1M6ZA

Crystal structure of reduced recombinant cytochrome c4 from pseudomonas stutzeri
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
190
structure length
190
Chain Sequence
AGDAEAGQGKVAVCGACHGVDGNSPAPNFPKLAGQGERYLLKQLQDIKAGSTPGAPEGVGRKVLEMTGMLDPLSDQDLEDIAAYFSSQKGSVGYADPALAKQGEKLFRGGKLDQGMPACTGCHAPNGVGNDLAGFPKLGGQHAAYTAKQLTDFREGNRTNDGDTMIMRGVAAKLSNKDIEALSSYIQGLH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c4
publication title Structural comparison of recombinant Pseudomonas stutzeri cytochrome c4 in two oxidation states
rcsb
source organism Pseudomonas stutzeri
molecule tags Electron transport
total genus 67
structure length 190
sequence length 190
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2002-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00034 Cytochrom_C Cytochrome c
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 1m6zA02
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 1m6zA01
1CTYA 4IL6V 1HZUA 2EXVA 2OZ1A 4NFGB 3TGUD 2N3YA 4PWAA 3L74D 4DY9A 2B0ZB 1C7MA 1I8OA 4Q5PA 3CX5D 4V2KA 1J3SA 5TISV 2ORLA 4AAOA 1H33A 1HZVA 2BGVX 5CIFB 2C2CA 1HJ4A 2BH4X 3WFEC 2C1DB 1H1OA 1DVVA 1GDVA 1OCDA 2CE1A 1CXCA 1LC1A 1K3GA 2CE0A 3X39A 3ORVA 5E79V 4WQDA 4FANA 4PD4D 3L71D 3HQ9A 3HQ7A 1GJQA 2CXBA 1DW2A 1M70A 3ZOWA 1H32A 3RN0A 3M97X 1DW0A 1MZ4A 1QN2A 2PCCB 2YQBA 3A0HV 4U3FD 1U75B 1BCCD 3SLEA 1FOCA 1MG3D 1HJ5A 3RN1A 4EIEA 1F1FA 1H31A 1N50A 2QJKB 1YCCA 1DW1A 1CTJA 1BL9A 4AANA 1CHJA 1A2SA 1CTZA 451CA 5DFSA 1I55A 4FB1A 2YCCA 3WU2V 3OCDA 1GKSA 3L70D 4FAVA 4UB6V 1CCRA 1SQBD 1KB0A 1W2LA 2ZOOA 1S6VB 4WQEA 1HRCA 2I8FA 3MK7B 4LJIA 3H1ID 1LS9A 2ZZS1 4K3IA 1WEJF 1YIQA 1CRCA 1CEDA 1CYJA 2N9JA 1S5LV 3ZCFA 3VRDA 2D0WA 1CRIA 5EXQA 4GEDB 1CSVA 2BCCD 4XYDB 3KZIV 3L4OA 1KIBA 2CA4B 4XXLA 1CSUA 4H0JA 4WQ7A 1IO3A 1QYZA 2A06D 1CORA 5IY51 1CRHA 1C75A 5DJQB 1LFMA 1RZ5A 3SWSA 1N15A 1CRYA 3CWBD 4PJ0V 1AOFA 5AURA 3JBTB 1E8EA 1VYDA 1CRGA 3OA8B 3DMIA 3O5CA 1EZVD 1U74B 1CNOA 1C6RA 1A8CA 1KB9D 1FHBA 3RLMA 3O1YA 2N9IA 4WQ8A 5H2FV 1QL3A 4JCGA 1DT1A 2QJYB 2PCBB 2C8SA 1HCMA 5KLIB 2CA3B 2JQRA 5DF5A 1DIQC 3MK7C 1CO6A 3H1LD 1CIHA 2VHDA 4WQCA 5CIBB 2PACA 3ZOOA 4FA4A 5CIEB 2FYUD 1GU2A 2C1UA 2GIWA 1NIRA 1OAEA 1LMSA 1FI3A 1F1CA 4L3GA 3NWVA 1AYGA 1CHHA 1I6EA 1B7VA 1HROA 1BGYD 1FJ0A 2FWLA 1CYIA 4YE1A 4H0KA 5C0ZA 3PXTA 1C2NA 4WQ9A 4FA1A 1LC2A 4QAOA 5DJQC 2OZ1B 5CICB 3DP5A 1CIGA 4WQBA 1NU1D 1EB7A 3PXWA 2YK3A 3HQ8A 2MTAC 3HQ6A 5C9MA 4L1QA 2ZONG 1W5CT 3WFCC 4KMGA 1H33B 2C9XB 3L75D 1FI9A 1FI7A 1CC5A 4D6TD 1HJ3A 2L4DA 1R0QA 2BLFB 5CIGB 1NTZD 1QL4A 1YICA 1DW3A 2AI5A 4UB8V 1ZZHA 2C1DA 1I54A 2C1VA 4FA5A 1M6ZA 1YEBA 1H9XA 1C6SA 2B12B 3SXTA 1CIFA 3CU4A 1QKSA 3WFDC 1H32B 5KLVD 1CIEA 3TYIA 2FRCA 5B6QA 3PXSA 2B10B 1IQCA 1CRJA 5B5EV 3O20A 2JTIB 2GC7D 1PPJD 