  1PXA A;  4OPI A;  3GYI A;  1B4V A;  3AED A;  1JRY A;  2B9Y A;  3OC4 A;  3RP7 A;  1MO9 A;  3DH9 A;  4H4T A;  1D4C A;  2BCP A;  3SXQ A;  2Z5Y A;  1COY A;  4OCG A;  4B1B A;  2R4E A;  2QCU A;  3K30 A;  3LG1 A;  1XDI A;  5KOX A;  3AYL A;  4H4S A;  3CPI G;  4UDQ A;  3CGE A;  3SGL A;  3T37 A;  4FX9 A;  2ZBW A;  2X3N A;  1EL8 A;  2WP9 A;  3ABV A;  1D5T A;  2TPR A;  2A87 A;  1L9C A;  1ELI A;  5HYM A;  3V3N A;  4AOX A;  1DNC A;  4TM0 A;  1L0V A;  2CFY A;  2B9W A;  4OPG A;  5J60 A;  1PDH A;  2EQ7 A;  4J34 A;  1KDG A;  3NIX A;  2IID A;  2WOW A;  3URH A;  2R46 A;  2R45 A;  1TRB A;  3TOR A;  5TR3 A;  2WPE A;  3CGD A;  3AYI A;  1DOD A;  3KVE A;  4NTC A;  5U25 A;  4IVM B;  4H2P A;  4CNJ A;  1N4V A;  2JAE A;  3F8P A;  1JOA A;  1Y56 A;  2CUL A;  1F8R A;  3IC9 A;  3CPJ G;  1L9D A;  3LXD A;  4KPR A;  4USR A;  1JNR A;  4YSY A;  1RP0 A;  1Y56 B;  1IUU A;  3NK1 X;  3F8D A;  2RAB A;  4BK3 A;  2JB1 A;  2C75 A;  3L1R A;  3ITJ A;  4Z43 A;  1TDO A;  1YKJ A;  4L3X A;  2XFO A;  1JU2 A;  4O5Q A;  2C3D A;  1GRH A;  2VQB A;  1LPF A;  2YG7 A;  4U8J A;  4Z44 A;  2BK3 A;  4B68 A;  2OAM A;  2C73 A;  1M1P A;  3D1C A;  1PBB A;  3PS9 A;  4Z24 A;  2VOU A;  3AD9 B;  1ZKQ A;  2EQ6 A;  1ZY8 A;  2JKC A;  3C96 A;  3UTH A;  2FJD A;  2X50 A;  4EQW A;  2GMH A;  3UTE A;  4YKG A;  4MJW A;  1Q1W A;  1SEZ A;  3I3L A;  1TDF A;  3V3O A;  3DK9 A;  1V59 A;  1YY5 A;  3L1T A;  3CNP A;  2AR8 A;  3VRB A;  4H50 A;  1KSU A;  3H8L A;  4N9X A;  4U2S A;  1H7X A;  3UTF A;  4B65 A;  5EB5 A;  1GRT A;  1XAN A;  3FPZ A;  4J31 A;  3AEF A;  4CRT A;  1EL9 A;  4EIQ A;  5KOW A;  3UOX A;  2ACZ A;  4H4Q A;  3FO3 A;  5ER0 A;  3VQR A;  3K7T A;  4Q5B A;  3AWI A;  4GUV A;  1REO A;  3KU9 A;  3GWF A;  1Z6L A;  2YVG A;  3GDP A;  3IHG A;  3SFD A;  3OZ2 A;  4Y4M A;  1BZL A;  4GF7 A;  4UP3 A;  1GER A;  4Q17 A;  3FIM B;  2W0H A;  3R9U A;  2WP6 A;  3LAD A;  3NGC X;  4U8K A;  3NK0 X;  4WCT A;  5BUK A;  2WDR A;  3EPT A;  2WPF A;  3UOY A;  2WDQ A;  1F3P A; 
#chains in the Genus database with same CATH topology
 4Z2R A;  1IUT A;  2ZZC A;  2V60 A;  1DOB A;  2YG3 A;  4H4U A;  5GRT A;  3AE8 A;  1JRZ A;  2C65 A;  3UP5 A;  4Y4N A;  2WU5 A;  4A79 A;  3B3R A;  4EQX A;  5JCL A;  1YQ4 A;  2ZO5 A;  4I59 A;  2YLR A;  4OVI A;  1VG9 A;  1GND A;  3PO7 A;  1LQT A;  2RDZ A;  3UKA A;  5EOW A;  4L3Z A;  3AXB A;  2J3N A;  5KVI A;  5JCK A;  4TM4 A;  1IUW A;  2V5Z A;  1GXF A;  4U8I A;  3AE6 A;  4II2 A;  3T2K A;  4BK1 A;  5KWF A;  4GDE A;  2EQ8 A;  1NG4 A;  3UKH A;  1CF3 A;  3F29 A;  1NHP A;  3GRT A;  2O9Z A;  3RP6 A;  1LTX R;  4H2N A;  1KF6 A;  1TYP A;  4K2X A;  1S2Q A;  3FMW A;  3EF6 A;  3E1T A;  1FS8 A;  3PVC A;  1GAL A;  3KA7 A;  1NHS A;  4PAA A;  