1M72A

Crystal structure of caspase-1 from spodoptera frugiperda
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
256
structure length
247
Chain Sequence
b'RVARMPVDRNAPYYNMNHKHRGMAIIFNHEHFDIHSLKSRTGTNVDSDNLSKVLKTLGFKVTVFPNLKSEEINKFIQQTAEMDHSDADCLLVAVLTHGELGMLYAKDTHYKPDNLWYYFTADKCPTLAGKPKLFFIQACQGDRLDGGITLSRSYRIPVHADFLIAFSTVPGYFSWRNTTRGSWFMQALCEELRYAGTERDILTLLTFVCQKVALDFESNAPDSAMMHQQKQVPCITSMLTRLLVFGK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Caspase-1
molecule tags Hydrolase/hydrolase inhibitor
source organism Spodoptera frugiperda
publication title Crystal structure of an invertebrate caspase.
pubmed doi rcsb
total genus 80
structure length 247
sequence length 256
chains with identical sequence B, C
ec nomenclature ec 3.4.22.36: Caspase-1.
pdb deposition date 2002-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00656 Peptidase_C14 Caspase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1m72A00
3RJMA 2CJYA 2HBRA 3R6LA 1GQFA 4QULA 1M72A 5IBRA 1KMCA 2QLBA 5IAJA 5IANA 4DCPA 5LU9A 3P45A 2H5IA 1SHJA 2QLFA 3D6FA 4FGUA 2AR9A 1CP3A 2J30A 4ZVRA 3V3KA 3GJRA 4EHFA 3GJSA 4EHHA 1ICEA 2CNNA 4ZVOA 4EHLA 1JXQA 2XZTA 3K7EA 3V55A 2FQQA 4ZVSA 4QTXA 3ITNA 3UOAB 1NMEA 1NMSA 4DCJA 4NOLA 2FP3A 5IAGA 3V6MA 3UO8B 4QUEA 2J32A 1BMQA 1SC1A 5LUBA 3DEHA 3PD1A 2CNKA 1SC4A 5I9BA 4QTYA 1K86A 2HBQA 4NBNA 4ZVTA 4N6OA 3DEIA 3R7NA 4FEAA 3IBFA 1PAUA 5IABA 3EDRA 3R7BA 3D6HA 4JB8A 2HBZA 2HBYA 2K7ZA 3EDQA 1RHMA 3P4UA 1RHQA 3S70A 4QU0A 4QU9A 3R5KA 1I4EB 2XYHA 3H11B 3IBCA 1SHLA 3OD5A 2C2KA 4LSZA 4JQZA 1F1JA 2CJXA 3PCXA 4M9RA 2C2ZA 4QUJA 1CVRA 4HQRA 4HQ0A 3H11A 4HVAA 2CNLA 3H13A 4N7JA 2QL9A 4QUDA 2H65A 3SIRA 4QUIA 3KJFA 4IEFB 3V6LA 1QX3A 2J33A 2QLJA 3DEJA 4JJEA 3DEKA 4NOKA 1NW9B 1QTNA 3R5JA 1RWXA 5I9TA 4NOJA 3E4CA 4FXOA 3V4LA 3GJTA 1RWKA 4JJ8A 1RHUA 2H54A 2Y1LA 3GJQA 2H51A 5IC6A 3SIPA 1NMQA 4QU8A 3R7SA 4QU5A 1GFWA 2QL5A 4N7MA 4AWAA 3PD0A 4JR2A 4D3XA 3R6GA 1RE1A 4NBKA 5IBPA 4AW9A 5IC4A 1RWNA 2C2OA 3H0EA 2H5JA 4PRZA 4D3YA 2Y0BA 2P2CA 3BIJA 3KJQA 4JR0A 1SC3A 4NOMA 4AWBA 4ZVQA 4EJFA 1RWOA 4IYRA 1RHRA 4JJ7A 4JR1A 1RHJA 4NBLA 5H0IA 2WDPA 4PS0A 3D6MA 4ZVUA 5LUAA 4FDLA 2H4YA 2XYGA 5IAEA 5JFTA 5IAKA 4EHKA 2DKOA 1RWWA 4N6NA 1RWPA 1IBCA 4EHNA 5IASA 2CNOA 2C1EA 3KJNA 3NR2A 3H1PA 4N5DA 4ZVPA 5IARA 4I1RA 3S8EA 4I1PA 2XYPA 5IBCA 2CDRA 4N6GA 4DCOA 1I3OA 1I4OA 2C2MA 5LU8A 1K88A 4PRYA 4QUGA 2H48A 4JQYA 5K20A 2QL7A 1I51A 3V4OA 1PYOA 4D3ZA 4EHAA 1RWVA 1RWMA 1QDUA 2NN3C 2FUNB 3QNWA 4PS1A 4EHDA 2H4WA 4QUBA 2XZDA 4QUHA 4QUAA 3NS7A 2J31A 1RHKA 1F9EA 3NKFA