1L9BC 2BH5X 1H31B 1K3HA 1CCHA 1PP9D 1FCDC 3CXHW 1C2RA 1CSWA 5GTIV 4N0KA 1A56A 1KYOW 3OCDB 1JDLA 1CHIA 3SJLA 4MU8A 5KAIV 1YFCA 2LIRA 4L3HA 1GQ1A 1SQPD 2GC4D 4WQAA 3WUIA 1NMIA 3L4MA 1YTCA 3CX5W 1ZRTD 4EIDA 1I6DA 155CA 1AKKA 2N3BA 1I5TA 3H1JD 2V08A 1M60A 1NTMD 1NTKD 3L72D 2D0SA 1AOQA 1KV9A 1DIIC 3ZBMA 4RSZA 3CP5A 2MHMA 1IRWA 3ZOYA 1RAQA 1DVHA 1CSXA 1RZ6A 3PH2B 1BE3D 2BPBB 3VNWA 2GB8B 2DVHA 2N18B 2HV4A 4AALA 4GYDA 1L0ND 3NBSA 2BCNB 3CYTI 1SQXD 2FYNB 1ETPA 1YNRA 5KAFV 5CIHB 1E29A 3H1HD 1GIWA 3OA8A 3O0RC 3A9FA 5CYTR 3BCCD 2B11B 3L73D 4EICA 1NMLA 2AXTV 1YEAA 1CXAA 2ZXYA 2YIUB 1KX7A 2B4ZA 2XTSB 5KKZB 1SQVD 1N9CA 1MG2D 2V07A 3WFBC 3A0BV 1I8PA 1KX2A 4Y5RA 5B66V 351CA 1N90A 3DR0A 3ZIYA 1CYCA 3WC8A 1HH7A 4FA9A 1RAPA 1WVEC 2LITA 1IRVA 1L9JC 3ZOXA 2AIUA 1C52A 4PW9B 1P84D 1H9YA 5CIDB 4AX3A 1SQQD 1IZL0 3NBTA 5GTHV 2QJPB 3H1KD 3RMZA 1COTA 4O1QA 3SVWA 1L0LD 4P4QB 3CXHD 2DGEA 3VYMA 4O1WA 1NNOA 1E2RA 2N18C 2IBZD 4AAMA 2ZBOA 4EIFA 1KYOD 1C6OA 3C2CA 4J20A
chains in the Genus database with same CATH superfamily
1CTYA 4IL6V 1HZUA 2EXVA 2OZ1A 4NFGB 3TGUD 2N3YA 4PWAA 3L74D 4DY9A 2B0ZB 1C7MA 1I8OA 4Q5PA 3CX5D 4V2KA 1J3SA 5TISV 2ORLA 4AAOA 1H33A 1HZVA 2BGVX 5CIFB 2C2CA 1HJ4A 2BH4X 3WFEC 2C1DB 1H1OA 1DVVA 1GDVA 1OCDA 2CE1A 1CXCA 1LC1A 1K3GA 2CE0A 3X39A 3ORVA 5E79V 4WQDA 4FANA 4PD4D 3L71D 3HQ9A 3HQ7A 1GJQA 2CXBA 1DW2A 1M70A 3ZOWA 1H32A 3RN0A 3M97X 1DW0A 1MZ4A 1QN2A 2PCCB 2YQBA 3A0HV 4U3FD 1U75B 3D0WA 1BCCD 3SLEA 1FOCA 1MG3D 1HJ5A 3RN1A 4EIEA 1F1FA 1H31A 1N50A 2QJKB 1YCCA 1DW1A 1CTJA 1BL9A 4AANA 1CHJA 1A2SA 1CTZA 451CA 5DFSA 1I55A 4FB1A 2YCCA 3WU2V 3OCDA 1GKSA 3L70D 4FAVA 4UB6V 1CCRA 1SQBD 1KB0A 1W2LA 2ZOOA 1S6VB 4WQEA 1HRCA 2I8FA 3MK7B 4LJIA 3H1ID 1LS9A 2ZZS1 4K3IA 1WEJF 1YIQA 1CRCA 1CEDA 1CYJA 2N9JA 1S5LV 3ZCFA 3VRDA 2D0WA 1CRIA 5EXQA 4GEDB 1CSVA 2BCCD 4XYDB 3KZIV 3L4OA 1KIBA 2CA4B 4XXLA 1CSUA 4H0JA 4WQ7A 1IO3A 1QYZA 2A06D 1CORA 5IY51 1CRHA 1C75A 5DJQB 1LFMA 1RZ5A 3SWSA 1N15A 1CRYA 3CWBD 4PJ0V 1AOFA 5AURA 3JBTB 1E8EA 1VYDA 1CRGA 3OA8B 3DMIA 3O5CA 1EZVD 1U74B 1CNOA 1C6RA 1A8CA 1KB9D 1FHBA 3RLMA 3O1YA 2N9IA 4WQ8A 5H2FV 1QL3A 4JCGA 1DT1A 2QJYB 2PCBB 2C8SA 1HCMA 5KLIB 2CA3B 2JQRA 5DF5A 1DIQC 3MK7C 1CO6A 3H1LD 1CIHA 2VHDA 4WQCA 5CIBB 2PACA 3ZOOA 4FA4A 5CIEB 2FYUD 1GU2A 2C1UA 2GIWA 1NIRA 1OAEA 1LMSA 1FI3A 1F1CA 4L3GA 3NWVA 1AYGA 1CHHA 1I6EA 1B7VA 1HROA 1BGYD 1FJ0A 2FWLA 1CYIA 4YE1A 4H0KA 5C0ZA 3PXTA 1C2NA 4WQ9A 4FA1A 1LC2A 4QAOA 5DJQC 2OZ1B 5CICB 3DP5A 1CIGA 4WQBA 1NU1D 1EB7A 3PXWA 2YK3A 3HQ8A 2MTAC 3HQ6A 5C9MA 4L1QA 2ZONG 1W5CT 3WFCC 4KMGA 1H33B 2C9XB 3L75D 1FI9A 1FI7A 1CC5A 4D6TD 1HJ3A 2L4DA 1R0QA 2BLFB 5CIGB 1NTZD 1QL4A 1YICA 1DW3A 2AI5A 4UB8V 1ZZHA 2C1DA 1I54A 2C1VA 4FA5A 1M6ZA 1YEBA 1H9XA 1C6SA 2B12B 3SXTA 1CIFA 3CU4A 1QKSA 3WFDC 1H32B 5KLVD 1CIEA 3TYIA 