1FCD A;  1PHH A;  3KPF A;  4JY3 A;  2HQM A;  2OA1 A;  4BK2 A;  4C77 A;  3AEC A;  4II3 A;  4EQS A;  3O0H A;  4UDR A;  4Q5C A;  3QJ4 A;  1OJC A;  4YT0 A;  1CBO A;  2WS3 A;  1NEN A;  1HYU A;  2GQW A;  4FK1 A;  1PXC A;  3D8X A;  3ICT A;  3IWA A;  4TLX A;  2YLW A;  2BRA A;  2WOV A;  3QFB A;  3GM6 A;  4H2R A;  4OPC A;  1K4Q A;  1YQZ A;  3DK4 A;  5BVA A;  4YSZ A;  3LOV A;  1FL2 A;  5BUL A;  2GR0 A;  2R0P A;  3NK2 X;  3GD3 A;  1QDB A;  3UP4 A;  3GMC A;  3WE0 A;  3C4A A;  4PAB A;  5KMQ A;  2WP5 A;  3M12 A;  4RG3 A;  1PS9 A;  3NNE A;  2BK5 A;  1H83 A;  4O5U A;  5EBK A;  1PXB A;  5C3J A;  3SFE A;  5C2T A;  1ZP0 A;  2C72 A;  3AYJ A;  1BGN A;  2XVJ A;  3CN8 A;  2QAE A;  4OPL A;  1PN0 A;  1BWC A;  3G5R A;  3P1W A;  5KVH A;  3NN6 X;  1GOS A;  4REK A;  4G73 A;  4YTM A;  1TYT A;  2BXS A;  3ALJ A;  3NTA A;  4USQ A;  4D03 A;  1OJ9 A;  1OJD A;  2NPX A;  2J7A A;  2FJA A;  4FDC B;  4APN A;  3ATQ A;  2RGO A;  4A6N A;  1DOC A;  2GQF A;  1DOE A;  3TTB A;  1ZDL A;  2E4G A;  4NZH A;  3KLJ A;  4X9N A;  4HA6 A;  4XWZ A;  4A6N B;  3BNG A;  1E7P A;  4L3Y A;  4CCQ A;  3BHF A;  3DGZ A;  4B66 A;  1IUV A;  4Z26 A;  2TMD A;  1M6I A;  2YR6 A;  4A5L A;  1GPE A;  2UZZ A;  4CNK A;  3BI2 A;  3K7Q X;  1H7W A;  1GV4 A;  3SZF A;  5HY5 A;  1NPX A;  4EIP A;  2WQY A;  2K3V A;  2GAH B;  3BNM A;  3UBR A;  3P4Q A;  2OLO A;  4XXG A;  3VR8 A;  4U8M A;  4DGK A;  5M10 A;  1P2E A;  2GMJ A;  2XFN A;  4GCM A;  4YTN A;  3GDN A;  4CBQ A;  4YWO A;  1SP3 A;  2YLX A;  3UU9 A;  4AP1 A;  2GB0 A;  2VVL A;  1N4U A;  2JK6 A;  4NWZ A;  3LJP A;  2I0Z A;  4EMW A;  4C3X A;  1IUX A;  3CGC A;  4X4J A;  1YQ3 A;  2CZS A;  3EAN A;  3QVR A;  4Y4L A;  3COX A;  4JNA A;  1LV0 A;  1FEB A;  4NTE A;  4YSH A;  3AE5 A;  2R0G A;  1B8S A;  3AB1 A;  3QSS A;  4M52 A;  2Q7V A;  3CNJ A;  1JEH A;  1LVL A;  5J7X A;  1FS9 A;  3GYJ A;  1TDE A;  4YKF A;  2XLT A;  4CY6 A;  2VVL G;  4H4W A;  1K0L A;  2AQJ A;  5KMP A;  3UOZ A;  1PBD A;  1DJN A;  1GSN A;  2YLS A;  3AE2 A;  4C3Y A;  2BS3 A;  2X99 A;  1S3E A;  1D7L A;  3VRA A;  5JCM A;  4UDP A;  2CDU A;  2YR5 A;  4ECH A;  4ICY A;  2WHD A;  2QA1 A;  1KFY A;  1QO8 A;  5M0Z A;  4BJY A;  1KNP A;  1OJA A;  2X8G A;  3AE4 A;  4LA1 A;  4JN9 A;  3LGQ A;  3AE7 A;  4IV9 A;  3V76 A;  2XVH A;  4U8O A;  1M1R A;  4A7A A;  3AD7 B;  4RSL A;  4JNQ A;  2JB2 A;  4LU6 A;  3NKS A;  2ZZB A;  4J56 A;  1CJ2 A;  2RF7 A;  3M13 A;  2APG A;  2VZ2 A;  4OPD A;  2YM2 A;  1VRQ B;  2GF3 A;  3H8I A;  3QFA A;  1NHR A;  1UKV G;  2X8H A;  4Q4U A;  3FBS A;  1ZMC A;  1QLB A;  4NEV A;  1P2H A;  2EQ9 A;  4U2L A;  1RSG A;  3FG2 P;  2B7S A;  3CTY A;  1CC4 A;  3GYX A;  2ZZ0 A;  3ALL A;  4P9S A;  4K5R A;  5IQ1 A;  1N4W A;  4BUR A;  