1M71A

Crystal structure of a monoclonal fab specific for shigella flexneri y lipopolysaccharide
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
215
structure length
215
Chain Sequence
b'DVVLTQTPLSLPVRLGDQASISCRSSQSLLHSDGNTYLHWYLQKPGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYFCSQTTHVPTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords light chain of the monoclonal antibody Fab SYA/J6
publication title Molecular Recognition of Oligosaccharide Epitopes by a Monoclonal Fab Specific for Shigella flexneri Y Lipopolysaccharide: X-ray Structures and Thermodyanamics
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 44
structure length 215
sequence length 215
ec nomenclature
pdb deposition date 2002-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1m71A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1m71A01
1A1MB 2NY2B 4HC1H 4UV4H 3EOBA 4YUEL 2IQ9L 2AJYH 1OAUH 1MCWW 2AXGB 2B4CC 3O4LA 2ED7A 3WNMA 5LAXB 3SY0A 2DAVA 3BZEB 3NZ8A 4HKJB 2EDFA 3ZE1F 4NO5A 4I18C 4EI6A 4RMWA 5JHDE 2P5WD 5DA4A 4Y5VA 5E8OB 4TUKL 5I1LA 3GMQB 3GSOA 3O81A 4ODHH 4RFNB 4M93C 5HHNA 1PDKA 2XYCA 4TQEH 1EMTH 4WU7B 2ZUSA 3WXWH 5HI4C 4BSVB 5F3BB 4ZXBD 3ULVD 2KBGA 1YY9C 3CVIH 3UTSE 1BFSA 2MKLC 3KXFE 2X4QB 1F45A 4MDIA 1BQHB 2FCBA 1JGLL 1MIEL 5FDWB 3PQYE 4OM1L 1RHHA 4YIQB 5E8PA 4XC1H 4KRNA 3SCMD 3HE6B 2VOTA 2H32A 1IM9D 2AQ3A 4JQVA 4LCCA 4LLAA 3NN8A 3QDJE 5E2UL 3RAJH 5JXEA 2AW2A 4WY7L 4CNIA 1P4BL 2BHUA 1G6RL 3RVTC 1KB9K 1XGRB 2HJLA 1DVFD 2AEQH 4IIQB 4M62L 1EEZB 3LIZL 3VE0B 2ITDB 5SV4A 1SY6H 2R9HC 3CFEA 1FCCA 3OXSA 5TFSH 1L9MA 1UCBL 4QCIA 3QUZC 5DVOA 1T21B 5GGTA 4R2GC 4CU8A 5FYKH 5GGQL 3K3QA 4L5FL 2X4OA 3ZKSD 2WINB 2J8UB 1VADA 1GC1H 5IEKA 1JGUH 2QR0B 3T1FA 1N6VA 1CFTA 4YDJB 5HGBA 2AJXH 3RTQB 1CFBA 4RAVA 3N06B 1I4FA 5FFLA 2GJ6D 2I60H 5SWSD 4OFDA 1K4CB 4HLZG 2BZDA 5E8DL 4Z7VB 3KJ6H 5TF0A 3P4OA 3ZKXC 5GS1C 4LVOC 2X9YA 3P77A 1AKJB 3ABZA 1BQLL 1OP3H 2YA0A 4FQCL 1EUTA 4JM4H 1NLDL 3RUGA 3CK0L 3I2CH 3RWCB 4DKFH 4F8TA 4NQSA 1S7VB 3QIWA 1MRDL 1QACA 4P59H 4YHMH 1HINH 3FFDB 1UH3A 4A6YH 5F7WC 1ULVA 4K8RD 5LQBH 4OUUA 4JZOA 2L4OA 1R0AL 2R1XB 3P0GB 2Y6SD 4PRBA 3VXRD 5IV2A 1NL0H 1GH7A 5I1HL 1F6AA 4JJ5A 1KJ2A 3D69A 5DHVA 1FO0L 2HAZA 1UJ3A 2A0LD 5IMOB 2FX9H 1S7QB 4RGNC 4IRJA 4R26H 3UP1A 5EO0A 1AGFB 3IDNA 3V4VH 2FEDC 4Y16C 4LKXA 3P4NB 1P4IL 4RA3A 1BHGA 1FPTH 3MLRH 3DETD 4XPGH 1XF5A 2VITA 3UTPD 2MCG1 5T1KD 4HJJL 5IFJA 1JZ6A 1NGXB 1NC2A 2JJTA 3L3GA 1LILA 1A6TA 2ZUYA 1QFOA 3DRTB 1P4LB 5C0AA 5ADPL 1RK0B 4FHBD 4NN7C 3B5HA 5C0CA 1VENA 1V3LA 4H5SB 3OTTA 4IRZH 4WV1A 1GGYA 2OI9C 3IDJA 1BFVL 2XN9A 1XMWA 4I13B 3ILPB 4KXZI 5L2KA 1XCTB 4IOSD 5HY9B 1WUNT 4OBSA 3TLRA 3MROB 3HHRB 3S5LA 2HJFA 1NDMA 1CLOH 1AC0A 2VXTL 2YOCA 3QP3A 5IQ9A 4L4VB 3CH1B 1EHNA 3HR6A 2J8UE 4NCDA 1I8LA 1AGBA 3TT1L 3FO0H 3BGMA 4NUJB 3P4MB 1PD6A 1YJDC 2YEZB 2P8LB 5CEZD 3JTSA 5T3ZH 4XX1E 2IG2H 3LKSA 4Z7VE 2E6JA 3BPNC 1MCFA 4HQQL 4P5MA 2EXYD 3FRPA 4MNGA 5JIKA 1NDGA 2AERT 2OMBA 3F12B 1CK0H 3O2DH 4KMTH 4XGZB 2EO9A 5D1QA 1EJ6A 1BJ1J 5FHAH 3QI9D 4GRWB 4LLUB 2OJZL 3O9WC 1SJHA 1D7FA 4KKLC 3ET9F 5KS9F 4PYGA 5C9JB 4GMTL 4YBQC 5D2LF 3QCUH 4RQQA 1JWMB 4RZCB 2PYFA 3HC0A 1YN6B 1X6LA 4LHUA 3QHZH 1PG7L 1G7JB 4JQXC 4PJ7B 1FZOB 1S78D 4PJDB 1EGJA 4UTAL 4NKMB 4PJFB 1I1FB 4PTTB 4XVJH 4OBRA 1CD1A 4UIMA 1I3UA 4M7KH 4XHQA 1U92A 5KSBB 2D7MA 1PZ5A 4EI5C 4OI8A 1T83A 3P3YA 4U1GC 1K8DB 3UJJL 5KVEL 3HAEA 2G60H 4C55A 3BT2L 5FXCH 4NDMA 2GJJA 1EDQA 4JZJA 2WQRA 2ICWJ 3QEQB 3VGAB 1MEXH 3MTRA 1ZT7B 1MCLA 4AT6A 4JDTL 2VAJA 4YHIB 3KXFA 4LKCA 2E27H 3HRZA 4GXUM 4M00A 3VFUA 2OP4L 4JHAL 4NRYA 3X12B 4UMGA 4WNQA 5IB3A 4Y88A 3FCTB 4NGHL 1TVHB 2B4CH 2FJGB 2AEIT 1BM3L 3Q6GH 2FX8H 2HT3C 1IKFL 1MFBL 1H3VA 1E4KA 4L4VE 4OZIB 1MELA 1F11A 4HKXB 4WI5A 4HIXH 2HT2D 4X6CB 5CMAA 1WIPA 2RBLA 2X4PB 4OZFG 1SJEB 2VDML 3E6HA 4UIKL 2APFA 3DSFL 4ZOBA 4RMRA 3TH4T 2C3VB 4J12A 2B0SH 5FO9A 1CFSA 1IZKA 3QUXD 5DMIH 3TIEB 3SDCA 1MJ8H 3M17B 4M7ZB 1A6AB 3OAUL 1Z0MA 4GW5A 5MI0B 4WWKC 3VWJD 3FONA 3WHE0 5JPNB 2W9DL 3L3HA 3LRHA 4JDVB 3LEVL 3DGCR 4TTDD 1UB6B 2WBJC 1NC4A 4NZJA 4GRWE 5DMGD 1JZ2A 2V5YA 5LBSH 1RJZA 2V7NB 3KAAA 5CSZB 4KHTH 1DBJL 2KQNA 1JRHH 4H0HB 1C5DA 1DN0B 4ZYKB 4ZUUB 3ZE0E 4D9LL 2GK0B 1TETL 3VRLE 4PJ7E 1QFUL 1TZIB 4PJDE 2Q6WB 1UXWA 2CO6B 4HULB 2VLME 4PJFE 5LAXA 4FS0A 4YDLB 1JHTA 3BSZL 4O51A 4MA1C 4HKJA 5JW3L 1PEZA 1A1NB 1P7KB 2CR3A 1M7DA 1XGYL 1AGCB 5E9DB 4YHKH 5HI5D 1IGCL 5KSBE 1U93B 2VDOH 3GMQA 4OZGB 1C5BL 3HFMH 2AKRA 4WHYH 1FV1B 4N0FB 1TVBA 3SKJH 3QIUB 4GG8A 1K3IA 1FSKB 3QR2A 1K8IB 4LNVA 5GRZA 1JGVL 3F7YA 4ZFFA 3GJFB 2E3VA 1I3RA 3QEQE 4DWHA 1R3KA 8CGTA 5CFHA 3DROA 1MH5A 5GS0C 3B2UC 1D5ZA 3OG6B 1KLGB 4PJHA 1QG3A 5TE6L 1F4YH 4GMSL 1X6NA 4KJYA 3THMH 1DBKL 1TQBB 1KTDA 1ZHKB 5HJ3B 4QRRB 1HNGA 1JL8A 4RISL 4Y4KB 3QPQD 1FIGL 4H26A 4TSCH 1MCQA 1NCBL 1QRKA 1RZFL 1OPGL 1SYSB 3ARVA 1RI8A 1U8MB 3KVQA 4KK5C 4Q6IC 1P69B 4G9FD 4OZIE 1XAUA 3SGJA 1J7VR 5AZ2L 5KW9L 1A6WH 4X6CE 3SJVB 3K0WA 2JJWA 1R3IL 1NCAH 4G6MH 2VDLL 1DQQB 2HFTA 3VE0A 2ITDA 2PW2A 1I8MB 2QL1A 1BBJB 3OAYK 3PDOB 4ZTPH 3MRLB 1DQJA 1TQCC 4ZUSA 3WNOA 5DZNA 