2FRCA 5B6QA 3PXSA 2B10B 1IQCA 1CRJA 5B5EV 3O20A 2JTIB 2GC7D 1PPJD 1L9BC 2BH5X 1H31B 1K3HA 1CCHA 1PP9D 1FCDC 3CXHW 1C2RA 1CSWA 5GTIV 4N0KA 1A56A 1KYOW 3OCDB 1JDLA 1CHIA 3SJLA 4MU8A 5KAIV 1YFCA 2LIRA 4L3HA 1GQ1A 1SQPD 2GC4D 4WQAA 3WUIA 1NMIA 3L4MA 1YTCA 3CX5W 1ZRTD 4EIDA 1I6DA 155CA 1AKKA 2N3BA 1I5TA 3H1JD 2V08A 1M60A 1NTMD 1NTKD 3L72D 2D0SA 1AOQA 1KV9A 1DIIC 3ZBMA 4RSZA 3CP5A 2MHMA 1IRWA 3ZOYA 1RAQA 1DVHA 1CSXA 1RZ6A 3PH2B 1BE3D 2BPBB 3VNWA 2GB8B 2DVHA 2N18B 2HV4A 4AALA 4GYDA 1L0ND 3NBSA 2BCNB 3CYTI 1SQXD 2FYNB 1ETPA 1YNRA 5KAFV 5CIHB 1E29A 3H1HD 1GIWA 3OA8A 3O0RC 3A9FA 5CYTR 3BCCD 2B11B 3L73D 4EICA 1NMLA 2AXTV 1YEAA 1CXAA 2ZXYA 2YIUB 1KX7A 2B4ZA 2XTSB 5KKZB 1SQVD 1N9CA 1MG2D 2V07A 3WFBC 3A0BV 1I8PA 1KX2A 4Y5RA 5B66V 351CA 1N90A 3DR0A 3ZIYA 1CYCA 3WC8A 1HH7A 4FA9A 1RAPA 1WVEC 2LITA 1IRVA 1L9JC 3ZOXA 2AIUA 1C52A 4PW9B 1P84D 1H9YA 5CIDB 4AX3A 1SQQD 1IZL0 3NBTA 5GTHV 2QJPB 3H1KD 3RMZA 1COTA 4O1QA 3SVWA 1L0LD 4P4QB 3CXHD 2DGEA 3VYMA 4O1WA 1NNOA 1E2RA 2N18C 2IBZD 4AAMA 2ZBOA 4EIFA 1KYOD 1C6OA 3C2CA 4J20A
chains in the Genus database with same CATH topology
1CTYA 4IL6V 1HZUA 2EXVA 2OZ1A 4NFGB 3TGUD 2N3YA 4PWAA 3L74D 4DY9A 2B0ZB 1C7MA 1I8OA 4Q5PA 3CX5D 4V2KA 1J3SA 5TISV 2ORLA 4AAOA 1H33A 1HZVA 2BGVX 5CIFB 2C2CA 1HJ4A 2BH4X 3WFEC 2C1DB 1H1OA 1DVVA 1GDVA 1OCDA 2CE1A 1CXCA 1LC1A 1K3GA 2CE0A 3X39A 3ORVA 5E79V 4WQDA 4FANA 4PD4D 3L71D 3HQ9A 3HQ7A 1GJQA 2CXBA 1DW2A 1M70A 3ZOWA 1H32A 3RN0A 3M97X 1DW0A 1MZ4A 1QN2A 2PCCB 2YQBA 3A0HV 4U3FD 1U75B 1BCCD 3SLEA 1FOCA 1MG3D 1HJ5A 3RN1A 4EIEA 1F1FA 1H31A 1N50A 2QJKB 1YCCA 1DW1A 1CTJA 1BL9A 4AANA 1CHJA 1A2SA 1CTZA 451CA 5DFSA 1I55A 4FB1A 2YCCA 3WU2V 3OCDA 1GKSA 3L70D 4FAVA 4UB6V 1CCRA 1SQBD 1KB0A 1W2LA 2ZOOA 1S6VB 4WQEA 1HRCA 2I8FA 3MK7B 4LJIA 3H1ID 1LS9A 2ZZS1 4K3IA 1WEJF 1YIQA 1CRCA 1CEDA 1CYJA 2N9JA 1S5LV 3ZCFA 3VRDA 2D0WA 1CRIA 5EXQA 4GEDB 1CSVA 2BCCD 4XYDB 3KZIV 3L4OA 1KIBA 2CA4B 4XXLA 1CSUA 4H0JA 4WQ7A 1IO3A 1QYZA 2A06D 1CORA 5IY51 1CRHA 1C75A 5DJQB 1LFMA 1RZ5A 3SWSA 1N15A 1CRYA 3CWBD 4PJ0V 1AOFA 5AURA 3JBTB 1E8EA 1VYDA 1CRGA 3OA8B 3DMIA 3O5CA 1EZVD 1U74B 1CNOA 1C6RA 1A8CA 1KB9D 1FHBA 3RLMA 3O1YA 2N9IA 4WQ8A 5H2FV 1QL3A 4JCGA 1DT1A 2QJYB 2PCBB 2C8SA 1HCMA 5KLIB 2CA3B 2JQRA 5DF5A 1DIQC 3MK7C 1CO6A 3H1LD 1CIHA 2VHDA 4WQCA 5CIBB 2PACA 3ZOOA 4FA4A 5CIEB 2FYUD 1GU2A 2C1UA 2GIWA 1NIRA 1OAEA 1LMSA 1FI3A 1F1CA 4L3GA 3NWVA 1AYGA 1CHHA 1I6EA 1B7VA 1HROA 1BGYD 1FJ0A 2FWLA 1CYIA 4YE1A 4H0KA 5C0ZA 3PXTA 1C2NA 4WQ9A 4FA1A 1LC2A 4QAOA 5DJQC 2OZ1B 5CICB 3DP5A 1CIGA 4WQBA 1NU1D 1EB7A 3PXWA 2YK3A 3HQ8A 2MTAC 3HQ6A 5C9MA 4L1QA 2ZONG 1W5CT 3WFCC 4KMGA 1H33B 2C9XB 3L75D 1FI9A 1FI7A 1CC5A 4D6TD 1HJ3A 2L4DA 1R0QA 2BLFB 5CIGB 1NTZD 1QL4A 1YICA 1DW3A 2AI5A 4UB8V 1ZZHA 2C1DA 1I54A 2C1VA 4FA5A 1M6ZA 1YEBA 1H9XA 