chains in the Genus database with same CATH superfamily
1XRJA 5FLYA 5IT5A 3LT0A 1M72A 3BM5A 4MB6A 3T9EA 5FR1A 4M1YA 4C89A 4OJQA 1IWOA 3I2GA 4JUBA 1EB9A 3HJNA 3PDUA 3QX9A 4UMDA 3WMXA 5B7PA 4PNPA 1JR6A 2AYXA 3O0DA 4QBTA 3RF6A 2MOKA 4FFMA 1SO8A 4NECA 3KEGA 5J1SB 5FAKA 2FW6A 4WNAA 5AUOB 4NU5A 1C4KA 4P3PA 1NWHA 1FQOA 1N8SA 3EY9A 4LDJA 2WT8A 4XKJA 3R4CA 4Y9RA 5L3RA 3WQRA 2DPGA 4RULA 3L6OO 1B6GA 1Q1NA 2NADA 1ODJA 3TQOA 4YIKA 4Y6GB 3UF0A 3B38A 4HAYA 1NJ8A 1RTTA 1ESDA 5DM2A 1OFUX 2P9QA 3W8EA 4DLKA 1WCXA 2BKEA 2HA4A 4IJMA 4O4HF 1LY1A 1WXIA 4RVUA 5A9TA 4LWOA 4L72A 4UKDA 2BKUA 5TGTA 3OZFA 1TC1A 2XTZA 3N2KB 3Q8KA 3NM6B 3VSCA 5HJEA 2PSJA 1IY9A 1RHQA 4K9MA 2FEWB 4RJKA 4EJSC 3A36A 2QG9A 3L1UA 4JQZA 2IZ0A 4QBKA 4U7PB 4YH1A 3BXHA 3WMFA 3RWMB 2WFAA 5KYXB 5JVDA 2DQYA 5ALZA 3PQ3A 4TTPA 3VC2A 1FFEA 4NLLA 3ROZA 5M04A 2IP4A 4X44A 1BX1A 1N8NA 2OHJA 1QGED 2Z5GA 4IEFB 2FP4B 3N0RA 1UDRA 1VIVA 2ATXA 2XTNA 3L4SO 4FXPA 2C3PA 4D0NA 2XMRA 5DHTA 3IT3A 1OF1A 4D4LA 3W7BA 2NO6A 2GRUA 3ZWBA 2YS7A 1JHOA 4ZO7A 1ZSVA 2JVIA 3A1WA 2P3LA 5BMVA 1XLUA 3AUYA 3K2QA 3CZRA 3CRZA 1GUDA 2HLHA 3QX7A 3NBYC 4RFSB 3D0RA 1OX4A 1JHRA 5LP6A 1X7YA 5CFRA 2WW8A 4DVJA 3WXMA 1U0FA 3ED1A 4I4IA 1LVGA 2HF2A 3WV4A 3GFPA 2QBYB 2JKZA 3CRMA 2JGAA 4LNAA 2H3EA 1GGNA 1K7FB 2W6ID 2XA1A 3P2JA 4RHXA 5F33A 3VNQA 3ZDEA 3KOYA 3MCVA 4HC4A 4AURA 3ZHCA 3K0AA 3JCZA 4IO0A 4IX9A 4A5OA 3V1MA 1YBFA 2BYTA 3PHGA 1EUCA 1I1OA 1RYMA 4AY3A 1HLDA 3VH2A 6AT1A 4IS2A 2Q0HA 2XHEA 1WXGA 2G07A 5BV2P 2LIPA 3FYHA 4GYYA 4OHKA 3FMVA 1E3QA 2MHCA 4WN3A 3FUTA 4WXPA 1PHRA 3E53A 2XUGA 4C14A 3SNKA 3TVTA 1BDHA 2HU2A 1P9WA 3KSRA 3LK6A 1E6KA 2HRRA 1KFJB 3VR6A 2XE7A 4BO6A 4N6GA 4BY9E 1K5PA 3NYRA 1TAUA 1DARA 3KQUA 2QVLA 3SLKA 4KQHA 4GXTA 4V24A 3QHQA 4KIWA 1YASA 3CW2A 1PD0A 5I7FA 3KE9A 3OT4A 4BWYA 4QE3A 3JAMA 3D7RA 4FONA 3HYTA 1WX1A 4TX1A 4KNVA 3WFIA 3P19A 1EXMA 1K8ZB 2ZVPX 4EKEA 1DHTA 1N1GA 3S2EA 1Z07A 3PNMA 1P5ZB 2YQZA 5JAQA 1M0SA 3IDAA 4P4TA 2HA0A 3BX1A 4QM7A 3LG2A 1FNNA 4DW8A 3PWTA 2MR6A 2EZ4A 2WA2A 1XQ9A 1HK7A 1NRWA 4K81B 4JKYA 2FF5A 3ONEA 1QXSA 3PNVA 3CRRA 4H16A 1GAEO 3S3TA 4IZHA 1KYQA 5KTKA 3IQFA 3DMYA 