3RVVC 1U8HB 3MACL 4PP1C 4JCLA 3TIDB 3GMOB 1A9BB 4YDJA 1Q9KB 1QNZL 3BE1L 5IFAH 2HLAA 1AIFA 1ZVYA 4HJGA 1N7ML 3C5SA 3EYQC 5DD0L 4CN6A 3G5ZB 2Z91A 3VD4A 4QHKJ 4QXTB 5DGRA 1UVQA 3CLEL 2DYPB 1I7RB 3C08L 3RWCA 1AHWA 3WFDL 5DK3A 4HS3B 4NYLB 3RX7A 3SE9H 1KIPA 2J5LB 1VB9A 3FFDA 4M9OA 5CUSL 5EA0H 5SWQB 4QRPB 3RWIA 3NCCB 2O5XL 3HG1B 4PJGA 4POZD 3IJHB 43C9A 5E70A 4L8SA 1VA9A 4Y2DA 5DWUL 2A73B 5E9DE 4YX2H 2R1XA 1MHPL 4IBLT 5IHZA 5JMRA 4GBXC 2O93L 4OZGE 1LNUB 5HTSA 4B5EA 4ZNEA 3D2UB 5DFTA 4OLVL 2R0LL 3X3FH 2FHCA 4MJIA 3ARGD 3B2VL 4P46C 4EEEA 1J8HB 3HPLB 5IMOA 1CGSH 2EKSA 5EZJB 1TPXB 1G0DA 4LVHC 2D7OA 2VLKB 1ZSDA 3CVHH 3LKQB 4XBPB 4XP6H 3WD5L 2X40A 3KDMB 5IMMB 4C59B 2P43B 5D7IB 3IFNL 4X6BA 5DD6A 2HLFD 4QRRE 1T1WB 3CDCA 3NFSL 5B3NA 4OCXL 1T66C 3ZKND 3QA3A 4JO4H 3L7FA 5LGKA 5DMKB 5BS0B 1YNLL 3SJVE 1XCTA 4FFVC 5HSFA 2X1PA 2V17H 4LBEA 4OB5L 3AY4C 4XCYA 4BK5A 4LQFL 1TZHB 1J1OH 3TZVB 3DUHA 1EXUA 1KCSH 1C16A 4M7LH 1DLFL 3HE7C 1LEGA 1CICA 4XWOC 3ZE2E 4JFZL 3CH1A 1MQ8A 3V6OE 1JYNA 2Q8AL 3BPLC 4PIRF 4K3HA 3S35H 5C0BB 2RFXB 3P4MA 2PO6D 1DZBA 2EDOA 4HFWB 5D7SH 4S1RL 2YD9A 5KG9B 1AD0A 1Z6JT 1M7IB 4O58H 1KBGL 3C2AH 3VFSA 5F8RC 1OTUD 3AMLA 2BVOB 3QZWB 2IQAA 3MYJB 1ZK9A 5AAMA 5H35B 5IGXL 1IGJB 5FUZH 3NGBB 2ZCHH 2D3VA 4PJIB 5E6IA 2B39A 3PJSA 2FBJH 1PSKL 1HDMA 3MLSH 1MIML 5CHNA 3L1OL 5GPRA 4BFIA 3RIAK 2WP3T 3LD8C 2C3XA 3L6FB 5IESL 5ICXB 5DVKA 5EZIL 1NAMH 4FFWC 4QRPE 3A6CH 4GKOA 1G6RA 3HG1E 2FD6H 1C5CL 1J1XH 4X9HA 1RSFA 3ROLA 4YE4L 4RZCA 4Z78A 4LSDA 3EFFA 4O2CB 5DJCA 3CDGB 1MFCH 3BEWB 1YN6A 1L7TL 3NZHH 4Q2ZB 5KSAD 3NMEA 4PJBA 2YS4A 2VDRH 4J3WA 3ZDYF 1F58H 1L0XA 1G7JA 1F6FB 2D7PA 2FECI 4FA8A 3GJEA 2XICA 1GGIL 2AK4A 1AD9A 3NCBB 1E4WL 2FECL 3WIFA 1MCHA 2AK1H 1QRNA 1J8HE 1NUNB 4RAUA 3OJDB 4XVSH 2EDLA 4HT1L 4DN3H 3KHQA 1ROWA 5I76A 1INEH 3IDGB 1ZKAA 2VLKE 5DSCB 4ZPTA 4BSWA 4HZAA 1F3JA 3ULVL 1JMZA 4I0CC 5C08B 3E6FB 3HI5L 4LCWD 4X98A 4Y4FD 4PJEB 5D7IE 2DQJH 3T4AB 4AEHL 1G7LB 1IGFH 1M71B 3DI2B 2DQDH 5DRWA 3NFNA 4XAWL 4PJ9D 5J4MA 3C60D 4LLYA 4JQVC 2DTSA 5JXEC 4PRIA 4J4PD 1RZ7H 5BS0E 4B7IA 1A7QL 1NEZG 2AJZA 3N0PB 3R8QA 4HAGA 2QLVB 3ARDD 4JO2H 4WUUB 4P3CL 2R69H 4FQXC 3PP4H 5DURD 1IAKB 4XNUL 4BH8A 1SJVA 4JB9L 5A40E 4OZIA 2X5PA 1FO0A 4YHLL 5F6IB 1EVTC 2G2RA 4JHBA 4J1UB 2BJMH 5CJXA 3S88H 4Q9RH 4G5ZL 1ADQA 3DMMD 4S2SB 3HA0A 4Z8FL 2Q86B 1TFHA 3RJQB 2ENSA 5C07A 4P5TA 2C3VA 3FB8B 4EKXA 4JQIL 2Z9TA 4Y4HA 3FB5A 1GZPB 2Y9RT 2BY1A 2EDDA 2YZ8A 5F1KC 3S36X 3QFJB 1OCWL 3FOLA 1AXTL 4PJIE 3H9SB 3NACL 4JLRB 2YHGA 2F58L 3MCKB 5GS0H 4PR5B 3PIQB 3BGFB 3D0VA 3VA2C 1WWWX 2F53B 4QTHA 3RGVB 5DD5H 1S7XB 3UBXI 4ENED 4OFPA 3QQ9D 4IRSD 3QNXB 3DX9B 3QULA 3KLAA 1MCPH 3UJIH 3F6LA 5EFIA 4ZYKA 1QP1A 3T0BA 3U0WH 4PJ8B 5HVWA 3MA7B 2IBGA 5ID0B 1G0XA 3GBNH 1B2WL 5JHLH 3GI8H 2HVKB 4P3DB 3JV6A 1MF2L 4NZUH 3WSQL 1QKZL 1JZ4A 2DQIH 4Q97A 4ZUTB 4GT7A 1YQ2A 1AGCA 3O6FD 4LSSL 3O4OC 3BQUC 5C3LD 2FB4H 1CGYA 1X5GA 5C08E 1EJOH 2ZUVA 3UBXG 2X70B 1NBYB 4PG9B 4CVWA 1T3FB 4PJEE 2ZUQB 1YPZF 5K9OA 1AJ7H 4XWGH 2JJTC 2FGWH 5DUPH 5FGRA 4XBGA 4FQPA 1G7IA 4PV9B 4ETQB 1BFOB 1P7QD 4MGXA 3ULUD 1A14H 3BESR 3VGDA 3FO9B 4YNYB 4WV1C 5ENWB 5KJRL 2EDQA 1TTGA 1KLGA 1VGKB 4U3HA 2YXFA 1JN6B 4WUUE 3OXRA 3OKKA 4PJXA 2ZSVB 5IQ7L 1TLKA 5ALBL 4J3OC 4LCIL 2CDGB 1LO5B 1NGQL 5FYJH 3L3IA 1XIWC 3CFBB 4F57L 6FABL 4U1HA 4X6DF 4PJCF 4R4FL 4APQA 5BJTB 4Y1AB 1I8MA 1OAXL 3LH2L 3OF6A 3T2NH 1LK2B 1AY1H 2BFVL 4QWWD 5EIIB 1S9VB 5GS2D 2BY0A 3MRLA 4M3KB 2CXGA 4ERSL 3CSPA 1QBAA 2WWMC 2JJSA 4D3CH 4NZRL 3QFJE 1JPST 3H9SE 3MNZB 4XVUD 4XHJD 1R3LB 4H1LH 4V1DB 5CGTA 2NPLX 3KPQA 2Z31C 4YDVB 4ODWB 5D1QC 3IF1A 3GSQB 4L3EA 1DQTA 4JFQB 1P2CB 1SEBB 2F53E 5ITFA 3MOAH 5GSRB 1BEYH 4M6AA 2ATKA 2APWA 3UEZA 1I7RA 1TZGL 3GMLA 5T1MB 4LAJH 7FABH 3QPXL 4QRSA 1JPTH 4LMQI 5GHWH 4A2MA 5KVGL 3PXJA 4JANA 4NYLA 4Y8DC 1I7TB 5F1NB 3RWGA 3BIBX 1G6VK 5J3HC 1CYGA 5EOCJ 3HG1A 4N0RA 3IJHA 3QJHA 1TNMA 2QADD 3OR7B 4E5XA 4K3DL 1FL5B 3IAQA 3S35X 4Y89A 4I5BB 4OCYL 1Y0LA 2EC9U 4MVBC 4MWFA 5I71C 3GSUA 3IGAA 4OGYL 4U1SB 2NXZD 4MJ5B 3HPLA 3B9DA 4OD1L 4F58L 5K9KA 3V95A 3WFEL 3BJ91 1DL7L 3EYFB 4GKNA 5C0JB 5E24E 3DV6A 1TENA 4HIEB 2DQUL 4NRXB 4NUGH 1G7MA 1KJVA 3UTTA 4C54A 2VZSA 3VW3L 1SJXA 2UZIL 5JA8B 2E8YA 1EVUA 4LNRA 1YNKH 5DFVC 1JNLH 1WGOA 5TQ0H 2BNQA 2X7LA 2R1WA 3WNPA 1BPVA 4MQ7A 3OKEB 4OFYA 3WN5C 1QSED 5DMKA 3O45B 1U8KA 3BIAX 2VQUA 3KLHD 2EDBA 4PUBL 4F7TB 3VRIB 4ZO6A 4Y1AE 3HZVA 4QLRA 3QDAA 2GSGB 2IC2A 4QYOB 1GGCH 2AI0L 1UC6A 2DLFL 1CTOA 2V9TA 1A7BA 5GGUB 1YN7A 1FVCB 2HWZL 5C0BA 4V1DE 4HFWA 3UTOA 4XPAL 3V6ZB 3VG9B 2LTQB 4G7YL 1JPFA 2MHAA 1AP2B 3GM8A 4HXAL 1FIEA 2GTWA 3QG6B 5TDOA 2FL5A 3S34H 1IGJA 4BKLB 4JFYB 1GOGA 1IBGL 1EHXA 5LWYL 4EUPB 3EJZC 2NY2C 2FR4B 2Z35B 2HT4C 3DUSB 2AJVH 2DQTH 5CKAA 4LPCA 4KZEL 3SOBH 4HXBH 4KMQA 3L6FA 3MLWL 3QNYB 2ZG3A 4NKIL 5HVGB 4AQOA 1C12B 4LAQH 1FVEB 4FFZL 4C56A 3RDTB 1PW3A 5EORH 1BZ9A 4RFOH 2P24B 1RZIB 1CXLA 1U3HB 3IDXL 3CDGA 5C0FB 4H20H 5GGTH 5M95B 3Q1SH 4DW2L 4L9LB 1FFPA 3MXVL 5F1IA 4RFNC 3JWDL 2ZKHH 4RGOL 1F97A 4D0DB 5IMKB 4EDXA 3BIKB 5IOPA 2A6KA 2V5RA 3IDGA 4ELKB 4KZDH 3VXSB 1MCOH 2FRGP 2UWEA 4KFZC 5FYLD 