1ZMD A;  1B5Q A;  2BS2 A;  3AEE A;  3GMB A;  3VR9 A;  3RP8 A;  3CGB A;  3KPK A;  3AE9 A;  2X8C A;  4EM3 A;  2BAB A;  3C4N A;  4Z2U A;  3QSE A;  1E1L A;  4H4R A;  1GU6 A;  5EB4 A;  2GEW A;  3T0K A;  3UKF A;  2JBV A;  3CNT A;  1GET A;  1LJ1 A;  1DJQ A;  3HYX A;  4C74 A;  4OPT A;  1JRX A;  2Y6R A;  3ISH A;  2WU2 A;  5KRQ A;  1M1Q A;  1K0I A;  1EL5 A;  3BNJ A;  3SY4 A;  2YLZ A;  3NYC A;  1E1K A;  3DJD A;  2RGH A;  4TM3 A;  2BS4 A;  5L46 A;  4D04 A;  2XFP A;  1EL7 A;  1ZOV A;  3AE1 A;  1F8S A;  5JCI A;  2BYB A;  3DA1 A;  1XHC A;  1E6E A;  3UKQ A;  3AE3 A;  1GTH A;  1H82 A;  1H86 A;  1LQU A;  5U1O A;  4H4P A;  3JSK A;  3BNF A;  2BC1 A;  2C67 A;  1D4E A;  1L9E A;  1E1M A;  2R9Z A;  1NEK A;  2B76 A;  1B37 A;  4U8P A;  1KSS A;  1RYI A;  2GRT A;  2YAU A;  1NDA A;  3CNS A;  2BXR A;  3KD9 A;  3SQP A;  4YSX A;  3F8R A;  4GAP A;  1AOG A;  3SYI A;  2IVE A;  4Z25 A;  2XDO A;  3AD8 B;  1QJD A;  3DJJ A;  5KXJ A;  1IJH A;  4KX6 A;  2XFQ A;  2BC0 A;  4A65 A;  1VG0 A;  3HZL A;  2GH5 A;  2WDV A;  4H4V A;  2C70 A;  2VVM A;  2CVJ A;  4K5S A;  4NTD A;  2C66 A;  1PJ6 A;  4E0V A;  1GRE A;  2Z5X A;  3NT6 A;  4OPU A;  1N1P A;  1CHU A;  1CJ4 A;  2JB3 A;  1OAH A;  3CND A;  3S61 A;  1Q1R A;  2OAL A;  3G5S A;  3S7W A;  3P9U A;  3ALM A;  4C5O A;  2OLN A;  3MMO A;  1GTE A;  3RHA A;  2PHH A;  5GSN A;  2AAQ A;  3K7M X;  4Z2T A;  2LFC A;  2E5V A;  5HHF A;  4HB9 A;  1ZK7 A;  1GES A;  3UKP A;  3LB8 A;  2WBA A;  3Q6J A;  3ADA B;  2FJE A;  3BNU A;  3IHM A;  4AT0 A;  1CJ3 A;  4WJY A;  1H81 A;  4JY2 A;  4RG4 A;  3IF9 A;  3NYF A;  3T14 A;  2YM1 A;  1BVB A;  2V6O A;  2OT4 A;  3HYV A;  4BJZ A;  1NAA A;  4EMI A;  3DJE A;  2B9X A;  4K22 A;  4U2T A;  2DKH A;  3QSM A;  1F8W A;  2XLR A;  1GRF A;  2WPC A;  4DSH A;  2C4C A;  2NVK X;  3P4S A;  2FBW A;  1O94 A;  2Q0K A;  4G9K A;  3NH3 X;  4DNA A;  5BRT A;  5CKU A;  4CY8 A;  2E80 A;  2BRY A;  1ZOY A;  2GAG B;  5FS9 A;  1IUS A;  2C64 A;  2YG4 A;  3DK8 A;  2BCG G;  5KNL A;  2YVF A;  4IA6 A;  3B6D A;  5FS7 A;  3BNH A;  2A8X A;  3GSI A;  1K0J A;  1DXL A;  2YVJ A;  3DGH A;  1S3B A;  3UTG A;  4K8D A;  2V3A A;  1VQW A;  2FJB A;  4BV6 A;  1O5W A;  2WET A;  3NG7 X;  4DSG A;  2GVC A;  4WX1 A;  4J33 A;  1NG3 A;  1CC2 A;  2XFU A;  3CIR A;  3M0O A;  1PJ5 A;  1BKW A;  4TLZ A;  5IPY A;  3ICS A;  5FS6 A;  2RGJ A;  3L8K A;  4EQR A;  2C76 A;  2XLS A;  1CJC A;  2E1M A;  2WES A;  2GV8 A;  5FMH A;  3NYE A;  3BHK A;  1S2Y A;  2Q6U A;  3BI5 A;  4G6G A;  2VRM A;  1GT8 A;  2V61 A;  1CC6 A;  1MXT A;  3LZX A;  4JQ9 A;  4YTP A;  3GRS A;  2F5Z A;  1FOH A;  1Y0P A;  3SM8 A;  2YWL A;  1OJT A;  2XLP A;  3ATR A;  2E81 A;  1XPQ A;  2XCG A;  2WOI A;  4GAV A;  1TDK A;  4X9M A;  3UOV