3C43A 4C9BA 4TN5A 1JHXA 3WGLA 2DULA 5A02A 2JGEA 4F5WA 3TX2A 1BIFA 3K6SB 1JFFB 4HGOA 1O1YA 2M2IA 3NUQA 3PICA 2DM6A 4FBLA 3DR3A 2IP2A 3T5CA 1NPYA 3DJYA 3WRWA 7REQB 3FR8A 1VM6A 3HLYA 4HNAA 2X58A 5AOVA 5FNVF 4ZHQF 4C0KA 1P9OA 1KO1A 1G19A 5CH5A 1PW5A 1Y7LA 5D7NA 3SC2A 1VYUA 1PAUA 4IXTA 2ZJ4A 1LLCA 2A86A 3ZLVA 1OGIA 4JB8A 3KRTA 3TIGA 2D7JA 3H5AA 1AB6A 2OFOA 2NXNA 2W4MA 1N2BA 3NHRA 4OO3A 4IHQA 4JJ4A 4MS4A 1XMXA 5AOAA 5A4KA 3CX3A 1IUKA 3BD8A 3K32A 4ETMA 3N0VA 1BD3A 2GXSA 2GWHA 2LKCA 2C8LA 2YNMC 3IJPA 3LL7A 3E82A 2UUAB 1KI6A 4MKZA 1E2HA 4R51A 5G0WA 3VVBA 3RSZA 3DVQX 3GY0A 5I48A 3QXCA 1J06A 1OX4B 1PSDA 4YFVA 3WNDA 4GM0A 5ITWA 3DE3X 1D2RA 3SKYA 1P2BA 4PTZA 3R8CA 5CBPB 1FNMA 1XI2A 3NRBA 4R8SA 3C1TA 1FU8A 3THOA 4BDSA 2QGZA 3A9UA 5ALWA 2DQZA 2B61A 1EEHA 1VZ3A 4S24A 1C3JA 1MB0A 4R8RA 2XOEA 3OCVA 3EF1A 1W4AA 2X9VA 3D4OA 1NUQA 4NBKA 4AMGA 4AJKA 3H83A 4LY6A 4LDAA 2HNBA 1RWBA 2POCA 2BFBA 2JLBA 4YN3A 3L18A 5ARCA 5AWFC 5EY5B 2ONZA 4OATA 3LXXA 2X0DA 3NCHA 1CUHA 3EVZA 2RHBA 3DBHB 4WKPA 3O93A 1ZD5A 5BO5A 4B33A 2DTXA 4BJ6A 4NP6A 5DTEA 1EUDB 2C29D 2QYOA 4LZNA 5ADUS 1XVIA 2DQSA 1MAHA 1Q0ZA 4PHCA 2UXBB 4PAGA 4K9QA 5BQOA 3QLJA 4CQMD 2FFHA 4BO9A 2O8EB 2QPOA 1AV7A 4L4RA 4MVJH 1HMYA 4UOEA 2JIOA 3H17A 5FWAA 3QVLA 1MXHA 3ZK7A 1O3YA 1TJ5A 3F3MA 3GFRA 4B7UA 3L8GA 1TKCA 1OLOA 1OSNA 2VTEA 2QP4A 2IXFA 2GO1A 3O1IC 3ND7A 3RQSA 5HGXA 1FDWA 1WB5A 2IU3A 5JC1A 3PFBA 1L5ZA 3PXBA 1O96B 3P1JA 1PYGA 4DUGD 1Q3KA 2PA0A 3BSWA 5JDCC 3F67A 1CDOA 2Q8PA 2ESRA 5EYPB 3W5HA 5U4QA 2B99A 2ZI6A 4PCLA 4J0JA 4KQIA 4B9AA 4IGIA 1E3MA 5EMJA 1T9KA 4RCZA 3O5AA 4E5YA 1DRJA 2R1VB 4CIXA 2O7RA 4ZIRA 3ELUA 4WXHA 1MV5A 3HU5A 3UKOA 3TB4A 2XRFA 3CISA 1JQ5A 1XTZA 1M75A 2C5EA 3WLNA 2Q1UA 4ZKDA 2UZ4A 2XF2A 3LHDA 3WGZA 3H6KA 2IC5A 2QRLA 2GCPA 2VSFA 4WFQA 1SGWA 2V7UA 1ZCAA 4PYIA 1L5OA 1O4WA 4ALIA 1YR9A 1ICEA 2PUVA 5JS6A 2R25B 2WI8A 1F8XA 1XNRB 4JK3A 3E8XA 3O91A 3BMNA 2XNHA 3FSJX 1H6BA 2UVPA 2Y1WA 2YWXA 3FW1A 4MP6A 1AMUA 3CUSA 1L8AA 1D1TA 4EB6A 1SZCA 5AJZA 5GVRA 1RKUA 2NVOA 1YQ9A 1KTIA 2C5HA 4BQPA 4Z49A 3IE1A 2H1VA 4LXGA 2HGZA 4PLPA 3JX9A 4B75A 4DEXA 4EFMA 1A9ZA 1INLA 4M0FA 4OQXA 2DB3A 1G2IA 3PU6A 4Z2AA 3EH1A 1TTPB 3T8YA 3F8WA 3OZUA 1VFNA 3IQGX 3KJXA 4YS6A 1GA6A 2WSYB 1HYBA 1SA0B 2QTWB 4WESA 4KYTA 2FEXA 3ZV7A 2VYFA 2PSEA 4TRMA 1JIXA 3AHFA 1XL0A 1IQPA 3A32A 1JHVA 4B43A 2PR2A 3L02A 4YMHA 