5L6YH 2ED9A 2QQKH 4NNPH 1UWXH 3ETBF 3W9DB 1BJ8A 1NQBA 1UZ6E 3RVXD 4P99A 1FNSL 5TF1L 4ORGA 4DAGH 1E6OH 4MNQD 3MBED 4G9DA 5F7YC 2HFFB 4F7CB 3ZTNH 3HE6C 2CIIB 3WLBA 1KG0A 4LLDA 4TULL 4OKDA 4K3JH 4MAYB 4KY1L 3SGJC 3VGBA 4XXCA 1ACYL 2ICWI 5KVDL 1DLHA 2H2SC 2VWEE 3G9VA 4IIQC 3BPOB 2NY5C 2R1YB 1W2KT 2VLLB 2Y4SA 1FYTD 1OSZB 1MHCB 3OKOB 1FORH 5F70A 2BVQA 4NOFA 3LSOB 4MB3A 3HZMB 3K81A 3P40A 1MWAB 4O2EB 2ID5A 1RUPL 1L4IA 1JYVA 4J1UA 2NY3B 2ARJA 3WFBH 2MCPH 2DIAA 3LZFH 3WS3A 1TVDA 1NCCH 2VERN 4U2YA 2H8PA 5SWZB 3RTQC 4FZEH 3VXMD 3C5ZD 3REVB 1EERB 4RWYL 4G8GD 4HX1A 1KGCD 4RRPA 5IIEA 3ZDXF 1I1RA 3LS4H 3O0RL 4LDEB 3VFNB 1H3GA 4UTBH 3H9SA 4DVRH 3VFTA 3AROA 3EIFA 5MHSD 3A67H 2M1KA 2DOCA 3RGVA 2VMFA 1I8IB 1S7XA 4OQTH 3O11B 2JK5B 1U6AL 3QNXA 4OLWL 1V8HA 3U4BH 3RP1A 1RUAH 4HUUB 4NSKA 3VD9A 4PJ8A 4FXKB 3MA7A 4DZ8B 5I1CL 4C58B 5HHOD 3BKYH 3EJYC 3MODL 4MJ4A 3W11D 3O2VL 1IQDB 2GY7B 2EDXA 2C5DC 4IHOB 4NO0D 5DQDH 4OD3L 3VXSE 1MRCH 1NAKL 1RU9H 1W8NA 1YEEL 3OSKA 3R1GH 5F93C 3SGEI 5LGJA 1ZA6A 4QXUH 3G9AB 1HSBB 3VMNA 5F9OL 3RNQA 3OKLB 4PG9A 4HWBL 2FWOB 4YEEA 4IOIA 4JPVL 4G6FB 4DGIH 4ODSH 4NWUL 4F9PA 1K4DB 3ZYIA 3RIFF 1T7YA 3D9AL 3HR5B 1WVZA 3VFRB 3OB0K 5HYFA 3RWFB 5ENWA 3QUKB 1YYLL 3MO1B 5LGHH 4JM2B 3ZL4L 1HQRB 4RDQF 1JN6A 1NCWL 1ZHLA 4N0CD 1EHLH 3LKPB 3MCLH 3L95A 4I3RH 4UDUB 2BSRA 3BEVB 4LPUA 1LO5A 3KYMB 2CJUH 4P23A 1O5DT 1QOKA 1YNTB 3DXAD 3U36A 2X4NB 1CXIA 3CFBA 3FAXA 3WIHL 1ZTXH 1MFAH 4MCZB 1HH6A 2IAMB 1DEDA 5GZOC 5BJTA 2WANA 5SWZE 3VXNA 5DRZA 3PP3K 1PFCA 3NBNA 1JYXA 2CXKA 3EYSH 4I3SH 2AXJA 5KOVC 3WXVL 4Y7MA 1HQ4B 4NQXB 4PRHB 1OWWA 4XC3L 4YBLB 4J3XA 5I18L 4XBEL 1T5XB 1A0QL 1A1OA 2NXYB 1R3HB 2WBWB 2VQTA 3LOWA 3TF7C 5D7KE 2UYLB 2PN5A 3QUYD 2DLTA 2BSSB 1ZS8A 3CU7A 4TN9A 3DIFB 4FTVA 2ESVD 2W65A 1FJ1A 3ARFA 4OGXL 2W1NA 5J12B 3O2WL 1BD2A 3LKOA 3RPKA 4N8PA 4QHKI 2G9HA 4KJQD 3LV3A 4R0LA 4HS6B 3O3EB 3FT2A 3GO1H 5AAWA 5HDQL 5DR5H 3PGDB 4LARH 2J88H 3CJJA 4AIOA 4JAMA 4BJLA 1N5AB 5IM7B 4BELD 4ODVL 1RAMA 4MA3A 4D0BA 4WGWB 3WL9A 2YRZA 5C09D 2DTMH 2A2QT 4Q9QL 3KPNB 3KR3L 2A9MH 2XY2A 4X8JB 2CLVB 4U1SA 4MJ5A 4ZUVA 2GKIA 2Y5EA 3ZT7A 4KRPB 3OKDA 2IANB 4NM8H 2ZOKB 2GYSA 3EOTL 3VGAC 4NRXA 2Z8VC 1FFOB 3TBWB 4LEXL 5B38B 4Z77B 3FQUB 1XGPB 4JREB 5CIPA 4DEPB 4PJHF 1KN4H 2DF3A 2VQ1B 4QHNB 4HCRL 1EEYA 4UILL 5I1IH 1NEUA 2G5BA 3O6ML 4QRQB 4LDLB 5EOTA 2NX5D 3D1MC 1HXMB 2SEBA 4RIRA 3KPMA 5D70L 5IK3B 2EDTA 5CJXC 3T08A 1Q1JH 1G9EA 1HXYB 2EEBA 5GJSH 3VXOB 1U8QA 4UDTB 3U1SL 2C4FU 3G5XA 4U1MA 2XZQL 1M7XA 1HOCA 4K7FB 4M7ZC 4X99B 5CZXD 1CGUA 4R7NA 5MI0C 1XH3B 3RA7H 2J8UF 1S9XA 4PRHE 3RI5K 5HVHB 4TNVF 4TVPL 1NCNA 4MD4A 3DVNB 4PD4K 5DJ6B 3V6ZA 3QDMD 3SGDI 5D4QA 2F54B 3QCTH 1L0YA 1S9WA 3MLYL 3QDGB 2PXYB 2HRLA 5D93B 5DUBB 1H3TA 4EUPA 4ONFH 3IS0X 1Q72H 5IW1A 4PB9H 3IETA 3QRGL 5AZEL 1OGTA 5GGRY 8FABA 2OL3H 1JTOA 4LK4A 4CUCA 5BMFH 3QO0A 1Q38A 2NY5H 4YDLC 4RX4A 5F7NC 4PJGF 1U3HA 1JPGA 2CK2A 2E9WA 5C0FA 3V5DB 3ZKMD 1U3JA 2VE6B 4OIAA 3U48A 4JY6A 4XPHH 2Y07H 5TE7H 5C0EA 4JFXA 3GIVB 4JO1L 4C4KO 2BVEA 1JPSH 2PTVA 3QIUC 1JGDB 1WCBB 1FSKC 3PL6B 3MJ9L 2IANE 1MPAH 1D5IH 1WWCA 2Z92A 1W0WA 4UAOB 3VXSA 1RULH 3S98A 1QQDA 4OM0H 4X4YA 2YPLA 3T3PE 4EDWL 4PGEB 2OZ4A 3B9KA 3W9DA 3WFCH 3U7AA 4NRZB 3VFVB 4P4KD 3ULUL 4X6FA 4M5ZL 4AM0B 5E6YA 3CZFA 3I9GH 4NN6B 4UT7L 2VDNL 4X5WA 4YR6B 5AWNL 1TQBC 1L6ZA 1T1ZB 2CLZB 1RURH 4Z7QF 3N9GH 2HFFA 1RZGA 2HTKC 4GQPH 3LS5L 4Y4KC 4IMLA 3W0WD 2XIDA 2CIIA 5SX5K 1KLUB 3NTCL 4J3TA 5E2VH 2Q87A 1CXKA 1KELL 4OZHB 3K2UL 3NCJH 1I1AD 1OSZA 5CJOL 4WW1B 1MHCA 3WE6B 2IMNA 1RIVH 2Y36L 3LSOA 3FO1B 3QXDB 2JIXB 2OR7A 4YGVA 2ILLA 4TPRL 4B0MM 3C87A 5ISZD 2HKFH 2R4SL 2PTTA 3V6OC 4K9EC 2YA1A 4QOKA 1A4KA 4JRWA 3VFWB 3T0WA 2HJKA 4Z95H 2F54E 3T0ED 3HMWH 3REVA 4JY5L 3L3JA 2X4TB 1MAML 3V0VB 2BXZA 1DUZB 3QDGE 3MJ8B 4OCSL 3IYLW 1RQ5A 1IEBB 5EU3B 3RZCD 1PVHA 4N8VA 4U7SA 1H8OA 3D85A 3ARYA 4G8EB 1VFBB 4YFDB 5I19L 4KK8C 5BOZG 2WAHA 4CN4A 4U1NB 3QUML 5I8OH 4ZS6D 2XZAH 3Q3GB 5EZOL 3ELAT 1N4XH 5E2WH 5CEXA 2J5LC 1BX2B 2A38A 3DX7B 3SDDB 3ARQA 1I8IA 5EUKA 1MI5D 1NANH 1HHJB 2JK5A 4HC1L 5B8CA 1BIIA 4Y19B 5IJVB 1U8JA 4KVCH 2AJYL 1MVFA 4NCC2 4ODTH 2RHEA 3PWVB 4DZ8A 3GIZH 1AFVL 2GITB 3ZE0F 5EB9A 2VYRE 4EXKA 1OGAB 3O6LL 1CGWA 3WFZA 4PJDF 3L9RA 2EZ0D 3QISA 1F5WA 3WNNA 1ZLVH 1HWHB 1TPXC 1FZJB 5I2IB 4LLWA 3O3DB 4P2RD 3F6IA 4MCYB 1KEGH 4TQEL 5FF6B 2R56L 5KSBF 3EDEA 5D2NA 3MV7A 5T3XD 1HZHH 2HTLC 4GRWH 3UMTA 2AJ3B 3ARBD 3C8KA 4MXQC 4HEME 4OV5A 5IR1A 4L3AA 4O9HL 1T7WA 5IHLB 4EN3A 2NR6D 1HQRA 4OZHE 3SE4C 5HYJB 2VLRD 3VMPA 2WSKA 3HZKB 1FL6A 3TZVC 4OCLC 5JUEH 2GTZB 1QR4A 1UFUA 3CFKB 3SN6N 1LDPH 2E7CA 4HH8A 5I1JH 1XF4A 3IKCB 1OTSD 4XMLH 5CINH 4HWUA 4OZIF 3EZJB 3EZ8A 1SY6L 3GRWL 5TFSL 4X6CF 2VJXA 3HNVL 5LKNA 4WFEE 1HK6A 4NNYA 3MRFB 4X4MA 4XRCB 1DQDH 4ZFOL 4K94C 1UKSA 4NZDA 5FEBA 4NQXA 3BOVA 2QV2A 3DVGA 3NGBC 3QIBA 5F9WB 5TDNA 3T8XA 1UA6H 5KN5B 2XWTB 3X13B 3KJ6L 3RL1B 2D31A 5JOPD 2C1OA 1B0RA 4DKFL 4MMZC 2BSSA 4Y19E 5DDHB 4PFEA 4U6XA 5KSUB 1JF5A 3BI9X 3VFGL 4P59L 4QHUB 2EDHA 4JRYD 4YHML 1HINL 4KRMB 1OGAE 1WEJH 2ZUTA 3TJHC 4MMXC 5GGRA 3D6GA 4YXHH 3JWNC 5LQBL 2VLJD 5JXAL 