1M71A

Crystal structure of a monoclonal fab specific for shigella flexneri y lipopolysaccharide
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
215
structure length
215
Chain Sequence
DVVLTQTPLSLPVRLGDQASISCRSSQSLLHSDGNTYLHWYLQKPGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYFCSQTTHVPTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular Recognition of Oligosaccharide Epitopes by a Monoclonal Fab Specific for Shigella flexneri Y Lipopolysaccharide: X-ray Structures and Thermodyanamics
pubmed doi rcsb
molecule keywords light chain of the monoclonal antibody Fab SYA/J6
molecule tags Immune system
source organism Mus musculus
total genus 44
structure length 215
sequence length 215
ec nomenclature
pdb deposition date 2002-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1m71A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1m71A01
3QZWA 2OXGA 4JM2F 4UB0H 1XZ0A 1T1XB 3O8XA 4OLUH 1P69B 2AJSH 2WIIA 3RAJH 5EIQA 5FYKH 3BDYH 2ESVD 3VFGH 3V0VB 1FGNL 2KL6A 1BQHA 5DC0A 1K8IA 5EZOH 5MP6H 3BH8A 3CSYB 5DDHB 4OZ4B 3IFLH 2ITCB 1OLLA 5FECB 2B5IC 4P59H 4MD5B 3ECBB 1SYSA 1NCNA 3D3VB 4PJ7E 1HH6B 3OKKB 4DEPB 4OT1H 2H2SD 1ITBB 1ZT7A 1FO0H 3OKNA 3ES6B 3HLAA 3MCKA 5F7FA 3B2UD 4JQXC 1X5HA 3EJZD 3DBXB 2EYTB 3WLWD 2WWMD 3GK8L 2P5ED 1NCBH 3EDEA 3MCLL 2J8UA 1N0XL 4EJ1C 2VAJA 5ALCL 1A47A 4JREB 4NO2B 4AEHH 4A2LA 1FYTA 3MA7B 4UT9H 2VIRB 1UG9A 4LF3A 4RX4D 2YD1A 4AT6B 4K94C 1XF1A 4L29A 4X9GA 3F8UB 3UYPA 4X7EC 4NRXB 2O26U 1MCCA 4HEME 2Q7NA 4N8PA 1U91B 4WHYH 3UPRB 1ZA3A 4R7DA 4EUPH 2AXFB 1UXWB 3B9DA 4JCMA 2YKLL 1LILA 1LP9A 2XTJC 4K23L 5DHYA 5HDOA 3VFOB 4LPTA 3NZHH 1CU4H 5D1XB 1RZJH 1XCTB 2VLRA 3QUYC 5ENWB 3QUXB 4RAVA 4WNQA 1TZIA 5SWSB 5J6GB 1B2WH 1DR9A 3AGVA 1CGUA 3H2WA 2QQKH 3BRGC 1B6UA 2QTEA 5I1GL 4MQXC 3NCYP 4FTVA 3S4SA 4NN6B 2VZTA 3WFCL 5D7LD 4FQIH 1CGTA 4Y4HB 4DN3H 4K94H 3DTXA 1IGML 1FV1B 4NKMA 2WM0A 3UTSE 1KCUH 1YY8A 5CBAA 2R1WA 1U95A 5BQ7B 1AO7E 4L1DA 3V5KA 5DJ2A 4N5UA 3Q0HA 4QRUA 5FV2A 1FPTL 4ODUB 4Y5XA 1K3IA 1X5XA 3I3DA 4EIGB 5D7IE 2XFXB 1TJHH 1UWXH 5C07E 3O3BA 4R26L 2X1OA 4OLZL 4WI6A 1MJ8H 2F74B 4F7EB 3BP6A 3RGVD 2Q7YA 3S3PA 3EYFA 3BIAX 4OD1H 2BNRD 2X89D 3U36B 4I4WA 1EZVY 4NQVB 1ZKAA 1ZLUK 2YC1A 2OZ4H 3IFPB 2ZCHH 4TSAL 2DL9A 2CLRA 4KKLD 2GCYA 1FNGB 1MNUH 4F7CB 2WBJC 2X4NB 2MPAL 5CKGA 4F37K 4WWKD 5E00A 1MLCB 3PWNA 3UTZB 1A3QA 1XF5A 4HIJA 1LEGA 1B0RA 4IJ3B 5I8EB 2H8PB 3FHAA 1OAUL 1YMMA 3AS1A 2RR3A 3MLSL 5ESQA 3MLYL 4M8QA 1XGUA 3U1SH 4NRZA 3B2VL 2IANE 2X44D 5AZ2L 5KTEL 2OR9H 5GISL 1IT9L 1RFDL 4HWEL 5C0AA 2CRMA 5EUKB 2V2XB 3PP4L 2XKNA 1MLBB 2CDFA 5HYQA 4OCWL 4N1CA 1F11B 5FO9A 3FN0H 3ZL4H 1KB5B 4KUCF 3IKKA 5BW7A 4KKCC 5EIIA 4HIHB 4XP6H 2AK4B 2F54D 2G5RA 4P99A 3IT8D 5TF1H 3FOLB 3QULB 4IRJC 2L0DA 1GAFH 4KKBD 1JYXA 5I76B 1ZOXA 4CADA 1HWGB 2BCKB 3RVXD 1OSZA 4GAFB 1BEYH 1FYHB 3WSQH 1F4WL 5A1AA 1P7QB 1QR1A 4FXGB 3FAXA 4OM0H 4JFQB 1X7QA 2NX5A 3QPXL 2VABA 5F88B 5BXFA 3KVQA 7FABL 5CGYC 3TVMC 3FFCA 2W9DH 3OKYA 5I66A 3O2WL 3MO1A 1HYSD 4PRNA 4OV5A 5KSBB 4DVRH 1GYAA 4OJFH 2BMKB 4ELME 3HE7B 1OWWA 2DIBA 5I75B 2N7BA 3GHBL 1LP9F 4M3JA 5I1IH 2AGJL 2AERT 5I8KH 5F89A 2PO6A 3HCVB 3MGAA 5KG9B 2VDQH 3TIDB 5GS0D 5ERWB 3GSQB 4XRCB 3TYGL 1NCDH 1MAMH 3QUKA 4JVPA 4TUKH 2C4FU 4AM0B 4LPCA 3VFTB 2AQ2A 4HV8A 3VXUE 5JDSA 2BVOA 2XWTB 3BEVA 5E4EB 5EBMA 5L0QB 3P0YH 4P5MA 1DDHB 4WUKL 3B6SB 3ROOA 1F42A 4CMMB 4JZNB 4NUJA 5IVXB 1HH9B 1I1YA 2X1XR 4JVWA 4ZOEA 3VFNA 4C55A 2WINA 4HC1H 3BDBA 3CCHB 3MV7E 5D6CB 1D5XA 3UAJD 2CJUL 3FO2A 3CSBA 2OL3A 3VW3H 3J8F7 4PYHA 3VRLF 3ALPA 3P9MA 1KPRA 4JFYA 1JYNA 4NQCA 1G0YR 3HZMA 4KPHH 1JTTA 4O4YH 4PJAA 3BPNB 2FEDD 2FJHB 1AD0B 3ULSB 3WS6A 3O8XD 1NCWH 4S2SB 4NQDB 4LLMB 1JZ8A 3IRZA 2DQFB 2P4AB 4XAKE 1NC2A 3K0WA 3WLWC 2WWMC 3CFCH 3S6CA 3BD3A 3X13A 4DZBA 3CU7A 3V6ZB 3GMPB 4XBPA 3KYMA 3VE0A 1C5CL 2XZQH 1ZVYA 3JV6A 5AUMA 1RJZA 5ICZB 3C2AH 2DIJA 4Q6YA 4KUCD 4YK4B 2PYEA 3INUH 1E28A 4JQVA 1H3TA 1CFTB 3K1DA 5C0DA 3FKUS 3DX6A 2XOTA 1X9QA 1L6ZA 3LN9A 4QOKA 1KEMH 3SJVB 3QUZA 1UM5L 3BKJL 3PUCA 4M61B 3FRPA 1F6AB 3EOAB 1HWHB 3S35L 4UIKH 5I1DA 4ZO8A 1EERB 2DLIA 3GJFK 3E8UL 4QRPA 3WIHA 2W9EL 3I6GA 2UZYB 1RIUL 4PJ9B 3NH7H 5JW4M 1NMCC 3BGFB 4L8CA 4HKXB 1J0HA 3ZSSA 1N6UA 3ZT7A 3HZKA 4PRDA 1WFUA 3PGFL 5T33H 1INEL 1FYTD 5J57B 5ID0B 4MXQD 2Q8BH 3TPUB 1UVQA 3C6SB 4EIZC 4Q9RH 4C83B 5EO9A 3M17B 2P8PA 2E9IA 3QUMH 4HXAH 2YA2A 4G9FB 5EU6A 1C8PA 1H9VA 1BF2A 3G5XA 2O5ZL 1D5ZA 2YRLA 2H45A 4OF7A 2ADIB 4OLXL 2FJGB 4GW1A 12E8L 1IAII 4FQQB 5IR1A 4HWUA 3UTOA 1DQDL 5J11B 2W92A 1QA9B 2YXFA 4JPIB 3BWAB 1S78D 5FK9A 3RGVC 3SKJH 4FTVD 3VXTB 5CEXA 5IW3A 1T89C 1U58A 5F44A 2WUCH 5JMOC 1G7MA 3BD4A 5TH2A 1H5BC 4QRSA 1DQJA 3Q3GA 4KKLC 1R3JB 4R0LA 2CLZA 4PRPA 4G8IA 4WWKC 5C0CA 4FZEL 3M1BB 3QHFL 2GTWB 5FYJU 5C08B 3PIQB 3FFDA 4HZLB 4P2OA 4R7NA 3F5WB 3FQWB 3JWOL 4L9LB 4WCYL 2XTLA 4FQXB 2DQIH 2XA8H 5FUCE 4XNUH 1JE6A 4ONHA 5L8JB 3EO1A 4ZDHB 4NZTL 5CJXC 3NACL 3V6BR 1XGTA 3GKWH 2HJLB 3W0WE 4JFXA 4YWGH 1IGTB 2DBJA 2AS5M 3HNSH 4D9QD 5KVGH 4EQ3A 5F70A 3SGKC 3T4YB 4FZ8L 4NWUL 4YDLB 4N1EA 5DHXB 25C8L 2O5XH 4KJWD 3BJ91 4ZMAT 3N06B 1UJTA 