3H13A 1TM4E 1CK4A 1U0HC 3NFYA 4HAOA 1VMEA 2VWGA 1LDNA 1T1IA 1XSEA 2ZJ1A 3V7WA 4YXWA 2WK1A 5HIIA 4GBMA 5AW5A 4AJNA 1J09A 4WEOA 5AR1A 4ENRA 1N34B 4K86A 2YW9A 4NNOA 5B1HA 3WZMA 4L6CA 5BVGA 3PX2A 3K70B 5AJTA 1SVIA 3I45A 2I29A 4XPIA 4D43A 2Y1LA 4QATA 4P7BA 2C31A 4FYMA 4BLQA 3ZD7A 4P82A 2E21A 2ZJ0A 2PBFA 4DA9A 1TCUA 1X2BA 3C4VA 3C97A 1Z6QA 3PSHA 3RJ9A 3H3FA 4DMGA 5A3JA 1JFTA 1UOQA 2H3HA 2IXEA 3K8YA 3TFOA 4AN4A 1WR8A 1I4LD 1O95D 1UXOA 2IYPA 4P4UA 1R37A 5LBUA 1A97A 2BFNA 2X8BA 4UHCA 5DRYA 3ET5A 5KNBA 4RGBA 3FYUA 3O26A 5FUVA 2TSYB 2HK7A 3B3FA 3U7JA 4ZQEA 1XYGA 5K3AA 4E5SA 3LRXA 5HKLA 2BGIA 2X6RA 3DKIA 2OCBA 4WINA 4TT8A 4A7PA 4NNPA 1NNSA 1Y1RA 1P18A 1N9GB 5H83A 4NONA 2V7GA 3DZCA 521PA 3HEBA 4XDZA 4A5SA 3F7OA 2VJPA 4X7MA 5DYTA 2P8SA 3QWFA 3DEAA 1TJ3A 3RBVA 3FVQA 3ANXA 2D0DA 4A23A 1WVMA 5T3YA 1PEDA 2JA1A 1SCNE 3AI1A 5C5EA 4BQOA 1FJ2A 4IZOA 1U28A 4JYBA 3ZXYA 2HQ1A 4IDAA 5DTRA 2R8YA 4OMFG 4PYOA 4K0KB 4B7ZA 3JVUA 1QFMA 2ZRMA 4KPEC 1WXEA 4MLZA 1DEXA 2BFCB 3H19A 1BDMA 1NKVA 3TRHA 5CBKA 1SWWA 3I2YX 5DTQA 2WUEA 4RPHA 3HYNA 1LRJA 3WKEA 4LVOA 1T2NA 3KJEA 2XB8A 3TS1A 3MXOA 2E37A 3HB1A 2JCGA 1U8UA 5HOEA 3JRWA 4LPKA 2YYZA 1GPKA 2HRDA 2R44A 1E1CB 2COKA 1CRLA 2H00A 3JR3A 1A76A 2AG8A 3PUXA 2C5BA 2BMDA 4R2IA 4HEA6 2QSZA 4LI3X 3RROA 3BRWA 2FRXA 2G1AA 5IVIA 1SPXA 1GRCA 4I55B 4DLBA 4MW2A 4P7KA 4NBVA 4EI7A 4FQ5A 2C9BA 2QZ4A 1W2WB 2XMPA 3MGCA 2Y1KA 3LC0A 3GD5A 1S0UA 4JFAA 4D9BA 3VSDA 1JLLB 3D7KA 3KQSA 1W0KA 2PGLA 4DBZA 2ZOSA 1GARA 3GW8A 3A0RB 3MD0A 1BWSA 3PGMA 2QSJA 2YMQA 1JI3A 3S2GA 1NULA 1DRVA 1SK9A 1L4YA 2V4ZA 3FYUB 3IUJA 3P4UA 3T9FA 4KN5A 3ZHZA 2HLDD 5IHXA 1BN6A 4OK5A 2I2FA 1AY0A 2ECOA 5CNMA 1Z0SA 4FLMA 3BBPA 4OEHA 4KRXA 5E7IA 3OEYA 3RUHA 1AUQA 4GVXA 2FSVA 3AUXA 3NT5A 1QH1A 4M8NE 3DG9A 2ZRHA 2YZ2A 2RJNA 3DLAA 3A1TA 2Z83A 3QLEA 1HT1E 4I4CA 1QCYA 2HX1A 5EGSA 1O6BA 1M8JA 1V4NA 2ZYTX 4X97A 4WUTA 2CJPA 3LBYA 4FHEA 4C7XA 5CB4A 1ZMTA 4EVIA 2YHAA 3P97A 4QHTA 3GEMA 3LCJA 4QARA 3GNLA 3VZPA 4LJSA 3QRWA 1DCTA 5FX2A 4CM3A 2QVGA 1OYVA 4U7GA 6NULA 4CT4B 3MWDA 4X1IB 2QRHA 1II0A 4OHFA 1MN6A 3DA8A 3C5EA 3PC6A 3NV9A 3VKUA 4XTRA 2CV1A 1OJLA 3K05A 3TW0A 4KKVA 3QEJA 3JAWB 3LKZA 4JODA 2OORA 1K8QA 5E4FA 1KFEB 3WL3A 3CVOA 2FWIA 4C6RA 4DHWA 5ALRA 1IG0A 2Q41A 3S2UA 2IYUA 1NNLA 1XZIA 2IUFA 4LOAA 4DR6B 1NN5A 4G1MB 1NBAA 1Y9AA 2DPLA 1NX6A 1T5OA 2XMDA 3GBVA 3H7AA 