1M6OA

Crystal structure of hla b*4402 in complex with hla dpa*0201 peptide
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
276
structure length
276
Chain Sequence
b'GSHSMRYFYTAMSRPGRGEPRFITVGYVDDTLFVRFDSDATSPRKEPRAPWIEQEGPEYWDRETQISKTNTQTYRENLRTALRYYNQSEAGSHIIQRMYGCDVGPDGRLLRGYDQDAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQDRAYLEGLCVESLRRYLENGKETLQRADPPKTHVTHHPISDHEVTLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, BW-44(B-12) B*4402
molecule tags Immune system
source organism Homo sapiens
publication title A naturally selected dimorphism within the HLA-B44 supertype alters class I structure, peptide repertoire, and T cell recognition.
pubmed doi rcsb
total genus 79
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 2002-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1m6oA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 1m6oA01
1YQ2A 4HH9A 4GAGL 2JJWA 3QXDA 3K46A 5L7XH 3UTZA 4LSRL 4HGMA 1U42A 1X5KA 2Y4SA 2IALB 4RWYH 5IQ9A 3FZUD 3O4LB 1BEYH 3HPLB 5I1LB 3MRKB 5I76B 4F7MB 1CDGA 1D9KC 1OF2A 4MZ3A 5FF6B 5L8LB 4XBPB 1NEZG 1RJYB 4ZFZB 4KXZI 5J12C 4KHTL 2P7TB 4AL8H 3WNOA 2P8LA 1NGQL 1J9CT 3AS0A 1V3JA 3U30B 5FEBA 1UVQA 1ITCA 1J0KA 1ONQB 4UILL 3CMOH 3GI8L 3EDJA 4PGJA 4J1UB 3T2OA 2UY6A 3R06A 1F4WL 5DMGD 4BH7B 5B38A 3OKOA 1JHKL 4GKNA 5EZLA 1MREH 1XGYL 1CDHA 3CDGA 3FN3A 5INCA 3DVGA 3T65A 4GAGH 3SDXA 5DC4B 1FIGH 4PJDE 4XP6L 3QHTC 4M1GL 3W9DB 4R4BA 2G5RA 1I4FB 3GSWB 3BP5B 5F7WC 1HHKB 4X7CC 1M4KA 4Z18A 4N0UA 3NFSL 2DF3A 4K3EH 1X6LA 3HLAB 2R0LH 4U33A 4HIEB 5E2VH 3WS3A 4NUJB 3PWVA 3SKJH 5CJQH 5CSGA 3RZWA 1SM3H 3CMOL 5DWUH 1ZLSH 4Y5XA 3RBGA 4CADA 4NHUA 4HKXA 1MHEB 2DM7A 4TULH 3JVGA 4MXVE 3TVMD 5FIEA 1U91A 5D6DC 1HH9A 1ES0A 4LLQA 1FIGL 1BF2A 4P46A 1CXFA 2H6PA 4Y2DB 4F2MA 1J8HA 1BBDH 4XZUB 2AV1A 1DTUA 3O6ML 3MV11 1U8LB 4LBEB 4NIKB 3QQ9C 12E8L 3KYNB 4KRPB 4GG8B 4U1NB 2X4RB 2R4SL 4R7NB 5EN2A 4P9HL 3L5IA 3GMOA 43C9A 1Z5LB 3OXSB 3T1WA 4YHKL 4K7PH 4J3UA 1Q9LB 5CILH 2Q7YB 1GGIH 4MDIB 4Y0GA 4Y16C 3VCLB 3FFCB 1WSST 3SKMA 3O3DA 5D5MA 3WXVH 3PXHA 5CBEB 4NQXB 3O2VH 3TJEH 2R69L 1H3WM 4JFPA 1VB9A 4TN9A 2IQAA 1G1CA 2JE8A 3NCFB 2BNRB 4P9ML 4QWWD 4Z7QE 1R3HB 2MNUA 4IJ3C 5C6WH 1LK3L 1I1YB 5D8JL 1ZA3A 3Q1SL 5H94B 1JHTB 2GEEA 4C55A 3O8XD 4ETYA 5C2BH 5JORA 4AYFA 3TBYA 2HRLA 3KYOA 3O6KH 3U46B 4GBXB 5DYOA 4O9HH 2YEZA 1NGZA 1OTTD 4P2OC 1BZ9B 1YECH 4JZNA 4FQCL 1WC7B 4OF5A 2E9IA 3OJ2C 1VFBB 2EDEA 1MJUL 5B39B 3P11H 1KN2H 2XT1B 1D5ZA 5EU4A 1N3NB 4K7PL 5HHVL 1E4XH 2VH5H 3VXTA 5TGBA 1MCPL 4OQTH 2HG5A 3JVGC 4RNRB 5EUOE 4YO0A 5IHUH 3MZGB 4PD4J 3TZVA 3MRKA 1CS6A 3EJZD 3ZTJH 1EVTC 2WIIB 5GXBB 2IPKB 2B1HL 3Q1SH 2XIDA 2H8PA 4HXAH 1OAUH 1VDGA 4IRJC 1BHGA 3L5WA 1RIVH 1G7IB 4KY1H 4WFHD 3X12B 1NQBA 2DM4A 1K8IB 5JXAL 4MAYD 1D5IH 1IZJA 1MY7A 5KW9L 1S78C 4M03A 5EC2A 5HDQH 2NY1C 5I1EL 4LNRB 2CO6B 4C4KT 1N5AB 3TCXA 4LNVA 3K81A 5IOPB 3S3SA 2X4TA 4MD5A 1RZIA 1NMCC 1A3RH 3T77A 4P2RB 1A9BA 5E5MA 4ESKA 5FECA 1YEKL 2RJMA 3RVXC 3C9NA 2CIKB 2DLFL 3T0EA 1CXKA 5E2UL 4LAJH 4NQDE 2OR8A 2IC2A 4RMTA 4DGYL 2X4OB 3VG9B 1HZHL 1O7SA 2QADC 5DJCB 4P57B 4ZO8A 1QSVA 3S36H 4MVBA 1AY1H 1LNUA 1NCTA 4PJHF 4M8QA 1WIUA 4O51A 4C83A 4Q6IA 2ITDA 3UEZA 4QNPE 2EH7L 1PGRB 4PJ8C 4PJ5B 4PS4L 3CLEH 3MODL 3UXFA 4EXKA 4XPBL 5IMLB 4KKAD 3RWGA 3PABA 4TNWK 2HVJA 1G7LB 4QXGH 2J6EH 3CMGA 4U1NA 5CLWA 1IGIL 1DEEA 4U6YB 3HG1B 2VXSL 3D1MC 1F58H 5C8JA 1UXWA 3QJFB 3BVNA 3EO9H 2V5YA 4BK4A 1IEBA 5T1LA 2NY2D 1LD9B 1FZOA 4P23A 5JO5A 2NTFA 1KCUH 2YBRA 3QDGB 4CU7A 1VPOL 4HFUH 3VXPA 3L3JA 3O6MH 5K59F 4F57H 2W9DH 5EUKB 2BERA 5LAXB 4BH8B 3I50L 1OP5H 4RFEA 1CZ8H 4LPXA 2N7BA 4YDKH 2AJVL 1Q9OB 3Q48A 4JN2A 1ZHLA 5I71C 4K7PY 4PJAB 4I77L 1Q0YH 1WITA 5KANG 1R0AL 4GXUM 1QFPA 2CIIB 3G9AB 1MJ7L 1FL6A 2NYYC 5JORB 3ARWA 3O2VL 3MJ9L 5HYFA 2HH0H 3MUJA 3IF1A 2ZUSA 4GRWB 5J1SC 4LVHC 3S34H 3S5LA 2J6EA 1ZK9A 3DBXB 3DX7B 5D8JH 2IG2H 2BVUA 2VDKH 4FFVC 1IEAA 4QRPE 5EU3A 3BDYH 2AJXL 1MEXL 3RKDD 5AAMA 5IMKA 2YD3A 3FN0H 4D9LH 2I07A 4UUJB 5BCAA 5HYJE 2BRQA 4XNZB 3V4UH 3MLTB 5IMOA 2C4XA 5AG9A 3SGEI 4BFEA 1U6AH 4E42A 4WFEE 4U4BA 4YGVB 1MHHA 3QCTH 1OB1A 2ADJA 3VGHA 3F8UB 2B7DT 4GAYA 1J8HB 3V52L 4YPGB 3CFBA 3FJTA 3I75A 1J1OL 3PP3H 4Y1AD 3TBWA 2FLBT 4OQTL 4XP1H 3RUGF 4DEPB 2DM3A 4FXLA 1HWHB 3C6LC 5IROC 3JV5A 4ERSH 2IBZY 4JDVA 1J18A 1DBKL 1HHIA 2HLFC 4XMKH 4DFHA 4OBSA 1QLRB 1XGUB 2E6JA 1GGUA 4YHMH 5T5FH 2DQFB 3RJDA 2H32H 4J3WA 1H3UA 2NY6D 4NNXB 5C3TA 1H9VA 1UZ8B 3PHQA 4HS3B 1F11A 3DI3B 4PP2B 4ODHL 3FCTB 3HTLX 4LCIL 3VGBA 1OSZB 1UACL 2DQDH 2YSSB 1ORSB 3MV7B 3SDCD 4ODUB 2EYSB 5SX4H 1BQUA 3MOQA 4QOKD 5C6TH 5IB5B 4TQEL 2QSCL 1N0LA 2MKLC 1GJIA 1BZ7A 1MJ8H 2R1XB 4LVOB 1JF5A 2B1AH 5INDB 5IVXB 2A6DB 4PJXB 4Y88A 3VFVB 3WEXA 3C2AL 4Y89A 2ADGB 4MXQC 1YYML 4AEIH 5C0EA 4P23D 4MB4A 3GUTA 4QTIL 1JGVH 5C6PB 3CXHJ 3G6AA 1U8KA 3KPSA 2P8LB 4IRJB 4XCCL 3ARBA 3N1PC 4G6MH 2Y5EA 2ORBL 1QVOA 5DJXA 3DRTA 3LQAL 5F93C 4Z95L 3ZE1F 4KMLB 3MODH 1BVLA 3MRPA 5EORL 5GZNC 2EDQA 4X6DB 1AGDB 1VFAA 4LLVB 1Q94B 5HHOA 1JCKA 1WBXA 2ICWI 4ZFOA 5GRUL 4NQTA 4W4OC 4G7YH 3ROLB 2OBGA 3VGAB 1S7TB 1F90L 4JFZH 3D39E 3JBG7 