3O9WA 4QTIL 5IEHB 4MB5A 3C5ZA 1FNFA 4MXVF 3V0WH 3OX8A 3UC0H 4PJAF 4KKBC 1G7JB 1YMMD 2R2BB 3RVXC 3QA3B 3A67H 2D2OA 1KN4H 3IFOB 4GUPB 1WWBX 2D9QB 4U7MA 4OFVA 2ICEB 4RISL 1JHTB 4YDKL 3PWJA 5HI5D 4Y0GA 5C0AD 5JXAH 3T0EA 3KPPA 4NNYB 1SEBA 5ANMB 3GBMH 3ZLQC 2FH8A 3UDWC 3AS2A 2HG5A 5FA4A 3DX7B 4JZJA 4M4PA 3R8QA 2VZSA 5ITBL 1HYSC 2BERA 3AAZB 1J1OH 2F5AL 3V5DB 4C56E 5K9OB 3FQRA 2ZJSL 4FMKA 5KN5B 2RFXA 2G9HA 2FX8H 5JW5B 4QXTA 1CE1L 2ZSVB 3MZTA 4LSVH 3BSZH 2K9UA 1KLFA 4PJGE 4WU5A 3QG6A 1Z9OA 2VDML 5F7NC 2FL5A 1LO4H 4UV7H 4O2EB 1A6VH 2V5RA 1OF2A 3LPFA 1ZAGA 5DJ0B 4GXVH 3EHBD 3AU1A 3K8MA 4AQOA 4C58B 2QSCL 4APQA 4B5EA 5IQ7L 2FX9H 2NX5D 4DUVA 1FG2A 3LEVH 4YXKH 1LEKB 5DA0B 3FFCD 3HNVL 4NM4H 5L2KA 4JFOB 4KK8D 3SDAC 3R0NA 1CIDA 3TCLA 4U1MA 3O2VH 4E41B 1U8LA 1V7NH 3Q48A 1QHPA 3UO1H 5B38A 3UAJC 5MENB 1INDL 1ULVA 2PO6D 2IC2A 3MRPB 3O11A 3LS4H 3Q2CA 4Z7QE 5CEZE 5IGXH 3VFWB 4G43B 2W60A 1OARL 3GSNA 3ZKQD 3EO9H 4K7FB 3W2DH 4G6FD 4YBHA 2QV2A 5DS8B 3BPCA 4WY7H 5C2UB 2FEDC 1G6RH 4XP9L 3WN5A 3O8XC 5H94A 1N26A 2WLYA 3H9SB 5D96C 1J5OL 3QFDA 1T6VN 3WO3B 3GDBA 1NMAH 2AW2A 2DICA 2VAAA 3ZYZA 4FFYH 2PXYB 1IQWH 4Z76A 4N8VA 3RUGE 3ULUF 2OCFD 2B1AH 3MGOA 1S7XB 3BAEL 1HDMB 4JDTL 5D1ZB 4RA0C 4E42A 3QG7H 5AYQA 5DMIH 2IAMA 1BAFL 4XH2A 3VXQA 3G6JB 3BJLA 4NQCD 4QT5A 4PV9B 5B39G 5E2TL 3FCTA 1BOGA 2ATPB 2H26A 4WHDA 5L6YH 1N5YL 2I9TB 3QT2A 3VGBA 1BP3B 1G84A 1S9XB 2BNQB 5CWSA 1BD2B 3SQOH 1NC2D 1R6VA 4MDIB 1EHNA 4MWFB 4CVXB 2K1MA 3SOBH 5GGVH 1S5IH 1OOAA 3D85A 1Q94B 1SJHB 4XPBH 1DEDA 1IC5L 3UTTA 3CDCA 2AJ3A 4MXQC 2IALB 3MFFB 4HMDA 3ARFA 1TETL 2GY5A 4JR9L 5C1MB 2PYED 3CK0H 1GIGL 3PWPE 3BGAA 1O7SA 1T4KA 3VH8B 4X83A 2QSQA 4WHYG 5C0EA 4QOKD 3QUZD 4EUPG 4P57B 5IVZA 1IMHC 2FEEI 4NZUH 1PZ5B 4QHMB 4XVTH 4QRPD 4JFEE 2IQ9H 1TQCB 5CGMA 3KLHC 4YHZL 2VZ1A 5BOZG 2GSIA 2LFGA 4F80A 5E1HB 3ZZ1A 2LE9A 4DQOH 1C16B 4YC2C 5A2FA 3QDMB 1JNHB 3CSGA 1WICA 1NFDA 1YUHB 4DKAA 1B0WA 2DTMH 4JM2B 4KH2A 1S78C 1ZSDB 2R0KL 4OD3H 5EPMB 1TCRB 3D25A 5INCB 1S7WB 5IESH 1DN2A 3S3JA 1JHLL 3TO4A 1U3ZA 2CDGA 3F7PC 4H25B 5DVNA 4ZSOA 1ES0A 3BE1L 3V52L 2EYRA 2NR6D 5EU6D 4UU9B 4AIOA 5IB5A 1RZIA 4LRNH 2EECA 4YR6A 2CMRH 4WI7A 3VGGA 4Y5XC 5FFLA 4JFPB 4ZFZA 2ZUXA 4HSQA 3WS3B 3L5WB 3VDCA 1S9VB 4HPOL 2PCPA 4OIIL 5AZEH 2UUDH 4JHAL 3LRGA 4LPYA 3DECA 3IXTA 1U92B 1KLGB 5FGSA 4S11A 1MREH 2P5WA 1FCCA 1FN4A 2DQJL 3ULUD 2WQRA 4PJ8A 5D2NB 1KB5L 1T1YA 1I1FA 4W81A 1JFQH 4KJWC 4X7SH 4LCIH 3L5IA 2QLVB 4GLRH 2VLKA 4NO5B 4PRPD 2UYLA 5D71H 1ZS8A 5C0CD 4CU6A 3NN8B 5I1HH 1W0VB 1FL3A 1LDPH 4P2OD 2VDLH 4JJ5A 2HP4A 4LQ1A 1BFVH 1BGXL 4KJPD 3PGCA 1A5FH 4F57H 5KJRL 1WWWX 1JN6B 4KKAD 2D4FA 4LDOB 8CGTA 2UZIL 2D7TL 3GNML 3TJEL 5HI5C 4UB0L 4LNRB 3LQZA 1HHJA 3CXDH 5FYKE 5FGCB 1ZHLB 3CVHA 1UWGL 1A64A 1IAIL 5FV1L 1UACL 5FYKL 5DUMH 3BDYL 4NT6A 5BW7C 2X5PA 4N0UA 1EBAA 4L4TB 1IZJA 2YR3A 3O9WD 2XA3A 3C5ZD 2KDGA 3BKYH 2EDJA 4DGYH 4PUBL 1PYWA 3SCMB 1M6OA 2FYYA 2HJFA 1MJUH 1S3KH 2QQNH 1WFNA 4D9LH 3FONB 5F3BA 1KIRB 1WJ3A 3LH2H 5BS0E 1PY4A 1QLEH 3T0ED 3EHBC 4PJ5B 4G6MH 4YHIA 2ATKA 1IVLA 5IWLA 2WUBH 3TNMA 3UYRL 1X5FA 1CL7I 2EC8A 4V2CB 15C8L 1Y0LB 2A6DB 4Y5VA 4KK8C 1J11A 5EORH 4RDQF 4CVZB 2VOTA 5L88L 4Z7OE 5EOCH 2H1PL 1CTOA 1B0GB 2W0PA 3O4OB 2PO6C 3CFDB 2A9NL 1IM9A 1MVUB 3C9NA 5TE6L 1DLFH 5FIEA 3FL7A 4FP8L 1A9EB 1A7OH 3NZHL 4OUUB 4P2RA 4RMRA 5E08L 3EOTL 4P46C 1NFDF 3HUJE 3QEQA 5IM7A 3V7MA 3L7FB 4G5ZL 1QPXA 1KTKE 1MI5A 5ITFA 5DZNA 3SDDA 5L2KD 1YNLH 4OCNC 1J12A 5IB3A 1NCUA 2ZOLB 2A38A 2CKBH 4M1CD 1S9WB 1MSPA 4MJIA 2Z35B 1HQRB 4YHOH 3ZMRA 4HF5H 1A1OB 4MX7B 2E6QA 1EH9A 4V1DB 2XTJE 2AVGA 3I3BA 5DTFB 2HT4D 1NAKH 4LBEA 2C1PA 3MLXH 2OJZL 4G7VH 2Y25A 5CZXD 1ZLVK 3T8XB 3WS6C 1R5VA 1BIIB 1XGRA 4KRNA 5KAQF 3AREB 3DNKA 1OY3B 4XPHH 1H8NA 4XNMB 4JGJA 3HAEB 1FC1A 2QR0A 1V5JA 2XWBB 1HNFA 1MFDH 1RIHH 4NHUB 4KV5F 3BUTA 4L29B 1I3RB 1JYWA 2IAMD 2ZCHL 3I50L 4JFFE 1A4JA 4JQVC 4X5WB 3RJQB 1OGTB 1EVTC 2OL3H 3QUZC 1FNEB 4MQ7B 1K85A 2J8HA 2YPKB 4U3CA 5HGHA 3P2TA 2MKWA 4L5FH 5GGTA 1QR4A 3HC0A 1PZUB 1EJOH 5E7FA 3C09B 1AQDB 1JF6A 1DQLL 3QXDB 3TP4A 1LO5A 1XF4A 4U7KA 1UJ3A 3GB7B 4JHWH 3D85D 3SPVB 3KPSE 2X4OA 4LEOB 3UTTD 3FN3A 4GBXA 4OZIA 2P7TB 1KJ3L 2CDEB 3ARFD 1J0ZA 2ITDA 5F9WC 4NRYB 3S96A 5MERB 3BGMA 1JPTH 1RJCA 4JDZA 3CH1B 3S5LB 5FOBB 1A7BA 4XCFL 4U1NA 4YX2H 1KIPA 1MCNA 4GAGH 4XPAH 4K71C 4P5KA 1YECL 2ZUVA 1S7UB 2IPUG 4PJEB 5IKCA 1OAXH 5T3ZD 3GMOB 3SY0B 2EIZB 4O02H 3WIHH 3PNWA 1RU9L 2X4RA 1HXYA 2VUYA 3S34H 1CDCA 1ND0B 1SHMA 1U8JA 2P8LA 4OZHB 2CK0L 5DRZA 4O2CB 3H3BC 2PTVA 4OM0L 1INQA 2OTUB 4F2MB 3TO4D 5C0BA 3FQUA 3VWJA 1VFAB 3ULUC 5TDNB 4XMKH 4Z7UE 5DK2A 4F7PA 3VH8G 3WXVL 1MCHA 4OJFL 5INDB 4B53A 5DXWA 3VCLB 3TBWB 5C71A 4K8RL 2Z0BA 2ICWJ 4P2OC 1EMTH 4KJPC 3LHPL 2FEEL 2XQYK 3DXAB 3D39E 3NIDE 2QBWA 4WWID 4PPTA 3RDTA 4WEBH 1DCLA 5DRWB 2EDFA 1IKFH 5LCVL 1G7LB 1OB1B 1K8DB 4A6YB 5DO2D 2P5WD 1JK8A 4PJ8D 4JFDA 1IC7L 4X4XA 2V2TA 3ULUH 3B9VA 3DPBA 5CS7A 4F8TA 2CRYA 2VLKD 3O9WC 5ALBH 2OJEA 2BFVH 3MRFA 1ZLVH 5HI4D 4XMPH 3C5ZC 4BJLA 1P4IL 3VW3L 4Q9QL 5EUOA 1IAMA 5E2VL 3RA7L 3REWB 1I3UA 4XVJH 1CXKA 3V79C 4GG6A 5E56A 5C6TH 1OHQA 1F4HA 1NQBA 1CI5A 