1U0OC 1YRLA 3ZWNA 3ZDXB 3OOYA 4N6NA 4EIWA 2R62A 4CMGA 1DPFA 2FQXA 3ITKA 3RYIA 2H4ZA 2V3CC 5H9VA 4G37A 4IGFA 3ZNNA 5DNDA 5EC8A 4X64B 4K9SA 1KTVA 4DZTA 5JR3A 3IVCA 3AOGA 4N54A 3RAEC 4LY9A 2JGFA 5EP4A 3VXKA 2VNAA 3GLFA 3EFEA 4INOA 4FHCA 2QQFA 2ZANA 3E3NA 4CKZA 2X76A 2ZPTX 1WQ4A 2WWWA 2FPIB 1AKUA 4GGOA 3K0SA 2BR3A 2VSQA 5BOSB 4YROA 3JVDA 5JADA 4IJ5A 3BSYA 3DTYA 4OHPA 5EWMB 2K2QB 3NRJA 5ALNA 3TW8B 5C1DA 5ILGA 4C6TA 3D43A 1XD8A 2FHSA 3JD1A 3FVWA 3O95A 4P81A 3KQLA 1GDDA 2BFEA 5IAJA 3CA8A 1DDIA 4BMOB 4LJ4A 4IIYA 4Q3AA 2XNDD 1FRVA 2CXPA 2ZSDA 4UULA 4GM4A 1U2GC 1FNCA 3MINA 5EE0A 1QPGA 1EGQA 3CGWA 2E6UX 3EEYA 4W5HA 1JA0A 4FDAA 3FXAA 3MS4A 1Q0UA 4TS1A 1NKTA 4RELA 2J3HA 3WYDA 1YONA 2Y0DA 5F64A 3N74A 1E2PA 5BSVA 1RIIA 2UZIR 5HTKA 2O4UX 2QTRA 2CKMA 3INTA 4HFNA 3ROMA 2WVAA 3LPDA 2E87A 2H08A 2JAUA 2ZIVB 2A9VA 3ASVA 2X1VA 3B6MA 1XRQA 1H2HA 2XDQA 5GZ1A 4FHDA 1SVMA 2ZRBA 3EBPA 5DW0A 3UT6A 3W5VA 2VO1A 5L53A 3BGOS 1XWIA 3DOOA 5IEBA 2PT5A 2QLTA 1PNVA 5EIOA 4RK0A 2RGCA 5DNUA 2FOXA 5G0UA 1CQPA 1X7XB 2CNDA 5EQJB 1N92A 1DMSA 1U6JA 1VMIA 1NXQA 4EW1A 5JNLA 1DKOA 1SD1A 4JT8A 4P34A 4HNVA 3ZNQA 3JPYA 5FFFA 1FLAA 4R54A 2E6KA 3AONB 3Q3VA 4FGSA 4PQFA 4C08A 1I2MA 3DPUA 4JT4A 5CPBA 2JGNA 1EVZA 1WU8A 3L7CA 4K1XA 4L4YA 4E5MA 4ENQA 1D6SA 3DEFA 1JNXX 3AEQA 1YBVA 4NG4A 2RHWA 2J48A 1KQFA 5FA6A 3DS8A 1FNBA 3THXB 3E5HA 5FBRB 2N1BA 4R3UC 4E1BA 1ZXLA 4BNXA 4KLAA 1W5EA 4FDUA 1VSUA 4J9VA 1TU3A 2PFGA 4OQNA 5EHIA 4J29A 4XYLA 1L7VC 3C7AA 3RBAA 1SBHA 3HR7A 4MHSA 4Q82A 4AMBA 3N7AA 1LGYA 4JVNA 2G09A 2XUHA 3CFYA 3FDFA 3NP7A 4BWGA 2NZ2A 5L3SA 3T3NA 1W73A 1LVHA 3SVTA 4IDHA 4IDFA 1EUQA 2R4UA 3WFZA 4RMNA 1PJ3A 3ZWOA 4LF8B 2OVFA 1HFWA 1XCLA 1HQKA 1Z5GA 3EZLA 3EZFA 4J1QA 5FPQA 2NYRA 1NN3A 3OEEA 4FGKA 5KHLB 3KKMA 1EWKA 1LI5A 3PYLA 3IQIX 3RQIA 2XUOA 4RKRA 3WDMA 5AM0A 1GV0A 1WHTB 2C92A 2VJLA 2BEUB 1DTSA 3G6KA 4AY2A 1QHHA 2EJUA 3ECCA 3KDSE 4JBYA 2FZ5A 2B0CA 2JFHA 2ZBFA 3BZUA 2GN0A 3GA0A 4B47A 3LGAA 2JGIA 3OF3A 3JXEA 3UQZA 1NN0A 3W05A 3GC6A 3PQ2A 2VPQA 2V9PA 4H3VA 4DCNA 3I9OA 1CFJA 4BKOA 3KSMA 4QGFA 4H6WA 1JDPA 2RI6A 4HAVA 2Q46A 4LC1A 1WPQA 1EX9A 2H9AA 4PLFA 5L3ZA 2E2WA 3VR3A 4IQFA 3ER8A 2XB2A 3GLKA 2RARA 3O8OA 5KDLA 1VHDA 4Q1FA 4TKVB 2ZBRA 3TTTA 1F38A 1CDDA 2VEDA 4ZZ1A 4XWKA 4BLRA 4N65A 3KEQA 1PTJC 1Y6JA 2HSZA 2DLCX 1AJEA 1A98A 5ESWA 3ZXSA 3AVPA 4P84A 2QJOA 2GCEA 1M1YE 