A;  1PBC A;  1KNR A;  1F6M A;  1BGJ A;  3II4 A;  1TDN A;  2H88 A;  4U8N A;  4H4X A;  3G5Q A;  4H4Y A;  4U8L A;  2YQU A;  4H2Q A;  3NTD A;  3P4R A;  1FS7 A;  1D7Y A;  1H6V A;  4B64 A;  1PBF A;  4XWR A;  1JNZ A;  4ADW A;  3BI4 A;  2H89 A;  3LZW A;  2XVI A;  1NHQ A;  4JDR A;  2VR0 A;  1MOK A;  3DJG X;  2R4J A;  3CMM A;  4GDP A;  1Q9I A;  2GR3 A;  4A99 A;  1H84 A;  2BA9 A;  3CPH G;  4LII A;  4AP3 A;  5JCN A;  3RED A;  2GR1 A;  1E1N A;  2DKI A;  2WEU A;  3AEB A;  3Q9T A;  2BK4 A;  5DBJ A;  3KKJ A;  2YG6 A;  5LV9 A;  1FEC A;  2R0C A;  5HXI A;  2YR4 A;  2BAC A;  4G74 A;  4Q0T A;  1GEU A;  1W4X A;  2YLT A;  4B67 A;  4YXD A;  5CQF A;  1X31 B;  1D4D A;  4H4Z A;  4EM4 A;  4FK1 C;  3OWM A;  4IVO B;  1PBE A;  4J2W A;  1VDC A;  2VRL A;  3ZYX A;  3SZW A;  2IVD A;  3UKK A;  3I6D A;  3QVP A;  3SCE A;  3RNM A;  4B69 A;  3GD4 A;  3P4P A;  2XVF A;  3VRD B;  3RKH A;  2QA2 A;  3GWD A;  3UKL A;  5FS8 A;  5IQ4 A;  1JNI A;  1CL0 A;  2GR2 A;  2XLU A;  4EMJ A;  3H4K A;  4ZCC A;  3T2Y A;  3UCL A;  2V3B A;  2C3C A;  1GRG A;  4IA5 A;  3DME A;  2Q0L A;  1ZX9 A;  4TM1 A;  2YG5 A;  4K7Z A;  4AT2 A;  4A9W A;  3ZDN A;  4Q1O A;  1EBD A;  2B7R A;  3S5W A;  1FT5 A;  2ARD A;  4GR1 A;  4GRT A;  1FT6 A;  2XVE A;  4J57 A;  3ICR A;  4AOS A;  3AEA A;  1FEA A;  3NRN A;  3NN0 X;  4ZCD A;  4B63 A;  1GRB A;  4L38 A;  1GRA A;  1PJ7 A;  2A89 A;  4H7U A;  2VQ7 A;  4J36 A;  4I58 A;  4ZN0 A;  2PYX A;  3NLC A;  1M64 A;  3D1I A;  2C7G A;  1E39 A;  4NEW A;  2Y6Q A;  1ONF A;  3AEG A;  3EAO A;  3NHO X;  4CCR A;  1BF3 A;  2XYO A;  1O95 A;  5U63 A;  1PXA A;  4OPI A;  3GYI A;  1B4V A;  3AED A;  1JRY A;  2B9Y A;  3OC4 A;  3RP7 A;  1MO9 A;  3DH9 A;  4NNJ A;  4H4T A;  1D4C A;  2BCP A;  3SXQ A;  2Z5Y A;  1COY A;  4OCG A;  5KMR A;  4B1B A;  2R4E A;  2QCU A;  3K30 A;  3LG1 A;  1XDI A;  5KOX A;  3AYL A;  4H4S A;  3CPI G;  4UDQ A;  3CGE A;  3SGL A;  3T37 A;  4FX9 A;  2ZBW A;  2X3N A;  1EL8 A;  2WP9 A;  3ABV A;  1D5T A;  3T31 A;  3SX6 A;  2TPR A;  2A87 A;  1L9C A;  1ELI A;  5HYM A;  3V3N A;  4AOX A;  1DNC A;  4TM0 A;  1L0V A;  2CFY A;  2B9W A;  4OPG A;  5J60 A;  1PDH A;  5KMS A;  2EQ7 A;  4J34 A;  1KDG A;  3NIX A;  2IID A;  2WOW A;  3URH A;  2R46 A;  2R45 A;  1TRB A;  3TOR A;  5TR3 A;  3SXI A;  2WPE A;  3CGD A;  3AYI A;  1DOD A;  3KVE A;  4NTC A;  5U25 A;  4IVM B;  4H2P A;  4CNJ A;  1N4V A;  2JAE A;  3F8P A;  1JOA A;  1Y56 A;  3HYW A;  2CUL A;  1F8R A;  3IC9 A;  3CPJ G;  1L9D A;  3LXD A;  4KPR A;  4USR A;  3T2Z A;  1JNR A;  4YSY A;  1RP0 A;  1Y56 B;  1IUU A;  4G6H A;  3NK1 X;  3F8D A;  2RAB A;  4BK3 A;  2JB1 A;  2C75 A;  3L1R A;  3ITJ A;  4Z43 A;  1TDO A;  1YKJ A;  4L3X A;  2XFO A;  1JU2 A;  4O5Q A;  2C3D