1GAFH 1WIUA 4ESKA 5K9JH 1UG9A 5D6CA 1B4JH 1YC7A 4UBDD 1N5AA 5DJXB 3DBXB 2NMSA 1NL0L 1MCIA 2ZNWA 3J7HA 3F65A 5TPWH 3RKDD 3NA4A 1RMFH 5KVMC 3CH8A 1AO7A 1BZ7B 4OZFB 5EOCL 4X8JA 4RA0C 4JFEA 1NGYB 3RY4A 4X80L 5LXGL 3BKJH 3DTXB 2OQJA 2GAZA 3N85H 1K6QL 3KJ4C 2VABA 4U1KB 1GHFL 1QA9A 4I4WA 4QRTA 3T09A 5E7BA 5HHMD 3ZLQC 2Q7NA 4YWGL 2MNUA 4BZYA 5HYJE 1NBZA 1X5YA 5FCUH 1RZJC 1OP5H 3MRRB 5GRJH 4MQXC 4BH7B 5HGGS 2CRMA 3VG0H 4CJ0A 3LEXB 4OCWL 5EZLB 1UB5A 1YEJH 3BZDA 2ADIB 4PJXF 1KIUA 3P0VL 5A16A 1LEKB 3VFOB 1HXMA 4PRNA 4P2QD 5F6IC 4X9BA 4XCEB 5GRVL 4WIQA 2CIKB 3MV8B 3JWOL 1IT9H 3B3IA 4TSBH 3VFPB 2R4RL 1CLOL 3CDFA 3GSRA 5IB4A 2KQMA 4K7FA 3FO0L 3VGGA 2P5EB 1YYMH 1XH3A 3ARXA 3GJFH 3OX8A 2IGFH 3VRJA 3VFMB 3DVNA 3DYMA 1G9NH 5T3ZL 4LRIC 5L88L 4NZTL 1KNOB 1U3YA 2F54A 3BGFC 2DJ4A 4XP5H 2DI8A 3RGVC 2DMKA 4N0UB 1GPOL 5CEYA 3O2DL 1CK0L 4KMTL 1MCCA 1EK3A 3PABA 2XFXA 3NA9L 4PJ8C 3TO4D 1CE1L 2VDPH 2K7QA 2DJSA 4YDKH 4MX7B 1FNFA 1CQKA 3TN0B 3QCUL 4RCAA 2R8SH 5JOEA 3WIHA 2FZ3A 5JOFB 4X4ZA 3MPCA 1CE6A 3BWAA 4LEOA 3LKNA 3V5DA 1UM4H 1NFDB 4JO3L 1P1ZB 5FB8B 1OARH 5HYEA 4E41B 2PYEA 1BWMA 4CMMB 4QHMA 5KVFH 1RIUH 4F37F 2ZUQC 3IJYB 1GIGL 5DT1H 2D03L 1A22B 4AENB 1W72H 3I6LE 4FNLL 3MRIA 3WJJA 3K2MC 3W9EB 1N2RB 1L7IH 1TJIH 2F5BH 3IDMB 3NFPA 4HUMB 5CGYD 2OS7A 3OR6A 5HD8C 3C6LB 1DTUA 3MSPA 4JRXD 1ZT4A 2AQ2A 3CSBA 4AM0A 3TA3A 2G60L 4EJ1C 5D7LB 3HB3D 1JWUB 4HV8A 2APBA 4YR6A 5D7IF 3CAFA 1SHMA 3LRGA 4KKBC 2H2PC 3O8XB 4F33A 4U6YA 5BV7L 1AQKL 4LF3A 4PTUB 5DRNB 4BM7A 5JQ6H 4TNWK 5IVOA 4OIIL 3FO2B 3O4LD 2XWJA 2P8PA 4G6AC 5F7KC 4P9MH 3P9WB 2B4CL 3MV8E 4OZHA 3Q6GL 2V5MA 5T5NF 2OJEA 1F4WL 4ONHB 3WFHB 4HIXL 1GOFA 2J6EH 5CP3A 4RSVA 2FSEB 3BAEH 2P5EE 4D0CB 2JELH 4X9GA 5E00B 4DGVH 3IU4L 3BRGC 3QG7H 2BRRL 3VFWA 2BXYA 3KYOA 2AEPL 1AQDB 3LCYA 1RJCA 4KV5E 4O2FB 3SDXA 3K8MA 4MB4A 1CCZA 3TV3L 5JW5B 4GFTB 4N0UE 1HIMH 3MJ8A 4W6WB 4PRDA 1FVDB 5ICYA 4OD2A 4JFDA 5LBSL 4BFBD 1YUHB 4XP1L 5AYUL 2PF6A 4KHTL 3Q3GA 3U4AA 2OCFD 4DUVA 3EHBC 3P73A 2JB6B 5KSVB 5J9PB 1HHJA 4PGJA 1WZLA 2YKLH 4M43L 2CUHA 3MJ7B 1F8TH 3STBA 4FFYH 4LSUL 3ARZA 1NFDE 3BZ4B 2X9WA 1KYOK 2VZ3A 1PQZB 1GGUA 3CLFH 1OGAA 4PBXA 4E41E 5GIRA 3UPRA 1J1PH 3MLUH 1QSVA 2XACC 2B5IB 5ICZB 3GB7A 5DJDA 5JLZB 1X4ZA 3EBAA 1B6DA 4YHKL 5I1KL 3WO3B 3MOBL 5I2IA 3HFML 5DJZB 3GSNB 3KPSA 3SKJL 3MRCB 2GT9B 1BBDH 4K94H 3R8BB 1N59A 4HIHB 1FN4B 5D7LE 1UYWL 2HVJB 4BQ6A 2ATPB 1DFBH 1FZMA 4WI7A 3V5KB 4QNPF 1XGUB 5DO2C 2D7NA 1EPFA 2GW5A 1DQMH 3QIWD 4YAQB 5C3TA 2NY4D 4NM4H 1JHKL 3QWRA 4DFHA 3JUZA 3S4SG 3LMJH 4WHDA 1Y6KR 4IOFD 2MPAH 5CZVL 5J8OA 5J06A 2VWEC 4TSCL 4OCNC 3KPRB 1PYWA 2ORBH 4OGAD 5I6XB 2YA2A 1QPXA 3DSNA 2BOBA 1NKRA 5BVPH 3J8F7 1SMOA 4URTB 1OW0C 1SEQH 2O26U 3RX5A 4IRJD 4DN4L 3BWUC 3EO9H 1FL3A 4N68A 3VG9C 2LTQC 3OBAA 4FZ8L 4ELMB 2W9LA 5F7LB 4HK0B 2XQYG 1NC2D 1EO7A 3PGFL 5D7JA 5C0AD 1UWEL 5KN5A 3QHFH 2XWTA 3MFFA 1CDCA 5C0CD 3RL1A 3MREA 5AD0B 1A6VH 5L2KD 2D9CA 1RZJH 2WUCH 1NCDL 4R3SB 3RDTC 3KNBB 1I3GH 2NY6C 3MOQA 2P5WB 4HK3N 5L8JB 1U3HC 4ODBD 5DJ0A 5I66A 4QHUA 3SE9L 4D9QD 3SO3B 5EA0L 5DQJA 2ZCLL 4L9LC 4NQTA 1LEIB 4G43B 4IMKA 1NEZB 3RY6C 3TBYB 4Z7WB 4RBPK 5D1XA 4ZXBB 4KJWD 4J3VA 4W70A 2BVTA 4L4TA 4NO2A 5LCVH 4UU9A 1CFQA 5DJ2A 5D1ZA 2E7HA 5I1DB 3EO0B 4X4XA 1YJDL 4NQUA 1HH9A 5JR1H 4YPGA 3KS0H 3SCMB 1IM9B 3CVHL 5IVZB 3RU8L 2V2TB 1EUUA 5MEPB 5DK0B 2FATH 5M94B 3MNWA 1DVFB 3BXNA 1H9VA 3EAKA 1X3DA 4U1LB 4ZTOL 5J1SC 1OAYL 2CKBB 1OTTD 4MAYC 2BHZA 3I50L 1YEDB 3BPOC 3M1BB 4JO4L 3W5MA 3KPRE 1BVKB 5EZLA 3R06A 4P9HC 4LHUD 3FOMA 4LLQB 4Z0BL 2G75A 2VO5A 3QT2A 4RMQA 3TBTA 2C4XA 2NY3C 1J1OL 2VXSL 1ZE3C 2GJ6B 3O41B 5SWSB 1KCSL 3MNVB 5HGHB 4PLKD 3UYRL 5F21B 1PY9A 1YEGH 4ELME 2ERJB 1C7TA 5HPMB 1J0ZA 3UCRA 1LDSA 4F7MB 2P5EA 5D7SL 1QO3A 2YUVA 2DQHL 5DJYA 3UBXB 1EFXA 4KKAD 5DHYA 1UENA 1BP3B 4Z18A 1KNOA 5J1TC 2GK2A 4TOYH 4NJAL 2VC2L 4N0UA 2EH7L 4D8PA 2ZCHL 2P5WE 2RIKA 3LQAC 3VXRB 1K3ZA 1P6FA 2I27N 5DEFA 5K59E 5F7DA 5EUOB 3ZHKA 1NAML 4IDJH 3A6CL 3AGVA 3AB0B 2YPVL 4Z7WE 2FD6L 1J1XL 1EAPA 2VXVH 1Y18B 3ULVE 1NMAH 4FQQA 1BIHA 4FP8H 1SY6A 5EULV 3NZHL 4YFEA 1VCAA 1F58L 3JBG7 4UT9H 1NFDA 2ADGB 1PEWA 3P0YH 4ZAKA 5FB8A 5KANI 2DLEA 1INQB 5F3HB 5T1KB 1NMBH 2A6JA 4PBVC 5JO5B 1T0MB 3SE8L 4WEBH 4CL7A 1IL1B 3U7YH 3KYKL 3BH9B 4NQCA 4XMKH 5HVFB 1Z2KA 4J6RH 3SDCD 3WIIL 4ZFOA 1T22B 4K7PH 1LP9B 3IXAB 2LE9A 4F9LA 4AENA 5SX4H 1QEWB 2CR6A 3HI1A 1DBAL 3MUGA 2IH1B 3IDMA 5T3XL 2XWBB 1NGPH 3PHQA 4M6MH 4PPTA 4PBWD 5A2LH 4AQ1B 4S1QL 5D96B 1BECA 3MV9A 4NJ9H 1CF8H 4JM2C 4JCMA 1JWUA 2VL5B 1UZ6F 2R0WH 5IROA 1IGFL 2DQDL 1HHGB 2FIKB 5KANG 3QHTC 5LVEA 1WISA 4A6YA 5INCA 1I8KA 1RJYA 1F90H 3HUJA 4P57B 4JO2L 1U95A 2GJ6E 5SWSE 3AUVA 3W82A 2AV7B 2IAMC 3CD4A 3OKNA 3CCHA 1MNUH 1U8IB 3SBWC 5MP6L 2BJML 2FSEA 3S88L 3H7LA 4Q9RL 4R4BA 4D0CA 3OG4B 3B6SB 2H45A 5B39G 1G1CA 1S5HA 1MLBB 5JZ7D 3QEGH 3TP4A 2BVPB 3QI9B 3X14B 5C8JA 2EYRA 4S1SL 5GISH 4YBLC 5I1GL 3FT3B 3C9NB 2O5YH 1AQDA 1RK1B 1N5YH 1FDLL 2NXYC 3C09B 4NKDB 5I17B 1FZKA 4YHPA 4ZFZA 4CN1A 3JTTB 3P30H 3VXRE 1F6LL 3D3VA 1FVDA 5FK9B 4QO1A 3OGCB 5GS0L 5EUOE 1A3RH 4XI5C 3BUYB 1X5JA 5J12C 5DD5L 3MGTB 1MCPL 3T04D 4HKBA 