4KMTL 2FO1A 3RI5F 1TTGA 2KQNA 4NWUH 1U3YA 3Q5OA 2Z4QA 1NDMB 4NM8H 2H26A 4YR6B 4M62L 1RHHA 2WBWB 4XCCH 1QOKA 1GCFA 1G7PA 3ABZA 1QA9B 1XF4A 1S7RA 3B2UC 1VGKA 2XKSA 1SEBB 5HYJB 5CUSL 1CZ8L 3DXAD 4Y19B 4TNVF 4NCC1 2EDOA 1PKQB 1X5ZA 3EYFB 4KV5F 1D9KD 5D6CA 5BOPA 4XHJD 2NQCA 4ZS6C 4ETQA 1MVUB 1PX3A 2ZSVA 4J8RA 2HH0L 2Y6SC 2Z4QB 2HT4C 5CZXC 4O58L 3D3VA 1D5BA 3BQUD 3G08A 1EO8H 4U6TA 2D9CA 5K9KB 1P4BH 2DRUA 2R2BB 3JUZA 1U8HB 3LSOA 4EI5B 5LKNA 4R26L 2BMKA 4YHPA 5LVEA 5HGDB 1GVIA 1FNLA 2CDGB 2AJUL 2VLRD 3RZCC 4E41E 5DRNB 1UZ6F 4EDXB 4XH2B 5K93A 2MHAB 4HK0B 2BSED 3D2UD 5GS1C 2BDNL 5I8OL 4FRWA 2BVYA 4QOKA 5LG1A 1FO0L 1BD2D 5E8EA 3ULUL 5F7MC 4GJTB 1NCBL 3ZDYF 1J1OH 2OJZH 3QUYD 2A0LC 1IQWL 1NGYB 1KNOA 3OAYK 5K9QI 1WQVT 5I19L 4Y4HB 2HKFL 2E27H 4KROB 5BZWA 5K9JL 4YK4B 2P5WD 1MPAH 5D6DA 1UZ6E 2CO7B 4R4FH 2X70B 1IQDA 5F1NB 1KG0A 3WFEH 2OL3H 1CFVH 4XNXH 2EYTA 2V5MA 5FYKL 1AJ7L 1OAZL 4YFLF 2NNAB 2XZZA 4HUUA 3B3IA 3U0TA 4JQIL 5D2LF 1IAIH 5D1XC 1F3DJ 2Y23A 1NMBH 4L8CA 1I85A 4UV4H 1NDMA 3QI9D 3ILPB 2JELL 3AM8A 3DTXA 1U92A 5EU5B 4GRLA 3JXAA 3BZFA 4J12A 5I19H 5C0RH 3CCHB 1A7QL 3MV9E 1PZ5B 4U7MA 3H0TA 4LSQL 4JDVB 1RJCA 3EYQC 4I4WB 1XGPA 2D03H 1H3PL 4LSPH 4X9GA 3VFGH 4NNYB 3QEQB 3QPQC 4K3HA 3WFEL 4L4VA 1PYWA 3I6KA 1K4DA 3GJEA 4LF3B 3VXSB 3HC4H 4H8WC 1KB5H 4NZRH 1RY7B 5E8NB 3EJJX 3UYOD 4HKJA 4R2GB 5F9WC 5HI5D 3V4VH 4HQQL 2AJ3B 3CCHA 3DETD 4OLWL 1YJDL 4PRPA 2ADGA 1U8JA 2F53A 1RUAH 4UTBH 4NN7B 2WY3A 3IETA 3ZT6A 2CLVA 5EOTA 3ULUE 4DOHE 2MOVA 3QFJB 3T09A 1C5DB 2LQRA 1UWEH 3VD9A 1CDJA 5DHVH 4QRPD 3OAUL 4O2EA 5ACMA 5HHME 3P9WB 4XPGL 3MBED 1TQCC 1JGEA 3S37L 3MNWA 4KRMB 3VDCA 3AM8C 4H1LB 1U93B 1V3KA 4NQDA 1HSBB 5DS8B 1EBAA 1S5IH 1U8JB 3HFML 4FABH 3WUWG 1BIIB 3MLZL 3BP4A 4OZHE 5IW6A 5J6GA 1RU9L 1AXTH 1KT2B 2H41A 4RX4D 2YBRB 4TSAL 4P4KC 2FJHB 2MKWA 4WV1A 1J0ZA 2EEBA 1B0WA 1UGNA 3ARGB 4OT1L 4U6VL 1INEL 4XRCA 3O6LL 2H9GB 3CX5K 5AEAA 2EXYC 1HN1A 3MOAH 1HKLH 1RUPH 3A67H 4IBLT 4V1DE 2A6KA 4YBLC 5K9OB 1JRHH 1H8NA 4WW2C 4AG4H 4HH8A 3MMEA 3HNVL 4HEPG 2H32B 3NABH 3QFJD 1VFUA 4L9DA 1IKNC 1IAIM 3DMMA 1M7DB 3LB6C 1Q9KA 3OPZH 3LKPB 2OP4L 4P5KA 4FXGB 4XAWL 4MMXC 1S9KC 2DLTA 1I9IH 4GRLD 5DDHA 1CVRA 3NVQA 1RZGA 5F7UA 4P3DA 1E28B 3ARUA 4ENEC 4BSVA 4UDUA 3F58H 5TDPB 3DHMA 3U6RA 2C5DC 3BPCA 3QEUB 2ERJB 2ILLA 4H88L 2J1KA 3PDGA 1INEH 1B3JA 1WUNT 5ALCL 5DEFB 3VFSA 5IHZA 3L5XL 3MCG1 3HB3D 1AH1A 4AG4L 2MSPA 5F96L 5LAXA 1S7SA 2W91A 4Z76B 3QEQE 1RPQA 5CS7A 4XWOC 1CXLA 5FKPB 4JM2A 4RMRA 1YEDA 1BD2E 1A1NA 3RWHB 4OCSH 5ILTL 5C0GA 5JA9A 1LD9A 2FHCA 5C07D 3MNZA 3AS1A 2Y7QA 5JHLH 3CFIC 3LS5L 3T1FA 1DLFH 3TZVC 5CIPH 3L95B 5EZIL 4F7EA 3MO1A 4NJAL 1UXSA 5TF1L 2J8UE 1RZ8B 1RJLB 1CGYA 2YWYA 1CGSL 3U9UB 2VUYA 1SBSL 1PY4A 1CE6A 4XBGB 5A2IH 1K6QH 2H1PL 4XVTH 3WN5A 4PJ8B 1HOCB 1S7UB 3EOBB 2FIKB 5EZOL 1KIUA 4HXBH 4POZC 5D7LB 3OB0H 1QBBA 4EQ2A 2NY3C 5JLZA 3T04D 3D85D 5C0BE 1GGTA 3E3QA 1FVDB 3QAZB 5MERB 4KTDH 2ITDB 1TNNA 1A6WH 2AGJH 1UKSA 4X5WB 4OCLC 4CMHC 4GQ9L 3VGEA 3D5OF 2FWOA 4ZUUA 4ZO6A 3OKNA 5J1AA 3RDTC 3MV9D 1IARB 3GMMB 2QHRH 1YMHB 3UTSB 4R2GD 1BZ9A 3ESUF 3MRIB 1F13A 5GS1B 5D7IE 4DTGH 5GS0C 2W59A 4NKOB 1YUHB 4UU9B 4L3AA 3HI5H 1H3TA 5JW4Q 2F54E 4POZD 5FO8B 1RUKH 1GZPB 5HYEA 3KGRA 1FYTA 4FQXB 4KDTC 1J12A 2GHWB 2EDTA 2HA1A 2IWGA 2JJSC 4PJDB 3VWKA 1B4JL 4FNLH 4ODXB 5JHDE 1CDYA 1QBML 3SKMB 3BWUC 2QBWA 1Z5LA 3OXSA 1CDIA 4BJLA 4C56E 1FFQA 4M6OH 4R7NA 1KCLA 2DI7A 1NFDF 2ATKB 1Y6MR 3G6JA 3MLZH 3QI9B 3I3EA 5IBUG 4LBEA 5HD8D 4OM0L 4I5BB 1KPVA 1XF5A 2W0FA 3V0WL 1UWXK 2VQTA 3R1GL 4ALAL 3MRDB 3EO1B 4OZHA 3UDWA 1RUQH 4MA7L 4E0RB 2DWDB 4N0YH 1BREA 4OQTA 3QJHA 3HI5L 2IPUG 3RL1A 4L4TB 1RUKL 1NAMA 4KQ4H 1WAAF 4JZJB 3VI3F 4JR9L 2V5SA 1OT1A 1RZJL 3ETBF 5ID0A 1A6AB 2H2SD 2BXYA 2EECA 5TE4H 3MQIA 4X6FA 4GBXA 3L7EB 5F3HA 1T1ZB 4D0BA 5ADOH 1TZGH 3WUWA 3OAZH 4HFWB 1JN6B 5HPOA 1HIMH 3TH4T 1A7BA 4TNWF 3OZ9H 2R8SH 1JZ8A 3VXRE 1CD1A 1ZGLP 2H45A 1X4ZA 1UB5A 4K94L 1S78D 1XCTA 5E8OB 2EIDA 1YDPA 4KMQA 4AEFA 1CL7L 2ATPA 4RBPH 3RVWC 3RTQB 3HUJA 3B2VL 2Z31C 4NO3A 3QWOA 2KZWA 4PB0H 5CSBA 1F4HA 2RCSH 5EN2B 5KSBB 1TMCA 4H26A 4IRJD 3BQUB 5E7FA 2AXGB 3QISA 4HAGA 1KIQB 2BXZA 5E9DE 2GSGB 3MV9A 2HN7A 1CXHA 1FFNB 5GHWH 3OKDA 1SJEB 4Z7QF 5TQ0H 5JDSB 4MAYC 3HE6C 5DTFA 3NIGF 4E5XA 1J8KA 4HWZA 3BX7C 3PGFH 2P5WE 1VHPA 1JGUH 5EZIH 4YQXL 1IAKB 5GQBA 5HVHC 2IALA 5SWQA 4DJMA 2LAAA 3CFJB 3O9WC 3SDCB 2VR4A 4GMTL 3S36X 2B2XH 3NCJL 1TMCB 3L3OB 4NUJA 1B88A 4WIQA 5HHXL 1KB9J 3B8SA 1FVEA 3U9PL 5HYQB 3RTQA 1PKOA 2I60L 1J0HA 1U95B 4NQCE 2ZZUT 4Q9CA 3ARDC 4MQTB 2OTWA 4R4NC 1U8MB 4M8QB 2NY6B 4U7SA 2XZAL 1S7XA 2VDRL 3OKKA 4KUZH 2Q76A 3PWPA 3KPPB 5FYJH 1CFBA 3SDXB 3T65B 3MXVL 4YZFF 3V0VB 2A74A 1FLTX 1YUHA 3L7EA 3GM8A 4RGNE 3MLVH 4YHNB 5FUZH 5CINL 2F58L 1I7RA 1S5HA 4P2RE 1CK0L 3QPQD 4ELMF 3QWRD 2AEIT 4NZUL 4RFNC 3MNVA 2DL2A 3MUY1 1VKXA 1N64L 1T5XA 2AJZB 4P23B 5JO5B 5D7JD 1BX2B 1FVCA 2YXFA 3R8QA 3P4LA 5HGHA 1MWAH 2EIBA 4FTVE 3TFKC 4QRPB 5ISZE 3WN5B 4ZFGH 4QGTA 5KVFH 1A7OL 1JNLH 1NL0L 3QI9C 5TFSH 1E4XI 3MA9H 1FN4A 4K3JL 4MA8H 3CZFA 3M17A 3V6ZB 3FO0H 3ES6B 1BQSA 2HVKA 5EORH 5ICYB 1T1WA 5D71L 3W9EA 4M1GH 