3E22B 4RS3A 5KTRA 5AVRA 2ZXUA 5HQJA 5BY2A 4MH0R 1PLKA 4R9SA 2Q9CA 5ALJA 3FCOA 1MC5A 1KO5A 3OCWA 3QK7A 2AE2A 4EH1A 5K0BA 4B8WA 2FH5B 2WSSD 1XOIA 2I67A 2PMFA 4DLLA 1EIWA 1QH8A 1XJQA 1KIFA 1CZNA 1LQ2A 2RC5A 4IUYA 5ESDA 1K0UA 2MINA 2XWBF 1M2GA 4MP3A 2PH3A 5JAIA 1D2MA 4INZA 3OZIA 2AMVA 3COYA 4YNBA 4QNNA 1LBIA 2PS9A 3HA3A 2B8NA 3G0CA 1ECBA 2OZPA 4H4DA 3UKDA 1V6SA 4WZAB 3VHQA 2K7ZA 4C88A 1JQDA 3N2IA 2IW3A 3S70A 4P3KA 2QA5A 4OJKA 2R8OA 1LI7A 2RGWA 3UHJA 1NUHA 1NVBA 2JLRA 3TTSA 8OHMA 5IX8A 5GJBA 3OJ0A 4RQUA 3HZRA 1I7QB 2WPDD 2F8MA 2WM2A 3AP1A 2A35A 3LQFA 4B2IA 5B3JC 3WGIA 4BXOA 2AC4A 3F46A 2PO7A 5EKTA 2BGMA 3H42B 1SOUA 4YBZA 5D3QA 1I1HA 2EP8A 5ICCA 4ZOLA 3RIMA 4QVIA 1F7UA 4YJHA 1PJ2A 2BZGA 1XQ1A 4JJEA 4AICA 5JPDA 5KVCA 1XNGA 4GC9A 1DE0A 1QUEA 1Z0KA 2O8NA 2Q5JA 1C7JA 3ID6C 2AZ4A 1B00A 3WE7A 1KO7A 4QQKA 4Q4AB 1VE1A 4JL8A 4RJTA 1R12A 3I4FA 3VZCA 1A9QA 5KCZA 3ZZTA 3LYAA 1KDOA 2GUWA 3FM9A 3IHTA 4AW9A 3PDCA 3TZEA 1TVKB 4EFLA 4IJKA 4V0SA 4H35A 3ANTA 4UTNA 1EMDA 2Y0BA 3B82A 1WHTA 1YZ3A 1ZOOA 4LGCA 1NW5A 3HBAA 1SXQA 1IBLB 3TFWA 1FMJA 1ULUA 3BMCA 3M2TA 3ZI7A 1MCZA 2XMSA 2O0MA 4TPKA 4LF4B 1HTTA 4IY1A 2CHGA 2J07A 2QRNA 3GUUA 1RI2A 1AG9A 5DEOA 3A4IA 4L16A 5G3YA 5BMVF 1T4CB 1RJGA 4XUDA 5CG1A 1KEWA 2H52A 3BPSA 1E2JA 3ZV6A 4JOCA 1Q3TA 2OCGA 3WL6A 4DTIA 2GLUA 1OYOA 2X4LA 1ZFNA 2WD9A 3P2EA 3WK4A 4UTRA 3F6BX 1XZDA 2R86A 3DNMA 3DWFA 5K0SA 1ZH8A 1P1HA 1IQ0A 2C97A 2D7CA 4M7PA 3UY4A 1EBUA 3EVDA 3DBLB 3I5AA 3OUTA 1K63A 3N2KA 3Q6MA 1EAMA 1B0UA 2VRCA 4Z53A 1ZVKA 5FP0A 1MQSA 2CFSA 1TMGE 1ACJA 1BRTA 3PPVA 1GL6A 4UTVA 1QHSA 2Y9PB 3VJRA 4LS3A 4KGDA 5C1PA 4RENA 4F93B 1YHZA 1WUTA 3RLIA 4WZAA 1GA1A 1ZIYA 4O2LA 3OM8A 3BE5A 4MVYA 1S2OA 4Q16A 5JXJA 1PQWA 4OHRA 1SOAA 2WYVA 3F71A 3G8YA 1DQRA 3PFKA 3IOBA 1PSWA 1OI2A 1O97C 3CH4B 2V5UA 5A04A 1NNUA 4KSYA 4JL5A 4FKZA 4TL7A 4NCHA 3HLTA 4RFVA 2WIBA 4OQQA 1M76A 2G8NA 1EVYA 4MI1A 4P4SB 4F1WA 4YO8A 1UBOS 1YTLA 2AFIB 2O0LA 1PD1A 2XYVA 1NV8A 2ZBUA 2GYUA 4MUGA 4U2GA 3VC1A 1V1RA 2XEXA 3NM5A 2BM1A 5DGIA 3SC4A 4Z4CA 5BURA 2V9CA 1G6Q1 4W1SA 3LCRA 3VNSA 3IPLA 5EJEA 4QTUB 1DL5A 2XGOA 2YW2A 3H1FA 4F9FA 4XLZA 4L5YA 1COWD 1USWA 1MW9X 1WD5A 1L5GB 3PR1A 2ACVA 1GXSA 4GICA 4H31A 1L5SA 3HKDA 4XYGA 1CCWA 2E4ZA 2UZ1A 3QQPA 4NV3A 3K16A 2AOXA 2CC2A 2I2CA 3I01A 3IMGA 1ZN2A 3MJ4A 4LE2A 2FNAA 3DDHA 2C2WA 3B1WA 2JH9A 3EC7A 4AZSA 3Q6IA 