1C6SA 2B12B 3SXTA 1CIFA 3CU4A 1QKSA 3WFDC 1H32B 5KLVD 1CIEA 3TYIA 2FRCA 5B6QA 3PXSA 2B10B 1IQCA 1CRJA 5B5EV 3O20A 2JTIB 2GC7D 1PPJD 1L9BC 2BH5X 1H31B 1K3HA 1CCHA 1PP9D 1FCDC 3CXHW 1C2RA 1CSWA 5GTIV 4N0KA 1A56A 1KYOW 3OCDB 1JDLA 1CHIA 3SJLA 4MU8A 5KAIV 1YFCA 2LIRA 4L3HA 1GQ1A 1SQPD 2GC4D 4WQAA 3WUIA 1NMIA 3L4MA 1YTCA 3CX5W 1ZRTD 4EIDA 1I6DA 155CA 1AKKA 2N3BA 1I5TA 3H1JD 2V08A 1M60A 1NTMD 1NTKD 3L72D 2D0SA 1AOQA 1KV9A 1DIIC 3ZBMA 4RSZA 3CP5A 2MHMA 1IRWA 3ZOYA 1RAQA 1DVHA 1CSXA 1RZ6A 3PH2B 1BE3D 2BPBB 3VNWA 2GB8B 2DVHA 2N18B 2HV4A 4AALA 4GYDA 1L0ND 3NBSA 2BCNB 3CYTI 1SQXD 2FYNB 1ETPA 1YNRA 5KAFV 5CIHB 1E29A 3H1HD 1GIWA 3OA8A 3O0RC 3A9FA 5CYTR 3BCCD 2B11B 3L73D 4EICA 1NMLA 2AXTV 1YEAA 1CXAA 2ZXYA 2YIUB 1KX7A 2B4ZA 2XTSB 5KKZB 1SQVD 1N9CA 1MG2D 2V07A 3WFBC 3A0BV 1I8PA 1KX2A 4Y5RA 5B66V 351CA 1N90A 3DR0A 3ZIYA 1CYCA 3WC8A 1HH7A 4FA9A 1RAPA 1WVEC 2LITA 1IRVA 1L9JC 3ZOXA 2AIUA 1C52A 4PW9B 1P84D 1H9YA 5CIDB 4AX3A 1SQQD 1IZL0 3NBTA 5GTHV 2QJPB 3H1KD 3RMZA 1COTA 4O1QA 3SVWA 1L0LD 4P4QB 3CXHD 2DGEA 3VYMA 4O1WA 1NNOA 1E2RA 2N18C 2IBZD 4AAMA 2ZBOA 4EIFA 1KYOD 1C6OA 3C2CA 4J20A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CTY A;  4IL6 V;  1HZU A;  2EXV A;  2OZ1 A;  4NFG B;  3TGU D;  2N3Y A;  4PWA A;  3L74 D;  4DY9 A;  2B0Z B;  1C7M A;  1I8O A;  4Q5P A;  3CX5 D;  4V2K A;  1J3S A;  5TIS V;  2ORL A;  4AAO A;  1H33 A;  1HZV A;  2BGV X;  5CIF B;  2C2C A;  1HJ4 A;  2BH4 X;  3WFE C;  2C1D B;  1H1O A;  1DVV A;  1GDV A;  1OCD A;  2CE1 A;  1CXC A;  1LC1 A;  1K3G A;  2CE0 A;  3X39 A;  3ORV A;  5E79 V;  4WQD A;  4FAN A;  4PD4 D;  3L71 D;  3HQ9 A;  3HQ7 A;  1GJQ A;  2CXB A;  1DW2 A;  1M70 A;  3ZOW A;  1H32 A;  3RN0 A;  3M97 X;  1DW0 A;  1MZ4 A;  1QN2 A;  2PCC B;  2YQB A;  3A0H V;  4U3F D;  1U75 B;  1BCC D;  3SLE A;  1FOC A;  1MG3 D;  1HJ5 A;  3RN1 A;  4EIE A;  1F1F A;  1H31 A;  1N50 A;  2QJK B;  1YCC A;  1DW1 A;  1CTJ A;  1BL9 A;  4AAN A;  1CHJ A;  1A2S A;  1CTZ A;  451C A;  5DFS A;  1I55 A;  4FB1 A;  2YCC A;  3WU2 V;  3OCD A;  1GKS A;  3L70 D;  4FAV A;  4UB6 V;  1CCR A;  1SQB D;  1KB0 A;  1W2L A;  2ZOO A;  1S6V B;  4WQE A;  1HRC A;  2I8F A;  3MK7 B;  4LJI A;  3H1I D;  1LS9 A;  2ZZS 1;  4K3I A;  1WEJ F;  1YIQ A;  1CRC A;  1CED A;  1CYJ A;  2N9J A;  1S5L V;  3ZCF A;  3VRD A;  2D0W A;  1CRI A;  5EXQ A;  4GED B;  1CSV A;  2BCC D;  4XYD B;  3KZI V;  3L4O A;  1KIB A;  2CA4 B;  4XXL A;  1CSU A;  4H0J A;  4WQ7 A;  1IO3 A;  1QYZ A;  2A06 D;  1COR A;  5IY5 1;  1CRH A;  1C75 A;  5DJQ B;  1LFM A;  1RZ5 A;  3SWS A;  1N15 A;  1CRY A;  3CWB D;  4PJ0 V;  1AOF A;  5AUR A;  3JBT B;  1E8E A;  1VYD A;  1CRG A;  3OA8 B;  3DMI A;  3O5C A;  1EZV D;  1U74 B;  1CNO A;  1C6R A;  1A8C A;  1KB9 D;  1FHB A;  3RLM A;  3O1Y A;  2N9I A;  4WQ8 A;  5H2F V;  1QL3 A;  4JCG A;  