4J6RL 3U2SA 5GGUB 3E3QC 3JV6A 2CXGA 1A14L 1ZS8A 3VRIA 2R0KH 1N59A 5T3XL 1K5NA 3NPZB 2GFBB 1DBAH 3O2DL 4GKSB 2R29H 3F7YA 3WSQL 1AR1D 3SQOL 1TJGH 1FO0A 4WWKA 4NFCA 2A0LD 3HS0B 3U4BL 2YRZA 3LEXB 1JPGB 2C1OA 4Y4KC 1A9BB 5E5MB 3B9KD 4NGHL 1CTOA 4D0DB 3WNKA 2A73A 3P4NB 1QACA 4U1KA 4NOFA 2AJYL 4P49A 3BUYB 1EEYB 4CVUA 2XG5A 4L3EE 5MEQA 5L7XL 1QEWB 4G5ZL 3E0GA 1MCNA 3O2WH 3CH1B 1JWSA 4K94H 3BGMB 2JIXD 1IL1A 5FKAB 1E6JH 3KXFE 3BXNB 4QRTB 4G3YH 4Y4HC 3LHPH 1K4CA 3GFUA 5IB3A 5KVEL 1QRKA 4NNPH 5T1MA 3CSGA 5I1IL 1N26A 3BP6B 4NM4L 4DKEH 4UIKH 5DURB 4N0FA 4Z8FL 2NPLX 2XWTB 4D8PB 4J3OC 5JXED 1QFWM 4HW6A 1MFCL 2JCCE 3UDWC 1EVUA 1OW0A 1Y0LA 4UINH 2YC1B 2FJHA 3RNQA 4CKVX 4Z7UB 4RISH 4Y4HD 1FO0H 3FT3B 4UB0L 5CZVH 3GRWH 4LRIC 1IGTB 4NQVB 3KR3L 3DRQA 5FUCE 2EDLA 4PJDF 3MLWH 4FTVA 2B2XL 5F7HA 1WISA 1YECL 3KLDA 5HGBA 1S8DB 4WO4B 1KTLB 1MCHA 4MNQA 1MJUH 3TBSA 3L5JA 5L6YL 4JFDD 2CUHA 5E7BA 4Z7VA 4K8RC 3BT2L 3R0MA 4HMDA 2CJUH 4KK8D 4MXWH 5CJQL 4FZEH 4NZTL 4OTXL 2DQGL 4DVRH 4PP1C 4Y4FD 2E7MA 1DDHA 5BZDB 4I3GA 5IESL 1JPST 3VFPB 1RIVL 5D1QC 5HI3D 3WJLA 2P5EE 5ALBH 5ECJE 5E70A 3PGCB 1T7VA 4BYHA 3FQTA 4CVXA 4JGUA 4Q0XL 1BBDL 3HMXL 5C2UB 4JO4L 5JIIA 4JPKL 4XZUA 5DVMA 1NGPH 1Q72L 3D6GA 1VFMA 5E1AB 1PYWB 2HAZA 3I6KB 3O0RH 4WEBH 4OGAC 4XVJL 5I1GL 1ZAGA 3DWTA 2GYSA 3O4LA 1IKNA 3DMMC 5FA4A 3RWCA 4LCWE 4OZIF 4OV6F 2NY4C 2DQGH 5D2NB 3RWFB 4I3SH 5CJBA 3I6GB 5J6GB 2YR3A 4JFEA 2BNRD 3KPLB 4XVUD 3TFKD 4LCCA 5KZCD 2PW1B 2J8OA 4OGAD 5EO1B 4LSRH 5AYUL 1T83C 1C8PA 2IANE 1IBGH 1IMHC 4F58L 1T2JA 2AAVA 2XZCL 4CL7A 1CQYA 5E9DA 2BHUA 4JRXB 1YJDH 4J3XA 3HC0B 2AK1L 1G6RB 3K7UA 1D5XB 1G6VK 2HJLB 3JWDL 3S96A 1N6QL 3VRJB 1CI5A 1J5OH 1XMWA 4N0CD 4ZQKB 4CU6A 4Y2DD 2R29L 1K3ZA 1FL5A 5CWSA 3HMWL 3RRQA 1NCNA 3EAKA 3IU3B 3U1SH 4YBQD 4OSUH 3OF6A 2AK4E 1DQJB 1QBAA 4K23L 3G5ZA 5KOMC 3EZ8A 4DAGH 5GS2D 3SGKC 5DQDL 4W4OA 1IM9D 3H3BC 1L9MA 2V2XA 4KROC 3QZWG 4HKJB 1ZANH 3E1F1 1FP5A 1X9QA 3OL2A 1NGYA 4TSCL 5J3HC 3DV4A 4NYLB 2MPAH 4JZJC 1DQTA 3TNMB 3QEGH 4GMSL 5CD5C 4GBXD 1RAMA 4M1DL 1X5LA 1KBGL 3MJ9A 4NNYA 1HEZB 1OOAA 2ZUYA 3SE8L 4JKKA 5M94B 4YDKL 4X8JA 1KJ2L 4MA3B 1CBVL 3MRFB 1L7TH 3QULA 3UTZB 4D9QD 2YS4A 3HE7C 2ATKA 1YEHL 3TN0C 4DZ8B 4RAVA 4WFHE 3IKCA 3O3EA 5CAYB 4NM4H 2PCPA 5GRYA 3QRFM 2IFFH 4FFZH 3QHFL 5EU7E 4YIQB 3VXOA 3QBTB 2Y7QB 3TO2B 1IM3A 5ACLA 2EH8L 3QDJB 5D1XB 1JHLL 3E8UH 3F5WA 3SCMA 1BM3L 1NFDA 4WTZG 1Q38A 2PETA 3OX8B 1GZPA 2J12B 1ZLWK 1XFPA 1NAML 4HS8H 1QD0A 4JPWL 3W39A 4HT1H 1I75A 1BJ8A 5IW1B 4PGBA 4JHAH 3MRNB 3W2DL 4BFGA 3TVMB 4NHCL 3WL9A 3QIUA 4NRZB 3LKOB 4XCNB 1BOYA 3O4LD 3RWEB 3ZDXE 1CGUA 3HZMA 3DPBA 3Q6FA 1KUMA 3GMMA 2FX9L 3OKNB 2GCYB 4LEOB 4GG6F 3VXOB 4MQXC 2W60A 4HPOL 5F88B 4W68A 4P9MH 5IVZA 1AGCA 4XPAH 2O5YH 4PJGA 4FXGA 4X9FA 3VFTA 2FL5B 1MNUL 4KZEH 3K8MA 1AR2A 2W92A 4DN4L 3BIKA 5JPNB 1RVFH 5F7KC 2FL5A 5AUMA 3WJLC 3RBSA 3E3QE 5HTSA 4EI5C 3IFNL 3DVNB 2QSTA 4PJGB 3SE3C 5HVGB 1QVOB 1L6ZA 4X4YB 5DJ0A 5I6XB 4BM7A 5IKCB 1DQML 1HCVA 1TVHB 3C08H 5M95B 2VMFA 3NIFE 3D3VB 3QXUA 5BVPH 2DKMA 1C5BL 2B8OT 3U0PB 3C8DA 4EOWH 2VDQL 3EFFA 3Q6FB 4HAFA 3ULSB 4HV8B 1FPTL 2BZDA 4NO2B 3VFRA 2J8UA 5JDJA 1MCCA 1K2DB 2MQCA 3VFVA 1A1OB 3T2NH 4E41D 1KTKE 1RULL 1CICB 2R1XA 5D7JA 2D31B 4L8SA 3VFSB 2EYSA 1DQDL 5C0JB 1G7PB 1JZ4A 2YD1A 3STZB 4NWTL 3S4SG 5D1XA 2FD6H 1DVFD 5SWSD 1OSZA 3AUVA 4BQCA 4OLEA 5JXAH 2DYPA 4Y16B 1TITA 1LO4L 5DVOA 4OCWL 3V4UL 1Z9MA 3MLSH 2Q86B 3GHBH 4FFEX 2QV2A 3BSZL 2BK8A 5I0DA 2V7NA 3EDFA 2Z92A 3WFBL 4WU7B 3QT2A 2OCFD 1A6ZB 3MZTA 4PJGE 5DVKA 3TJHA 5F21B 1JZ3A 3EDEA 2AQ3A 2IBZX 3MMEB 4HD9A 4KKCC 1JWMA 2IFGA 4M93C 2PKDA 4O2FA 2BJMH 1EFXB 4Q9RH 1YNLH 1V7ML 1OSPL 5E6ZA 4DGYH 1CN4A 4QXTA 5T5NG 3WNPA 2FH8A 3QEGL 3HC3L 1C08B 4TUOA 4X7EC 3UZQA 1GXEA 3DX8A 4A6YL 1RUQL 4N0UE 2PTTB 1TZHB 3OV6A 5EA0H 3FRPG 5E95B 4LCIH 4KWUA 4PS4H 1CLOH 4HWEH 5J56B 5BJTB 2P42B 3EFDL 4UT6L 3MGOA 1DBML 1DQJA 1B6DA 3VXUD 4OCXL 4WY7L 2PXYC 3P9MB 3SDXE 3TZVD 5CJ5A 3PP4H 3I02A 4PRID 1DBJL 1HYSD 1T4KB 4HJJH 3MCKB 4MJID 2ICEA 1G84A 2X4PA 2EYRA 3NTCH 1EHXA 3HE6D 1UM5L 2VAAB 1HNFA 4WUUB 1D5XA 2HJLA 2IH1B 2X4QB 4RGMC 3C2AH 3TEUA 2C3XA 1NLDL 5CFHA 3E6HB 3KPQB 1N5YH 1HXMA 4GSDL 1XIWB 3K3QA 1AO7B 3B3IB 5HI4D 5EOTB 2GK0A 4AENB 4KKLC 1F4YH 2J88H 3QXVA 1WBYA 4H20L 2Z35A 4YNYA 1CICA 3CK0H 3RVUD 1ETZB 3LKQA 5HHMA 1F6FB 4HPYH 2VJXA 3I2CH 4BH8A 1LO3H 1KXTB 4KPHL 3GEWB 3BJ91 4LAQL 2VITB 4YDIL 5HGAB 2ZUVA 4ZFOL 5HHPB 4OB5H 3LPFA 3VXMD 1KEMH 3H7LA 2OJZL 4DEPC 1UCBL 3WDIA 4Q9QH 2VNCA 2FEEL 2Y25A 2RFXB 1TVHA 4DVBB 3GSRB 5JW5A 2XNAA 5HDBE 3MV8B 1CGWA 4O2FB 1NLDH 3QB7C 3BIBX 5TQ0L 4S2SB 1ZE3C 4MB5A 3DURA 3PABB 3QWQB 4OZIA 3PHSA 1MCWW 4HUXA 2I07B 4UUJA 3VFMB 5E08H 2A1WH 3GJFK 4NPYA 1JZ7A 1U41A 4XB7A 5H35B 1DFBL 3KJ4C 3MRJB 1XR9B 2QTEA 1AXIB 1ZA6A 3M8OL 2OLDA 4TUJB 4PJ9A 5K9KA 2ESVA 4OIBA 5JZ7D 4KPHH 5BS0B 1ADQH 1L7IH 2X89D 3WO4C 5IG7B 2PYEA 3SE4C 2L7JA 1R6VA 4L8CB 5DRWA 1UKQA 1MVUA 5HD8C 1TCRB 3MRCB 4UZGA 1LEGA 1DN0A 4YHLH 2CIKA 1SY6A 1FC2D 5C09D 2GTZB 1J10A 3TYFA 2XZAH 4YDLC 3UZVB 3T77B 4G6KL 4GT7A 4WWKB 3S8WA 5HGBB 3WFCL 3SDAD 2NX5E 2AK4A 5LCVH 3EOTH 1N59B 1CFTB 3MXVH 1F00I 2DD8L 