A;  1GRH A;  2VQB A;  1LPF A;  2YG7 A;  4U8J A;  4Z44 A;  2BK3 A;  4B68 A;  2OAM A;  2C73 A;  1M1P A;  3D1C A;  1PBB A;  3PS9 A;  4Z24 A;  2VOU A;  3AD9 B;  1ZKQ A;  2EQ6 A;  1ZY8 A;  2JKC A;  3C96 A;  3UTH A;  2FJD A;  2X50 A;  4EQW A;  2GMH A;  3UTE A;  4YKG A;  4MJW A;  1Q1W A;  1SEZ A;  3I3L A;  1TDF A;  3V3O A;  3DK9 A;  1V59 A;  1YY5 A;  3L1T A;  3CNP A;  2AR8 A;  3VRB A;  4H50 A;  1KSU A;  3H8L A;  4N9X A;  4U2S A;  1H7X A;  3UTF A;  4B65 A;  5EB5 A;  1GRT A;  1XAN A;  3FPZ A;  4J31 A;  3AEF A;  4CRT A;  1EL9 A;  4EIQ A;  5KOW A;  3UOX A;  3SZ0 A;  2ACZ A;  4H4Q A;  3FO3 A;  3SZC A;  5ER0 A;  3VQR A;  3K7T A;  4Q5B A;  3AWI A;  4GUV A;  1REO A;  3KU9 A;  3GWF A;  1Z6L A;  2YVG A;  3GDP A;  3IHG A;  3SFD A;  3OZ2 A;  4Y4M A;  1BZL A;  4GF7 A;  4UP3 A;  1GER A;  4Q17 A;  3FIM B;  2W0H A;  3R9U A;  2WP6 A;  3LAD A;  3NGC X;  4U8K A;  3NK0 X;  4WCT A;  5BUK A;  2WDR A;  3EPT A;  2WPF A;  3UOY A;  2WDQ A;  1F3P A; 
#chains in the Genus database with same CATH homology
 4Z2R A;  1IUT A;  2ZZC A;  2V60 A;  1DOB A;  2YG3 A;  4H4U A;  5GRT A;  3AE8 A;  1JRZ A;  2C65 A;  3UP5 A;  4Y4N A;  2WU5 A;  4A79 A;  3B3R A;  4EQX A;  5JCL A;  1YQ4 A;  2ZO5 A;  4I59 A;  2YLR A;  4OVI A;  1VG9 A;  1GND A;  3PO7 A;  1LQT A;  2RDZ A;  3UKA A;  5EOW A;  4L3Z A;  3AXB A;  2J3N A;  5KVI A;  5JCK A;  4TM4 A;  1IUW A;  2V5Z A;  1GXF A;  4U8I A;  3AE6 A;  4II2 A;  3T2K A;  4BK1 A;  5KWF A;  4GDE A;  2EQ8 A;  1NG4 A;  3UKH A;  1CF3 A;  3F29 A;  1NHP A;  3GRT A;  2O9Z A;  3RP6 A;  1LTX R;  4H2N A;  1KF6 A;  1TYP A;  4K2X A;  1S2Q A;  3FMW A;  3EF6 A;  3E1T A;  1FS8 A;  3PVC A;  1GAL A;  3KA7 A;  1NHS A;  4PAA A;  1FCD A;  1PHH A;  3KPF A;  4JY3 A;  2HQM A;  2OA1 A;  4BK2 A;  4C77 A;  3AEC A;  4II3 A;  4EQS A;  3O0H A;  4UDR A;  4Q5C A;  3QJ4 A;  1OJC A;  1CBO A;  2WS3 A;  1NEN A;  1HYU A;  2GQW A;  4FK1 A;  1PXC A;  3D8X A;  3ICT A;  3IWA A;  4TLX A;  2YLW A;  2BRA A;  2WOV A;  3QFB A;  3GM6 A;  4H2R A;  4OPC A;  1K4Q A;  1YQZ A;  3DK4 A;  5BVA A;  4YSZ A;  3LOV A;  1FL2 A;  5BUL A;  2GR0 A;  2R0P A;  3NK2 X;  3GD3 A;  1QDB A;  3UP4 A;  3GMC A;  3WE0 A;  3C4A A;  4PAB A;  5KMQ A;  2WP5 A;  3M12 A;  4RG3 A;  1PS9 A;  3NNE A;  2BK5 A;  1H83 A;  4O5U A;  5EBK A;  1PXB A;  5C3J A;  3SFE A;  5C2T A;  1ZP0 A;  2C72 A;  3AYJ A;  1BGN A;  2XVJ A;  3CN8 A;  2QAE A;  4OPL A;  1PN0 A;  1BWC A;  3G5R A;  3P1W A;  5KVH A;  3NN6 X;  1GOS A;  4REK A;  4G73 A;  4YTM A;  1TYT A;  2BXS A;  3ALJ A;  3NTA A;  4USQ A;  4D03 A;  1OJ9 A;  1OJD A;  2NPX A;  2J7A A;  2FJA A;  4FDC B;  4APN A;  3ATQ A;  2RGO A;  4A6N A;  1DOC A;  2GQF A;  1DOE A;  3TTB A;  1ZDL A;  2E4G A;  4NZH A;  3KLJ A;  