3EFFB 2DQGL 1F58L 2LAGB 5J3HD 3ARYA 3CVIH 3KHOA 3T0EC 1WBXB 5KW9L 2F53A 2NY4B 3BT2L 1QLRA 1CGXA 4HKBA 4UILH 43C9B 2ESVE 1JGVH 3CFCL 2YEZA 5EZLB 3DOSA 5CMAB 4FRWA 4JZJC 2CKNA 2VQ1B 5KSVB 4QHUB 4X4ZA 2ZPKL 2DM2A 3IS0X 1U9KA 1YYLL 1JPSH 2FECI 1YNKL 1IFHH 2Y6SD 4TSCH 1C12B 2Z4QB 2BHZA 4BSWA 2ZUQC 3R1GL 4PLOB 4HIIA 4YJZL 5I17A 3DETD 4G7YH 3DRTB 4L3CA 2IFFH 2OQJA 3QUKB 4LLUB 5F96L 4WFGD 4XXDB 2R4RL 4NC2B 4APQC 2NLJB 2P5EE 1T5WA 4PJIF 1C5BL 4P5MB 1D9KB 3PWUB 4LPXA 3ZE2F 4JPKH 4JLRA 5J9PB 4LU5L 4HJGA 4M1CC 2NTSP 3V4UL 5T1LB 2XRAH 1TVHB 2APVA 1HHHA 1D5XB 3FO2B 4MS8D 1DQML 3QIUA 1IM9D 4NFBA 4F33B 5C6WH 3H42L 4HXAL 1P5UA 4ONGL 5EFIB 4LDLB 5KSAA 2JIXB 1BVKA 4P2RD 2HAZA 3HE6A 4PREA 3SDXE 3WN5C 2FX7L 2B1HH 2EE6A 3QEQD 1T04A 4NO3A 2Q3AA 1NL0H 2R2HA 1L7TH 1NGXA 1MI5D 3BEWB 3VFUA 5FYJL 3GSWB 3SDDD 1GSMA 2WIMA 1JF1B 5D7LE 4LIQL 1RMFL 3LRSA 3SKJL 4MLSA 3V4VH 3UZEA 2WK2A 3B3IA 3ZHDA 1AY1H 5CUSL 4MJID 2YPLB 5EBWB 3MRDA 4PP2A 1MEXH 1CFVL 2WUCL 5EC2A 1CL7L 4BQCA 2IAMC 1Q38A 3HPLA 35C8L 3GMRA 1HIML 3VG9C 3NPSB 4R97B 4CUCA 4PR5A 1MHPL 1A7PH 5DWUL 1C5DB 3DROA 4JN1H 3GSXA 3GSNH 1NAMB 3WO4C 5I15H 5I1DB 4P4KB 1A6AA 4MD4A 3REVB 2VISA 1HE7A 1X5GA 1ZT4A 4RGND 4DGVH 2COQA 3U0TA 3TFKD 3P4MA 3NFPB 3QZWG 3AB0C 2GT9B 3RIAK 1CD9B 3RWJA 3UX9B 1DL7H 4PTTB 2X05A 2DMBA 3E1F1 2D4DA 4XNUL 2BNRE 4GXUN 5IV2B 1S9YA 3U0PA 5IB4B 3SEPA 4QEGA 2V6HA 3ZHKA 4L8BB 4U6TA 2MNUA 3ARFC 5DJ8B 4HIEB 3GKZA 3EYQD 1W0YT 3ZKSD 1IAKB 3CFEB 1KPUA 1JGDB 5EUOF 5AD0B 5I8OL 2FNBA 5EU6B 4FOMA 1MJ7L 4J23A 4GG6F 3W39B 3DX9B 4JCLA 3FT4B 4OCSH 4QXGL 4DFHA 4JB9L 2OLDA 2JB5H 1LE5A 5IFAL 1YEGL 3A6CH 5GHWL 4GW1B 3QHZH 4HGWA 4WUUA 4XI5C 3T65A 3MNVA 1HKLH 5KVDH 1SY6L 2X41A 3HAEG 1Q9LA 1KTDA 4L1HA 3GBML 5HDQH 3TO4C 2YD8A 4RZCB 3RY4A 1CDYA 2CUHA 5GRJL 1YQ2A 2MWCA 1EEQA 2F54E 3U9UB 4KK9D 5JQHC 4R0LB 1FP5A 4GAJH 3BKCL 4N8CH 3UCRA 1F3JA 1FH5H 1O0VA 3ZDYE 4WI8A 3E0GA 1RZ7H 1CF8L 4XBEL 5T3ZH 5J6HA 3MRHB 1XMWA 3RL2A 4X9IA 5DI8B 3V7AG 3WFDL 1MCBA 4NM8L 3FFDB 4ZOBA 2IBGA 5L8LB 4RMTA 3VRIA 2DQCH 4X6FA 1ZV5A 3CLEH 4NJAH 1NBZA 4C4KT 1OAZL 4G9DA 3EO1B 4G6KH 3C5SA 2IJ0C 3S4SG 5IMMA 5C0BD 1AC0A 5I1JH 5I6XC 5FHBH 3VWJD 3MREB 4M1DH 4HPYL 4PJ8C 1TITA 3S5LG 3ZT5A 3QJHA 4FQ2H 2ZUUA 2ADJA 4TVPD 4JANA 4R4FL 5HI4C 4NZJA 4NKDA 2LTQB 2VDPH 5EU4B 2KPNA 4R2GB 4L8DB 1D5MA 4HQQL 2VXSH 3BZ4A 5GS0L 1PBYA 2BRRH 4OZFA 4RQQB 5D4QA 4PJBA 5CZVH 1I9IL 3QXTA 4O51A 3RDTD 5J3HC 1VHPA 3QIBA 1QP1A 4QRRB 4G6JH 3RWIA 3NCMA 5JOEA 4PGJA 1U93A 4KI5F 1CD1B 2RIKA 3T2NH 4PJCF 4QTHB 3QCTH 3GBNL 4R90L 1OP5K 4JFDD 2W65A 5ID1B 2C26A 1J8HB 5H35A 2GFBB 3FT3A 4LAQH 1C7TA 1YEIL 1JMZA 5JPMA 2P24A 4J1UA 1QFUH 4YGAB 4XT1C 3DETC 3OMZA 4RMSA 2FL5B 4LFHD 3LKPA 3CU1A 2HFTA 3G6DL 3NIGE 4C4KO 1OF2B 4O58H 5I1LA 1N64H 3L3GB 1T1WB 5IWLC 1BZ9A 1YN6A 3ARUA 1ZK9A 3CVHH 2LU3A 4J6RL 4M48H 2H2PD 4Y5VC 3HZYB 2OMBA 4OLEA 3U7YL 1GXEA 3MACH 1KENH 4KMLB 4OIAA 1JZ6A 1M7IA 1MIEL 2BVPA 3IVKA 4GMTL 4JGUA 1KPVA 3CK0L 3PQYA 5B38B 2NW3B 5I1EH 4HAFA 1HXMA 5HHPA 4MS8C 5I0ZA 2GTZA 1T0PB 3VJ6B 3BZDA 3FTGA 2NY3B 4LCWB 1DEEB 1MHCA 1U8PB 5DYOB 3SKUD 3MBEA 1YNTA 5EOTB 3CNKA 2CPCA 3DV4A 4LLWA 3KHQA 2J8UE 4P23A 1NUGA 1FYTE 4RAHA 3SDDC 4MA8H 3WHXA 3SGEH 2IG2L 1NCAH 2F58L 4XX1G 3VI4F 5HJ3A 3RZCB 3GMMB 1R3HB 1FFNB 1MCWM 1JPGA 2V7NA 1DUYA 3GRWL 3D9AH 2CIKA 4QF1B 3B9KB 1S7QB 4Y1AB 1LP9E 3QIUD 1OTSD 2Z92A 5JHDB 3TIEA 3I75B 1QTYT 3GGWB 2XWJB 3V7AE 3MV9B 4QGYA 1KBGH 5KSAD 5F7WC 5E99H 4OI7A 5JPNB 2FECL 3HE6D 1UB5B 1F4XH 3IDMA 4ZQKA 3RVVD 3TFKC 3OGCB 4RMQA 3HI6L 1NC4B 3O4LB 3GJEA 1KIQB 4M5ZL 3U83A 5B21A 1WZLA 1JHKH 4FTVE 3QO0B 1A1MA 3ROLB 3F6IA 1T0MA 4QYOB 2P49B 4LARH 1PG7X 1U8HB 2AI0L 4W4OA 4XPGH 3DYMA 3EYQC 3D2UA 2OK0H 5E8OA 4XVSH 5C0GA 1XF2B 5MEOA 4H88H 1HI6B 3ISWA 4EN3A 3VRLE 2VE6B 4JPWH 1VGKA 1T22B 4U1SA 5CD3B 5DC4B 4U1KA 4Q7DA 2BOBB 4CMHC 1FNHA 4PJBF 5FA3A 5GIRB 1UEMA 3CPLA 2GSIB 3O6LH 4XCEA 1UJ3C 4OF5A 2HFEA 2YRZA 4KXZH 4R4BA 3VD9A 4D9QE 4GRLB 3PABB 1U6AL 4GBXC 1JWSA 2ZG2A 2J5LC 3DO7B 3B5HA 2BP3A 4Y5YB 1ZE3C 1P9MA 1J0YA 3WNLA 3D69A 3P30H 2E8YA 5GRXG 5GRZA 3DVGA 5JOPD 3MCG1 1Q9OB 3FB7A 4Z7VA 4KK9C 4JO3H 4X8JA 2NCMA 1TPXC 5CSGA 1G7QB 4DN4H 3FRPG 1C1EH 1YMME 2DBLL 1BF8A 4XP1H 3BKYL 2UZXB 2VDKL 5C9JB 4PGBA 5GGTH 4XNYL 4MSWB 5SX5K 3RU8H 4ZUWB 4O00A 4R9HA 2VZUA 4ODWA 3QO1A 3RX5A 1AE6L 2QQNL 3IETB 1T2XA 2ADFH 2VXUH 1P84J 4WUUD 1L4IA 5C0AE 2IH1B 4QCIB 4Z7NF 4G3YH 3RNKA 3AXLA 5IMLA 4JKMA 3MOBH 4RNRB 4F9LA 5DJYB 2R0ZL 2YA0A 4B0MM 5BCAA 4ETQA 4U4BA 3L95A 2E7HA 5BV7C 1RK0A 3MXVL 3QCUL 3VWJC 3SDYL 1FL6A 4QHNA 2EEBA 1JGUH 4JAMB 1LO0H 3PV7A 4GMSL 4KRPC 3IB4A 1BWWA 2PW1A 3TBSA 1LD9A 3JTTA 4PB0L 3F7QA 5LWYH 3KR3H 1QO3A 3HC3L 4YE4L 1JI2A 1VPOL 2FB4H 3PHOA 3MRKA 1FGVL 3E6HA 1FZMB 3K81A 5GGRA 4O5LL 5I30H 4Z7WA 2NX5E 4LL9A 1YEFL 2MHAB 3VXPA 3RDTC 3BW9B 4WU7A 1HHJB 3FFCE 4U2YA 4HFUH 1S5HB 4N90D 5BV7H 1RUML 3TGXA 3NA9L 4NNXA 4N0YH 1PKQB 1CGSH 4FHBD 3ULVF 3U30B 3MJ6A 4TPRH 1A6UH 5F7DB 1CXFA 4PY7B 4TVPH 3TC9A 2FHBA 4GG8A 3VDAA 1IC1A 4HF5L 4U6HA 4YH6A 4PG9B 1NGQH 3VXOA 2JJTA 3RWEA 5DJ6A 4HUWB 1KTLA 1I7TA 2ZOKA 2I26N 5F3BB 2VKXA 3L9RB 3QIBD 4PRAA 1Q0YL 2HFFB 4NPYA 