3ZTNH 2H26B 3SO3B 5ID1B 4FP8H 4LOUC 2L4OA 5DZOA 3CXDL 1Y0LB 1K8DB 4PY7B 3TO2A 4F7PA 5KG9A 1OAKL 2OJEB 5CJXA 4DKFH 4Y5VB 4RAVB 1WZKA 5IEKA 5BVJA 3MRLA 4ZODA 4BQBA 2XV6B 5E8EB 1G7JA 3WFBH 3MRFA 2V9RA 3UJIL 4K9EC 1BQHA 1K85A 1KTRL 5TDOB 2OR9L 3W11D 3RDTD 2YK1L 1RHFA 5CCKL 1L6XA 1MI5D 7CGTA 3K1DA 2W9EL 3RWGB 3WHXA 3MRPB 4LCWA 1KELL 4WRLA 3W0WA 3O4LE 5TFSL 3AU1B 3NACL 5E03A 3HNSH 2P8MB 3GB7A 4Z7VE 1U3HB 2XKNA 3VXRD 4CAGA 1P2CB 4OKVB 4LEOA 1S7WB 2JJSA 2VLJB 3TO4B 1CGVA 3G6AB 4DK3A 1LP9A 5HHQB 1AJ7H 1VFBA 1G0XA 5CHNA 3CXDH 4HKBA 2W65A 1SY6L 2A9ML 2R56L 1D6VH 3AB0B 3LH2L 4NKIL 4F37F 2WV3A 3HS0A 4NN7C 5FHBL 4JKPH 3LOWA 4P5TC 3D3VE 4G8IA 4LVOC 1MUJB 2JCCA 1AGEB 1ZHBB 1KC5L 5D93C 3SQOH 5JOPE 1ORSA 3MV7A 5CEZE 3NPSC 4WHTB 4JFFD 4PB9L 3EYVB 5CBEA 4DFIA 4C4KO 3TIEB 1OGAD 1WV7T 2R0ZH 3LKSA 3HNSL 2FATL 4CJ1A 3W9EB 4CW1A 2CDEB 1G7IA 1I1RA 2GT9A 2NCMA 3SDCA 3V95A 2O5ZL 2X89A 1UT9A 3BEVB 5SWQB 2VLKD 5K9QG 5E4EC 1KB5L 4NZRL 2CUIA 5E00A 5J4MA 1CYGA 1XF1A 5SX5K 5FGCB 1DL7H 4L3EA 5C09A 1YA5A 4A2LA 1HHJB 5F72S 3WIHL 1NCWH 2R0LL 3VXTB 4YPGA 1P9MC 1OB1B 5DMYA 1FLRH 4JRXE 4E42B 5ISZB 1CLYH 3O9WA 5CJ8A 5M7QA 3P73B 3QDMD 4OF6A 5J13C 1C16B 4R26H 4L3CA 5D1QD 3G5ZB 3C6LD 1T83A 3ZO0A 3H8NA 4PR5B 1T0MA 1I7TA 2IH3B 3BKJH 3WIFA 1EA9C 1YDPB 3DYOA 2B4CC 3NFPB 3PWUA 3GRWL 1GGYA 3KPTA 1GOFA 2J2ZA 4HIHB 3KR3H 4KTYA 1JPFB 1AI1H 1QHOA 2FECL 3KXFA 3N9GH 4JRWA 4LHUB 2EXWC 3S96B 1S9WB 3UTTB 3IB4A 5F44A 3WNLA 3L9RB 1KFAH 2YSSA 3RDTA 1AQKH 1W0WB 1I3RB 4LEXL 1UFUA 5ITBL 3SBWC 3QUMH 3FFCA 2HKFH 4L3CB 3RU8L 4YBLB 1A6AA 1H3GA 3UROR 3O6LH 2CMRH 5ISZA 5E8PA 4FQQA 3DX6B 4ELMB 2YZ1A 2X1QA 3L3JB 1YMMB 3OJDB 1CFVL 3FKUS 5KJRH 4M4PA 5IB1B 4ISVA 2ZNXA 5EOQL 1OLLA 4XPTL 2BVQA 3ZDZF 3SDXF 1U91B 4TTDD 4JO1H 3VJ6B 2XN9B 2GJZA 4OZHB 5FYLD 5ICZB 1QNZH 3BP6A 3ME0A 4ISVB 3I84A 3IT8D 1KPVB 2W0FB 3ZMRA 2Q6WB 1A6PA 1J0YA 4TVPD 1A4JB 5EUOB 2YKLH 4MCYB 4X6CF 5ANME 2UWEB 2H2PC 4IMKC 5D7KE 3MV7E 5F7DB 4MZ2A 5FK9B 5I1GH 2XWBA 5B8CA 1OW0C 1X7QA 4LKCA 5EU6A 3GJFH 3RZCA 4U6HA 4Y5YB 5FDYA 4LARL 3IAPA 4PJ5A 5A2LH 1LEKA 5I75B 4XP5L 5DQJB 1RFDL 1S9VA 5BZDA 1QEWA 1YN6A 3NA9H 1IEAB 1MAML 1OP5K 2EIZA 3D2UA 3VFGL 2QL1A 3BUYA 4OUUA 4U6XB 1LO0H 4QYOA 1X5HA 3EYOB 1JYNA 2VN4A 3CLFH 1C12A 4O4YL 5IWLC 4OZHF 4R4BB 1Z9OA 4LLUA 3VG9C 1MQKH 5F6IC 1W72L 1LE9B 4XTRC 1B2WH 4L1HA 3RA7L 5FGRA 4Q58C 4ZNEE 4LLWB 1KYOJ 1IC5L 3IS0X 1EO7A 4MD5B 3QPXL 4PRBA 1A6VL 1AGBA 3G6DH 3O41B 4PLKD 2P5WA 4XMLL 2X7LB 1KC5H 4OZFH 1I3GH 4PIRF 1J87A 3FT3A 2A77L 4G42B 2P7TA 4GS7C 3QDGA 5C9JB 2NTFB 4OSUL 4ZAKD 1RJYA 3P3YA 4D3CL 3U2SB 3VD4A 1M6OB 5EZJB 5D7LA 4L3EB 4NN5C 3NH7H 4D8PA 1HOCA 1S7UA 3EOBA 2VWEE 2CDFB 4NQUA 4YHIA 3QG7L 1OPGH 3GZKA 3WKMH 1PLGH 4OAWA 3UO1H 5EDXA 2ZCHH 4JHWL 3KXFD 2BRRH 4G9FB 4MD4B 4Z7WE 2M2DA 1HZHH 3N85H 5I1AA 5L9DH 2GT9B 1WJ3A 4U1SA 2B20A 4R97C 4MQ7A 3QXWA 4ZG1A 4P5TD 3OR6A 3V7AE 4G6FB 1BVKB 4F9PC 1SMAA 3N50A 4ZOEA 5IVOA 1AGFA 1YEDB 4KKLD 1F02I 2OI9C 4QXWA 5HHMD 2AJZA 4KK8C 5ID1A 3H3PL 4H25B 2V2TB 3WUZA 5IJVA 4XNYH 1U8OA 1NJ9B 3WXVL 4Z7UF 1CGXA 4HC1L 1ZHBA 5DJCA 1IGIH 3QRGL 3U4AA 1IGJB 5FCUL 2VSCA 3ZLQC 1M1SA 2CGRH 3QHZL 1G7QA 1ZSDA 5C0CE 2RCSL 2CRIA 5HPMA 3BH8A 3ZE2E 4IS6A 3TBYB 3IS1X 4EKXA 3HZKB 1CIDA 4A6YA 2XZQL 3R4DA 4P46D 1RMFH 3GKWH 3UYRH 3AREC 1FG2A 4UIMB 2VLJE 2CKBA 1JHTA 3QIWB 5C2BL 4TVPE 1EH9A 3LRSB 4UT7L 3PWPB 4U6XA 4OZIE 2OMBA 1F45A 4PRPD 2YPVH 3RPIA 2IJ0C 1E28A 1BFVL 4PYHA 4X5WA 1AHWC 1AGFB 1FVDA 3V0WH 1OHQA 3ZE1E 3LKPA 3UJTH 4ZMAT 3NCYP 5A16A 3CC5B 3VXSE 43C9B 3NCJH 2HMID 2VTFA 4LRIA 1NCCL 1VFOA 5DD0L 3TO4C 4G8GD 4PJ7E 2EDXA 3D0VA 5E6ID 2O5YL 3NZHL 3CFCL 4OAWB 5TJWK 3FFDB 2WANA 5JHDA 2C4FU 1EDQA 2H9GA 2V6HA 4LLQB 1KPUA 2XZQH 4Q6IC 4RFOL 1I1FB 2YUZA 5HGHB 4NN5B 4HUMB 5EZJA 2AABL 4CN1A 3T3PF 3QUXC 4WV1B 3F65A 5HHPA 2KZ1B 4LSVL 1AXSB 2EICA 2F54A 1HINH 2DMCA 2F8OA 4RDQG 1JFQH 3TBTA 4MLSA 2VR5A 2ADIA 5CSZA 1TJHL 2DIBA 3HB3C 4LVHB 5D7IA 5FYKD 3X3GH 1BAFL 1S3KL 3PF2A 3V52H 1R24A 1AIFB 3D25B 4P2OB 5DQ9B 5CILL 5BV7L 3SCMC 3TVMC 1N64H 3RWIB 2WSKA 2F74B 4TPRL 5IF0B 3DMMD 2CLVB 3M07A 3OKLA 4G8GB 5TDPA 4BFIB 4KQ3L 5CIPA 4CRPA 3QUXB 1DQDH 4TVPL 1Q0XH 4WW2F 1BQHG 1FYTE 3V79C 5EIVA 4G8EA 4OFKA 5GS0L 1Y18A 1FGNL 1RD6A 1LGVA 1I8IB 3HNTL 4XX1E 3MJGX 4NCC2 4N9GA 3KYNA 4WI7A 3MRBA 3RNKA 5FYLH 3RVUC 5IEHA 2ADFH 1T20B 3KWWA 5HHVH 4HUVB 3EIFA 3GJEB 4C56B 4CU8A 1R5VB 3SPVB 1NSNL 2IGFL 5J06A 5I1LA 1D9KA 1DBAL 2BVPB 1B4JH 3O2DH 4X6BB 4N5EA 3IDMA 4U3CA 3ARYA 3WKML 5IQ7H 2DWEA 2I24N 2ICWA 3LVEA 1JGVL 1QLFB 3S5LG 4WW1B 4XNQA 1IGFH 1ACYL 5DJAA 4ODVH 4NGHH 4JAMA 4XXDA 3PIQB 3QWOB 5J7CC 1JHKH 1KSRA 1OP9A 3LKSB 5BW7C 2PTUA 5E6IC 4G6FD 2NX5B 3F62A 4AQ1B 2CLZA 4QY8B 2X4QA 4WY7H 1NMCB 4HUUB 2WBJB 4G9FD 1BD2A 3THML 2BVTA 4PTTA 5JXEC 2AXJA 1JBJA 4Z7OF 1Q8MA 1ZGLA 4LPYA 2AV7A 3UJJH 1ACZA 3ZZ1A 3CFEB 3OKOB 4GKNB 3LRHA 4M7LT 3MUZ1 4PJEA 1DZBA 4NNPL 3T0DA 1I85C 5DUBB 5ITFB 4WDIB 4UIKL 4LGPB 5GS3A 2FX7H 1VA9A 1UVQB 3DX8B 1HI6A 4GG6B 4ZUWA 1B9ZA 4MAUH 1QYGL 2D7OA 3HPJB 3VE0A 1MFBL 2Z8WC 3FB8A 2RBLA 1IAII 5ADOL 3DUUB 5EO0B 3E2HC 4HS6A 4RISL 5GGTH 4QHUA 43CAA 2MQ0A 1KB9K 2WBJD 4P3WA 3DUSB 