4X9N A;  4HA6 A;  4XWZ A;  4A6N B;  3BNG A;  1E7P A;  4L3Y A;  4CCQ A;  3BHF A;  3DGZ A;  4B66 A;  1IUV A;  4Z26 A;  2TMD A;  1M6I A;  2YR6 A;  4A5L A;  1GPE A;  2UZZ A;  4CNK A;  3BI2 A;  3K7Q X;  1H7W A;  1GV4 A;  3SZF A;  5HY5 A;  1NPX A;  4EIP A;  2WQY A;  2K3V A;  2GAH B;  3BNM A;  3UBR A;  3P4Q A;  2OLO A;  4XXG A;  3VR8 A;  4U8M A;  4DGK A;  5M10 A;  1P2E A;  2GMJ A;  2XFN A;  4GCM A;  4YTN A;  3GDN A;  4CBQ A;  4YWO A;  1SP3 A;  2YLX A;  3UU9 A;  4AP1 A;  2GB0 A;  2VVL A;  1N4U A;  2JK6 A;  4NWZ A;  3LJP A;  2I0Z A;  4EMW A;  4C3X A;  1IUX A;  3CGC A;  4X4J A;  1YQ3 A;  3EAN A;  4YT0 A;  3QVR A;  4Y4L A;  3COX A;  4JNA A;  1LV0 A;  1FEB A;  4NTE A;  4YSH A;  3AE5 A;  2R0G A;  1B8S A;  3AB1 A;  3QSS A;  4M52 A;  2Q7V A;  3CNJ A;  1JEH A;  1LVL A;  5J7X A;  1FS9 A;  3GYJ A;  1TDE A;  4YKF A;  2XLT A;  4CY6 A;  2VVL G;  4H4W A;  1K0L A;  2AQJ A;  5KMP A;  3UOZ A;  1PBD A;  1DJN A;  1GSN A;  2YLS A;  3AE2 A;  4C3Y A;  2BS3 A;  2X99 A;  1S3E A;  1D7L A;  3VRA A;  5JCM A;  4UDP A;  2CDU A;  2YR5 A;  4ECH A;  4ICY A;  2WHD A;  2QA1 A;  1KFY A;  1QO8 A;  5M0Z A;  4BJY A;  1KNP A;  1OJA A;  2X8G A;  3AE4 A;  4LA1 A;  4JN9 A;  3LGQ A;  3AE7 A;  4IV9 A;  3V76 A;  2XVH A;  4U8O A;  1M1R A;  4A7A A;  3AD7 B;  4RSL A;  4JNQ A;  2JB2 A;  4LU6 A;  3NKS A;  2ZZB A;  4J56 A;  1CJ2 A;  2RF7 A;  3M13 A;  2APG A;  2VZ2 A;  4OPD A;  2YM2 A;  1VRQ B;  2GF3 A;  3H8I A;  3QFA A;  1NHR A;  1UKV G;  2X8H A;  4Q4U A;  3FBS A;  1ZMC A;  1QLB A;  4NEV A;  1P2H A;  2EQ9 A;  4U2L A;  1RSG A;  3FG2 P;  2B7S A;  3CTY A;  1CC4 A;  3GYX A;  2ZZ0 A;  3ALL A;  4P9S A;  4K5R A;  5IQ1 A;  1N4W A;  4BUR A;  1ZMD A;  1B5Q A;  2BS2 A;  3AEE A;  3GMB A;  3VR9 A;  3RP8 A;  3CGB A;  3KPK A;  3AE9 A;  2X8C A;  4EM3 A;  2BAB A;  3C4N A;  4Z2U A;  3QSE A;  1E1L A;  4H4R A;  1GU6 A;  5EB4 A;  2GEW A;  3T0K A;  3UKF A;  2JBV A;  3CNT A;  1GET A;  1LJ1 A;  1DJQ A;  3HYX A;  4C74 A;  4OPT A;  1JRX A;  2Y6R A;  3ISH A;  2WU2 A;  5KRQ A;  1M1Q A;  1K0I A;  1EL5 A;  3BNJ A;  3SY4 A;  2YLZ A;  3NYC A;  1E1K A;  3DJD A;  2RGH A;  4TM3 A;  2BS4 A;  5L46 A;  4D04 A;  2XFP A;  1EL7 A;  1ZOV A;  3AE1 A;  1F8S A;  5JCI A;  2BYB A;  3DA1 A;  1XHC A;  1E6E A;  3UKQ A;  3AE3 A;  1GTH A;  1H82 A;  1H86 A;  1LQU A;  5U1O A;  4H4P A;  3JSK A;  3BNF A;  2BC1 A;  2C67 A;  1D4E A;  1L9E A;  1E1M A;  2R9Z A;  1NEK A;  2B76 A;  1B37 A;  4U8P A;  1KSS A;  1RYI A;  2GRT A;  2YAU A;  1NDA A;  3CNS A;  2BXR A;  3KD9 A;  3SQP A;  4YSX A;  3F8R A;  4GAP A;  1AOG A;  3SYI A;  2IVE A;  4Z25 A;  2XDO A;  3AD8 B;  1QJD A;  3DJJ A;  5KXJ A;  1IJH A;  4KX6 A;  2XFQ A;  2BC0 A;  4A65 A;  1VG0 A;  3HZL A;  2GH5 A;  