2I07A 1O7VA 5CILH 3OKMA 1L0QA 2FJHB 2JJUA 1T1XB 3HZYB 3S9DB 3P9LB 3GBNL 3MMEA 3DURA 3UTPE 5IVXA 5JHLL 3GI8L 1IAIH 1T4KA 4GAYB 5BW7A 4LPVA 3CDYA 4NZUL 1QR1A 4J2XA 2CGRH 4R4ND 5E03A 1LP9E 3O6KL 1TCRB 4KRPC 5C71A 2UVFA 2FB4L 1J11A 3HPJB 1EV2E 2VXUH 4M61B 2GT9A 2K7PA 4JZNB 3FZUC 2VZTA 3VXQB 1Q9LA 3HC3H 3T3ME 5JORB 3K46A 4U3CA 4OAWB 1VACB 4FXGA 1AJ7L 4ZPVA 4HIHA 4EUPH 3WUZA 3O2DA 3VH8G 4JREC 5AG9A 1S9KC 3QDHA 4DEPC 3S3SA 3D5OF 3RBGA 2BOCB 2YD5A 1FAKT 2X4UB 3IVKA 1EA9C 3ARED 3WYRA 4JKPH 2WWKO 4QXGH 1LE9B 3L5XL 2GY5A 1GZQB 1MCBA 1FG9C 4X83A 3JVGA 3NABH 5CEZE 1CDGA 3N1QC 4Y2DD 3ROOB 3WUWA 3KPRA 2XQBH 3QUXB 5FYKU 3VXTB 1IC5L 2VL4A 3ZMRA 5IUSA 2D4FA 3VWJB 5CCKL 5FYJL 2BNUA 5EOQH 4WO4A 3U9UA 4MJID 1VPOL 3V5HA 1C08B 3T2NL 2W91A 5HVHC 4YDIH 4D3CL 4HK0A 5B4MD 4I2XB 1S7RA 1XEDA 1KB5B 4UUJA 2PXYC 5D93C 3CPLB 3MUY1 2XZCH 3QAZB 1A4JB 5H94B 3FHAA 2X09A 4H25B 3TNNA 1QHPA 1OB1B 3K1DA 1VKXB 4M6OH 3GMPA 4FQ1L 1X9QA 3TBSA 1BEYL 1ETZA 2NW2B 2A6DA 3B4NA 4JHWH 4O02L 5AD0A 4P5KA 3CSYA 3BH8B 1MHEB 7FABL 1X5LA 1JPTL 5GHWL 4P9HH 4GW4A 2ADFL 4HPOL 4ZDHB 4MA1B 4ONGH 3TWCH 1MWAH 4TTGA 4E9LA 4G43A 3WO4B 1NEZA 4I18A 4TSAH 1CICD 1PX3A 4XP9H 4JR9H 2I9TA 1U8PA 4M8VA 4OLEA 4ETYA 3QQ4A 3PL6C 4LSPL 1UACH 3QFDA 3GHEH 4IDLA 1QVOA 1R3JB 1MJJA 2EDWA 4UAOC 4P4RA 4WFGD 3AU1B 3B8SA 3B5GA 2Q76B 5I8CB 4KHXH 3INUH 3CX5J 4EOWH 4X9FA 2OSLA 4NN6C 1FAIH 3LN4A 3SCMA 3MRDB 3RPIB 1IM9A 5CWSA 1SVZA 5E6ID 3F5WA 4NUGL 3U2SB 4G9FB 1KJ3L 5FHBL 3NOIA 1EZVX 2Q8BH 3LQAH 3HI6H 3LHPL 3T77A 1T0PB 3DI3B 4GKZB 2ZOLA 2P8MA 4L8BB 5A3ID 3HC4H 1CD9B 1JNLL 1YNKL 3M1BA 3W39B 5FM4A 1FBIH 2NY0D 4UT6H 1G9MC 4MS8D 3GHBH 1K2DB 1MAJA 2AK4D 1Q9OA 5D8JH 3S37L 5GRVK 5IFHL 1QRND 3T0XA 3MRGB 4RNRA 1GGCL 3VXUA 4K7PX 2EEAA 2X1QA 1UWGH 1A2YA 1I85C 1YDPB 2HMIC 3D25A 5IW6B 3PF2A 1OP9A 1M05B 3IB4A 4I2XE 1CQYA 2AABH 3L5IA 4HW6A 3BKMH 4Z7NF 3GSVB 4BZ2L 2XNAA 4JPWH 4PB0L 1CXHA 5GS1A 5IMLA 5DQ9B 3SDDC 4G6JL 1PG7W 4PRID 4U0QB 4WRLA 4AEIL 2FYYB 1T0NB 5FO7B 4PJAA 5EUOA 3TC9A 3X17A 3B83A 3JXAA 3H0TB 3VWKD 3NCFB 3BP6B 5E8EA 4L8DB 4F2MB 5IB2B 5I30L 1A6ZB 3ARGB 2VR4A 5EORL 1OM3L 3AS3A 1LD9B 1NPUA 3NAAH 1U8LB 2W60A 4H20L 2V9RA 1IC4L 5GGTL 4QTIL 4HSQA 4YLQT 4KI1A 1Z0NA 2RR3A 2ZUWA 5DK2A 1D5MB 5FUOH 3VXPB 1A8JH 3A6BH 4OSUH 4W4OC 5C07D 4P5TD 1INQA 1HEZB 5JIHA 3OZ9L 2EE6A 1WBXB 4FQLL 1T0MA 3SDAD 2ZKHL 4Y4HD 4W6YB 4YZFE 2HG5A 4MD5A 3C6SA 2OXGA 5CSBA 4KVNH 3IXAA 2LU3A 2VIRA 4KZDL 1ORSA 1ES0B 1JNNL 1GGTA 2DBLH 4G9FE 2QQKL 3QNZB 1URLA 2R15A 4K71B 4OGZA 2XY1A 5I1EL 4NBZB 3C2SA 1Z5LB 1R5IB 3EYOA 4Y2OA 4RMUA 5FM5M 1H3WM 2VL5A 3EOAA 1MY5A 3ZTNL 5DVNA 1M4KA 4PGBA 4K3JL 4KGJA 1E28B 2NY7L 1NBVH 4M1DH 4K2UH 4ZD3H 1A5FH 1ORQA 3WEXA 2PO6B 5E5UB 1N64L 1H3PL 3D18A 4GG6B 4LPXA 5IB1A 2YRPA 4LSVH 2XG4A 5ADOH 1GOHA 4QF1B 25C8H 2D2OA 4O4YH 2MCPL 1JZ8A 2PW1A 4JEGB 1A21A 1MLBA 3LZFL 4WTXA 5EU5B 2BC4A 3CVHA 2EDKA 5F9WC 1FYHB 2WM0A 2R0KH 3UAJD 4E42A 4X5XB 5IP4A 1MLCA 2H26A 2VKXA 1OQOA 4QT5A 5A2KH 1JBJA 4N0YL 1GGBH 4LLMB 4UTBL 5KSAB 4DVRL 4HUWA 3O9WA 2XTJD 3OGCA 4N90D 3QQ3B 1G7HA 32C2B 4LU5L 2FLBT 5FCSH 1B0GB 4KJPD 5T33H 1MFEH 2D9QB 2H1PH 3A67L 2BY2A 2DKUA 4RFEB 4XCFL 4AMKH 3MGTA 1KFAH 2HH0H 4FABH 3U4BL 1JV5A 1OAZH 1RUAL 2F15A 4JQXA 1S5IH 3UJTH 5C0NC 1TTFA 4KK6D 1LO0H 5DEZA 4OZ4B 1BGXH 1T1XA 4APQD 1TDQA 5E8NB 4LCWB 4XP4H 4Y4FB 1AR1D 4MZ3A 5I15L 4PS4L 1MFNA 4QHLB 4TUOA 3MC0A 4YO0B 3RVUD 2QSCH 4DK6A 1KXVC 3QO1B 5DQDL 1MRCL 3D39A 4PJ9B 1B0WA 3C60B 3MBXL 1WAAA 4JG0H 4KK9C 4EI5A 1FE8H 4X6EA 4DKEH 4XZUA 3RHWF 4L3ED 5JORA 3S5LG 2YSSA 2OXHA 3ARDB 4DGIL 4M03A 3V2AR 1KSRA 4QY8A 5EN2B 3OAZK 3MUHL 5J6GB 5JPMA 4CVXA 5DURB 5IHUL 4HKZA 3Q5TA 1NAMA 4HIIA 4ODXA 4GW1B 1JWSA 3PGCB 4UQ3B 4G7VH 5CD3A 3LEYL 4UNTA 2QQLL 4WU5B 3DMMB 4XPBL 2YUWA 2I5YH 4GG6E 4RGMB 4PG2C 1EGJL 3E2HB 3CUPB 3QXAA 3ROOA 2XQYK 5C0RH 4OZHF 4NNXA 1EHLL 4FOMA 1TNNA 2J2ZA 2W0PA 2BCKA 3UTQA 1S7TB 1G1YA 2CJUL 4J8RB 4WHTB 1KB9J 2NNAA 1MFAL 5C0DA 1MIEH 2Y7QB 4GS7B 4JDZA 4OM1H 3BO8A 4N1CA 1N8ZA 1KXQE 4QRUB 3W81A 1VGEH 2D0GA 3MA9H 4LHUG 2NTFA 4IRSB 4I3SL 5DD3L 1D6EA 5E2UH 3UTTD 5FECB 1P4BH 3MRKB 2WBJA 3SDXF 1A7OH 1FFNB 1S7UB 4WUKL 1N0XH 4HLZH 4U0RB 4CW1B 4M62H 3LIZH 1ZWIB 2XKNB 3U7WH 3OHXB 5I16B 4MDJA 1OB1A 5H37G 1UCBH 5BRZD 2BNQD 3MV11 3NPSB 4U3XA 4OFYD 5GGQH 2O5ZH 5GZND 3TN0C 3I6KB 3U46B 1E4XH 1BQSA 3O6FB 3H6JA 3EDJA 1S7SB 4NQVB 1G9MH 4OKVA 1T2QL 3NIGF 4ZDHA 2IADB 1CT8B 4LCWE 5HHQB 1EBAA 3GO1L 4HLJA 5GSVA 4Y5YB 1CDIA 4LARL 2J88L 5E8DH 4X9IA 3DECA 4GSDL 3V0AC 3KS0J 2DRUA 1P7QB 1BQLH 1V7ML 5F89A 1NLDH 4RDQG 3CK0H 4JKLA 4N9GB 2ZCKH 1MRDH 1D5XB 2DTML 4HUNB 1G7QB 3C6LC 1JGEB 1MCKA 1YMMA 2AGJH 3VMOA 1LQSR 1IGML 5ESAB 3QCVL 4CU7A 4FQHA 3MRDA 3RPIA 4DKAA 2PCPA 3O8XC 3U2SA 4NKOA 5EO9A 3EO1B 5I1HH 4E0RB 3DWTA 4NCC1 4ZUWA 3PWPA 1AR2A 1KN4L 4GKZA 3BGAA 3SKOB 4C56D 4Q6IA 3RQ3A 1ZLWK 5C1MB 2AS5M 1B3JA 2QHLA 3CFDB 2V2XA 4XNQB 1X5XA 3U0TB 4WTZG 1P4IH 1FGVH 2DLHA 1LE5A 1AXSA 1Q1JL 4HJJH 3MLTB 5E5RB 3ORJA 3ZTJG 3MRGA 3TVMD 4L9DA 4WVRA 3U4EA 5E99H 5FKAB 3TJEL 5D9SA 3O3AB 1YDPA 5KAQG 3QUMB 1BFVH 5FA4B 2DKMA 2P49B 5B3JF 2A9NH 2OX5A 3SE3C 2BNRA 2YBRA 3DO3A 3PWUA 3RA7L 