2XY1A 1G7MB 3VWKD 5IQ9B 5DD0H 3TLRA 3G6JB 2BMKB 5IEKB 5TPWL 2CDEA 1I8KA 5IVZB 4R3SB 4F7EB 1E4KC 1TFHA 2XWJB 3BGAA 3H9YA 2Q20A 3SQBA 4KK9D 1Z9SA 5E6YA 4R0LC 3EDDA 4PJ7A 5DXWA 2DQIL 3V5KA 1WTGT 1HINL 3QIUB 4NRZA 4RRPG 3MUGA 1G9MH 3VWJA 2F53E 1JPTH 4F57L 3GSQA 2FX8H 4PTUB 1JGUL 2BY1A 5GGTL 3RX7A 1TJHH 2WP3T 3P40A 5HHNB 3X13B 4G7VH 4D0CB 4JVUA 5MEOB 2NXYC 3B83A 1H3VA 1Q0YL 2A6IA 3GSQB 4JCLA 5DEFA 5D70H 3RIFK 1Q9WB 3V6FA 3S35X 5GS1A 1JNNL 4ZUSA 4MB3A 5E2JA 1YMHA 3SKUD 1AQDB 3GSXB 1BLNB 4CMMA 2VLJA 3PWJA 3WJJA 4R8WH 5F1OB 5MP6H 3U36A 3BW9A 4FQ1H 5L2KD 1MCQA 5E24E 1A1MA 3LKNB 5DRXA 4K7FA 2HTKC 2G9HB 4NQEE 5FYJL 2ZOKB 5D72H 3CFDA 2NY6C 5F9JB 1MHCB 3QEHB 4MNGA 2WW8A 3GSVA 5TDOA 1AGDA 1BQHB 4IRSC 4JKMA 1T22B 2Z9TA 3NN8A 4X6DA 3ZYZA 1WZ1H 2G9HA 2VC2H 1FAKT 3B9DA 3TIDB 4UB0H 5CZVL 5CLTA 2A9NH 3LKNA 3AMLA 1HQRA 3VGDA 4FQIH 2X4SB 4JPIB 3H9HB 4KI5C 5F88A 5E56A 4BSWA 5IB4B 5DJ2B 1E27B 2GCYA 4JG0L 1BLNA 4CMMB 1FC1A 4HJGB 1NEUA 1C5CH 1PAMA 5C0RL 4RX4A 4Z7WA 5FKPA 3GI9H 4BZ1H 1RZ7L 2GAZA 1DUYA 1NBZA 1T66C 1NEZB 1MLBA 2D03L 4I3RL 4C56D 1ETZA 3AY4C 1MCLA 2P8PB 1RURL 2Y5TB 4JPVH 3NBNA 1QG3A 1VGKB 4PLOB 1G9EA 5ESVA 4TSCH 5IMMA 4RBPK 3SBWA 3P0VH 5IVNA 5SX5H 3OHXB 4JFEE 4PV8B 5C0AB 1JYVA 1PG7X 2R23A 1NH6A 4RGMB 5DEGA 3LKRB 1NBYA 3QCUL 2Z31A 4ZNEA 2X4PB 4BSVB 4QOKE 1AFVL 1DBBH 1JWUB 5DT1L 3KJ4B 3QUMB 3FO9A 2NXYB 2R0KL 3CLEL 1NGPL 5DDHB 1RIUL 2HT2C 3ZKMD 3UJJL 3VFMA 3PWPD 2BSTA 1WCBB 1N7ML 2DS4A 3DMMB 4G8GE 3WCYA 1QLRA 4OZIB 2EE2A 4LOUD 3Q3GB 3MOBL 5JIPA 4DK6A 2P24A 3MYJB 4QWWC 2V9QA 1T0PB 5I8KL 4PBWD 2EH8H 1PW3A 2NXZB 4LF3A 4IIQC 5EU6E 3KLHC 1X5AA 5KS9B 3BZ4A 3KPMB 3HKFA 1MOEA 4NKQB 4PG2A 3ULVL 1RU9H 1GAFH 4OZFB 1RUML 1U8NA 4UBDD 5A2FA 2CK0H 2XTJC 1WCBA 5T33H 2XA8L 1NBVH 4HG4K 2VLJD 1OP3K 5KBNC 2X9XA 5F1KC 2DTML 1UEYA 4C57C 1HXYA 1U3HD 3VXRB 3FO9B 4LMQE 4P5TB 1CD0A 4MNQE 4MJ6A 2OZ4H 4B7IA 2F15A 2Q1EA 4RFNB 5E5RB 2BNQE 3MPCA 1JTTA 1OAZH 1T3FA 4FA8A 4FQJH 3OKYA 3KLAB 5IK3A 5B4MD 1HHHB 3MRHB 3RGVD 2GSIA 3BO8A 4LHQB 1A64A 1ZT7A 1YN7B 4M00A 4P59L 3QCVL 4Z7OE 3P9MA 1HXYB 2XN9E 4O2CB 5T1LD 4QXUH 4H0HB 1IGTA 2QR0A 3PV7A 3RWFA 3S98A 3VXPB 1U8NB 1LEIB 2Y06H 3QIWD 12E8H 3KJ6H 1L0YA 2JF1A 3JTCA 4B5EA 5L6YH 5ACZB 5BQ7B 3KPSE 5IW3A 4MD0B 3BP7A 2J7LA 4PJ9C 5ENWA 1KACB 3I3DA 3SDYH 1A3QA 1DQQA 3RWJB 4LKXA 4APQA 2XXCB 4L4VB 1EFXA 4J2XA 4DCQB 1ZVSA 2DM2A 1KJMB 4YGVA 1KGCE 1BP3B 1YY9C 4KI5F 5IB3B 1K4CB 4HWBA 3TYGL 5I73C 1FH5L 3D39A 3PQYD 4PP8C 3BPNC 3MRQA 3DJ9A 3HRZA 1JHLH 1RZFH 3E8UL 1WZ1L 3C09C 3RX5A 4KJQC 3CX5J 2A9NL 3HRPA 4MXVF 4O9HL 3QQNA 2YRLA 4YXKH 2X4NB 3DTXB 3BN9D 4JPKH 4K55A 3BQUC 1UM6L 4JG0H 2X4OA 4YDJA 4F15C 4KJWC 4ZUVB 3OHXA 4X80H 1NUGA 2XN9D 5C0JA 4HWBL 5MEOA 3IFLH 2EDRA 3LPGA 4CBPA 1KTLA 1JZ2A 3U4EB 4GFTB 4WHYG 1LVEA 1YMMD 3FTGB 4M4RA 5D7IB 3LQAC 4JPVL 2GFBA 4BKLB 5IJVB 4G9DA 3VXMB 1E4WH 4N5ED 3AVEA 3IGAB 1EXUA 4OD1L 1Q1JL 1T04B 1QRNE 5D9SA 2AJSH 3LY6A 4OLZH 5I6XC 1JF6A 4UDTB 2VL4A 1FNSH 5FM4A 5DJ0B 3RY4A 3ES6A 3P77A 4KK5C 4YWGH 4BZ2L 4G43A 5IVXF 3IDUA 3TIDA 5KW9H 5FUOH 3VU2A 2OK0L 4J4PA 1OGAE 4P2QB 1T22A 3NN8B 4LHUD 3VA6A 1OAXL 3GBMH 4Y4FA 1G7LA 2WLYA 3C5ZC 3QG6A 1Q94A 5HHOB 1ZMYA 1IGYB 3T0WA 4LQFH 4F9PA 1I7ZA 1INDL 3G5XA 2UUDH 1OD9A 2EE9A 4MJIB 2FCBA 2I26N 1GGCH 4KMTH 2ZUTA 5J9PA 4YC2B 5CEYB 4PRIB 1N5YL 5DGQA 3T2NL 3QDMB 5B39A 3X3FL 1A21A 3QO0B 5J8OA 2PUQT 5ITFA 4KKBC 1SJHB 1LO5A 2YEZB 3EO0A 3KPSD 1JPGA 4PGCA 2FD6L 3SE8H 2A74B 1BBJB 1X5IA 5HPMB 1ZLVH 1FQ9C 1UWXH 4YDIH 3QUZC 1G7QB 4APQD 5HYJA 1EFXD 3MA7A 5C0IA 1XF4B 2AEPH 2MTPA 4NP4H 2AVGA 2FBOJ 2H2SC 2J5LB 4XI5D 4FQXC 3REVB 3RP1A 2BNRA 1IILE 1JJUA 3PXJA 2NX5A 2ZJSH 1UYWL 1IM3B 4ZO7A 4CGTA 2Z8SA 3EGSA 1QR4A 4YIQA 4DN3L 1PJ9A 2XWBB 1BVKA 4N9OB 4R3SA 3L3OA 1MCBA 2R39A 4TUKH 1IEHA 1DLFL 4PJCE 2BX5A 2UWEA 3V9FA 3UTTD 4G8FB 5IB2B 4JVWA 3UTOA 1H0DB 2P46B 5DUMH 3ARFB 3ARPA 5C08A 2ESVE 1R3LA 3W5NA 3Q6GL 1IFHL 1HYSC 3ILQD 2G60L 3C6LB 1NCBH 5TGBB 3I75B 3HUJE 5I74C 1QQDA 3O3BB 5T3ZL 2ADJB 4E41B 2ENYA 1C1EH 4HHAB 3BKML 2MJWA 4NYLA 2VLMD 4IDJH 4FQQB 4ZUWB 3TO4D 3QH3B 4H26B 2E27L 3NTCL 4ONGH 5C9KA 3O41A 3TYGH 2HP4A 4GQ9H 4G6KH 1S5HB 4MS8A 2AS5M 4I18C 4PREB 3ARED 1MRCL 2X9WA 1TDQA 2O61B 3CVHL 3WLBB 1MI5B 1A7NL 4LCYA 4KKCD 3G6JF 4FQPA 4LCUA 4M5ZL 1RVFL 3O3AB 4LHUG 4H20H 3OKLB 2BOCA 1XH3A 5F1IA 4MHHG 5DMKA 5IHBA 3X3GL 5IF0A 1P5VA 1QFUL 2EKSB 1YY9D 2APWA 5GRZA 1CL7I 3CDGB 5CP7B 4DQOL 1JP5A 4U6HB 4Y5YA 5MHSD 2UY7A 4M7KH 1FVEB 4M3KB 4TPRH 4LSUH 4LLMA 2XRAL 3O11B 1N2RA 3PWLA 3GRWA 4F3FA 3QH3A 4ZXBD 3WLWC 1DBKH 4XMKL 3CFJA 1NFIA 5EUOA 4YHOH 5E0QA 4LSQH 2QQQA 5DK2A 4JRYB 4UOJA 4TVPH 4WWKD 1HHIB 1U36A 3G6JE 2VE6B 1IGML 1XR8B 2QKIA 5FF6A 5HVWA 2VXQH 3QJHB 2P44B 4EQ3A 5JHLL 2DWDA 4C56A 4GKZA 1WFNA 3ARFA 4N0FB 5C08B 1FNSL 4N0YL 3UBXG 5IEHB 2IBGA 5LGKA 3FONA 1IGCL 4Y7MA 5BXFA 2XFXB 4KVNL 1U3JA 2DL9A 3O11A 1R5IA 3WYRA 1FZJB 5L8JB 4NBXB 4GRMA 1RZJH 4LSUL 2P48B 3CUPA 1FG9C 9CGTA 4XTRD 3UYPA 2C4FT 2JTDA 2HLAB 3F6IA 2OTUB 4F37K 4KAQH 1A6WL 5DJZA 3CXHK 3GSWA 1I4FA 1T89C 3FQUA 2JCCB 3VRLF 1RZKH 2IEPA 3MA7B 2YD7A 1EPFA 4QTIH 5IV2B 2NY4D 4K3JH 4MA8L 5F7EL 4HSQA 1CF8H 4NSKB 1QFOA 