1DT1 A;  2QJY B;  2PCB B;  2C8S A;  1HCM A;  5KLI B;  2CA3 B;  2JQR A;  5DF5 A;  1DIQ C;  3MK7 C;  1CO6 A;  3H1L D;  1CIH A;  2VHD A;  4WQC A;  5CIB B;  2PAC A;  3ZOO A;  4FA4 A;  5CIE B;  2FYU D;  1GU2 A;  2C1U A;  2GIW A;  1NIR A;  1OAE A;  1LMS A;  1FI3 A;  1F1C A;  4L3G A;  3NWV A;  1AYG A;  1CHH A;  1I6E A;  1B7V A;  1HRO A;  1BGY D;  1FJ0 A;  2FWL A;  1CYI A;  4YE1 A;  4H0K A;  5C0Z A;  3PXT A;  1C2N A;  4WQ9 A;  4FA1 A;  1LC2 A;  4QAO A;  5DJQ C;  2OZ1 B;  5CIC B;  3DP5 A;  1CIG A;  4WQB A;  1NU1 D;  1EB7 A;  3PXW A;  2YK3 A;  3HQ8 A;  2MTA C;  3HQ6 A;  5C9M A;  4L1Q A;  2ZON G;  1W5C T;  3WFC C;  4KMG A;  1H33 B;  2C9X B;  3L75 D;  1FI9 A;  1FI7 A;  1CC5 A;  4D6T D;  1HJ3 A;  2L4D A;  1R0Q A;  2BLF B;  5CIG B;  1NTZ D;  1QL4 A;  1YIC A;  1DW3 A;  2AI5 A;  4UB8 V;  1ZZH A;  2C1D A;  1I54 A;  2C1V A;  4FA5 A;  1M6Z A;  1YEB A;  1H9X A;  1C6S A;  2B12 B;  3SXT A;  1CIF A;  3CU4 A;  1QKS A;  3WFD C;  1H32 B;  5KLV D;  1CIE A;  3TYI A;  2FRC A;  5B6Q A;  3PXS A;  2B10 B;  1IQC A;  1CRJ A;  5B5E V;  3O20 A;  2JTI B;  2GC7 D;  1PPJ D;  1L9B C;  2BH5 X;  1H31 B;  1K3H A;  1CCH A;  1PP9 D;  1FCD C;  3CXH W;  1C2R A;  1CSW A;  5GTI V;  4N0K A;  1A56 A;  1KYO W;  3OCD B;  1JDL A;  1CHI A;  3SJL A;  4MU8 A;  5KAI V;  1YFC A;  2LIR A;  4L3H A;  1GQ1 A;  1SQP D;  2GC4 D;  4WQA A;  3WUI A;  1NMI A;  3L4M A;  1YTC A;  3CX5 W;  1ZRT D;  4EID A;  1I6D A;  155C A;  1AKK A;  2N3B A;  1I5T A;  3H1J D;  2V08 A;  1M60 A;  1NTM D;  1NTK D;  3L72 D;  2D0S A;  1AOQ A;  1KV9 A;  1DII C;  3ZBM A;  4RSZ A;  3CP5 A;  2MHM A;  1IRW A;  3ZOY A;  1RAQ A;  1DVH A;  1CSX A;  1RZ6 A;  3PH2 B;  1BE3 D;  2BPB B;  3VNW A;  2GB8 B;  2DVH A;  2N18 B;  2HV4 A;  4AAL A;  4GYD A;  1L0N D;  3NBS A;  2BCN B;  3CYT I;  1SQX D;  2FYN B;  1ETP A;  1YNR A;  5KAF V;  5CIH B;  1E29 A;  3H1H D;  1GIW A;  3OA8 A;  3O0R C;  3A9F A;  5CYT R;  3BCC D;  2B11 B;  3L73 D;  4EIC A;  1NML A;  2AXT V;  1YEA A;  1CXA A;  2ZXY A;  2YIU B;  1KX7 A;  2B4Z A;  2XTS B;  5KKZ B;  1SQV D;  1N9C A;  1MG2 D;  2V07 A;  3WFB C;  3A0B V;  1I8P A;  1KX2 A;  4Y5R A;  5B66 V;  351C A;  1N90 A;  3DR0 A;  3ZIY A;  1CYC A;  3WC8 A;  1HH7 A;  4FA9 A;  1RAP A;  1WVE C;  2LIT A;  1IRV A;  1L9J C;  3ZOX A;  2AIU A;  1C52 A;  4PW9 B;  1P84 D;  1H9Y A;  5CID B;  4AX3 A;  1SQQ D;  1IZL 0;  3NBT A;  5GTH V;  2QJP B;  3H1K D;  3RMZ A;  1COT A;  4O1Q A;  3SVW A;  1L0L D;  4P4Q B;  3CXH D;  2DGE A;  3VYM A;  4O1W A;  1NNO A;  1E2R A;  2N18 C;  2IBZ D;  4AAM A;  2ZBO A;  4EIF A;  1KYO D;  1C6O A;  3C2C A;  4J20 A; 
#chains in the Genus database with same CATH topology