3PNWA 1HI6B 3GSVA 4KXZH 1U3ZA 4KKCC 1KPUA 2F74A 4OFVA 3WKML 1J0KA 1MJUL 2VXTH 1QBLL 4U1IB 4GLRH 2QADB 4ONFL 4RWHA 1Q72L 5T1LA 5FO7A 4MA8L 3BKCH 3ECBB 4HZLA 3H0TA 2F8XC 4L8DA 3FQXA 3ARGA 3UDWC 2HN7B 2NXZB 1IKNA 5DJ8B 4HQQH 4YPJA 2B5IC 4GBXA 1P9MC 3ULUE 5EU4A 1NSNH 2B2XL 4X7TB 1A9EA 3V8CA 5IWLC 2WMPA 5DI8B 4P46A 3FFCD 5I9QB 2VSCA 1JPSL 1YQVL 2OJZH 4JE4B 3AS2A 3MGAA 1AGEB 4BA8A 2Q7YB 3BW9B 5J1AA 2D4DA 1HHHB 2PUQT 5FKPB 3D48R 3GMNB 2D7QA 4GAGL 2C7UA 3QNZA 1QSEB 1PG7H 1U0QA 2DIJA 1UM6H 3WFCL 4KU1A 1Z5LA 2YUZA 3I9GL 5J6HA 1RURL 3S97C 3N9GL 4X5LA 1CFNA 5DLML 5I6XC 6CGTA 2MQ0A 5B22A 5E2VL 2EYSB 3GGWA 5I8EA 5FV1L 1I75A 3AAZB 5C0GB 3UJJH 5KVEH 3HE7A 1ZLUK 3BT2H 3FQTA 3TBVB 1JHLL 3VD7A 1CL7I 1RIVL 4WEUD 1FLRH 3BVNA 4LPTA 4OZFH 3TNMA 1CL7L 4HK3J 1DDHA 2YN5A 4JDTH 4PGCA 2HKFL 4QF1A 1F4XL 2YC1B 3VGEA 3MRNB 5E94A 2HP4A 5DS8A 3ULSA 4XCCL 2OP4H 3V7MA 4JHAH 3STLA 1IAOB 5EU5A 3KPPB 4OT1H 4NGHH 5EC2B 2DQEH 4Z95L 3HMWL 3IDYB 5SV3A 3FAWA 1IKFH 1MFBH 5BQ7B 1FG2B 2X44D 4CU6A 3BHBB 5L2JB 1LO2L 4HG4J 5IG7B 2ZWLT 2NLJA 2VDMH 2YRLA 3GSWB 4UIKH 32C2A 2XZAL 5ITBL 4MHHG 5E2WL 2EEDA 3E8UH 1RPQA 3SO3C 3GMMA 3PDDA 4HF5L 2EIBA 2M8XA 1H0DA 4NQDD 2FHFA 3ESVF 2NZ9D 3RVWD 4OFIA 5F7MC 4ZXBC 3OAUH 4KVCL 4P23D 3ULVC 2W9DH 4MJ6B 1R5VB 4LGPB 3I85A 3GIZL 3H42H 4M7LT 1I9IH 4NFDA 1NFDF 4XAKD 2FHBA 1J0HA 2ITCB 4MNQB 5BVJA 3MBEB 2DLGA 1DBJH 4QHLA 1ZHBB 1KJMB 1ZVSB 1KT2B 4NBXB 3F7PC 1IC7L 4P3WA 2YD6A 4PJ9A 5HGDA 4EVNB 3SCMC 4D9LH 1NUDA 5GGSB 1QSEE 1AGDB 1PKQB 2A6IB 2O61B 1MVUA 3ZE1E 1ZHNA 1HZHL 1DVFC 3U6RA 1E27B 3PUCA 3LQZA 4L8CA 4YXKH 3H9HA 4YHZL 1FYTB 3MR9A 5CGMA 3X11A 1OT2A 5F96L 3NCYP 2HKHL 5J6GA 1XGYH 2OL3B 4FTVD 2CK0H 4CJ1A 3TT3L 3VCLA 2BMKB 3ARFD 4M1CD 1A7NL 2H41A 4TRPH 1BD2D 4OJFL 1C5BH 5FYJU 5CJ8A 2M2DA 3DRQB 4YXLL 5BXFA 2VXQL 3DMMA 4KDTC 4FQXA 3DUUB 4Z0XA 4PGDA 1IGTA 1PLGH 5L8LB 3HUJF 3VXMB 1JGVH 2F19L 5JUEL 3KWWB 3C5ZB 1H8SA 4G8GB 4XMLL 2WQ8A 2ERJC 4J8RA 2V2WB 5HYSA 4WHTA 4N9OB 4YFLI 4GMSH 3ZZ1A 1X4XA 4G3YL 3MRJB 4RISH 2YPKB 1JYWA 1FIGH 2MTPA 1X5FA 4KQ4H 4FQIH 1OPGH 4YHYB 5ACZA 4MD0B 5AG8A 1OOAA 4K8RC 3CXDL 4X7DC 4XNXL 5KW9H 1HCFX 4G8IA 5EPMB 2Y6SC 5C92A 4CW1A 1R3IH 3AXLB 1ZWIA 5HHOB 2P47B 1QLFA 3JV4B 1UJTA 3DGGA 3PP3H 3AB0C 5D72L 2A0LC 1MHHB 5FOJA 3U46A 1IEAA 4GRMA 2CDEB 4NO0B 3CFCL 3O6FA 1KN2H 3MACH 5FYLE 1KF9B 4Z7OF 4M02A 2VTFA 4LIQL 2HFEA 5ELIA 1BVLB 1WEJL 5TE4L 2C1PB 3BE1H 3DETC 1CD0A 4JFFA 2ADJA 2DWEB 4Z9KB 4MNQE 1T1YB 1ADQL 5K9JL 5IVXF 3NVQA 1XR9B 3BQUA 3CLEH 1HHIB 1P84J 5JDSB 5FV2A 1NJ9A 4EQ2A 4CADB 4TUJA 1HWGB 2I26N 1PKQE 1D5XA 3FTGA 1A7PL 5D2LB 3PV6B 5BV7B 3G08B 5D96C 5I8KH 1R5WA 2O5XH 1FYTE 1RUQL 3IKKA 3LN9A 3MLVH 3CFJA 3BKJL 1ZGLM 5DWUH 3N85L 1MHPH 2DDQH 4OQTA 1RV6X 3L3DA 3MRQB 4DK3A 1CG9B 1XR8A 3DXAB 5ID1B 5C0IB 1FNGB 1XZ0B 2R0LH 3RWJA 1CXEA 2DL9A 3K74B 4EBQL 3L5WA 5FCUL 1N3NA 4N8CL 4RX4D 4UZGA 3SKOA 2AQ1A 1Y6NR 2Z8WC 3VG0L 3VXME 5FOBB 3GSXA 4HFUL 2Z93A 5T5FL 4KI5F 2CO7B 3JV5A 5ANMB 4G8GE 5EU6D 1XIWA 3MGOB 1KGCE 1T2JA 4G8FB 1RZ8B 2EXYC 1DBML 1UKQA 3L3OB 3WD5H 5BZDA 2VNCA 4GKSA 1Q9WB 4LLVB 4X7EC 3IFNH 5HHPB 3GSNH 1RUKL 3NFSH 2K3TA 4OCXH 3QI9C 5MHSE 3F7QA 5FKAA 3O3AA 1I3VA 2YPLD 4LGSB 2DI7A 3QUYB 4HJ0D 3C09C 4HEPG 1YYML 4HS8L 3FL7A 3B9KD 3MUJA 2Z31A 1PG7X 4ISVA 2ESVB 5CBAA 1YNLH 2B8OT 3I02A 4PRPD 2VSDA 2FO4A 2E6PA 4OB5H 1Z9LA 4ZMAT 1S78C 5HHOE 4XP5L 1DLFH 5ESQA 1G7PA 2BP3A 3EYVA 4JFZH 3QXUA 4G6KL 3TFKD 4G42B 1UADC 5C09B 5CJ5A 4X0KB 1OAQL 3ECBA 4YDKL 4S1RH 3S4SB 2N7AA 4KQ3L 5JNYB 3KPLB 3U0PB 5C6PB 4Z7WF 5JHDA 2P1YA 5IGXH 4ZO9A 5EBMA 4X7TA 2WIIB 4HUXB 4WDIA 4NP4H 4QOKD 1PSKH 1CFVL 3L1OH 3L3KB 4HHAA 5D2LE 4JY4A 4K9EL 5KVFL 4ALAL 5EC1A 4XXDA 5IESH 5EZIH 2PKDA 2YD7A 1QSFD 1DEEB 3QYCA 1C5CH 1NGWA 4YE4H 3FHQA 2A83B 1WFTA 3UTSA 1TJIL 4GXVL 3D85D 5HBBA 2NX5B 1WC7A 2GJZA 4LCYA 3DXAE 1A3QA 1GGIH 2HT2C 3PQYA 1E4WH 3MLXL 4LHJB 3I6GA 3DVFA 1VERA 3F58H 1DE4A 2COQA 3WN5A 5H8DA 3IFPB 2ZPKH 3QDJA 1WBYA 3FB6A 5ANME 5JQ6L 3QUXC 4ORZC 1INDH 3V52H 1K9TA 1ND0B 3G6AB 1OLZA 3ULVH 3VWJC 4P9ML 2EDJA 1XFPA 3HMXH 4TTDC 4JJHA 4FG6D 2EIZB 3QDMB 5DMGC 1MAKA 3QEUB 4AEHH 1U8NA 4F3FA 2R2EA 1KULA 4UV7L 4IS6B 4OCMC 3BAEL 5SX5H 2BSTB 4K23L 2CSPA 5M7QA 1S7WB 3ALXA 3MRNA 2ESVE 5IKCB 3MV7D 1SYVA 4DGVL 4R8WH 5DEGA 3KPPA 3T0DA 3QAZC 1VEMA 4MSWA 1OT1A 3MRPB 5FM8A 2A1WH 2CKBH 4F7EB 1A1MA 1FG2A 1TCMA 4XNUH 5F7UA 2L7JA 3CMOL 4YHLH 3QXWA 35C8H 4PREB 5L2JA 4EN3D 4KTDH 4DQOL 3RL2B 2AXGA 4Q7DA 3JWDC 4G5ZH 5C09E 5HI5C 3Q5YA 3SGKC 4Z8FH 2VZOA 4PJAF 3BZEA 5EUOF 3KPOB 4JQIH 4CVZB 5D71L 3WO4C 4L29B 2YKLL 1HSAB 1F8TL 5E8OA 4FFYL 3BN9D 4MJ6A 1AXTH 3NACH 1I7ZB 4I0KA 2P7TB 4WU7A 2NYYD 2F58H 3CLFL 1U91B 4P4KB 3ILQD 4PP2B 1SBSH 4BSVA 1Q94B 5F3BA 4MNQA 2QBWA 3MBEA 4LSRH 3GFUA 1ZVSA 2J3SA 3FN0H 4ZODA 1WF5A 1KT2A 2GUOB 2F5AH 3QPQC 4IEFB 2BX5A 5T5NG 3S36H 2NX5E 3W0WB 1LP9F 2EE9A 4K8RH 3K4DA 5GGSA 3QIBD 2X4QA 4UQ2B 3P9MB 1BBDL 4KDWA 1BQHA 2A6IA 3BX7C 5FDWA 3R0MA 4JPIB 4YIQA 1LGVA 4OF3A 1YY8B 4ZSOB 1DFBL 3T3MF 1I1AB 1MF2H 3HE6A 5FAAA 3GMRB 2C3HA 4WGVB 5GRYA 2QTEA 3H9ZA 1DQML 2OL3A 3FQWB 4LSSH 1J86A 1P5VA 2VAAB 5ISZB 1XGRA 4IIQA 5DYOB 1OF2B 1I7UB 1V3JA 