3FT2B 4KK6D 4KJYB 2DTSA 1U8PB 2VRAA 3MRGA 3DSNA 1RZIB 3A6BH 4TYUA 4UAOC 3CIQA 2Z8VC 3THMH 1NJ9A 4M43L 1G9MC 1OGTB 4DW2H 3RNQB 3BPLC 2NY1D 3OGCA 1AC0A 4KHTH 4WTZA 4MJ4A 4U1LB 2ZJSL 2A6JA 1UM5H 2YK1H 1CLYL 1KPUB 1KXQE 4JHBA 5GISL 2EEDA 1YEFL 1MH5A 5CZXD 1OL0A 3VXQA 4R0LB 2ZCLH 5ESAA 4M6MH 5GRVK 4ORGB 4MDJA 3S4SB 1CGTA 4R97B 1J1XL 4OFYA 3IDGA 4NC0B 3O6FA 5HYSB 1OTSC 2FYYB 3CC5A 3TZVB 5BO1L 5IFHL 3AXLA 3DSFL 3VXUB 1AD0A 4PY7A 4ZTPL 1A1NB 3RWHA 1P1ZB 3LH2H 4NKIH 4QT5B 4PJDA 1TNMA 4X5XA 3VI4E 4WFED 1H8OA 3BKMH 1TZIA 3LHPL 2X42A 4OLXL 5I0ZA 3G5VA 5E2VL 1MUJA 4MA1C 5SX4I 1YEGL 2QQLH 4PV9A 4NHUE 3SKJL 3U7AA 2HFGL 3TYFB 4OF8A 3KYOB 4LASH 3U46A 4KGJA 1MFDH 4U1JB 5I15H 3LN9A 1TCRA 1ZT1B 4JFYB 3P0GB 5EOQH 5IV2A 2PW2A 5CBAB 5IOPA 3LIZL 4YAQA 5I71B 4OKVA 1N8ZA 1TVBA 2NY2C 3BJLA 1MHPH 4X9BA 4B7LA 4PRIA 2XI9A 3DSFH 1P1ZA 4RDQF 3X14B 2NY3B 3LV3B 4MJIA 4V1DA 3EYSH 5T1DH 4DKDC 4Y16D 4KRNA 2FR4A 1YYLL 1DVFB 5SWSB 5TF1H 3AAZA 1BZQK 4AM0B 5JW4N 5JW4M 1L0QA 1ZLUH 3LMJL 4Y4FB 2VDNH 1P6FA 5E2WL 4O02H 4P2QA 4B53A 1EERB 4MCYA 4KJPC 4WUUD 2VSDA 2YPKA 8CGTA 1FE8H 2IPKA 5MHSE 1RFDH 4HJ0C 4Y2DA 1UXSB 2R69H 5FA3A 1CICD 4L5FL 1U3HC 2CDFA 4M5YH 5TE7L 4JHZA 1E6OH 3EOTL 3TH3T 5BV7C 3C6SB 4WI9A 5KSAA 1JGDA 4PJIB 5KSUB 3FT4A 3TPUE 1HH6B 2A38A 4OIAA 4QLRA 2CXKA 2PTVA 3BKCL 1OAYL 1WWAX 4JQIH 3VXMA 2EE6A 4MA1B 5C0FB 1KIPA 3DVFA 2PNDA 3UBXB 3SE4A 2VZVA 4LLMB 2G2RB 4JZNB 5DR5H 4U1IA 4XX1G 5BW7A 2QEJA 1X4YA 4PYGA 5DK0A 4PBXA 4P3CH 3FT2A 4I18A 1UB5B 1I3RA 1LE9A 1D5MA 3KPQA 1J1PH 1ZVHA 5H2BA 4LLUB 2W9EH 3BN3B 3ZKSD 4CN4A 3C2SA 3QQ3A 2ICEB 5DJZB 3STBA 2VZ1A 5A3ID 4M5YL 2WQRA 1I1AB 4K07A 4ZPTB 4YJZL 1AKJD 1OPGL 3DV6B 1MRFL 1W8NA 2GTWA 2AJYH 2X40A 5CD3A 4OLVL 1IKFL 4X6FB 1GYAA 1GPOH 1T7YA 2DJ4A 2VR9A 3S35L 2NY1B 4D94A 5AYUH 1KJ3L 1C16A 4L4VE 4EN3C 2GKIA 5A2JH 5DJ6B 1FZJA 3MGTA 1MCEA 4MCZA 5CZKA 1BMGA 1T5WB 2UWEF 2ZUXA 3H6JA 4P9HC 4GG8A 4NO0D 2P45B 1VGEH 2FHBA 1C08A 5J13B 3VXUE 5L88L 4ALAH 3JTSA 3IU4L 1M7XA 2Q6WA 5JNYB 2JB5L 4OLYL 1RIUH 5CP3H 2I27N 3QDGE 5AZEH 4GKZB 3VH8A 5DF0A 1KULA 5A1AA 2B4CH 2VXUL 3MOBH 3MYJA 3SJVE 1AP2B 2I9TA 2E7LE 5FYJD 3H7BB 1SM3L 4X98A 4DAGL 5HGAA 1MHEA 1S7VB 4HKXB 2NW2B 1RK0B 3H9ZA 4M6ML 2AXGA 3DIFA 1MAJA 3LD8C 1MFAH 2WLZA 3OR7B 4OGZA 1UWGL 4ZS6D 5KSBA 4AEHL 1BOGB 5HDBF 4OLVH 4JFHD 2FGWH 1MQ8A 5EU5A 1JVKA 2Z31B 1HQ4B 6FABH 3EGSB 4EDWL 4F7CB 1KPRB 1RUMH 4Y16A 4OCYL 1YEEH 1QR1B 1H5BC 5HI5C 2X10A 1NBVL 1T3FB 2R15A 5J57B 3RFZC 2P5EA 3BZEA 4PRAA 1KCVH 3J7HA 1G6RH 4PJ5E 5F1IB 4JKWA 1T89A 1NCWL 4XPBH 3WUWB 1KYOK 5DD6B 3VI3E 2HJFB 2F5AH 5C08D 2C3VB 3BRGC 1I3GL 2DIAA 1NGQH 3TV3L 4XNUH 3EO0B 3QO1A 1NANH 5IJKC 4UILH 5DD3H 3N1QC 1IM9B 5ID0B 2ZUQB 4Y4HA 4ZDHA 3AB0C 3TO4A 3LIZH 2ZCKL 2ZCHL 1V7NH 1EAPA 4TUOB 4YE4L 3BZ4B 4KFZC 4E41A 5I74B 2JB6B 4MS8D 3L3GB 1A3LL 5JOEA 1VPOH 1DE4A 5D96B 5GZND 4JO4H 1OF2B 1OAQH 3WHXB 3H42H 3HPLA 1H15A 3ARTA 3EO1A 2XYCA 1NDGA 4IRSA 1G6RL 5D1XD 1JK8A 3PP3K 1XF5B 1A7PH 1YPZB 2VH5L 1WIPA 3BH9A 1MJ7H 5FYLE 4PG9A 3LSOB 4EI5A 2DQHL 3U9PH 4JFDE 1C7SA 4ODWA 2D0GA 2VZTA 3QFDB 5TQ2L 4GRWE 2WAHA 1AQDA 3GSXA 3AROA 1KTDA 1BFTA 2QSVA 5F96H 4HXAL 1WGOA 4R90L 5LBSH 4BQ8A 1IBGL 5TH2B 1URLA 1LK2A 5ADPL 5KVDH 4OKDA 4GLRH 4LRNL 2QHLA 1I9RH 5FB8B 4AH2A 4KZDH 4XC1L 1CFNB 5JQ6H 4G8IB 4K3DL 4QNPF 2D7QA 5D7JC 1X5XA 4QRUB 2O26U 4PGCB 5BMFH 4P3CL 3REWA 2GAZB 3HMWH 1CK0H 3H9SB 1SJHA 5I8CB 5BVPL 1CGSH 1HKFA 3ULVC 3G04A 4I2XE 4BZYA 3K2UH 1C7TA 3LZFL 5KTEH 5D96C 3EJZC 4JFED 5DJ2A 3SJVD 1YEKH 1EIBA 2ZSWA 4MX7B 5HJ3A 1FAIH 4YC2C 4P3DB 3M1BB 5LGJA 1NUNB 4XCFL 3CH8A 2LU4A 4PDCE 1NCUA 1LK3H 3INUH 3RTQD 4AIZA 1Q9KB 4HUXB 2G75B 2QQNH 1DUZB 2KQMA 2VDLH 3FQNA 4OIIL 4PJ8A 5I75C 1QUNA 3QG6B 4HK0A 2GITB 4HZLA 3P0YL 4JRXD 1VFAB 1JNHA 3ULVE 4NT6B 5KAQG 1KJMA 4K3DH 4QHUB 4XCEA 3TN0A 2IANB 1JFMA 2YRPA 1GOHA 5FM5O 1RIHH 3B2UD 2VQUA 4XRCB 1YEHH 3RKDC 3PWJB 2B4CL 4OD2A 5GS0D 3K4AA 3QZWA 3QWRA 2QR0B 5CJOL 2YUXA 3WFDH 4GH7B 3BP4B 4Z5RB 1WFOA 3HI1A 4FNLL 1T0NA 1AHWB 3WV0A 2OMNA 3QG7H 1PLGL 3MROA 2XTJE 2BJML 3MTRA 2BFVH 3A0OA 5AAWA 2Q8AL 4XCYA 1UCTA 1HWGB 1WICA 4IHOA 4Z0XA 1G6RA 4B41A 1A6TB 3FAXA 3DROA 2K1MA 3FOMB 1ZTXL 4GQPH 2PYEB 3V7AG 5EBGA 3BESR 4OFYD 4F8TA 4QRRE 1MY5A 3U82B 3I85A 3GSUB 4MWFA 4XWGH 3SEPA 1FNHA 2WUBH 4P5KB 3IJSB 4NPYB 3JWDC 3MRQB 5D2NA 1YPZE 5EBLB 5JOFB 3HI6L 2X05A 3PWPE 1QZ1A 3B9KB 4IRSB 3SCMD 4K3GA 1QSEB 3DUSA 4EN3A 3CGTA 1WEJH 1W0VB 43CAB 2EC9T 2VLLA 3K80A 3UPRB 1F4YL 1S9YA 5IBLC 1KB5B 3TP4A 4KVCH 4YFLI 1TTUA 2UVFA 3ARGA 3AC0A 4PJAF 5F3BB 3UTSD 5EU7C 3K2MC 1QSFA 5DUBA 4ZAKA 2WUCL 5GS2H 3KS0H 3MLWL 4PJFE 3GDBA 5FGBA 5T3ZH 2BVOB 3ET9F 2A6DA 4PFEA 4X99B 4LIQL 4QXGL 3SDDC 3KLHD 4ZPTA 2C3HA 2OSLA 2IFFL 1TETL 2PYEE 3T4AB 4EVNB 3NZHH 3WDJA 1AO7A 4QRRB 1WK0A 4U7KA 2HLFD 3NCBB 3V6BR 1AD9B 2R4RH 3KPRA 3CVIH 5FUCC 4WWID 3S88L 4PP2A 5E08L 3KPOB 2WZPD 1ZHLB 3HUJF 4ODHH 1DFBH 4HS3A 3P30L 2DICA 3D69A 2B0SL 3VXRA 1AHWA 3KPLA 3FZUC 4N68A 2G5BA 2AI0L 3I50H 3T4YB 3W2DH 3MRMB 3DGGA 5ELIA 4P46C 3OKEB 1CTNA 4XBEH 3TA3A 4FZ8L 3PNWA 3S9DB 4NQSB 4RCAA 3MRRA 4X4YA 5IKCA 4HCRH 1JTPA 3CFBB 2VIRA 4MGXA 1K4DB 1VSCA 4ZPVA 2X1XR 