4NP4L 3D5OF 4UTBL 4JKWA 4E5XB 3SO3B 4OQTL 3PJSB 1Q1JH 1LQSR 3P40A 2H2PC 4OGYH 3H9ZA 4NQEB 3MLVH 3VGFA 2FO4B 3X3GH 7CGTA 4URTB 4NQCE 4U0RB 1CDUA 4M7KL 3A0OA 1UKSA 4MXVE 4YHMH 2XQBH 5D7JA 1QBML 1T0NA 4PJAE 4RWYL 1WAAF 1MHHA 1QYGL 5GZOD 4L8SB 4LSRH 2OI9C 4XXCA 3K2UH 3TYFB 3T0DA 3GSRA 4HG4J 3C8KB 1YJDC 1MCOH 1UWEL 3HS0A 4OSUL 1FIGH 2X7LA 3MRRB 1G0XA 4WRLA 5SWQA 2HWZH 1L7IH 1ZHBB 2KQMA 4GKSA 2FR4A 4CW1B 3MRBA 1JNNH 3QEHB 2VH5L 1MI5B 2EXYD 2HMID 4JHWL 4L9DA 4F58L 1QFWL 3MLTA 2PYEE 4MJ5A 5IB3B 2FGWH 4JRWA 3KYOB 4YHYB 4Z7VF 5I9QB 3WIIL 4PGCA 2G60H 3PQYD 5HHNB 3CMGA 4QOKE 1UB6B 3HG1A 4U49A 1ZVHA 4YNYB 1ZGLM 1VEPA 3QIUC 1OTSC 3D0LA 1ED3B 1G7IB 2EYSB 4QRPE 3H8NA 5KSAC 4OLYH 1FLRL 4ZUTB 1NAML 4GXUM 4WI3A 3HE6C 2E27H 3OKLB 1YJDH 4BSJA 4WHTB 3ZTJH 3KJ6H 3RVVC 4RGNB 3GMLB 1NKOA 4P23D 2ZCKH 5F7YC 3FQXA 1I7RA 4X6DB 1WK0A 3FHQA 3NCFB 1MUJA 5IMKB 4TUJB 3OG6B 1CBVL 3V5HA 3VGAB 2DKMA 3RIFK 4KY1H 3L3OB 2D0HA 4J7RA 3ULVD 5IOPB 1VADB 1NBVH 4U3XA 3H3KA 5EU6E 4BH7A 5B38G 3GZKA 2BOCA 3P9LB 3MJ8B 1A4JB 4NZRL 5C0IA 3JV0A 4FXKA 4S1QL 4LASH 1KJMB 1EAPA 1JZ4A 2DDQL 3QRFM 5HGHB 1UKQA 2LU7A 2HKFH 1D5BA 4Z7WF 4XNXH 5CCKL 1TLKA 1MRDH 4AEEA 3IAPA 5IB2B 5EBLA 5TJWK 2XN9B 3PWLA 4XNQB 1T2QL 4XP4H 3TWCH 4JKPH 3U7AA 1MCRA 1MFEL 3ULUE 4PJIB 2DI9A 4YPGB 5BVPH 1T7XA 3D2UD 1Z5LA 4PRPE 2GYSA 2CUMA 3ULUL 1QFHA 4EN3D 3QCVH 5C0CE 1YPZA 5J13B 1EPFA 2F5BL 3KNBB 4ZUVB 2YK1H 1CZ8L 4JO1H 2C4XA 4UUJA 4XMPL 2F8XC 2VDRH 2JELH 2QEJA 3HTLX 3F62A 4ONFH 1AGBA 3FMGL 1NGWB 1FSKB 4RFNB 4EDXB 4KJQD 5DRNB 2GJZA 3Q5YA 1KULA 3CVIL 2A1WL 2QKIA 1FVCA 3QAZB 1HSAA 5LGJA 1OTTD 2DMKA 4XWGH 3GO1H 5E6YA 2EIEA 5LQBH 3MRIB 3HNTH 2V5YA 5JOFA 2BDNH 3OR6A 3RWDB 2HT2D 4X0KB 5TQ0H 3QDGA 2NW2A 3EOBA 4KUZH 2NNAB 5GPRA 2VWEC 2YMXL 1FZKA 1WC7B 1RK1B 4BSVB 4TSCL 2VXVH 4KJYB 5HHMB 1Q0XH 3U4BL 4M02A 1N0LA 2NMSA 3PDOA 4MCYA 4BFEA 5D5MB 3FB6A 4HS8H 2CH8A 3G04A 3T0EE 5F97E 2HRPH 4XPFH 4FQ1H 1M1SA 4OCYL 2R1YA 2Q6WB 4WO4B 3WL9A 4Q0XH 3KPRB 3KPMB 1FVEB 1JPST 1NLDL 1FRGL 5KZCD 4OCRL 3TZVA 4JPKL 1IAOB 4MCZA 4OCLC 1I9EA 5FEBA 5F7MC 1MFCH 3QBTB 4X5XB 1FBIL 1GC1L 2Q76A 1PG7H 1NDGB 3GEWB 1GRWA 4LLVB 4XZUB 3C08L 4I48B 3GJFB 5FXCH 3CUPA 4U33A 1DLHA 4ZTOH 2PTTB 4CN1A 3R06A 2EE2A 2G75B 1LE9B 3OSKA 4TSBH 3SE9H 3MR9B 3QXAB 2B1HL 2VDOL 2R1XB 3L5HA 5KAQG 4WW2F 1YN7A 5BOPA 2EH7H 5L2KE 5IBTH 2A9ML 1L7TL 1SYVB 4ERSH 2WV3A 5IROA 4P2YA 1JP5A 4NFCA 3V4VL 4HXBL 3MRGA 3TNNA 3EO0B 3V9FA 3DIFB 3E6FB 3WEXB 5ECJE 2HVJB 4D2NA 2R0WH 1GPOH 2VDNH 1AIFA 4I9WD 4OFDA 1P4LB 4LEXH 4BQ9A 3CMOL 1G7PB 2NY2C 1L9MA 1FLTX 1OAKL 2ENYA 1E4XH 4OZFH 3BXNA 5IG7B 5EN2B 3LEXA 1VKXB 3GM0A 3QNXA 2H3NA 3ARDA 2MCPH 4CJ0A 3OJDA 5HD8D 2DAVA 4ODXB 1PX3A 3PGDA 2WZPD 1CQKA 3U2SB 4NJ9L 1AGDB 1E6OL 2RGSA 1IARB 1RJYB 2ZKHH 4P3CL 2KKQA 2HMIC 4TRPL 1MOEA 2E9BA 2D31B 3QWQB 1YC7A 4N5ED 4JRXA 1YPZF 4JO2H 3RWHB 5BVJA 5DUPL 1KXTB 1XIWB 4OZGF 1F6LL 2E9WA 5D7JD 3IJHB 5IB1A 1I9JH 3N9GH 3SDCA 3RGHA 5IW6A 4LCCA 2F19H 4NNPH 5EO1B 5MEQA 4ODHL 1FIEA 2IH3A 2DWEA 3MBEC 3KJ4B 2DYPA 4P23C 4Y16A 2OTWB 1ZLWK 4KZEH 3UTTE 1UXSB 5E8NB 4EDWL 5JR1H 1Q9KB 3CFJB 3JZ7A 2YXMA 4PRBA 4PJCB 3FN9A 1P1ZB 3ULVC 3HG1D 1KNOA 3IDJA 5EC2B 2DI7A 3WXWH 1JWMB 2GJ6B 2W0KA 4K7PY 5C0RH 4TQEH 1ORQB 2DLEA 5T3ZE 4MD0B 4BKLA 5GXBB 2YS4A 3LY6A 1FH5L 1A7RH 1RZ7L 3VXRA 1FDLH 4LHUB 2WQ8A 3PP3K 2ICCA 3FO9A 3VFMA 4JZOB 1NFDE 5BZWA 3S3SA 2ZUYA 3O3DB 1IC4L 1U8NB 2AXGA 3CLEL 4NZDA 2BSTB 1RAMA 1DUZB 4W4OC 4ZSOE 1UA6L 1V7MH 1J1XH 3EFDL 3ULVH 2FSEB 5JLZA 1NLBL 1QBLL 4PJHF 2EEDA 4ODVH 4EN3C 4OLVL 2IBZX 3E3QE 4RAUA 5ISZA 3N1GC 3UJIH 1RUAL 4W68A 3DV6B 4RRPA 1A6ZA 2DJ4A 1J05A 1KG0A 2Y07L 4MAUH 4YGVA 1XGPA 5DQ9B 3HMXL 2K7PA 1K6QL 2PKDA 3H0TB 1U3JA 2JF1A 5DD6B 3IJSB 2A6JA 2VXSL 2DI8A 2NY6D 1QQDB 5DLML 1UYWL 5CZVL 4KK5D 2V2WB 4HWNA 3MNVB 2P5WE 4Y4KA 4EXPX 1XGYL 3RP1A 2IGFH 2YZ8A 3U79A 2OP4L 1BFOA 4DOHB 1AQKL 1OTTC 2J1KA 2XZZA 1T1XA 4ZOCA 3BKML 1P9MC 2VLKE 3OKEB 2YPVL 4X6EB 5DZOA 5MEPB 1OW0A 4JPVH 4NO0B 1A8JH 4P49A 3V0VA 4LAQL 4AIZB 5HHVH 3S35X 3KYAA 1VACB 3HI5L 3NCBB 2XY2A 3S98A 4DW2H 1QFUL 1BFTA 4UT6H 3CSYA 1DE4B 1N6QH 5DDHA 3L3IB 1G9NL 4OZ4A 2ITCA 5FECA 3UPAA 4FQLL 5BZDB 4MD5A 2R9HD 3OAYH 3ECBA 4S1RL 3D3VA 3WFZA 4F9LC 1HH6A 3OKKA 5ADPH 1Z3GL 3FO0H 2AABL 1IQDA 5HYIA 3RL1A 5GJSH 3ES6A 1JUFB 4N0UE 3V4PH 1AI1L 3HB3C 2R15A 4TTDD 3DBXA 2EYTA 4WFHD 3FZUD 4K3HA 3IU4H 4NO2A 3QIWB 2CXGA 3QDGD 5AWNL 3MA7A 2VIRA 3LMJL 2DQDH 5EC1A 4AT6A 3CIQA 4FA8A 1ZLWH 4NRXA 4S1SL 4WFGE 1OQXA 1F8TH 1YEKL 2HFGH 2QHLA 4X98B 1U91A 4U2ZA 3WNKA 2FBJL 3DRQB 4KDVA 3UPRA 2AXFA 1W8OA 3L3HB 1UXWA 4IRSB 3RVUD 2AJXL 3IDIB 5D1XA 3HKFA 1UCBH 1XCTA 2E3VA 3E2HC 1FG9C 1KSRA 5ENWA 3QUXA 4BUHA 5DVLA 1BOYA 3LDBC 5GGUB 3QQ9D 1A22B 2DQHL 5SWSA 2BY0A 5J6GA 3TZVD 1WZ1L 3UROR 3PP3H 4BYHA 5J1TC 2A77L 4NKQB 3MLUL 4JY4B 1FGNH 3QEGL 2JJTC 4H26B 3UXFA 1FV1A 4P2RE 3MUGB 5JPMB 4LVOC 2APXA 3WFBL 1P7KB 5BQ7A 4LSPH 1GOHA 5DJAB 3UTPD 3WDJA 1S7TB 2C3VB 3QEQE 3ARGB 5GRVK 5I18H 2RAMA 1MI5E 1CXHA 5EULV 2X4QB 4TNWK 5HD8C 1WIPA 4ODUA 5JIPA 3H9YA 1JHKL 2XFXA 3MRLB 3P9WB 4MJIE 4L4VB 2F74A 5IW1B 3GK8H 3MCLH 4N5EC 2YRPA 1N0XH 2QHRL 5ALCH 5E8EB 3F6LA 5ILTL 