3RVKA 1RPNA 5HQ3B 5HF6A 3DOHA 5BSEA 3STTA 3IOCA 4YJ3F 3OZDA 1ZQ1A 3T1NA 1ZBQA 1RYFA 4JWKA 2AG5A 4BNDB 5HKBA 3GWZA 4JQCA 3QVOA 3RANA 4H7FA 3AJEA 4GH5A 5A3RA 5NLLA 3OFSA 5CFPA 5L7WA 5EP1A 4FGLA 4JSTA 3KYJB 1S2NA 3LVQE 3ICCA 3OTWA 4MRRA 1HL7A 4PNHA 2FLWA 5AT1A 3RS2A 4CLRB 4C7OA 3LUHA 1UAGA 1WHSB 3GFBA 4MGEA 2IYVA 1SU6A 3HFRA 4XQ9A 4L7QA 1IXSB 3WXBA 5H16A 1NSYA 2X8WA 1KY3A 2DF8A 3N70A 1JQKA 5COQA 2IODA 1TVKA 2VSOA 2BZ1A 4ZAVA 2GVZC 1JMYA 4LMAA 3SDSA 5G3ZA 3F5FA 2OZLB 1X70A 4GDMA 3A9VA 3RAJA 5TT1A 4CG2A 1KYVA 1Y8RB 2FLKA 4JASB 2HRZA 3E23A 1K66A 4NV0A 4PBSA 1OYWA 3H65A 3ROEA 3QMWA 2E5LB 5FBWB 2MU1A 1M5RA 3FLAA 5E1OA 2E5WA 3G0BA 2XUPA 4GAEA 2FFJA 1PFVA 4MXDA 2A14A 3A6KA 4MW9A 2O8DA 5BV1A 2ZFUA 3ETHA 3U4CA 4B6FA 2EJWA 4FKMA 1N1DA 3UJCA 4K9NA 1TAHA 2G72A 4UJ3A 2XD4A 1F14A 1Y7HA 3BE4A 4UHFA 4PZLA 5D00A 1J2UA 1E3WA 1EM6A 4HMOA 3SJUA 3QE0A 1BKDR 1G7RA 3U48A 2FETA 1SVLA 1QWSA 2V7QD 3O7WA 2ZIGA 4L8LA 4WVLA 5CVUA 4N7BA 4AP6A 1XC7A 1NMYA 1D6NA 2Q1WA 5EWJA 2FWNA 3D7MA 1T15A 4OBXA 3N76A 1SBNE 1NW7A 4J1TA 2PY6A 2XODA 2YWEA 2PVSA 5KOJA 2XUQA 2D2EA 1AZSC 1OASA 2H48A 1ULHA 3C6YA 3FFTA 3LVRE 7AT1A 1ZK2A 2I99A 4L0MA 5HIAA 3SXUA 4EVQA 1KC3A 2OILA 2ZYRA 4AJPA 4Q9IA 4Q3KA 4R1PA 1MH1A 4HQNA 4XRGA 3GP8A 5GP1A 1T36A 2CFOA 2QX8A 1GQFA 1SCKA 4D3DA 5F2NA 1FVFA 2ZTLA 1RI4A 1E69A 3AUUA 5E1DA 2B4AA 4A3SA 2VF7A 4PNEA 2X7JA 3AB7A 5H82A 3UWSA 4EATA 2FEPA 2J0QA 1GQRA 2A0YA 3WDKA 4FI3F 4P2BA 3OSZA 4RK7A 5TS2A 1KL7A 2OM6A 3ST7A 4MJXA 2XDYA 3CLRC 4ZVSA 2QTAA 1Z83A 2CBXA 4JLNA 5IMBA 2HR1A 2CCGA 1TUEA 3H1AA 1A9OA 2QMEA 3RYHB 1ZRNA 5HIJA 3JQ9A 2J3EA 1EGHA 2RGDA 3UMFA 4NFYA 3VV3A 5JXGA 3M9LA 2PU5A 4RVSA 4R2XA 1AUXA 1EUDA 4PQGA 5BSFA 3G85A 3JZMA 2Y0PA 2OEPA 1I36A 1WNTA 1LB1B 4Q47A 2NVUA 1CUZA 1LLQA 3OTQA 2P79A 4IINA 4UZSA 4OLBA 3T4PA 3KKZA 2PM8A 2JD0A 3DBOB 4TWBA 4CLRA 1KBZA 3QEAZ 4N3CA 1TE2A 2PYIA 1WW2A 4UEWA 4A91A 5LNK6 3T3EA 1W1IA 2VAWA 1I3CA 4Q3OA 1QLWA 2PX3A 4FOTA 1SHLA 3KD3A 2RI1A 3WMRA 3X1YA 1XLTC 4M0DA 4EA9A 1FMLA 2LTAA 5AHRA 4Q66C 3UW1A 3B9QA 4WLVA 2OO5C 2W8BA 3AY6A 4LWQA 4KSCA 2FDXA 3OX4A 3K9QO 3EXFA 3F5DA 4O3MA 4P31A 3KJFA 1FEZA 2P8JA 3MFYA 4C2AA 1ZR2A 1E2QA 3NHFA 4RK4A 3R4VA 1EIZA 4MTLA 1HRDA 3EN0A 3H16A 5HM8A 1LTKA 1CS0B 4RSGA 5CX1A 3ZPXA 5L95A 3HM2A 3GRZA 2N0SA 2Q3CA 3IIIA 2OQVA 4GXNA 2JIDA 1VYTA 4IQ8A 2OCIA 1QZXA 3OE4A 3RLFA 4P7GA 