4ZD3L 1I9JH 1SJXA 3HMXA 4WJ5A 1DEEB 1V7MH 2VB5A 2P24B 2QQNL 2HVJB 4Q7DA 3MLTA 5IMOB 1PZ5A 1DVFA 2A83A 1E0OB 3CFDB 5SWSA 3X17A 2VZUA 4DN4H 4KTEL 1HDMA 5EBMA 1B0RA 3C8KA 35C8L 1ED3B 2ZKHL 4LSSH 3ZE0F 4LLYB 3KHOA 2VISA 2I5YL 3ALXA 1ZHKA 3T0EE 1OAKH 3IFPB 4HUWB 1LP9F 1TENA 3DV6A 3LN5A 1F2XK 1FV1A 1RIHL 5J3HD 2DIJA 1MCWM 1G0YR 2F5BH 5E5UB 1XGTA 3HZMB 4QRSB 2ARJA 5EO9B 4OGYL 3MRNA 4M6NH 1FFRA 1LQVA 4XXCA 5FOJA 3D25A 4P2OA 5DQ9A 3IAQA 2NY0C 2E8YA 1S8DA 5DUPL 3ZE0E 3F7YB 1IGJA 2HFTA 1KIRA 1QFWI 3ARGD 3RIFF 3B4NA 1ACYH 1R3KA 3IDNB 5J11C 4GOSA 1DQLL 1FNAA 4PJ7B 4RMUA 3QQ9D 3D0LA 5D72L 5C3LD 1JGDB 4PJIA 1FBIH 4GXVH 1Y6KR 5F7YC 2NY5C 3MCLH 1D6EB 2NXYD 2CH8A 4YBHA 4WI3A 2EZ0D 3DVNA 2CK0L 3KNBB 5JUEH 2F5BL 2J6EL 3S4SA 3D0VB 4KKBD 3NZ8B 4RZCB 5E9DD 1JNHB 4KU1A 5GGVH 2VXSH 1DLHA 2IPUK 1BQLH 4I0PA 3MREB 4N8VA 4UT9H 4W6WB 1CBVH 4XPHH 3BHBA 4RA0C 4KV5E 3GO1H 3QQ4B 5DJXB 3CZJA 1D5ZB 2GY5A 3ARBB 3ZHDA 5JW3H 2W60B 3HC3H 2XQYG 4MQSB 4XPGH 1MFBH 4S1QL 1DQLH 1AGBB 1F4AA 1H5BB 1NCDH 5IFHH 2F9BT 2HT2D 2CKBB 4CDHA 2AJVH 1WF5A 3I9GL 3MCLL 3NFNA 4G5ZH 1FFPA 4K2UL 4QXUL 2VAJA 1XGRB 1EHLL 2D3VA 3B8YA 1A47A 1AFVH 3IJYB 3VRJA 1S7RB 1P6AB 2J8HA 4ODUA 5DVNA 2BNUB 1PVHA 4QY8A 2CLZB 2COQA 4M7JH 1NC2A 4CNIB 5LCVL 1ND0B 1BJMA 1NUFA 1KPRA 4F7CA 3RZCD 3IKKA 2Q7YA 1Q9LA 1OTSD 1VENA 5K33A 4JAMB 4XPAL 2FYYA 2J88L 4XP4H 2HVKB 2ESVD 2P4AB 2Z0BA 4MQ7B 1XF2B 2DMKA 3JSSA 4WGWB 1KLFA 2Y36L 5GGSY 2H8PB 4Z0BH 1MCIA 4MD4A 3C60C 1LQSR 3FO2B 3WO3B 3VXQB 3RTQC 4FFWD 4OM1L 4EZMA 4LIQE 3CSBA 2XA8H 1BX2A 1YMME 2JJTA 5CCKH 4X0KB 4OUOA 3DUUA 4UOW0 2JB6A 4KGLA 3RU8H 3SDAA 4YXHH 4G42A 4X80L 3ULVD 1EAPB 3DX6A 4ELMA 2ARWA 2NY7H 3RJQB 1UQSB 3SKOB 1P4BL 3D48R 3QIUD 4UOW1 4X6CE 5GRWA 2X6MA 2HTKD 3ARQA 5DJ6A 1MRDL 4PJBB 2BSRA 3QR2A 4JDZA 1HYRC 4L4TD 4Y4KD 4E9LA 3WIHA 1FZKB 5D7LD 1TVDA 3Q5YA 3CPLA 4OD1H 5CWSB 4W4NA 4BFIA 2YUVA 3VDAA 4F9LA 3L6FA 2UVEA 1R3HA 2YKLL 3Q2CA 4AQOA 2EIZB 3D2UB 4FQIL 1D5MB 2IQAB 4AMKH 1U8MA 3BPNB 1NUDA 3FAWA 4BZ2H 5AZ2L 4KDWA 4UTBL 3ARFC 5C07B 5GGTA 4FQHB 4GW1B 1UZ8A 2R0ZL 1E4XL 4I3RH 4DZBB 5IR1B 4HDIB 2AV1B 1RURH 5HYIA 3DXAA 1FNFA 5KSUA 2GJZB 1D9KB 1IEBB 4HWZB 4Q9RL 3MJ6A 4Q97A 1R5VA 2N56A 2RB8A 1H3XA 2EO1A 3SPVA 3LS4H 3UTQB 3VH8B 4JZOB 2GUOA 2VE6A 3KWWB 3DXAB 1WVZA 3MV9B 5FM8A 4GS7B 4TSAH 3RHWK 3BQUA 5I17B 3SDCC 4AL8L 4X6EA 1D5IL 2GY7B 5L2KA 4Z78A 8FABB 5IMLA 3D85B 3GMQA 4UTAH 1JWSB 1RUPL 5EB9A 3QUXA 2GTWB 1SEQL 3BD3A 1A9EB 3BE1H 3IFLL 5L2JB 3VWJC 1XGYH 1Z0MA 3JWOH 5CBAA 5KVGL 2FGWL 1JPFA 3O3AA 3RKPA 1ROWA 4LCYB 1I9IL 2PR4H 2A9MH 3BPOC 3VGFA 1FL6B 4RAUA 3NGBB 2R9HC 2ZG2A 1IAOA 4JANA 2GW5A 1FO0B 2FEEI 1GOGA 4KJWD 5A2KH 3ARZA 4WHYH 3O9WD 4NQVA 2BP3A 4PLJD 4YUEL 4Z7UA 1KEML 1AXSA 3BN9C 3W0WB 4XVSL 3C6LA 5IROA 4FG6D 3QYCA 4BELD 1PEWA 5I76A 4N8CH 1B4RA 3X12A 1INDH 1YNTB 1OWRM 1P4IL 4X4MA 4PJHE 3M17B 3V6ZA 4FQJL 1WLHA 4I5BA 2IQ9H 1B0GA 3S37H 1A3LH 1LDPH 3SHSA 5DZNA 3H2WA 3RAJL 1N6VA 1TZGL 1F6AB 4ZS7L 5LXGH 4F7PB 1T2XA 1BFSA 5H37H 1JPSH 3X14A 3ZSTA 2FZ3A 4G9DB 1X5FA 4Z76A 3MR9B 4G59A 1ZEAH 3EJYC 4XP5H 3MNVB 1VESA 2RHEA 2H1PH 4XVTL 3WXWL 1G1YA 5E99L 3JV4B 3ULUD 3CSPA 2VLKE 5HY9A 2X1WL 3IJYA 3PV6B 4R4FL 5DYOB 2OL3L 5DI8B 3TA3D 3QEQD 3MLXL 4NUGL 5L0QB 3V0VA 1MQKL 4ZAKC 3BPCB 3D18A 3N1FC 5I8EA 2DB8A 5DVLA 3U6RB 2OP4H 3FQUB 5BS0A 5J1AB 1ZOXA 2DQUH 4JFFE 1U3HA 2XKNB 3FN0L 4Z77B 1T1XB 5JPMA 4WVRA 5J9PB 4DGIL 1GSMA 5H35A 4MDIA 3VCLA 4EI6B 3NIGE 4QCIB 1Z9LA 3K2UL 3LZFH 1YEJH 2HTLD 1GRWA 1ULVA 3MREA 1KCRH 2RIKA 3CZFB 4GXUN 4RZCA 2K3TA 3U9UA 1G7JB 2A6KB 3JZ7A 4IDJL 5TE6H 5BVJB 2YOCA 2D7TH 3B43A 4YHIB 2PXYD 4ONGL 4KQ3H 5ENWB 1F8TL 4MD0A 1TXKA 3ECBA 2VDOL 5KN5B 1EHNA 3ZT5A 1KCSL 1ZWIB 3V6OA 2CRMA 4LPWA 3DGGB 4LDEB 4JJ5B 4JM2F 3KYAA 2DQUL 4JB9H 4HQQH 2HMIC 2O5XH 3EOAB 5CEXA 2RR3A 3D69B 4PRBB 4L4JA 3QDGD 2XACC 4YWGL 5FO7A 1I7RB 3MNWB 2OI9B 1F6LL 4KJYA 5FHBH 3QDME 1QSED 3DHJA 2EE3A 1JGLH 2CUMA 3QP3A 1DSFH 5IP4A 5DRWB 5EFIA 2VLRB 3HG1D 1WAAE 4MJ6B 5KVGH 2V2WA 4PB9H 1R5WA 3U79A 3IDIB 5B21A 3FO1B 4HMCA 4J3VA 3O4OB 3ZKXB 2F53B 3V8CA 3OG6B 1OLZA 1S5IL 1T0MB 1B2WL 1V3MA 4JN1L 4GRMB 2ITCB 4UNTA 3RVVD 4M7ZB 3WD5L 1FORL 4OJFH 4PJBA 4YPJA 2XQBL 3BIAX 5FK9A 4K71C 4KHXL 3L1OL 5CJXC 3WFHA 1ZVSB 4DWHA 4ZPVB 4W6YB 4QXTB 5KS9A 5TDNA 4NC2B 3B2VH 1ZV5A 3MJ7A 5T3XH 5IFJB 1DBJH 2OM5A 3MRDA 4HUNB 4UI2A 1QPPA 4JFZL 4JHWH 5E8PB 4N90D 5GZOD 1BIIA 3G5YA 4WW2B 4YX2H 2V7NB 2AXFB 1A8JH 4X5LA 4PJIF 5D7IF 2ZG3A 3CK0L 4DGVH 4IOFC 5DEGB 3FHAA 1A5FL 1R3JA 3IDXH 1JZ5A 4O2EB 1NC2B 4CNIA 3WE6B 3IFOA 1F3JA 3PGDB 4HEME 1AD9A 1IT9L 3IXTB 2P47B 1EFQA 3Q6GH 5C92A 2VQ1A 4HBCL 3SOBH 5T1DL 1UM4H 3FHQA 3MJ9H 3MLUH 3QUZA 4YDLB 1YYLH 4KQ4L 5FCUH 1WWWX 5DD1L 1MCFA 3PL6B 1BBJA 1J05B 5INCB 5F3HB 1CR9L 2XICA 4HJ0D 4BH7A 3MGOB 5TF0A 4Y1AE 4OCRH 3VFRB 2FSEB 4HJGA 4B50A 4UT7H 1E27A 2J8UF 3KPMA 4YHZH 1G9ML 3PUCA 2X44D 4MMZC 4XPTH 1FFOB 1JV5B 5EPMA 2BY3A 3GNMH 5HYJD 4DGVL 1CE1H 4I9WE 2CKBL 3UJTL 5MENE 2Q3ZA 4X6DF 4NZUH 2ADFL 4Y4FC 4E0RA 5DSCA 4FN0A 4N8VB 2YD9A 4P4KD 3VFNB 4CVZA 5J11B 5DRNA 5E00B 1K6QL 2NR6D 5AWNH 2CDGA 5J1TC 4L8BB 3P77B 4PB0L 1J1PL 5JQHC 2WWMD 1CR9H 4W81A 2YMXL 3U36B 