1UEYA 3U36A 1KEGL 1CFNB 1BQUA 5DC9B 4NQVA 5D7JC 1CFQB 1FZJB 1OSPL 5CILL 4JPWL 4UTAL 3BIKB 1WIUA 3OB8A 1EJ6A 4JY6B 1ETZB 4XXCC 4RGNE 5CAYB 1FNGA 4P5TB 3NZ8A 4F7CA 2YKLH 3K4DA 1YNTB 3ARDD 4K23H 5E9DB 1MLCA 3UTZA 3O6LL 3S36H 5F9DC 2Y36L 5B8CB 5I8EA 4B41A 2H8PA 1MY5A 2NY0B 1A7QL 3CFKB 4IIQB 1I1RA 4PY8I 3LQMA 4JRXD 3BH9B 5I1GH 3F7YB 2JJUA 3SQBA 5EUKA 2V2XA 4X6CF 3IJYB 3P30L 3WFCH 5CIPB 1MLBA 3DARA 5CJ8A 2WANA 5K93A 3SDCD 2XY1A 3I85A 1F11A 3BYTA 5IF0B 1AHWB 1N59B 1IGMH 5LJYH 1KB5A 3KPNB 4GQ9L 3SE8L 2CO6B 2D7QA 1F3DH 4MVBD 4HIHA 2AK4A 2O5YL 4C54A 4J3WA 2DYPD 4TNVK 4Y16D 1DP0A 3QULA 1FPTH 4RSVA 2VXUL 5I76A 2FZ3B 4OZIE 2BCKA 3A6BH 5HPOA 1MAKA 4R26H 4OLZH 1T0MB 3ZE2E 2W38A 4FXGA 2L7JA 4HMCA 1KLUB 2C9AA 1MQ8A 4XNZC 4JFQA 2NZIA 2V5TA 3X17A 1UZ6F 5LGHL 5F88A 1AJ7L 5FKPB 1R5IB 5B3JF 4NN5B 1A4KB 3NGBC 4P0DA 2X4TB 4TSAH 5KSBA 1E4XI 3NFSL 3VXRD 2BMKA 1CLCA 3HE7A 1OGAB 2MPAH 1OLZA 3PHQB 2BHUA 2NY6C 3VXMB 2CO7B 3HCVA 5KG9A 2EC9T 3TIDA 4KK5C 1GGYA 5ERWA 4QY8B 3GSQA 4XRCA 3VFVB 3MLSH 4OD2B 5BMFL 5JIHA 5C0BE 3MLYH 1HOCA 2AV7B 1CQYA 3B2VH 1PG7W 4UNUA 4AM0A 5KTEH 3VFTA 5IHUL 5GISH 1IT9H 1RFDH 3V0AC 1G7HB 2XWTA 4HWEH 2DWDB 3KWWB 4TVPE 3PP4H 2NTFB 2R2EB 4DVBB 1DDHA 3SGDI 3B6SA 5ISZD 1PEZA 4CMMA 4MA3B 4JZNA 5IVXA 1HH9A 2AV1B 4K71B 3T77B 4LHUG 3MYJB 2GUOB 3CCHA 5D6CA 2JLLA 3OXSB 4CN6A 2OR8A 4M6NL 2NY1D 3OPZL 3RHWK 4LMQE 5C0ND 2NYYD 3QQ3B 4LLQB 2XG5A 4HK3N 2R9HC 5EU5B 4Y4KD 4GW4B 1WZKA 4NQUA 1F4WH 4HUVB 4PB9L 1R3LB 4JFDE 1CICA 2Q86B 2FJHA 2G2RB 3ULSA 5IJKA 1ADQA 4S2SA 4U1GC 4NQDA 4LLMA 4FQJL 3QPXH 4TTDC 2DQFA 5JIIA 2ENSA 1FL6B 7FABH 1J87A 3EBAA 1ZLSL 3V6ZA 1X5YA 3GMPA 3O2WH 5TQ2L 5EUOE 2HN7B 1IGIL 4KDWA 3HI1B 4M7JL 4GG6E 1FNSL 3GHBH 1F02I 1MQKL 1D3CA 2AGJH 3HR5B 4G8GB 4LSRL 4OF0A 4CDGC 1JZ3A 2F53E 1AXTL 3SJVA 4M61A 4U1HB 3RVUC 1F6AA 3EOAA 3D3VD 3TYGH 2HWZL 4WU7B 1L7IL 3GHEH 1ZT1B 3QEUB 4HJJH 4Q6IB 1II4E 5I1CL 4JE4B 3RI5F 2I60L 5HHQB 1A6TB 1KJ2B 3QQ9C 2A0LD 3N85H 4PJ9A 4QXWA 4RGMC 3TZVC 4KTEL 4HKXA 3W9DB 1Q9WA 1V8HA 4WUKH 1EFXB 3VA6A 5ID0A 2DLFL 4FFZL 3TPUA 3C6SA 2GHWB 1NUDA 1OT2A 4N1HB 3MPCA 4C83A 2CJUH 1BVLB 1I8LA 2WAHA 4G9FA 5D93C 1TZGL 3MROB 3WBDA 4NIKB 4Y19D 3QDHA 2Z8RA 5D1XD 2ADIA 1EEUA 3QUXD 4RMWA 1MRFL 2FJGA 1KIUA 2HRLA 2P1YA 5SWSD 3TPKA 2Q1EA 5IROC 2QADB 1NDMA 4B50A 4FQQA 1QA9A 1YEEL 3BWAA 4OKVB 3VXTA 1F5WA 5D6DA 1C5CH 1NBVL 3LN4B 5KSBF 2BSRB 3ARPA 3DX8B 4HHAB 5JW4Q 2EH8L 2JCCB 3P4OB 3X11B 4KMTL 3ALWA 2C3WA 5TPWL 1B4JL 5DQDL 4GFTB 3TT1L 1R3JA 1VESA 1R24B 3GSRB 5C0JB 5EWIL 1UM5H 3ARDC 3S35H 5JIKA 5D7KD 4QRQB 2DS4A 3E8UH 2W9EH 3M1BA 5T1MB 4AG4H 1H3VA 2GTWA 5C08A 2QSVA 3PIQA 4U0QB 4HZLA 4X6BB 1P5VA 3F5WA 3FQWA 4L9LA 1RIUH 4NN7C 1LGVA 1ZMYA 4FQXA 4G42B 2C3GA 5K9JL 4JKPL 2BZDA 1WIOA 4CVUA 4ZDHA 4RBPK 4YBLB 5E1AB 2EDXA 3PGFH 2HJLA 1INEH 5CEYB 1IGTA 4LQFL 1RUPL 5IVXF 4CKVX 3OF6A 3SDCC 1FORL 3T4YA 4LCCC 4LSQL 5JORB 4DUWA 3CX2A 2AJYL 1TIUA 4PS4L 4MNGB 1HNGA 1N3NB 4MVBC 5IEHA 1YEDB 3VXSB 3LSOB 4JQIL 4ZUSB 4OFPA 4S1DD 3W81A 4EVNB 3LZFL 2O5ZH 4NOBA 2PF6A 5TFSL 2N7AA 1CLYL 4K3JL 4OLXH 1G7JA 2R2BA 3JWOC 3QA3A 3IFOA 4GUPA 3DUUB 3OG4B 4WW2B 4PBXA 2VJXA 1DQDH 4AY0A 2J6EL 4DTGL 2ICEA 1JHTA 4NCC1 5JOPE 5ELIA 5T5NF 1YMHB 4NNYA 2PN5A 5ANMA 4OM1L 1FAIH 2P48B 2X1WL 1UADC 3MQIA 3DX7A 3C6LB 2AJVL 3V5DA 4P2QB 5K9OA 4ZFGL 3TBTB 1WTLA 2AK4D 4PGDB 4WUUE 5JW5A 3OJVC 3CDGB 3OJ2C 4ZUUB 4X9HA 2DJSA 2NXYB 2R4SL 3G5YB 3JWOH 4U1JB 4WCYH 4XPFL 1KCVH 4O2EA 3VI4E 4CGTA 5GRYA 3K80A 5DJ0A 4Q0XL 4NZTH 3DGGB 3QQNA 1RPQA 1JL8A 1LEKA 4MA1C 3AC0A 3HC4L 1QSEB 2VWEE 3EAKA 3CXHJ 4FZ8H 4JFOA 4NWUH 25C8H 3X3FL 4OZGB 1DJSA 3GM8A 4E41A 3HE7D 5H2BA 1HHGB 2WMPA 4QTIH 3RZWA 1OP9A 1RZGB 1P6FA 4NFDA 1ODAA 1CFBA 5MENA 2NY1C 3MRPA 2NYYC 4GSDL 4G43A 3H7BB 3THML 4ZFFB 1A7NL 2GIYA 4K7FA 4Y4KC 3SE9L 4PRIB 4N90E 5SWZB 2FIKB 4UT7L 5DS8A 3RWFB 4RISH 5IBTL 3CGTA 3O45B 4YDKH 2IBZY 3H9SA 5A16B 1M05B 1RUKH 4AK1A 2BNUB 4PJFF 1EHLL 1DZBA 2PXYA 5D9SB 1RULL 1OW0C 5ITBH 3AFLA 2F5AH 4Y4FA 1HDMA 5D1ZA 4RIRB 3OAUL 2JK5B 1CLZL 2R0WL 2YSSB 2ZJSH 3VG0L 3MRMB 4FQCL 1ROWA 4PJBE 4LEXL 1UM4L 1HHIB 1CE1H 3LKOB 3G6JA 5DJXB 2YD2A 1E4XL 3G04B 3O6FB 4PV9A 1ZTXH 2VDMH 4XBGB 4I5BB 4DEPC 2ATPA 2I9TA 1CICD 5J12B 3NFNB 5KVFH 5I19L 4BH8B 4NQDD 2YUWA 2MMXA 1S9XA 2BNQA 2DKUA 2QSCH 4F7TA 5IQ7H 2A0LC 1BD2A 4M7ZB 5KVEL 4MDIA 3QP3A 4MWFA 4CVXA 3STLB 4MNHB 3ZYIA 3HNVH 4JREC 1Q94A 1SJHA 1HHKB 4BQBA 3BHBB 2IALA 3MFFA 4PJHB 2VB5A 1PQZB 3OB0K 3G5VB 3N9GL 2QJDA 3ABZA 1J0IA 2AXHA 3VH8A 3RNQB 2YUVA 3KXFB 3SJVD 5F6IB 1UENA 1OARH 1SBBA 4P57A 4Z7NE 4IOFD 1L0XA 1PZ5A 4QHMA 1IBGL 3TN0B 5D1XC 2AEIT 2Z93B 2XNAB 4I0PB 5EO0B 3JXAA 3MV8B 4F15B 4UOJA 3KPTA 3QUXC 4XP9H 1NFIB 3B83A 1M7DB 3U7WL 3LKSB 4PG2A 1J5OH 5E94B 1C16A 1X4XA 4X7TB 3QDMA 1JNHA 5JR1L 1AP2B 3PQYE 1QVOB 1YUHA 4JM2A 3TNNB 4KHXL 5EPMA 1TCRA 5A2LH 2GK0B 4NN6C 5INCA 1S7WA 4OGXL 4DK3A 4N9GA 4OIBA 3BAEH 2AEWA 4JDTH 5HDLA 5C3TA 3BO8B 4Y4HC 5C7XL 3L7EB 2XICA 3X14B 3X12B 1DQTA 1U2CA 2P43B 4H25A 2B39A 1BAFH 5IHLB 4DCQB 4UU9A 1DANU 4L3EB 5E2TH 4HK3J 4W6WB 3G08B 4OF6A 5L9DL 5J1AB 2R29L 2CRIA 4JFPA 3BYYA 4U6VL 5LG1A 1KV3A 3WS3A 1CR9L 3L5WA 3V2AR 