1RZKC 1EEZA 1ZA3B 4DTGH 2XRAL 1IGYB 2Y5TB 1T21A 4NHUB 2WUBH 3QDME 2ORBL 1OD9A 3T0EB 3A6OA 3WHXB 4CDGC 5IEHB 3C5ZA 2WINA 2JB5H 4J3UA 2J8UA 1JVKA 4G8GA 5BVPL 2QR0A 2DM4A 2W0FB 4LOUD 1LHZA 2GQHA 2Z4QB 3RZCB 2V2WA 5KJRH 3SKMB 1AO7D 3RTQA 2DD8L 1SEQL 1W72B 1KIRB 3PWNB 5F6HJ 3VI3E 1K4CA 4JFED 4Z7VA 1Q8MA 3EDKA 3EO9L 1OSPL 4EIGB 3HNTL 1AKJA 1MI5B 3TO2B 4LCIH 4POZC 3RIFK 1X5ZA 4X7CC 1S7VA 3CMGA 5HHVH 5IBLD 3IJSB 1GJIA 4S1DD 3EJJX 3QHFL 3UTZB 1U41A 3N1FC 4H88L 3QH3B 3WLWD 5C86A 3ARGC 2WUCL 1IKNC 1I3GL 3MXWH 4ERSH 4P2OD 5CEZH 4NZRH 4P2RB 2DQFB 1BVLA 3F7VB 5TDPB 3KHOA 1YEFL 1FGNL 2UZYB 1KIQB 1S7QA 4K3GA 2VB5A 1BQUA 4U2ZA 1AGFA 3VI4E 4XVTL 2HLFC 2IPTL 1DUYB 3ARBB 3P4NA 5LCVL 3ZKNC 2PNDA 2I24N 2XA3A 3W0WE 4WJ5B 1E6JH 3WS6C 2EYTB 3CC5B 1WAAF 2ICEB 4AY0A 2R2BB 1BF8A 1NGXA 3AM8C 3PV6A 4K71C 5BZWB 4BYHA 4JN2B 5B39B 3G08A 3DRTA 1P4LA 1RK0A 4H0GA 4ZSOE 2VLRB 3FQRB 1SVCP 2KL6A 1A7RH 4H5SA 4YJZL 1TIUA 1FLTX 3ILPA 4K3DH 1MOEA 3H3PH 5ISZE 2B1AH 4G80B 2D7TH 1J10A 5HY9A 2RGSA 1XZ0A 1G84A 3MROA 2UV3A 4OGYH 4P48A 4JFHD 2IPKB 3TCLB 3ARPA 2PO6C 4RRPG 4PLJD 3S96B 4OD1H 1JE6A 1MCEA 3T0EE 5HXMA 4UNUA 1DL7H 4L4VA 3EFDH 1OTUC 1AE6H 2CKNA 2DQUH 5EO1B 4XCNB 4NUJA 2PYED 3IXTB 4AG4H 2YEZA 2P8LA 5TGBB 1RIHH 3QEHB 1KPRB 2OK0L 4HUVB 5MEOB 5HHPA 5CAYB 1YEGL 3DX6B 3RWEB 4XB8A 1MI5E 4XNMB 3MRBB 3I3BA 1H15B 3F12A 3QQNA 4XGZA 1EEUA 2EICA 3TA3D 5KSAC 4LLUA 5EBWB 4JRYB 4PUBH 2DBJA 4I0PD 2PETA 1IM3B 4LVEA 1B88A 5ALCH 4PYHA 5C9JA 2VLJB 4TOYL 5GQBA 1FCGA 1JWMA 4PLNC 2AI0H 3VH8B 1J0IA 2DLFH 1CS6A 3FJTA 1KENH 3C5JB 4PJ7A 3H2WA 1V7NH 4P2RE 1FZOA 1F02I 4G42A 4PJDA 5TQ2L 4NKMA 1DN2A 3BYTA 4IDJL 4PJFA 1ED3B 4ZS7H 1I1FA 2QQNL 4PTTA 4M8QB 4V2BA 4Y4FC 5T3XE 1XF2B 1NMAL 5JNYA 4HXAH 4FP8L 1NLBH 3LN5B 4NPYB 2V7HB 4UT9L 3V7AE 5KSBA 1IBGH 1OAKH 2WIIA 4OUOA 5LWYH 2FLRT 3P0YL 4PJ9C 3C60C 3BMWA 1CR9L 4JGMA 1NMBL 4KUCF 4CGTA 4KZEH 3VA6A 3U7YL 5HHMB 4J4PC 1K8DA 4JFOB 4TNVK 1SM3H 5CD5D 5HHXL 4XMKL 3MLWH 4LCUB 4J6RL 1SQ2N 3QXVA 4K7PL 5F97E 1KB5H 1DEEA 5FGCB 2VLRE 4FFZH 2A77L 3ARDC 3KJ4B 3QEQA 5C70A 4YZFF 1ZT7A 2R23B 1JZ7A 2LU7A 3IDXH 2X4RB 4YHIA 2KZ1B 2NX5A 2H3NB 1BJ1H 2IMMA 4DW2H 4JFDD 3PXHA 3X12A 3G5VB 4P2QB 3FCTA 1UH4A 4NQED 1CF8L 1TVHA 2FJGA 2X1OA 3JWDH 3OKYA 1HYSD 2R0WL 3DMMC 4RGOH 2MOVA 1QFWI 1H5BB 4RGMC 3E2HC 4HKXA 4MQTB 4XTRD 1DBBL 4HH9B 2CRYA 5EWIL 2X05A 1QFWL 1MREH 4Z7UB 4X6CA 4GQ9L 1B4RA 2X4PA 1ND0A 1SJEA 4DGYL 5L7XH 1HHKB 1ITCA 4FXLA 3SKNB 1FNLA 5TF1H 2HRPH 4KROD 4GS7C 3QDMA 3QEUA 4TVPD 3TIEA 3M17A 1A6AA 5JOPE 4DJMA 3OPZH 5JPNA 3KPSD 4ENEC 3QQ9C 4IRSC 4JDVA 2XOTA 4TULH 4ZQKB 1JI2A 1UB6A 4KY1H 1ACYH 4LRNH 5KVDH 4JRYE 4ZFGH 3TO4B 4U0RC 4IJ3B 4WW2B 2V7NA 2JLLA 2A74B 5CSZA 3GBML 2DMBA 1CLZL 4R90L 2VLJE 3IRZA 2EH8L 3D0LB 4YQXL 1D6VH 3P11L 2XPGB 1DN0A 3NPSC 4ZUUA 4X6DB 2KDGA 5HDLA 4PJCB 3P30L 4BQCA 2GK0A 1RUPH 4R96B 1MFDH 2ZSWB 5FUCE 3UPAA 3O6FC 1A3RL 3RL2A 1TZIA 1UQSB 2Q6WA 2Y23A 4PJ5D 1PAMA 4M6NH 1RZKH 1A1NA 1P7KA 1EO8L 4CVZA 4Y5YC 1J05B 4HWEH 5CILL 5E9DA 3PHOB 5JW4R 5EDXA 5FO8B 3O0RH 4ZG1A 1U93A 4OZGA 3ULUC 1FV1A 4N0FA 3QIUA 4JRXB 5KOMC 3TPUB 3O3BB 5HHME 4AL8H 1U91A 1K8IA 4P4KA 2P46B 2CGRL 5F9JB 4XH2B 5FGCE 3GJFA 1ZV5A 1U6AH 1TITA 1FC2D 2VXUL 1A6UL 1NGZB 1KCVL 5D7JD 3SQOH 3O4LB 1HKLL 1YEKH 3HC3L 4P2QE 3SY0B 1ZHKA 5HJ3A 4F80A 4QRRA 3NZ8B 3MODH 4Y4KA 1U8MA 2VN4A 1SYSA 1ZAGA 4EI6B 1VDGA 4Y5VB 1HN1A 3FQWA 4QWWC 2AAVA 4OD3H 4BQ9A 2R0ZL 4JKPL 4Z7UE 4QXGL 1T89C 5ISZA 5K93A 3SJVA 4FMKA 3SGEH 1WZ1H 1DQQA 4HWBH 5D1XD 3NABL 1QPPA 4XVUC 4XHJC 1BBJA 4LASL 3PDOA 4L4TD 2XQBL 3UC0H 5IJKC 2DKSA 3UYPA 5K9QI 4GG6F 3V6OA 3D9AH 1QFHA 1U8HA 1ZT1B 4KGLA 5D1ZD 1BLNB 4MDIB 3TIDA 3GMOA 2AXHA 1A9BA 3SKMA 1QHOA 1Q9KA 1W72A 1RHHB 5E8PB 2OZ4L 1ZOXA 1I9EA 2GFBB 2H32B 4LCCB 3G5ZA 1T6VN 3NN8B 4HGMA 4QXTA 3NPZB 1MI5A 4CNIB 4X6DE 2DYPA 4PJCE 2HJLB 2QADC 3MX0A 2XZCL 1UEYA 4HS3A 3IJSA 3PWLB 3CFEB 5SWQA 4M6OL 5F1SA 4QRPA 4M48H 4JHWL 2X4OB 3UX9B 2A73A 1VADB 2NXZC 3WCYA 5IEKB 3T1FB 5CJBA 4P9HL 1CFTB 1LNUA 3V4PL 3L7EB 5HGBB 4PLOB 4P2RA 3D2UA 4CKVX 4RAVB 4ONGL 1I4FB 3F7VA 4JRXE 4NKQB 4Q9CA 5I18H 2J6EA 4XBEH 1A0QH 5I9QC 3SHSA 1J8HA 5ACMA 1KC5H 3P4OB 5DZLA 5EZJA 5C2BH 3P77B 2AJUH 1FNEB 3PV7A 4MXVF 2VLKA 3RUGB 3LKQA 4XBPA 4NQSB 3BDYH 2DQGH 3QIWB 4DUWA 2NY4B 3KDMA 5IMMA 3O4LE 2Q3AA 2ICEA 3O2WH 2R2BA 5D7IA 1EFXD 5BZWA 4MLIA 1T1WA 5HDQH 4EOWL 4OUUB 4RBPH 3KLHC 1FAIL 2B20A 5C6TL 4PRBB 5IV2B 1JF6A 3FQNB 5H2BB 5BS0A 1F6AB 4JJ5B 3HI6L 1KJ2B 3D69B 2VZUA 3SE4A 4BUHA 1UJ3B 1QD0A 1MQKH 1QFPA 3CX5K 4U6TA 5L9DH 1TZHA 3HC4L 3TZVA 1OP5K 4IRJB 5CJQH 3TCLA 5EO0B 3S96A 1FBIL 4RMVA 5EIQA 3IDNB 5IB5B 4UT6L 5MERB 4LKXB 4N8VG 3RFZC 3HRPA 2YR3A 2P4AB 3N1GC 1RUMH 5TH2B 3GHBL 1XF5B 4K7PY 4ZAKD 5EO1A 5FYKD 2VITB 2QJDA 1TMCB 4XCNA 4LEXH 5IFJB 2RFXA 5D8JL 1NC2B 3OL2A 2Q1EA 3IXTA 1JFQL 3L3GB 5KG9A 1OY3B 4NQCD 1M7IA 4FQ2L 5C0AB 4HUVA 3AC0A 1ITBB 4HCRH 1UWGL 2BVOA 3QZWA 5C0CB 3MYJA 1I9JH 1W0YT 5H35A 3O6MH 3IDJB 4XNMA 3IDYC 5L2KB 1UM5H 3HNSH 4PJIA 3BKML 3GJFK 5D70H 1UKTA 3U82B 3MV9D 4JN1H 5EBWA 4JRYA 5ICXA 1CLYH 4NO3B 3S5LB 2HJFB 1NDMB 5HYQB 2NY6B 2VLJA 5IQ9B 1Q0YL 3U1SH 1CDHA 4KAQH 4U6VH 4O2CA 