2WDV A;  4H4V A;  2C70 A;  2VVM A;  2CVJ A;  4K5S A;  4NTD A;  2C66 A;  1PJ6 A;  4E0V A;  1GRE A;  2Z5X A;  3NT6 A;  4OPU A;  1N1P A;  1CHU A;  1CJ4 A;  2JB3 A;  1OAH A;  3CND A;  3S61 A;  1Q1R A;  2OAL A;  3G5S A;  3S7W A;  3P9U A;  3ALM A;  4C5O A;  2OLN A;  3MMO A;  1GTE A;  3RHA A;  2PHH A;  5GSN A;  2AAQ A;  3K7M X;  4Z2T A;  2LFC A;  2E5V A;  5HHF A;  4HB9 A;  1ZK7 A;  1GES A;  3UKP A;  3LB8 A;  2WBA A;  3Q6J A;  3ADA B;  2FJE A;  3BNU A;  3IHM A;  4AT0 A;  1CJ3 A;  4WJY A;  1H81 A;  4JY2 A;  4RG4 A;  3IF9 A;  3NYF A;  3T14 A;  2YM1 A;  1BVB A;  2V6O A;  2OT4 A;  3HYV A;  4BJZ A;  1NAA A;  4EMI A;  3DJE A;  2B9X A;  4K22 A;  4U2T A;  2DKH A;  3QSM A;  1F8W A;  2XLR A;  1GRF A;  2WPC A;  4DSH A;  2C4C A;  2NVK X;  3P4S A;  2FBW A;  1O94 A;  2Q0K A;  4G9K A;  3NH3 X;  4DNA A;  5BRT A;  5CKU A;  4CY8 A;  2E80 A;  2BRY A;  1ZOY A;  2GAG B;  5FS9 A;  1IUS A;  2C64 A;  2YG4 A;  3DK8 A;  2BCG G;  5KNL A;  2YVF A;  4IA6 A;  3B6D A;  5FS7 A;  3BNH A;  2A8X A;  3GSI A;  1K0J A;  1DXL A;  2YVJ A;  3DGH A;  1S3B A;  3UTG A;  4K8D A;  2V3A A;  1VQW A;  2FJB A;  4BV6 A;  1O5W A;  2WET A;  3NG7 X;  4DSG A;  2GVC A;  4WX1 A;  4J33 A;  1NG3 A;  1CC2 A;  2XFU A;  3CIR A;  3M0O A;  1PJ5 A;  1BKW A;  4TLZ A;  5IPY A;  3ICS A;  5FS6 A;  2RGJ A;  3L8K A;  4EQR A;  2C76 A;  2XLS A;  1CJC A;  2E1M A;  2WES A;  2GV8 A;  5FMH A;  3NYE A;  3BHK A;  1S2Y A;  2Q6U A;  3BI5 A;  4G6G A;  2VRM A;  1GT8 A;  2V61 A;  1CC6 A;  1MXT A;  3LZX A;  4JQ9 A;  4YTP A;  3GRS A;  2F5Z A;  1FOH A;  1Y0P A;  3SM8 A;  2YWL A;  1OJT A;  2XLP A;  3ATR A;  2E81 A;  1XPQ A;  2XCG A;  2WOI A;  4GAV A;  1TDK A;  4X9M A;  3UOV A;  1PBC A;  1KNR A;  1F6M A;  1BGJ A;  3II4 A;  1TDN A;  2H88 A;  4U8N A;  4H4X A;  3G5Q A;  4H4Y A;  4U8L A;  2YQU A;  4H2Q A;  3NTD A;  3P4R A;  1FS7 A;  1D7Y A;  1H6V A;  4B64 A;  1PBF A;  4XWR A;  1JNZ A;  4ADW A;  3BI4 A;  2H89 A;  3LZW A;  2XVI A;  1NHQ A;  4JDR A;  2VR0 A;  1MOK A;  3DJG X;  2R4J A;  3CMM A;  4GDP A;  1Q9I A;  2GR3 A;  4A99 A;  1H84 A;  2BA9 A;  3CPH G;  4LII A;  4AP3 A;  5JCN A;  3RED A;  2GR1 A;  1E1N A;  2DKI A;  2WEU A;  3AEB A;  3Q9T A;  2BK4 A;  5DBJ A;  3KKJ A;  2YG6 A;  5LV9 A;  1FEC A;  2R0C A;  5HXI A;  2YR4 A;  2BAC A;  4G74 A;  4Q0T A;  1GEU A;  1W4X A;  2YLT A;  4B67 A;  4YXD A;  5CQF A;  1X31 B;  1D4D A;  4H4Z A;  4EM4 A;  4FK1 C;  3OWM A;  4IVO B;  1PBE A;  4J2W A;  1VDC A;  2VRL A;  3ZYX A;  3SZW A;  2IVD A;  3UKK A;  3I6D A;  3QVP A;  3SCE A;  3RNM A;  4B69 A;  3GD4 A;  3P4P A;  2XVF A;  3VRD B;  3RKH A;  2QA2 A;  3GWD A;  3UKL A;  5FS8 A;  5IQ4 A;  1JNI A;  1CL0 A;  2GR2 A;  2XLU A;  4EMJ A;  3H4K A;  4ZCC A;  3T2Y A;  3UCL