 1CTY A;  4IL6 V;  1HZU A;  2EXV A;  2OZ1 A;  4NFG B;  3TGU D;  2N3Y A;  4PWA A;  3L74 D;  4DY9 A;  2B0Z B;  1C7M A;  1I8O A;  4Q5P A;  3CX5 D;  4V2K A;  1J3S A;  5TIS V;  2ORL A;  4AAO A;  1H33 A;  1HZV A;  2BGV X;  5CIF B;  2C2C A;  1HJ4 A;  2BH4 X;  3WFE C;  2C1D B;  1H1O A;  1DVV A;  1GDV A;  1OCD A;  2CE1 A;  1CXC A;  1LC1 A;  1K3G A;  2CE0 A;  3X39 A;  3ORV A;  5E79 V;  4WQD A;  4FAN A;  4PD4 D;  3L71 D;  3HQ9 A;  3HQ7 A;  1GJQ A;  2CXB A;  1DW2 A;  1M70 A;  3ZOW A;  1H32 A;  3RN0 A;  3M97 X;  1DW0 A;  1MZ4 A;  1QN2 A;  2PCC B;  2YQB A;  3A0H V;  4U3F D;  1U75 B;  3D0W A;  1BCC D;  3SLE A;  1FOC A;  1MG3 D;  1HJ5 A;  3RN1 A;  4EIE A;  1F1F A;  1H31 A;  1N50 A;  2QJK B;  1YCC A;  1DW1 A;  1CTJ A;  1BL9 A;  4AAN A;  1CHJ A;  1A2S A;  1CTZ A;  451C A;  5DFS A;  1I55 A;  4FB1 A;  2YCC A;  3WU2 V;  3OCD A;  1GKS A;  3L70 D;  4FAV A;  4UB6 V;  1CCR A;  1SQB D;  1KB0 A;  1W2L A;  2ZOO A;  1S6V B;  4WQE A;  1HRC A;  2I8F A;  3MK7 B;  4LJI A;  3H1I D;  1LS9 A;  2ZZS 1;  4K3I A;  1WEJ F;  1YIQ A;  1CRC A;  1CED A;  1CYJ A;  2N9J A;  1S5L V;  3ZCF A;  3VRD A;  2D0W A;  1CRI A;  5EXQ A;  4GED B;  1CSV A;  2BCC D;  4XYD B;  3KZI V;  3L4O A;  1KIB A;  2CA4 B;  4XXL A;  1CSU A;  4H0J A;  4WQ7 A;  1IO3 A;  1QYZ A;  2A06 D;  1COR A;  5IY5 1;  1CRH A;  1C75 A;  5DJQ B;  1LFM A;  1RZ5 A;  3SWS A;  1N15 A;  1CRY A;  3CWB D;  4PJ0 V;  1AOF A;  5AUR A;  3JBT B;  1E8E A;  1VYD A;  1CRG A;  3OA8 B;  3DMI A;  3O5C A;  1EZV D;  1U74 B;  1CNO A;  1C6R A;  1A8C A;  1KB9 D;  1FHB A;  3RLM A;  3O1Y A;  2N9I A;  4WQ8 A;  5H2F V;  1QL3 A;  4JCG A;  1DT1 A;  2QJY B;  2PCB B;  2C8S A;  1HCM A;  5KLI B;  2CA3 B;  2JQR A;  5DF5 A;  1DIQ C;  3MK7 C;  1CO6 A;  3H1L D;  1CIH A;  2VHD A;  4WQC A;  5CIB B;  2PAC A;  3ZOO A;  4FA4 A;  5CIE B;  2FYU D;  1GU2 A;  2C1U A;  2GIW A;  1NIR A;  1OAE A;  1LMS A;  1FI3 A;  1F1C A;  4L3G A;  3NWV A;  1AYG A;  1CHH A;  1I6E A;  1B7V A;  1HRO A;  1BGY D;  1FJ0 A;  2FWL A;  1CYI A;  4YE1 A;  4H0K A;  5C0Z A;  3PXT A;  1C2N A;  4WQ9 A;  4FA1 A;  1LC2 A;  4QAO A;  5DJQ C;  2OZ1 B;  5CIC B;  3DP5 A;  1CIG A;  4WQB A;  1NU1 D;  1EB7 A;  3PXW A;  2YK3 A;  3HQ8 A;  2MTA C;  3HQ6 A;  5C9M A;  4L1Q A;  2ZON G;  1W5C T;  3WFC C;  4KMG A;  1H33 B;  2C9X B;  3L75 D;  1FI9 A;  1FI7 A;  1CC5 A;  4D6T D;  1HJ3 A;  2L4D A;  1R0Q A;  2BLF B;  5CIG B;  1NTZ D;  1QL4 A;  1YIC A;  1DW3 A;  2AI5 A;  4UB8 V;  1ZZH A;  2C1D A;  1I54 A;  2C1V A;  4FA5 A;  1M6Z A;  1YEB A;  1H9X A;  1C6S A;  2B12 B;  3SXT A;  1CIF A;  3CU4 A;  1QKS A;  3WFD C;  1H32 B;  5KLV D;  1CIE A;  3TYI A;  2FRC A;  5B6Q A;  3PXS A;  2B10 B;  1IQC A;  1CRJ A;  5B5E V;  3O20 A;  2JTI B;  2GC7 D;  1PPJ D;  1L9B C;  2BH5 X;  1H31 B;  1K3H A;  1CCH A;  1PP9 D;  1FCD C;  3CXH W;  1C2R A;  1CSW A;  5GTI V;  4N0K A;  1A56 A;  1KYO W;  3OCD B;  1JDL A;  1CHI A;  3SJL A;  4MU8 A;  5KAI V;  1YFC A;  2LIR A;  4L3H A;  