4Q2ZA 3BEWA 1AGBB 2YK1H 3C5JA 3K7UA 3JTSB 5HDBF 4HBQA 1F2XK 3LKSB 3OJDA 2E6QA 3RVXC 1XF2A 4P5MB 4MNGB 3NAAL 1NDGB 2GSIB 3OGOE 3MBEC 3SGDH 3F8UB 5DSCA 3RUGE 4NPYA 4U31A 4XPTH 5LG1A 3A6BL 4WI2A 3JV0A 5C08A 1D9KD 3E6FA 2IFFL 3QRGH 1YMHB 4PJEA 1SJHB 4X7SL 5AZEH 3I84A 4LSTL 3T4AA 4KVNL 1G7LA 1M71A 3HC0B 4N5ED 3D3VD 4LHUB 5HI3D 4PGZA 3JWOC 1CD8A 5D6DC 3C8HA 4JO1H 4WUUA 4JVWA 3UROR 1CD1B 3MQIA 1IAKA 3MJ9H 1QUNA 1U92B 3C5ZC 1NBVL 4M1DL 4K2UL 4XMPH 1A5FL 1JK8B 3BRFA 4S2SA 3UO1L 1NH6A 3BFOA 3WDJA 1IFHL 3ULUH 2Q86A 4M5ZH 2Z8RA 5C0AE 5GRXG 4NDMB 1IGIH 3FB8A 4JZJB 5AWNH 2EDRA 4XPFH 1GZPA 4F37K 5C0CE 2NY1D 3LS5H 5T3ZD 5L2KE 4YHYC 4LKCB 1J18A 3HRZB 3QFJA 3NTCH 4ZQKA 4JLRA 4NRYB 4WNQB 2CRIA 5IB3B 1P5UA 3MCKA 4PR5A 3PIQA 4LRIA 4D9QE 3TO4A 5J0BA 4WW2A 3K2UH 2F53A 3W2DL 2P42B 3GI9L 3DX9A 2BVUA 3ALPA 3D0LA 1QBMH 1CZ8L 3LB6C 3W11C 4MA7H 1GGBL 4TPRH 5CMAB 3WDHA 4OQ1A 2R4SH 3E6HB 4R96A 2ZSWA 4GRLC 5ID0A 5GS2H 1BOYA 5LJYH 4KI5D 2HVKA 4Q0XH 3LB6D 4AMKL 5FO9B 4P3DA 3ZDXE 4NFBA 4UI2A 1C1EH 4ZUTA 4MNGE 3SDCB 4FABL 3CFIC 1OAZL 4JY5H 4GRLD 3L3HB 3PHOA 3S3JA 4WO4D 4OCSH 1LO0L 1BGXL 1RY7B 4ZNCD 2X70A 5ETUB 1NBYA 2HYMA 1T3FA 3GNML 1RJZB 4F7PB 3QUMH 5EZOH 5F7EH 1C5DB 5BV7C 1OD7A 4PV9A 4ETQA 1BFOA 4NC2B 1KCUH 4JG0L 1FE8L 4J7RA 2F9BT 4DKEL 1A02N 3FO9A 4YNYA 4N0CC 1NGZA 1UXWB 1VGKA 1AFVH 1KOAA 4I9WD 2WK2A 3V9FA 3O6LH 1JHTB 2HA1A 4O51B 1WT5C 5F1OB 4NT6B 1M7DB 2ZSVA 4YHOH 5JQHC 2CDGA 3ARTA 2AKRB 4G7VL 1QLEH 3ZT5A 1TVBB 5E2JA 4GG8B 2I5YL 2R56H 4Y1AA 3IFLL 4WI4A 3TYGH 3F7YB 2FGZA 1LK2A 4ZFFB 5C0RL 4OLXL 5EIIA 1S9VA 1S9YB 1I3RB 2OYPA 7CGTA 1R3KB 1QYGL 2FX7L 5J89A 3DROB 1MH5B 1D5ZB 1ZT1A 4O9HH 5HI4D 3MNZA 4PJHB 4AIZB 1BLNA 3QUYC 1R3LA 1J88A 4LVNB 4KJYB 1VESA 4V1DA 4YDVA 1KTDB 1T2XA 4ODWA 5JW4Q 3GSQA 4JFQA 1YY9D 1P2CA 1SEBA 4H26B 1YECH 5GRUL 2GFBA 1VGEL 5GSRA 3MA9L 4KJQC 3LPWA 3GKZA 3U9PL 1A7OL 5F6HI 1U42A 5T1MA 1CN4A 1N0XL 2GCYB 1LO3L 3U7WL 2PW2B 5KZCD 5E1AB 3PWLA 3GRWH 1I7TA 5F1NA 3HNVH 1E4XI 2VZVA 1DQJB 3RVTD 3WJLC 4ZUSB 2GEEA 2O5ZL 1LK3H 2QSQA 2VDKH 1E4XL 3OR7A 4OTXL 4C57C 2YUXA 1IE5A 1FL5A 2R9HD 2V5SA 1EBPA 2YMXL 3L7EA 3QUZD 4I5BA 1G9ML 4KC3B 4R2GD 3OB8A 2CMRL 4U6HB 2HLAB 4MAUH 1AIFB 1J87A 4HJGB 3VXUD 3C5SB 1N26A 2J12B 1FH5L 2Z91B 1UVQB 3ZHLA 1FNEA 3EYFA 5C0JA 5KTEH 4HIEA 3IS1X 4FQJH 2ZCKL 4HGWB 1AHWB 1WK0A 1Z3GL 3AREB 5E0QA 1Q0XL 3VFGH 3LPGA 4MLSA 1KIPB 4WCYL 4KWUA 1TJGH 2MQCA 3RWIB 2AGJL 1ODAA 4PJGB 2E9IA 43C9B 4L8SB 5JXAH 5DC4B 4Y2DB 5IHZB 3MZTA 4GXUN 3OKEA 4PY7B 4GOSA 3O45A 3FQNA 5H2BA 1A6PA 1MRFH 2V5TA 3S3PA 3T0VA 2WLZA 3ZSTA 3M8OH 2BRQA 1FNHA 4F7TA 4MJIB 5CZXC 3VRIA 4S0TD 1WV7T 5EOCH 3HKFA 5GGVL 2EKSB 5FYLH 4YC2B 2GSGA 2XXCB 3BD4A 4QYOA 5IB5A 5MERA 1ZSDB 4X80H 3RKPA 5LXGH 1FGVL 1J9CT 4OLZH 3WDIA 5GGUA 5TH2A 4LPYA 1K6QH 3G6DH 3Q48A 1FVCA 1OW0A 4PJHE 1GHFH 2PTUA 4RGND 1DQLH 5DC9B 3VDAA 1C7SA 3MJGX 3OJ2C 4X6BB 5DD6B 4YWGH 2FEDD 2IBZY 4Y16D 5E99L 2E7MA 3QA3B 2CPCA 1AP2A 3L7FB 1RFDH 1T7VA 3QG6A 2X4SB 4Z7VF 5KBNC 4OCWH 4BKLA 4JFYA 2A9NL 1BWWA 3P0VH 3EUUA 2FR4A 2Z35A 4OF0A 3DUSA 4LBEB 4XCYB 3VDBA 4MXWL 3JWOH 3ZKMC 3NH7L 1EXUB 3QNYA 1C16B 4GLRI 4NO3A 1C12A 2R4RH 1FVEA 1LEGB 2OR9L 1CICB 3RDTA 5HYQA 2P24A 2XKUA 2ZG2A 1RZIA 2QHRL 2YWYA 4L9LA 2XG5A 3BKCL 3ZHDA 3RY6A 1UH2A 1AD0B 5IF0B 2C9AA 3MV01 2W38A 3VFSB 4P4KC 5L88H 3CIQA 2IQAB 4NZTH 4D0DA 5IMKA 3BIKA 2D0FA 1YEHL 2GSIA 1NSNL 4ELKA 1GPOH 1N6UA 5E6IB 5J11B 3PJSB 3B9EA 1HDMB 5CHNB 1G9NC 2V6HA 1TXKA 4BFIB 1NBQA 3NA9H 5ESVB 1YMHA 1CE1H 4BUGA 1G6RB 5IBUG 5MEND 4PJGE 4M1GL 4Z78B 3ROLB 3RGHA 2J4WH 3MFGB 3EFFB 5I74B 5DJCB 4F7CA 1I1AC 2NY0B 4OLYL 4PJBB 3QSKB 3O9WD 1UM6L 4KKLD 4ZNEE 4MAYA 3GJEB 4JO3H 2JJVA 4YBQD 2AK4B 1AD9B 2P44B 3AFLA 4B53A 1WITA 4HMEA 3WIFB 4MJIE 2L0DA 2R1YA 2VLLA 1QRNB 4RAUB 5C9KA 2DQCL 3OKOA 4S10A 2CRZA 5I76B 1GIGH 2D03H 3HZMA 4ZPTB 4JKKA 4BSWB 5JMOC 1MWAA 4OCRL 1F3JB 4O2EA 4FNLH 3T0EC 1CU4L 3OWEA 4X98B 1II4E 1JK8A 4Z7QE 3RZCC 5SWZA 3UXFA 4YBHA 4D9RD 3MZGB 1FLRL 3FB7B 3D39D 5DRWB 3NFNB 2GI7A 4LLYB 4ZS6C 4EI5D 2AJSL 3STZB 5BV7H 1AQKH 2Z8SA 4PRIB 4YK4B 4ZOEA 1VEOA 1KEMH 2BHYA 3VFNA 4OIIH 4OLUH 1A3LH 2AJZB 2VR9A 3H8NA 4OT1L 1QLRB 4I8DA 2W9EL 2DQEL 3VWKB 4HPYH 3MLZL 4GRWF 5C7XL 4XB7A 3O11A 15C8H 4WI3A 1F4WH 4BH8B 4UV4L 1FO0B 2EDEA 5JTWA 4HUUA 3IT8D 4CBPA 2EZ0C 2G2RB 3IU3B 4FXKA 1OAUL 1OLLA 2HT3D 2YD3A 2MQ3A 4WFGE 3IU4H 5C07B 4P5TB 1T20B 3E8UL 4PJ7F 5DJAB 3SDAB 3VRLF 2BRRH 4WI6A 4OIBA 2KKQA 3K8LA 4Y4HB 5DMYA 1IQDA 3FB5B 1ZANH 1H3UA 2AEPH 4PJFF 3S8WA 2OMNA 4IHOA 3TV3H 4ZO7A 1KCKA 3FOLB 4ODHL 4HG4K 2JKXA 3ARBC 1EMTL 3H42L 1HSBA 1CGVA 4WTZA 3OKLA 1I9IL 1KYOJ 5ETUA 4C4KT 3WXWL 2FWOA 3D0VB 4YFLF 4F7PA 4XP1H 4QTHB 5AYUH 4WWKD 2NR6C 3QULB 3KLAB 1K4DA 1U9KA 3CVIL 2JTDA 2WBJD 5EFIB 3HR5A 4M43H 1DSFH 4PJBE 3VFRA 3RWFA 4LSUH 3QUKA 3ESUF 3MO1A 1DANU 2AK4E 4JM2A 1OTSC 4XC1L 1J0JA 4YXKL 1QRNE 3JV6B 4HD9A 4NT6A 5JDJA 3RAJL 2X41A 1CTNA 2CK0L 3VGFA 2QKIB 5I1KH 3LKPA 4UDUA 3BEVA 2AEQL 3MOBH 4TRPL 3KYMA 1YNTA 2XT1B 2X4NA 1ACZA 2LVEA 4MCZA 2IAMA 2OR8A 5K9OB 1CBVH 2VISB 3M45A 2KPNA 1PLGL 3UZVB 5I0ZA 4XBGB 1UYWH 3LY6A 5FYKL 1G7IB 4JGJA 3OAZH 1S9YA 2X89A 3SBWA 1GC1L