A;  2V3B A;  2C3C A;  1GRG A;  4IA5 A;  3DME A;  2Q0L A;  1ZX9 A;  4TM1 A;  2YG5 A;  4K7Z A;  4AT2 A;  4A9W A;  3ZDN A;  4Q1O A;  1EBD A;  2B7R A;  3S5W A;  1FT5 A;  2ARD A;  4GR1 A;  4GRT A;  1FT6 A;  2XVE A;  4J57 A;  3ICR A;  4AOS A;  3AEA A;  1FEA A;  3NRN A;  3NN0 X;  4ZCD A;  4B63 A;  1GRB A;  4L38 A;  1GRA A;  1PJ7 A;  2A89 A;  4H7U A;  2VQ7 A;  4J36 A;  4I58 A;  4ZN0 A;  2PYX A;  3NLC A;  1M64 A;  3D1I A;  2C7G A;  1E39 A;  4NEW A;  2Y6Q A;  1ONF A;  3AEG A;  3EAO A;  3NHO X;  4CCR A;  1BF3 A;  2XYO A;  1O95 A;  5U63 A;  1PXA A;  4OPI A;  3GYI A;  1B4V A;  3AED A;  1JRY A;  2B9Y A;  3OC4 A;  3RP7 A;  1MO9 A;  3DH9 A;  4NNJ A;  4H4T A;  1D4C A;  2BCP A;  3SXQ A;  2Z5Y A;  1COY A;  4OCG A;  5KMR A;  4B1B A;  2R4E A;  2QCU A;  3K30 A;  3LG1 A;  1XDI A;  5KOX A;  3AYL A;  4H4S A;  3CPI G;  4UDQ A;  3CGE A;  3SGL A;  3T37 A;  4FX9 A;  2ZBW A;  2X3N A;  1EL8 A;  2WP9 A;  3ABV A;  1D5T A;  3T31 A;  3SX6 A;  2TPR A;  2A87 A;  1L9C A;  1ELI A;  5HYM A;  3V3N A;  4AOX A;  1DNC A;  4TM0 A;  1L0V A;  2CFY A;  2B9W A;  4OPG A;  5J60 A;  1PDH A;  5KMS A;  2EQ7 A;  4J34 A;  1KDG A;  3NIX A;  2IID A;  2WOW A;  3URH A;  2R46 A;  2R45 A;  1TRB A;  3TOR A;  5TR3 A;  3SXI A;  2WPE A;  3CGD A;  3AYI A;  1DOD A;  3KVE A;  4NTC A;  5U25 A;  4IVM B;  4H2P A;  4CNJ A;  1N4V A;  2JAE A;  3F8P A;  1JOA A;  1Y56 A;  3HYW A;  2CUL A;  1F8R A;  3IC9 A;  3CPJ G;  1L9D A;  3LXD A;  4KPR A;  4USR A;  3T2Z A;  1JNR A;  4YSY A;  1RP0 A;  1Y56 B;  1IUU A;  4G6H A;  3NK1 X;  3F8D A;  2RAB A;  4BK3 A;  2JB1 A;  2C75 A;  3L1R A;  3ITJ A;  4Z43 A;  1TDO A;  1YKJ A;  4L3X A;  2XFO A;  1JU2 A;  4O5Q A;  2C3D A;  1GRH A;  2VQB A;  1LPF A;  2YG7 A;  4U8J A;  4Z44 A;  2BK3 A;  4B68 A;  2OAM A;  2C73 A;  1M1P A;  3D1C A;  1PBB A;  3PS9 A;  4Z24 A;  2VOU A;  3AD9 B;  1ZKQ A;  2EQ6 A;  1ZY8 A;  2JKC A;  3C96 A;  3UTH A;  2FJD A;  2X50 A;  4EQW A;  2GMH A;  3UTE A;  4YKG A;  4MJW A;  1Q1W A;  1SEZ A;  3I3L A;  1TDF A;  3V3O A;  3DK9 A;  1V59 A;  1YY5 A;  3L1T A;  3CNP A;  2AR8 A;  3VRB A;  4H50 A;  1KSU A;  3H8L A;  4N9X A;  4U2S A;  1H7X A;  3UTF A;  4B65 A;  5EB5 A;  1GRT A;  1XAN A;  3FPZ A;  4J31 A;  3AEF A;  4CRT A;  1EL9 A;  4EIQ A;  5KOW A;  3UOX A;  3SZ0 A;  2ACZ A;  4H4Q A;  3FO3 A;  3SZC A;  5ER0 A;  3VQR A;  3K7T A;  4Q5B A;  3AWI A;  4GUV A;  1REO A;  3KU9 A;  3GWF A;  1Z6L A;  2YVG A;  3GDP A;  3IHG A;  3SFD A;  3OZ2 A;  4Y4M A;  1BZL A;  4GF7 A;  4UP3 A;  1GER A;  4Q17 A;  3FIM B;  2W0H A;  3R9U A;  2WP6 A;  3LAD A;  3NGC X;  4U8K A;  3NK0 X;  4WCT A;  5BUK A;  2WDR A;  3EPT A;  2WPF A;  3UOY A;  2WDQ A;  1F3P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...