5AAMA 3ZYOA 5EOCJ 2Y06L 5BJTB 3ULVE 1S9VA 2NZ9D 5BRZB 2VITB 5ICYB 4FFVD 1IC5H 3HZVB 1U92A 1KLGA 2IBBA 5DFVD 1TETH 4JR9H 1U3HB 4X4MA 4YO0B 1GIGH 3IDXL 5D2NA 2BXZA 5DF0A 1RI8A 4NO5A 3EKCA 4FNLL 4HLZG 3NCCB 2IQAB 2FIRT 1D6VL 1L0QA 2XZCL 4S1DC 3T1WA 3NN8A 5DA4A 2GY7B 4IJ3C 4Y16B 1W0VA 3BRDA 5C08D 4YHZH 1T3FB 3F7VB 4FQXD 4ZAKB 3ZE0F 3P73B 3T3PE 3TM6A 2PETA 1JN6A 2R0KH 4LNRA 3UBXB 4G6AD 3VA2C 3OF6D 1ZHLA 4IOIB 1JHLH 4K3DL 3BZEB 4P48A 2VLJD 4JPVL 1X3DA 3BE1H 1CGYA 1MF2L 3V52H 4L4TA 1MCIA 3BP4B 3G6JF 3F7RA 3FB8B 4K8RD 1HEZB 1WSST 1T21B 4MMXC 4LK4A 1OQOA 3VD3A 3SCMA 1KCLA 3VFPB 4XC1L 3IF1A 3STZB 4KZDL 3FONA 1KIRA 1CVSC 4GW5B 4UQ2B 4OIIH 5E6IB 3FO1B 4JHAH 4PJ5A 5E70A 4Z7VE 4LHJB 4YHPB 1MCJA 3GIVB 3B8SA 3ZDZF 1H0DB 1Y0LA 2A6DA 1UWXK 2DQJH 3GIZL 3VGDA 2YD3A 1WV7T 1MRCH 4XPTL 1KB5H 4OB5L 4CVZA 2LVEA 2Z9TA 2UVEA 3HE7C 5I75C 4WGWB 1B0GA 4BK5A 1WT5A 4YHKL 3CFDA 1MVUA 4MDJB 1BGXH 3WCYA 5KJRH 4OUUA 1UCBL 3F12B 5F6HI 2UZIH 2D7TH 3GNMH 5IQ9B 3TJEH 3EYVB 5D8JL 4LDEB 5E4EC 3L7FA 5L0QC 5E24E 1UWGH 1IAIH 1QSFB 3OWEA 4XWOD 1UACH 3VFRB 4K3EL 1TVBB 1AXSB 4X6CB 2ZOLA 4E41D 5J0BA 1S9WA 4QGTA 4L4JA 2Z35A 1HQRA 5L2JB 4Z7WE 3JBG7 1A1OA 4MX7A 5MEND 4V1DA 4PUBH 4DUXA 4P3DA 3JV4B 4LSPL 5DTFA 4Z18A 3PL6B 4F8QA 5I18L 1CDBA 2VN7A 5IJKC 3T8XA 1IQDB 1ZHNB 3RL1B 1JJUA 1BIIA 2Z31B 3H9SD 3AREA 1KJ2L 4K9EL 2JE8A 3T4AB 4CU7A 3UYRH 4J3XA 2APTA 2PXYD 15C8H 1R3IL 4JG0L 5GS1B 2Y72A 4D0BB 4XNMA 4I9WE 3HAEA 4Y4FD 3MRQB 2XT1B 5D1ZD 4HIXH 5L88H 2XWBA 3GRWA 4NHUA 5EC1B 2EE9A 5ACMA 4KRPB 4YK4C 2H1PH 1I3RA 4NQTA 2VMFA 4PRHB 4X5WA 4Z9KB 3LS5L 1OGTA 2E5EA 3P11L 1MH5B 2A9NH 1FNEA 5SX4I 4MQ7A 5TE6H 4IOFC 4FP8H 2YPKA 5EU7C 4Y19B 4YDVB 2XXCB 3S36L 5E08H 3EOTH 2BNQD 4PJ9C 1I7UB 1BD2D 3IAQA 1AQDA 5ETUB 3QXDA 1KCSH 3BGFC 5FYJD 4G5ZH 4Z78B 5HGBB 5ICXA 9CGTA 3GB7A 5CINL 3SPVA 4NWTL 3BPOB 4LEOA 5T1DL 1HINL 2P7TA 1GZQB 2CDEA 4NRYA 5MERA 4AYFA 4QKXB 3U9PL 4HJ0D 3CH1A 2GSGB 3S5LA 3SHSA 5FOBA 2XKSA 1I8LC 5DMYA 3QFJD 4Z8FL 3K3QA 3PDDA 4PJEA 1S7UA 1NJ9B 4MA7L 4PD4J 3GMOA 4HD9A 2OJZH 3SY0A 1CYGA 2EIZA 2CRZA 1KOAA 1I1CA 2GAZB 2GITB 4K55A 1MWAB 3A6BL 1QKZL 1ND0A 4OZHA 3QDMD 4XP5L 4O2CA 1CXIA 5J11C 5J8OA 4JM2D 3HG1E 1GZPB 2NZ9C 2OTUA 2BJML 4Q97A 4FFVC 4F2MA 3TO2B 4UZGA 2SEBB 5D6DC 5DFVC 1K2DB 2MQ0A 1VFAA 5TDNA 3I50H 4LVNB 4LPUA 3NZ8B 3ZKMD 5INDA 5IMOB 1NGZB 3KYNB 4U1LB 3CFBB 3MRCB 3VCLA 3TBWA 2W59A 1JNLL 3ARVA 4QLRA 1QLFB 4L9LC 4J3TA 5E95B 4FQXC 1DQLH 4EI5B 1BQLL 2ADGB 3DXAA 4KRMB 3DHJA 5DRWA 2MFNA 1PKOA 1G7LA 1OB1A 4BFIB 1K8DA 1KJ3H 4A6YA 4G8EB 3RTQB 3UTQB 3U46B 5GGSY 4YDLC 3GMQB 1ZEAL 4XCFH 5F8RC 3VD7A 2OS7A 1YECH 4OLWL 4M93B 4I18B 5FO8B 4K8RC 3I6KB 5E2UL 2X4SB 5DR5L 1MCKA 1MFNA 3BIBX 1RU9H 3REWA 4D0DB 3ESVF 4I2XB 5E8DH 4ELKB 1JIBA 2CK0H 3EFFA 3VFSB 2EDRA 3T0AA 4UDUB 2IADB 4HEPG 3DUSB 4M4RA 1WBXA 2AK1L 1F13A 4HUUB 5E0QA 1YPZE 3FOMB 4ZO6A 43C9A 5C07D 5T3XL 5EZLA 4X99B 4PJDB 5CMAA 4HK0A 5C2BL 5B3NA 3TH4T 1ORSB 2VQ1A 5C09B 5KSVA 4L4TD 4QHUA 2AAVA 3RWGB 3WXVH 4NOFA 2R8SL 1JV5B 4K8RH 5JHLL 1SVCP 1C12A 2Z4QA 3SCMD 1BBDL 1NSNL 1DVFB 2APFA 3MA9L 5D2LB 4R3SB 3I84A 5F9AC 3DRTA 3I02B 3LHPH 4LLYB 2VERN 4LLUA 1HOCB 1AKJB 2GJJA 3GHEL 4HJJL 5AG8A 4WFHE 4XXDA 4PJ5D 1I9RL 4MJ6B 1BLNB 2NLJA 5LCVH 3N85L 4YHNB 3EYSL 2FJFB 2Y9RT 2RB8A 4OQTA 3QDGE 4YUEL 4ORGB 4YHLL 4XWOC 1IC7H 1D9KA 3PWUA 5J9PA 1QRNB 5EA0L 3LN5B 3MX0A 4IDJL 4YQXL 3I9GL 2ORBL 5T1LA 1NCCL 1TVHA 3WJJA 1OAYL 5C92A 2MCG1 4LVHB 4PJEF 5K59F 3ZKND 1D6EB 2J88L 3CD4A 1E4JA 1P4IH 1H15B 5F3HB 4F33A 5FF6B 4Q9QH 5E2VH 1F4YL 3RA7H 5EFIA 4WTZG 2JIXA 5HDBF 4OZHF 2DQGH 2H2SC 1F58H 1CICB 2DL2A 3BZFB 5KW9H 1F90L 3B2UC 5HVFB 3EJZC 1QACA 3BT2H 2XACC 1GL4B 4V2BA 1CCZA 2ERJB 3WV0A 3BEWA 1T7WA 2XZAL 3TBYB 3GSWA 4UQ3B 4PYGA 2PXYC 1JF1A 2ZNWA 4KHTL 5GGQL 1LDSA 5D1ZC 1DBJL 1K3ZA 4K07A 1Y18B 4RRPG 2YPLA 5EBWA 2ZPKH 1YYLH 4Q74A 3UTPE 1YNKH 1J0JA 4V1DD 4AJ0A 1EEYB 4WI4A 2YD9A 3R1GH 8FABB 1C5DA 5CD5D 1U8OB 1NAMA 3B9AA 1M71B 4QRTA 5HHXL 4P4KA 5F96H 1XR8B 3REVA 4AG4L 3Q5TA 2R4RH 3NFPA 4ZTPL 3ARED 2GT9A 4WIQA 4PTTA 4OV6F 2ILLA 3BI9X 3OTTA 3RRQA 1Q9WB 1N7ML 5IV2A 1C5BH 5IB4A 4UINL 1KB9J 4WHCA 1EUUA 1DBKL 4LU5H 4ALAL 5F7UA 4Z77B 4L8BA 1HCVA 4ODTL 5DJ8A 3V4UH 4HIEA 2BHYA 4HJ0C 1IAKA 3CFEA 1JGDA 1DQMH 1TTGA 4LGSB 3H42H 3BP7B 4ONGH 1CFSB 5AD0A 5HHOB 4JRYB 1OM3L 2FD6L 3OL2A 2Y5TB 2IPTL 3W39A 43CAB 3DX9A 1TQCC 3FT4A 2I9LB 4LSDA 4CJ1A 2FX7H 4Y8AA 4DKDC 3P0GB 4PG2C 4JRXE 1MPAL 5E5UB 1NDMB 5F72S 5FYJH 3KYKL 4JM2C 2Y4SA 2ICWB 1HILB 1RMFH 4KQ4H 4LIQH 1OT1A 1Z6JT 4YAQB 3LKNB 2D7PA 5ESVB 1HQ4B 1E6JL 2VZVA 4PJFB 5CUSH 4PIRF 4RZCA 1FAIL 1UC6A 1DSFL 1WGOA 3KPQB 1CFVH 3RX8A 1CL7H 2VO5A 4HKZB 4PV8B 4JG1L 35C8H 5IK3B 1HIMH 3U9UA 2FATL 4M1GL 1MHPH 5C8JB 5DWUH 4XMLL 4HS6B 3ZKMC 1PW3A 1WFTA 4IS6B 3BPLB 5I71B 4LOUD 2D0FA 3MRHA 4R4ND 5DI8A 1LO3L 2Y5EA 3FJTA 2AJZB 3OXRB 2W1NA 2VZ3A 1U8QB 1RHHB 1K5NB 1KCVL 3RY6A 3IDNB 3BVNB 4D3CH 4M43L 3WLBB 3RX7A 1AXIB 3C60B 3B5TA 3MREA 1DQQB 4LSTL 4Z95L 3VXRE 5D2NC 2VLJB 2MSPA 1LVEA 4FG6D 2B4CL 3SKMB 3AROA 1LK3L 3DYPA 5I8OH 1AD9B 3AS0A 1S7RB 5CLWA 3EOYG 4NCC2 1MJ7H 5EU4A 5CP7B 4L8DA 4QXGH 1T2JA 4JB9H 1C08B 5HYEA 