1YY8A 4ZFGL 1YQVH 2NXZC 3RVTD 2VDML 1NBYB 1F5WA 5D1QB 2HFGH 4OGXL 1ND0A 2I9LB 4AJ0A 1MAMH 5I8CA 1CFTA 2F8VA 3V6OC 3AS2A 2VABB 1WBZA 5ISZD 1S7SB 3SDDA 3EDKA 5IESH 4QHMB 3RWDA 3FTGA 2AEQH 3CFKA 4RMVA 4Y1AA 3OGOE 4PGZA 2UZIH 2X70A 5F1NA 1BEYL 3EBAA 2ZPKL 3RA7H 1NCAL 3B9VA 4TQEH 3SDDB 1K2DA 3LAFA 2E8ZA 4WV1C 2B1AL 3T8XA 2J8UB 3QSKB 4JM2C 5DD5L 3CX2A 1H5BA 4XMLH 3U48A 4NRXB 2C9AA 2XQYK 4PJ9B 3O3EB 3UBXI 3OBAA 2IF7A 5MERA 5IHUL 3B9AA 4KJQD 3UTPE 1BFOB 5HGGS 1YEIL 5EH1A 1HDMB 4QOKB 1T1YA 5DJDB 2FIKA 4TNVK 4V2CB 1BWWA 3WIIL 4I0PC 4AEHH 3DURB 2B1HH 3V5HB 1EJ6A 3KDMA 3MLVL 4LLDA 3MBEA 5EBWA 4BUHA 1L8JA 1TPXC 2PN5A 5FV2A 3EW3B 4JLRA 5HJ3B 3OWEA 5GGVL 4S0SD 1K8DA 4NRXA 4XPHL 4XAKD 1PQZB 5KVEH 1P7KA 4LU5H 3GUTB 5I1EH 1EXUB 2XY2A 2MCPL 3UTTE 3S6CA 4Z9KB 4V2BA 1TQBB 2ZG1A 4G6JH 3QRGH 4O2CA 2HT3C 4NM8L 4JFQA 4HUKB 3R0NA 5KVFL 5CP3A 4OZ4A 1BZ7B 2X9YA 3SGJA 1S9XA 2FATH 3BOVA 1E4KA 4S0UC 2WBJA 4ZNCD 3GKWL 1RJZB 3RUGB 3UYRL 1WBZB 2IMNA 4NKMB 3QEUA 1LWRA 5HDLA 3QFJA 5GRVL 4GMSH 5C0BA 1U9KA 2E6PA 1KBGH 2PYFA 3A6OA 4NJ9L 2APFA 4U31A 1MCJA 2DMBA 1VGEL 4P5TA 2NY5H 5F8QC 3HAEB 4PPTA 1XR9A 1I1AD 4LCCB 4Y5VC 4LLYA 2DBJA 1EZVY 4FFYH 4CUCA 3BH9B 3HRZB 3EKCA 1SBBA 4LGRB 1I8LC 3QULB 5EBMB 4Q2ZB 4JY6A 1GGIL 3V7MA 1AP2A 2I9TB 4FMKA 1HEZA 4OFVA 4NKDA 5DRZB 3TT3L 2XXMB 1PG7W 5EPMB 5GRXG 1UWGH 3O6FC 3QEQA 1JWMB 3ALWA 3NCEB 1F42A 1WFTA 4GLRI 1FL3A 5D7SH 4I4WA 5IHLB 1IC4L 2Y6SD 4NBZB 3VGAC 2E3VA 4ONHB 4D2NA 4FQCH 4JM2D 1J8HE 5BS0D 4MVBD 1RV6X 3SY0B 2V17L 1KF9B 3IVKB 1AQKL 5IMKB 5GGSA 4NHCH 4LP4A 1BAFH 1S3KH 3QUML 3LMJH 2C3VA 3IDIA 1QHPA 4G80A 2YMXH 3ILPA 4H88H 1MCPH 2W0PA 2HRPH 2VLRA 4J4PD 3E6HA 4Z7VB 1U8QA 1C5DA 4PRHD 5E4IA 5DWUL 1ZLSL 2IAMB 3INUL 1IC7L 4JRYE 4XCYB 2VKWA 1AIFA 2VDLL 4OIIH 2E9JA 4OZ4B 4H1LG 2PXYA 2V9TA 3I02B 2BOBB 3GSNH 4H1LH 4G7VL 2JELH 4FTVB 2BVOA 2ADIB 4KY1L 4WW1A 4HIXL 5CKAA 3TBTB 2AERT 2N1KA 5J89A 2NR6C 2AEWA 4JJ5A 2YZ8A 1CDUA 1YPZF 4U1MB 4X7DC 3QCTL 1KN4L 1JF1B 1SYSA 4R8WL 4WCYL 3U1SL 4V3DB 1HQRB 1NSNH 1T7WA 2IGFH 4WI8A 4CMHB 3WFDL 2WINA 1FDLH 3MRBB 3LDBC 4NT6A 1O5DT 1JNJA 1QSEA 1XIWD 4N9GB 3KVQA 1MRFH 1I8IA 1LO0L 3FQNB 5DJDA 3Q5TA 2EIEA 2Q8AH 3VFPA 4Q2ZA 2XPGA 3HE6B 4MAYB 2JIXA 3TT1H 1HHGB 3RGVC 5DJYA 2DJUA 5IM7A 3SO5A 4HZAA 3FO1A 2CKNA 1LNUB 4XP9H 5I1DB 1D5BB 5L88H 1IVLA 1F2QA 3P4NA 1N4XH 4PV8A 1KOAA 1A6TA 4NKMA 4U2ZA 4XVJH 1UJTA 4MXQD 4U1HB 3C9NB 4PRPE 1B6UA 1CICC 4ZFFB 1GGCL 1NGWB 2GI7A 3G5VB 3IJHB 1WEJL 3K8KA 3C5ZA 2BNQD 4KUCF 1RHHB 3QDJA 1CLCA 2ED7A 3K1KC 5F1SA 4EJ1C 3GHEL 3MV8E 1KNOB 4JDTL 4F15B 5IB4A 4KK9C 1DN2A 2X4SA 3ZL4H 3JWDH 2NY4B 3AGVA 3MACH 4UT6H 2YPKB 3PWNA 1H8SA 2IAMD 2AEPL 4HGWA 1HSAB 4PRHB 5D2LB 3WS6C 2ZUQC 5L2KE 1WBXB 2N4IA 2YD4A 5HSFA 1YNTA 4G7YL 1JRHL 5FDWA 4Q74A 3QHZH 2W1NA 2XKUA 2OL3A 5HGDA 3VFTB 4EI6A 1FVCB 3DRTB 1AGCB 1T1XA 5JPMB 4OCMC 5MENB 3M1BA 3VMPA 3Q0HA 3HPJA 3QA3A 3OPZL 4JO3H 3T0XA 1P5UA 4P57A 3ARXA 4M62H 2X4UA 2P1YA 3ULVH 2EDNA 4YXKL 3QIWA 3U7YL 4IDLA 4ZUSB 2APTA 4GRWF 3BDBA 3WEXB 3T0EC 1PKQA 4UQ2A 2NZ9D 5IVXA 5FGBC 1I9EA 3X11B 1WZLA 3EHBC 4WI6A 2Y07L 1UCBH 4L8DB 1I3UA 4ZXBB 2P5EB 2DQHH 3HC0A 2EDJA 3CAFA 1FSKC 3WE6A 4YR6A 1MF2L 2VXTH 1FGVL 2GJJA 1AD0B 4N1HB 4AT6B 4FQ1L 1KEGL 1YY8B 2XWJA 4YZFE 2DLGA 1ZT4B 3VFOB 1GGBH 1A7NH 3G5YB 2P5ED 4L8BA 4R7DA 1I8MB 1BGXL 4LSSL 5BOZG 1TPXB 5MI0C 2F8XC 4ZFOB 4R0LA 3M8OH 1M7IA 4X7SL 4Z7VF 3J8F7 1EEZB 3QXAB 4LLVA 1CVSC 4MXQA 3O4OC 4KKAC 3SDDD 5IFJA 3FB7A 3OF6D 1IJ9A 1MWAA 5LQBH 4OFIA 4M48H 2XOTA 1T20A 1T80A 3OGCB 5F8RC 1SJEA 3SE3A 1YMMA 3OJDA 1EGJA 3I6LD 4JRYA 3UC0L 4HDIA 2FX9H 3WHE0 1HCFX 2F19H 3MLPA 2Y9RT 4RGOL 4DZBA 1F3RB 4M61A 4PLKC 1I7UA 1PZUB 3QDJD 1TCMA 3IRPX 3UTPD 3JWNC 3MRGB 5C07A 3LCYA 1CU4L 3QUKA 5CP7A 4ORZC 2Q8BL 1W0WA 1DDHB 5INDA 4JQVA 2DD8H 3ZTNL 3L9RA 2EKSA 1GC1C 1ZA3B 5K59E 2AK1H 3ULUC 1S9WA 4XP9L 2BOCB 3P0VL 4GXVL 1NGXA 3HNTH 1I8LA 1XIWC 1DQMH 2CD0A 3C08L 5H2BB 3PGDA 3DVGB 1QR1A 5F71A 5LQBL 3TA3C 4LSDA 1DBBL 5DT1H 4KRLB 3P2TA 4XBEL 4HIJB 2KKQA 1Q9OA 4S11A 3QUYA 4K9EL 5HHOE 2BNQB 4IMLB 3DRQB 4XMPH 2R1YB 5I17A 5F6IB 1KIPB 5I2IB 3PHOA 1KELH 1U8LA 2J3SA 2L7UA 1P53A 4FXKB 4NO5A 4L4TE 5FA4B 3IDMB 2YWZA 4LPUA 3FT4B 4NZDA 3H7BA 5SV4A 5T5FL 3WKNA 5ESQA 4TTDC 1NL0H 2VUOA 1I1FA 3VJ6A 3CDCA 2AJSL 3I2CL 1R3LB 4OLZL 1EHAA 4ZSOE 5FA3B 1QP1A 3BVNB 5IB1A 2LTQC 4UNVA 2CLRB 5D4QA 2HN7B 3ZL4L 3I9GH 4FXKA 4NO5B 1NFIB 3TNNB 3K0WA 3PWLB 4F3FB 1NLBL 3GSOB 1P7QA 3GBML 5DMJB 4FQHA 4GW1A 1QLEH 4EIGB 2WUBL 5A16B 2QSCH 4ZOBA 3ZKNC 3HI6H 3BGMA 1OM3H 1FJ1A 4CVWA 1MCDA 1EO8L 5DA0B 1I1AA 1R5WB 3KPNA 1N8ZB 1HHKA 3GBNH 3UTTA 4P2QD 3W5MA 4FQXA 4BSJA 5DHXB 4QRQA 3GGWB 4L9LC 4URTB 3V8OA 4WHCA 4EXPX 3UCRA 5F9AC 4KI5D 5B3JF 3T0EB 3LEXA 5GSRB 3WNNA 4J7RA 4NKOA 3BAEH 1J86A 5FHAH 5KSAD 4AZ8A 1Z3GL 1EMTH 3DGCR 3SOBL 4J1UA 4OM1H 3UBXA 3MLUL 3O2WL 4NP4L 3S37X 2FZ3B 4FTVD 4UV7L 1FCGA 2VZOA 5IGXH 2E7CA 3C6SA 1MWAB 1ZWIA 4YHOL 5ABDE 4GAJH 2F53D 3BHBB 3PL6D 4X6CB 1QKZH 3K4ZA 5DHVA 5DHYA 4KZEL 4HGWB 3IDGB 2R2EB 5C8JB 1FN4B 5C7XL 2DYPD 2DQIH 3TGXA 4N8PA 2FB4L 5SWSE 4APQC 2WWKT 5DHVB 3BXNA 4S1QH 1BVZA 4UINL 3U83A 2CR3A 4QRPA 2JKXA 3I6LE 5D9SB <