1GQ1 A;  1SQP D;  2GC4 D;  4WQA A;  3WUI A;  1NMI A;  3L4M A;  1YTC A;  3CX5 W;  1ZRT D;  4EID A;  1I6D A;  155C A;  1AKK A;  2N3B A;  1I5T A;  3H1J D;  2V08 A;  1M60 A;  1NTM D;  1NTK D;  3L72 D;  2D0S A;  1AOQ A;  1KV9 A;  1DII C;  3ZBM A;  4RSZ A;  3CP5 A;  2MHM A;  1IRW A;  3ZOY A;  1RAQ A;  1DVH A;  1CSX A;  1RZ6 A;  3PH2 B;  1BE3 D;  2BPB B;  3VNW A;  2GB8 B;  2DVH A;  2N18 B;  2HV4 A;  4AAL A;  4GYD A;  1L0N D;  3NBS A;  2BCN B;  3CYT I;  1SQX D;  2FYN B;  1ETP A;  1YNR A;  5KAF V;  5CIH B;  1E29 A;  3H1H D;  1GIW A;  3OA8 A;  3O0R C;  3A9F A;  5CYT R;  3BCC D;  2B11 B;  3L73 D;  4EIC A;  1NML A;  2AXT V;  1YEA A;  1CXA A;  2ZXY A;  2YIU B;  1KX7 A;  2B4Z A;  2XTS B;  5KKZ B;  1SQV D;  1N9C A;  1MG2 D;  2V07 A;  3WFB C;  3A0B V;  1I8P A;  1KX2 A;  4Y5R A;  5B66 V;  351C A;  1N90 A;  3DR0 A;  3ZIY A;  1CYC A;  3WC8 A;  1HH7 A;  4FA9 A;  1RAP A;  1WVE C;  2LIT A;  1IRV A;  1L9J C;  3ZOX A;  2AIU A;  1C52 A;  4PW9 B;  1P84 D;  1H9Y A;  5CID B;  4AX3 A;  1SQQ D;  1IZL 0;  3NBT A;  5GTH V;  2QJP B;  3H1K D;  3RMZ A;  1COT A;  4O1Q A;  3SVW A;  1L0L D;  4P4Q B;  3CXH D;  2DGE A;  3VYM A;  4O1W A;  1NNO A;  1E2R A;  2N18 C;  2IBZ D;  4AAM A;  2ZBO A;  4EIF A;  1KYO D;  1C6O A;  3C2C A;  4J20 A; 
#chains in the Genus database with same CATH homology
 1CTY A;  4IL6 V;  1HZU A;  2EXV A;  2OZ1 A;  4NFG B;  3TGU D;  2N3Y A;  4PWA A;  3L74 D;  4DY9 A;  2B0Z B;  1C7M A;  1I8O A;  4Q5P A;  3CX5 D;  4V2K A;  1J3S A;  5TIS V;  2ORL A;  4AAO A;  1H33 A;  1HZV A;  2BGV X;  5CIF B;  2C2C A;  1HJ4 A;  2BH4 X;  3WFE C;  2C1D B;  1H1O A;  1DVV A;  1GDV A;  1OCD A;  2CE1 A;  1CXC A;  1LC1 A;  1K3G A;  2CE0 A;  3X39 A;  3ORV A;  5E79 V;  4WQD A;  4FAN A;  4PD4 D;  3L71 D;  3HQ9 A;  3HQ7 A;  1GJQ A;  2CXB A;  1DW2 A;  1M70 A;  3ZOW A;  1H32 A;  3RN0 A;  3M97 X;  1DW0 A;  1MZ4 A;  1QN2 A;  2PCC B;  2YQB A;  3A0H V;  4U3F D;  1U75 B;  1BCC D;  3SLE A;  1FOC A;  1MG3 D;  1HJ5 A;  3RN1 A;  4EIE A;  1F1F A;  1H31 A;  1N50 A;  2QJK B;  1YCC A;  1DW1 A;  1CTJ A;  1BL9 A;  4AAN A;  1CHJ A;  1A2S A;  1CTZ A;  451C A;  5DFS A;  1I55 A;  4FB1 A;  2YCC A;  3WU2 V;  3OCD A;  1GKS A;  3L70 D;  4FAV A;  4UB6 V;  1CCR A;  1SQB D;  1KB0 A;  1W2L A;  2ZOO A;  1S6V B;  4WQE A;  1HRC A;  2I8F A;  3MK7 B;  4LJI A;  3H1I D;  1LS9 A;  2ZZS 1;  4K3I A;  1WEJ F;  1YIQ A;  1CRC A;  1CED A;  1CYJ A;  2N9J A;  1S5L V;  3ZCF A;  3VRD A;  2D0W A;  1CRI A;  5EXQ A;  4GED B;  1CSV A;  2BCC D;  4XYD B;  3KZI V;  3L4O A;  1KIB A;  2CA4 B;  4XXL A;  1CSU A;  4H0J A;  4WQ7 A;  1IO3 A;  1QYZ A;  2A06 D;  1COR A;  5IY5 1;  1CRH A;  1C75 A;  5DJQ B;  1LFM A;  1RZ5 A;  3SWS A;  1N15 A;  1CRY A;  3CWB D;  4PJ0 V;  1AOF A;  5AUR A;  3JBT B;  1E8E A;  1VYD A;  1CRG A;  3OA8 B;  3DMI