3MLWL 2HJKB 5FOJA 4Z0XB 5IFAH 1YEGH 5GHWH 4RQQA 3DXAD 1IKNA 1HCFX 4PJGF 3MLRL 5IP4A 4QRRA 3CX5J 2PW2B 1SY6H 2VZOA 5HVHB 5DJCB 5F7EL 1NEZB 5DT1L 2VKWA 1RUKL 1CD1A 5ISZE 3N1QC 4QHLB 4QTHA 5GRJH 5ID1A 1W72B 3P77B 4QHKI 5EBGA 1J8HA 2GFBA 3BKCH 3RWCA 5F1NB 1E27B 1D7FA 4M62L 1NGPL 1CF8H 4XBEH 1F4AA 3RJDA 3SCMC 3WFDH 5IEKB 4YPJA 4NM8H 3IDYB 5GS0C 3BDXA 1ZTXL 3WFEH 4Z7QF 3DYOA 3PE9A 5DRXB 4D94A 4PTUB 1CLOL 3M8OL 1G9EA 5KVFL 1OAZH 2NY4D 6FABL 3L3GA 1T1WA 3VRJB 4RMUA 2YUZA 5HYSB 2BC4B 1MCDA 1E4WL 3FRUA 4YXHH 4HPYH 3HZYA 1N4XL 3KLDA 2UUDK 3VWKB 3RKPA 5H2BB 3P4NA 4R4FH 3KPOB 3ZKNC 2NW3A 1A6PA 1WT5C 4PGEB 3O4OC 2AEQL 4ESKA 1EK3A 3D3VE 3H7LA 3RY5A 4HQQH 3U4EB 5DJDB 3IFNL 1SMOA 1E4KA 1SJVA 3VJ6A 5GS0H 4GRWF 5LAXB 4LCWA 1DEEA 1D5IL 1U8PA 1I9IH 5DYOA 1CD8A 5EOTA 5FDYA 3NA4A 2H9GB 2DQUL 5ACZB 2VR5A 2B0SL 1URLA 3MNWB 3GBNH 4R90H 1D9KD 2WNGA 1FFRA 1CDHA 4FFWD 3RZCA 4P9HL 3GMMA 1R3HA 1FFNA 3TH3T 5K9KB 3MJ9L 1L6XA 4Y4FB 3BQUB 5T1LD 3T09A 4QF1A 3B9KA 2P8MB 1S7QA 1YEIH 3OR7B 4Y1AA 1QEWB 5JHDA 3I75A 3GGWA 4H1LB 2XWJA 2AEPL 3MV9A 5CD5C 4LKCB 2JIXD 1JPFB 5JPNA 2R39A 3G6DH 1UB5A 5SWSE 3ORJA 1IGFH 2CSPA 4OAWB 2UWEB 3OGCA 1MVFA 3AREC 1NC4A 1U8IB 3O4LA 1KJVA 1R0AL 4F7TB 1ERNA 1KIQA 3O81A 3OQ3B 1K4CB 3QO0A 1MFAL 1IGCL 1GGUA 4J6RH 1OAQL 3ROLA 1EVUA 1IEAB 3U7YH 4QYOA 5TE7L 1U8HA 1MIEH 2YPLD 4OFYA 1WBZB 4JN2B 4GMTH 1CXEA 1XF2A 5I73B 4QXUH 3WYRA 1HI6A 3GFUA 2VE6A 3QFJB 5D7KE 1BHGA 1T22A 2HH0L 3TA3B 2I25N 5FO7B 5CD3A 4RFOL 1UQSB 2R56L 2X9WA 1FCGA 5IFHL 2BK8A 4P4KD 4PJXF 1RQ5A 4ZYKB 2BOBA 4RA3A 1VFUA 2QQQA 3SKNB 5M7QA 3IGAB 3QPQD 5GIRA 2FGZA 4G80B 3C09C 1MWAL 2HTLD 1R5WA 3D18B 4PJ7B 4GRLA 3PABA 5T5NG 5JW4R 2IG2H 3MYZA 2F58H 1K4DB 2E7LA 3HAEH 4WV1B 4HDIB 3DO7A 4N9GB 3GRWH 4Y5YA 5JA8B 1EO8L 1FVDB 1N8ZB 1LHZA 1Q9OA 3NCJL 1F6FB 4U1IB 3WIFB 1G7QA 5FHAL 2P44B 4LOUC 4R4NC 5C9JA 3LEYL 3HMXA 4MSWA 4ZUWA 2X10A 3ARBB 3HI6H 3G9AB 3IETA 1BVZA 3EDKA 4M5ZH 1ZANL 5TF0A 4K2UL 2IH1A 4QCIA 5A2IH 3I2CL 1V3JA 4RNRA 5DJYA 3DSFL 2IFGA 3GBLA 1SEQL 2EDYA 2AI0H 2N56A 3T08A 4BELD 3Q6FB 2ZWLT 3SO5A 3T04D 1WQVT 1U2HA 2IMMA 2AK4E 3DURA 2JKXA 1MRCL 3L3KB 4KAQL 4JAMA 2L7UA 3QQ4B 1YEJL 2OMNA 3RBSA 3L5XL 1OPGL 3UTSB 3MFGB 1YEHL 4UV4L 3DVNB 1FZMA 2X4UB 4UIMB 1AO7B 4NC0B 2X2YA 2MHAA 1QHOA 4Q2ZA 3BW9A 4XVUD 4BZ2L 1MCQA 1YQVL 1U6AH 3I6LD 1Z0NA 2XKUA 1S5HA 4H0IA 5D7IB 3U0WL 5KSBE 5C07B 5AAWA 4G8FA 1RZKC 1PKQA 3EJJX 1T1ZB 5IVOA 5F7DA 2FO1A 3ELAT 4PY7A 4KQ3L 5HBBA 2ZCLL 1BWMA 1Y6KR 3S88L 2VXTL 5CZKA 5HY9B 2DBLH 3ME0A 4R2GD 2VDKH 4PG9A 4ISVB 1MJJB 4XNYH 3C5JB 2HKHH 3K46A 5L7XL 4HUWA 1AE6H 1QD0A 5FAAA 3IF1B 2IMNA 1X4ZA 2P42B 2A6KB 3H9HA 3L9RA 4QRRD 4K7PL 2HFFA 2R0ZH 3QI9B 1OD9A 4AIXA 2XPGB 4E5XA 4A6YH 5IVXE 4D9RD 3A6OA 3PJSA 3MXVH 3QCUH 1T7YA 4ZNEA 2DTSA 1EHXA 2DN7A 3SDYH 4NQEA 2IANB 1RZKH 4PBWD 1RUQL 3LPGA 5GJTL 1J8HD 3ILQD 4HIXL 4MAYB 5HSFA 3IDUA 4U6XA 4GMSH 3LAFA 2FO4A 3QJFB 2W0FB 4PB0H 4HC1A 4P4RB 5EOQL 5GGVY 4DWHA 3HC3H 4YE4H 2OSLB 1VPOH 1XH3B 3KAAA 3LOWA 1FGVH 4L8SA 2EXWD 3TYFA 4NQDE 4O5LH 3JTSB 3RPIB 4ZXBB 3C8KA 5CP3A 5FM8A 3MRRA 1YEFH 1RVFL 1ADQL 5I0DA 4HUKB 1ZHBA 4DZ8B 2EIBA 1NEZG 1KCSL 4CW1A 3BN9D 1I8IB 1A3LL 3QEHA 3JWDL 1RUMH 3CC5B 3NA9H 2I24N 1D9KC 4FFWC 1TXKA 3KYOA 5J4MA 5JNYB 5I74B 3WJJC 5HHNA 3ZO0A 4YNYA 1UB6A 3SJVE 3D6GA 2Y7QB 1V3LA 4Y2OA 1ED3A 1G7IA 4P3DB 5EU7E 2EYSA 1KXQE 3L1OL 4ZUTA 2NY3D 3K74B 4LCWD 1I1AB 3OKLA 4I3RH 4KC3B 5IUSA 4WHTA 3QXVA 1Q0YH 3GMLA 1YYML 4NP4H 2H32B 4UTBH 1F45A 5HYSG 4X6DA 4OQTH 4M6ML 2BVQB 5CSZB 5IMKA 3MMEB 4S0TD 3LKRB 4TUJA 3RZCD 2NXZB 3ARWA 3VXUB 3L3OA 1PAMA 3B9KD 4HGMA 3LQAC 5IOPA 1VADA 2E7MA 4G9FE 4M7KH 4Y1AD 4PD4K 1RHFA 5K9QI 3P9LA 5JHDD 3MJ8A 2R0LL 1WCBB 3FB5B 3NPSC 4R97C 4EKXA 1Q72L 4OCXL 3MV9D 1QBMH 3GMNB 4RWYH 1KJMA 5JW3L 3VXNB 1QYGH 1FFQA 4KVCL 3V6OA 3BESR 4P4KC 3MV7B 1UWEH 4EI6B 1TZHB 4OSUH 5F1IB 4XAWL 1QFPA 1NC4D 3O4LD 5FCUL 3TV3H 4Y8DC 5IB2A 4LPWA 2HTLC 4PY8J 2XN9A 4XNQA 1M4KA 5ICXB 5H37G 2VH5H 5IVNA 4F58H 4LSSL 1QFWH 4X5LA 1H3PL 4GRMB 5D1QB 3BD5A 4PJIA 4OFYD 4AL8L 5ACLA 3WIIH 4XHJD 1NUFA 4YPGA 1WVZA 3NABL 1BM3L 2NR6C 3KNBA 3NOIA 4ZUVA 4Z7UF 5LXGL 5C08E 1FLRH 1V3MA 1NAMH 1SJEB 1I3GL 5EZJB 3WKML 2PR4L 5DD5L 1NGWA 5FYLD 4BFBD 4TOYL 5E8DL 4EDXA 4ZNCD 5DRNA 1RD6A 4GRLD 1X4YA 3R0MA 2NY7H 4GKNB 3O3UN 3V6FB 4YIQB 1SM3L 1CBVH 1I4FB 3T2QA 2F8OA 5IFJA 3O3AB 3LD8B 3MRIA 1T89A 4NZRH 4R0LC 5FKAB 3RWDA 5IJVB 4S1QH 2AKRB 4X0KA 5HI3D 4Q9CA 1XT5A 2NNAA 2DDQH 5D7SL 3N1MC 1WC7A 1RK1A 4LCUB 4BSVA 1FE8L 1PVHA 4WFED 2JJSA 2V7HB 3MLZL 4KJYA 1FFPB 3CLFL 5CCKH 3EYUL 4P9ML 4KDTA 5D5MA 5DGQA 1S7VB 2C4FT 4UBDD 3RY6C 3SBWA 3MRNB 5ANME 1KELL 4GKZB 4D0CB 4KKAC 1T2QH 2ARJQ 1T20B 1A0QL 3C8DA 4XVUC 3QNZB 1MFEH 2Q6WA 4WO4A 1YDPB 5LBSL 1W0WB 3GI8L 3KPRA 3KPMA 1FVEA 1G9ML 1VEOA 5ADOL 2X40A 5DEFB 4WEMB 4F37F 1IAOA 2FH6A 3TCXA 1X5JA 4X5XA 2F5BH 3SGKA 1NDGA 1BX2B 1CZ8H 1SMAA 4LLVA 2LTQC 4XZUA 4I48A 3GJFA 4R2GC 3MOAH 3BISA 1B4RA 3FMGH 1F00I 2PTTA 2VTFA 4NSKB 3FQTB 3MUJA 2G75A 1LE9A 1IKNC 2XI9A 1S7SB 4EZMA 1X5IA 5FGRA 1CT8B 3MR9A 3L3DB 2G5BB 3QXAA 4MB3A 4X6DF 2I5YL 2R1XA 2A1WH 4MGXA 4CL7A 5T1KB 2JJVA 3F58L 4LLDB 3MNZB 1SYVA 2PYFB 