A;  3O5C A;  1EZV D;  1U74 B;  1CNO A;  1C6R A;  1A8C A;  1KB9 D;  1FHB A;  3RLM A;  3O1Y A;  2N9I A;  4WQ8 A;  5H2F V;  1QL3 A;  4JCG A;  1DT1 A;  2QJY B;  2PCB B;  2C8S A;  1HCM A;  5KLI B;  2CA3 B;  2JQR A;  5DF5 A;  1DIQ C;  3MK7 C;  1CO6 A;  3H1L D;  1CIH A;  2VHD A;  4WQC A;  5CIB B;  2PAC A;  3ZOO A;  4FA4 A;  5CIE B;  2FYU D;  1GU2 A;  2C1U A;  2GIW A;  1NIR A;  1OAE A;  1LMS A;  1FI3 A;  1F1C A;  4L3G A;  3NWV A;  1AYG A;  1CHH A;  1I6E A;  1B7V A;  1HRO A;  1BGY D;  1FJ0 A;  2FWL A;  1CYI A;  4YE1 A;  4H0K A;  5C0Z A;  3PXT A;  1C2N A;  4WQ9 A;  4FA1 A;  1LC2 A;  4QAO A;  5DJQ C;  2OZ1 B;  5CIC B;  3DP5 A;  1CIG A;  4WQB A;  1NU1 D;  1EB7 A;  3PXW A;  2YK3 A;  3HQ8 A;  2MTA C;  3HQ6 A;  5C9M A;  4L1Q A;  2ZON G;  1W5C T;  3WFC C;  4KMG A;  1H33 B;  2C9X B;  3L75 D;  1FI9 A;  1FI7 A;  1CC5 A;  4D6T D;  1HJ3 A;  2L4D A;  1R0Q A;  2BLF B;  5CIG B;  1NTZ D;  1QL4 A;  1YIC A;  1DW3 A;  2AI5 A;  4UB8 V;  1ZZH A;  2C1D A;  1I54 A;  2C1V A;  4FA5 A;  1M6Z A;  1YEB A;  1H9X A;  1C6S A;  2B12 B;  3SXT A;  1CIF A;  3CU4 A;  1QKS A;  3WFD C;  1H32 B;  5KLV D;  1CIE A;  3TYI A;  2FRC A;  5B6Q A;  3PXS A;  2B10 B;  1IQC A;  1CRJ A;  5B5E V;  3O20 A;  2JTI B;  2GC7 D;  1PPJ D;  1L9B C;  2BH5 X;  1H31 B;  1K3H A;  1CCH A;  1PP9 D;  1FCD C;  3CXH W;  1C2R A;  1CSW A;  5GTI V;  4N0K A;  1A56 A;  1KYO W;  3OCD B;  1JDL A;  1CHI A;  3SJL A;  4MU8 A;  5KAI V;  1YFC A;  2LIR A;  4L3H A;  1GQ1 A;  1SQP D;  2GC4 D;  4WQA A;  3WUI A;  1NMI A;  3L4M A;  1YTC A;  3CX5 W;  1ZRT D;  4EID A;  1I6D A;  155C A;  1AKK A;  2N3B A;  1I5T A;  3H1J D;  2V08 A;  1M60 A;  1NTM D;  1NTK D;  3L72 D;  2D0S A;  1AOQ A;  1KV9 A;  1DII C;  3ZBM A;  4RSZ A;  3CP5 A;  2MHM A;  1IRW A;  3ZOY A;  1RAQ A;  1DVH A;  1CSX A;  1RZ6 A;  3PH2 B;  1BE3 D;  2BPB B;  3VNW A;  2GB8 B;  2DVH A;  2N18 B;  2HV4 A;  4AAL A;  4GYD A;  1L0N D;  3NBS A;  2BCN B;  3CYT I;  1SQX D;  2FYN B;  1ETP A;  1YNR A;  5KAF V;  5CIH B;  1E29 A;  3H1H D;  1GIW A;  3OA8 A;  3O0R C;  3A9F A;  5CYT R;  3BCC D;  2B11 B;  3L73 D;  4EIC A;  1NML A;  2AXT V;  1YEA A;  1CXA A;  2ZXY A;  2YIU B;  1KX7 A;  2B4Z A;  2XTS B;  5KKZ B;  1SQV D;  1N9C A;  1MG2 D;  2V07 A;  3WFB C;  3A0B V;  1I8P A;  1KX2 A;  4Y5R A;  5B66 V;  351C A;  1N90 A;  3DR0 A;  3ZIY A;  1CYC A;  3WC8 A;  1HH7 A;  4FA9 A;  1RAP A;  1WVE C;  2LIT A;  1IRV A;  1L9J C;  3ZOX A;  2AIU A;  1C52 A;  4PW9 B;  1P84 D;  1H9Y A;  5CID B;  4AX3 A;  1SQQ D;  1IZL 0;  3NBT A;  5GTH V;  2QJP B;  3H1K D;  3RMZ A;  1COT A;  4O1Q A;  3SVW A;  1L0L D;  4P4Q B;  3CXH D;  2DGE A;  3VYM A;  4O1W A;  1NNO A;  1E2R A;  2N18 C;  2IBZ D;  4AAM A;  2ZBO A;  4EIF A;  1KYO D;  1C6O A;  3C2C A;  4J20 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...