4E41E 4HK0B 1KCRL 1I85A 4XCCH 4LRIA 3S8WA 3EO0A 1H3UA 3ILQC 4C59B 2A6IB 3W0WB 5MENE 1GC1C 4Y2DB 4I0CC 3ZSTA 2D7OA 2GKIA 3DIFA 3E6FA 3WEXA 2HVJA 1XR9B 2YMXH 5K9QG 2ZZUT 4LLAA 4R96B 5DEGB 1P4LA 4HS3B 1G7PA 3U4BH 3ARXA 1BZ7B 1X5AA 2EXWC 4AEIL 3ARZA 4IRJD 3ZE0E 3H9SE 4X9FA 4GO6B 5IG7A 5EN2A 3V8OA 1VKXA 4OCYH 1N2RB 4ODXA 3M07A 3L5JA 3BN9C 4OF8A 3U2SA 1AGDA 2EZ0D 1NLDH 1RJYA 3DMMB 1TNMA 4NQED 1FRGH 1HN1A 4OCRH 4KWUA 2D31A 1Z2KA 4JFHD 5LGKA 4MNQA 2Q8AL 1FBIH 4UAOB 3G6JE 3WKNA 3RWHA 1GC1H 5SV3A 4UMGA 5E5RB 3C08H 5IT2L 1XIWA 5J06A 1LNUB 3IJHA 4JDVB 3SKOB 2HT4C 4ZS7L 5DD1L 4C56B 2NY3C 3BFOA 5EO1A 2BNQE 1ZVSB 1BD2E 5CZXC 1PX4A 1H3WM 5FYJE 2VDOH 4LIQE 4X7FC 1KB9K 2EDDA 3Q1SH 2OTWA 4PJGB 2A9MH 4W6YB 4LP4A 3LV3B 4TN9A 3ZDZE 1UXSA 4HFWB 5AYUL 1AFVL 5E8NA 2ZSWB 2CGRL 1KXVC 1UGNA 3RZCC 4KQ4L 1EIBA 1A6WL 1PSKL 1Q9KA 3CFJA 2R69L 4HXBH 1ZHKB 1NCTA 4PJCA 3WFHB 5BO1H 3B9KC 3QFJE 1P1ZA 1AGFB 1G0DA 2LAAA 5E2WL 3SGJA 1JWMA 2GJ6A 2H6PB 1ORQA 4U6YA 5CKAA 4MD0A 3CMOH 4QNPE 4H5SB 1Z0MA 1OAKH 4QRTB 5D70L 4LHUA 5D5MF 3QDME 1I75A 1GGCL 1FFOB 4JZOA 1OP3K 3SN6N 4DJMA 1RZJC 3R8BB 3DO3A 3O3DA 1JZ7A 1U8NA 2VLLB 1I8KB 4NJ9H 1E6OH 1DTUA 1FNLA 5DMGD 2DJUA 5DUBB 2BSTA 1FZOB 4P3CH 4X7CC 5FYKU 5I2IB 4TRPH 2J6EA 4MHHI 3Q6GL 1DUZA 3UPCA 2EO1A 4D3CL 1IM3B 3NAAL 4JHBA 4KVNL 4XHJC 2O93L 4JY5L 2FSEA 2HLAB 5DUPH 5MI0B 2X70B 3RUGB 4H0GA 5C86A 5C0FB 2E6PA 3DV6A 1GGBL 4ODHH 3MV01 1EXUB 5DQ9A 1GHFL 5DMKB 3ZDYF 3IYLW 4OTXH 3H0TA 5DD6A 5DJZB 3IJSA 4ZFOB 2XN9D 1QQDA 4GRWB 5CJOL 1Z9SA 2V2WA 3DVFA 4GRLC 1J88A 1JGLL 5HXMA 4EDWH 4X4ME 1MCPL 2E7LC 5D2NE 1EGJL 4Y5YC 1TQBB 2QQLL 3MXWL 1CS6A 3OKEA 4X6EA 3CFIC 1YZZA 5MEPA 4HCRL 3QRGL 3G9VA 4NO0A 5HI3C 3KGRA 2YA1A 4AIZA 4D8PB 1QBAA 1VACA 1UM6L 3E3QC 3WUWB 3PWPB 2C3XA 1JGEB 5FYLH 3QDAA 1DE4A 3CX5K 3WFEL 1TTFA 3L3IA 2V17L 5E8PB 3CAFA 4UBDC 1IC4H 5BZDA 5FGCE 1MCFA 5DQJB 1V05A 4JFEB 1EDQA 2NY5C 1DBBL 4A2MA 3EGSA 1UA6H 3K4ZA 4YDJB 5DO2C 3U6RB 1JUFA 3NBNA 1A14L 4LCYB 4L4TE 4YXHL 3EFDH 3HRZB 1MY7A 1NLBH 1QBLH 3EYOB 3LVEA 1B9ZA 1LEIB 4OLVH 2AQ3A 3QIWA 1NMBL 4BZ1L 1RUAH 2E7BA 1CD0A 4X4YB 2Y07H 5HHMD 4PP1D 3UEZA 3HMXH 3ZYJA 1K6QH 1MELA 3HPJB 4X98A 3MTRA 1G9NC 3QSKB 4PJ5E 4PJXB 3DRQA 5DLMH 3W5NA 1YY9D 1UYWH 3L3HA 4IRSA 4KGJA 2C7UB 4DGIH 1GGIL 1XGYH 1QFWI 4PLNC 3NIGF 3IDIA 2OP4H 4WO4D 2NY5H 3KPRD 1AQKH 1CK0L 1FJ1B 3EIFA 2W0LA 3BKMH 4HGKC 5GGUA 4HBCL 5C3LD 1F3DJ 3U30C 1NPUA 1UZ8B 5K33A 2YPVH 2UY7A 4RWHA 4IOSD 1LO2L 2X4PB 3OV6A 3RWCB 5GRVL 4JY4A 1OP3H 1OVZA 2Y6SC 3HI5H 2DQEL 2F9BT 4H26A 3MUGA 4AENB 5DHVB 4PLKD 5FDWB 4UDTB 4YFEA 1P7KA 3ET9F 3T0BA 1G9NH 5DJAA 5EDXA 1S7TA 2C3VA 4FQLH 1Y6MR 3ARGA 1IGFL 3PV6B 2CR3A 4S1RH 2CQVA 3MBXL 3B9EA 4KROB 3LKQB 2X4QA 3KLSA 1Z3GH 5GGSB 2AABH 3SO3C 5DEZA 1WITA 4J3VA 2J8UF 4YEFA 2EZ0C 4O9HL 5I1KL 1AI1H 3MRLA 3FRUB 3TEUA 1JRHI 4L4VA 5IW1A 4MHHG 4V1DE 1ACYL 1G1CA 5E8EA 5AWNH 1J1PH 4RGOH 1XF3B 3P4NB 4U0RC 3LMJH 1CFNA 2CKBA 4GS7B 1JF5A 1A2YB 4QXUL 1CFQA 1FZJA 3AUVA 3BIKA 4S1SH 4Q58C 4L8SC 3VGHA 3ZKXB 1YEKH 4JY6A 1ETZA 3NTCH 4P5TA 2FBJH 1FQ9C 4GT7A 5GSVB 5B39B 5E9DA 4J4PA 4J2XA 2AJXH 3GI9L 5DVOA 4MMZC 1FO0B 5B8CA 4P46A 2QL1A 3T1FB 4FMFA 1WISA 2CK2A 2DQHH 3CFKA 1XEDA 4IIQA 4R8WH 2DOCA 5BS0B 4HUXB 1KC5L 4MNQD 4YHYC 1WZ1H 3O0RL 5I9QC 3BH9A 5DURD 1CG9B 1LWRA 2WBKA 3F7YA 3HA0A 3SDAD 5A43C 3PDGA 2A77H 3IJYA 3MLUH 4HULB 1XIWD 5CIPA 3QEGH 2A74B 1LK2B 5IF0A 5IIEB 1AHWA 1N59A 4EOWL 2LV4A 5D72L 4FABL 2VL5B 4NQSB 2VSCA 3KPNA 3WFBH 1MCLA 1U8KB 2Y1VA 5FB8B 4EUPB 3C87A 5KOVC 5CP3H 1VERA 2B5IB 4RGNC 4HAGA 2P45B 3L6FB 1KJVB 3LRHA 1AR2A 2FZ3A 2CR6A 3O6ML 1X44A 1ZLUH 5DMGC 3EDJA 4B7IA 4KI5D 3VGAC 1IL1B 4MXWL 3HUJB 2KZWA 1KLUA 4M8VA 2QHRH 5KANI 4ZO7A 3U82B 4M03A 5ILTH 2ED9A 4PJEE 5K59E 1KEGH 2GJ6D 4W70A 3L3JB 1JWUB 5FKPA 1R5IA 4J3OC 1A4KA 1J86A 1OSPH 5CILH 4UTAH 2X4TA 1ONQB 1AGEB 4F3FB 3V6OC 1RV6X 4LGPB 4LHUD 5HYFA 3O6KL 5HDBE 1OGAA 4OZHE 4HH8A 5I8CB 1WAAA 3PHQA 1DFBL 2XTJB 3VXMA 4OI8A 4OCMC 2Y36H 2EDKA 2HVKB 4M5YL 4XB8A 1R5WB 3QUYB 1ITCA 4QY8A 1KT2B 1A7QH 3VFVA 1BPVA 4OD2A 1R3KB 2AV7A 1NKRA 1PY9A 3BUYB 1ZWIB 1I7ZB 2VYRE 3PWVB 1G7HA 1T5XB 2DWDA 3KWWA 4NYLB 1T03L 2NTFA 3WMSA 5J13C 2R2EA 4DVBA 2HLFD 4MA3A 4O2FB 4XCYB 4F7MB 2AV1A 3IU3B 3OZ9L 4GQ9H 3SE8H 2XYCA 1H3XA 3T77A 1GOFA 2GUOA 3MYJA 2O5YH 3DXAE 4JFFB 3OXSA 2HKHL 4BK4A 3G5ZB 1FSKC 3UJJL 4RFNC 4NCDA 1RIVL 2VLRD 4WENB 3KLHD 2FWOB 1MFBL 3QQ3A 4LKXB 4LLQA 5EU5A 4GW4A 5GRUL 2E7CA 2AXJA 4HUVA 3QAZC 1R3LA 2J7LA 1QUNA 2Q86A 5JQ6L 2G2RA 3FT2B 4A6YL 4JO4L 3KDMB 5LGHH 5EZIH 1IGYB 1AJ7H 1RZKL 2DF3A 3DURB 3KPSB 2RCSL 3IXAA 4NO0D 5ESAB 3W9EB 2I07B 2DRUA 2HN7A 3NFSH 1QNZL 3HI1A 4GAYB 3S7GA 2JJSC 2WBJB 4PP1C 4HWZB 4I0KA 1TVDA 3HR5A 4G8GA 4KDTC 5F6HJ 4EBQL 1YY9C 3SBWC 4U1HA 4Q2ZB 3HMWL 5BMFH 5DK0B 1ZT1A 3QEUA 4Q6IA 4WO4C 4XX1E 3D87B 3ALXA 5IHUH 1TJIH 3EDFA 5HHQA 1A6TA 1KJ2A 3D48R 4G8FB 1WFOA 3W9DA 4NQXB 1SQ2N 4DKEL 1VGEL 32C2B 3QIWD 1EFXA 3GSVA 3VD5A 4M3KB 1I3VA 2UY6A 3WUWG 4MZ3A 2RBLA 5HGAB 4Z7UB 2B8OT 1BVLA 4PLKC 4QO1A 3MODL 4XC3L 4M6NH 1PLGH 1S8DB 3OPZH 4HH9B 3UP1A 4IRJB 4IRSD 4I3RL 3MROA 5IHBA 1SBSL 3H9HB 3KPLB 3WE6B 4PB9H 3WHE1 4XGZB 2CLVA