4Y6RA 4HDMB 4YAJA 2V8OA 1FMTA 1R8QA 2FP4A 4PZPA 4QOHA 4EG3A 5JH7B 4C07A 4EF5A 4MB2A 4ND8B 4NU0A 3ACCA 5KVVA 2JCSA 1HDIA 1I32A 1IN8A 1PLLA 5DCUA 1M0EA 1DV1A 2PWYA 4HNSA 1X42A 1Z2CA 4ALKA 1JX6A 1LS6A 4IDCA 1M8FA 2ZJYA 3FCXA 4D81A 5IRCD 4CHGA 2EIHA 4PZDA 2IOFK 2YYAA 1K9VF 1ZGBA 1M1NB 1XAGA 1Y5NA 3H2GA 1BQEA 2EP7A 1DWPA 1PQYA 1KEEB 1MABB 2FV8A 4ITVA 4PFJA 4OHWA 3JYQA 3B51X 1NU8A 2IEBA 4XM2A 3C7CB 4GX0A 2BVNA 3PQCA 4Y2RA 1I4WA 1Z7WA 2JS7A 1X8XA 1NXOA 2Q2NA 4NF2A 1V1MA 3NR2A 3VHXB 2O1EA 1TQHA 4G1FA 1YSCA 4CMEC 1VMAA 4I1PA 4ARZA 1KJIA 3AHEA 1RQPA 3N2ZB 3OZEA 5F1KA 3B6KA 2W6PA 4Y2QA 2QYTA 4WVFA 3KAQA 3X1ZA 3VSEA 5BWBA 2JEYA 1BD4A 2VYVA 4MGYR 4OFBA 4WLUA 3UAVA 4UFPA 5B30A 4NG5A 4EEZA 2D2IA 5J40A 1J33A 1M73E 2WVHA 3EZGA 3KSUA 5DHFA 1R1DA 3WLLA 1WETA 1VL2A 5AJHA 2BGNA 3EAGA 3KTFA 4UHEA 1SB8A 1QYWA 3HB9A 1IN4A 4RZIA 2B7CA 1K75A 4UBJA 5EEHA 3UG7A 5F5LA 1DWQA 3DL7A 2XWSA 3HFGA 2WP0A 4N40A 1CY8A 2ONKA 4NTZA 3SFZA 2ZJBA 4BQFA 1AO0A 1TK3A 3NJ4A 4MJLA 4MR7A 4O4IB 4L5CA 1Z4KA 4LGMA 5FB3A 1I10A 2ZJ8A 4DMCA 4P7FA 1FBNA 4Q4LA 2VZEA 3FKSA 2QTMA 5KAPA 5B1YA 1JLHA 2XUJA 2LXNA 1C3VA 1Z6TA 1W0CA 1GGFA 2V03A 3NCTA 2NVUB 3VI4B 5B1EA 2VDVE 9LDBA 4Y9TA 2IOFA 1QMPA 3MMPA 3DWIA 3U56A 4QODA 2YV3A 4G36A 1ZNWA 4KQWA 3THRA 1LW7A 3ZWKA 1N1EA 1PBNA 3C3BA 2NLOA 1SFRA 4GQAA 1WCV1 1IH8A 1LNSA 1E7QA 1VPDA 3FBTA 1G1MA 2JDIA 1PKXA 5LZ7A 2PNFA 3WO0A 1QQTA 1WXDA 1ZCZA 5G0TA 4CM9A 4ZI7F 2ZITA 1PR6A 3EYAA 1Y3BE 1DINA 2NO7A 4ZDWA 1BYUA 4D8VA 1Z4JA 5JCPA 5GZ3A 4KQXA 1OTYA 4F45A 3TBKA 3IP9A 1A7AA 1XHFA 4KQFA 5IJWA 2ZJAA 1MVLA 4QT0A 5JROA 2GAIA 1ZW6A 2AUTA 1GIAA 3C48A 3N5CA 5A1JA 5IDQA 4ZCRA 1GITA 2GS9A 3IVRA 3K0EA 5ES3A 1S02A 1S2LA 2CNLA 5FWDA 3V4RA 4C7JA 2XNSA 4TVOA 2XE4A 1JR3A 1MHPA 4MP8A 1QTQA 3CMMA 4YJGA 1ODLA 2IELA 4MHTA 1GTL1 3ZJ4A 1JUDA 2WUGA 1NI5A 4BNGA 4GKBA 1DIGA 5CVDA 2PZJA 5AW9A 3V2UA 5H4GA 3CWQA 5HG0A 2LR0A 5A7FA 4M2LA 1SVOA 4DIFA 1Z36A 4RHFA 1F20A 3IR6A 3MUFA 3DDSA 3E2PA 4GMGA 4IFBA 3LO5A 1MRNA 2OXRA 5AI4A 3GLIB 3OCYA 4MKHA 4XOIA 3U26A 1AS0A 1GNRA 1GZ5A 1NR7A 4V0OA 4GHWA 1V1RB 2O6HA 5DN6D 2W71A 3DF9A 2X1LA 2ERYA 4AWBA 1YQXA 4PN7A 3PLAE 4ZVQA 4D0GA 1RWOA 1OTXA 2E5FA 3Q10A 3DVRX 3U0BA 3OHSX 4KXYA 3IMFA 3R3YA 4QQNA 3ZY6A 4LJAA 3TG2A 3HJFA 4G0OA 4YI5A 3V2GA 4ARBA 2IBTA 2YYYA 1EHYA 4I9GA 5D3MA 1H3EA 5JS1A 3QELB 1UPXA 2B82A 5ALKA 5A06A 5IXSA 3DFKA 5EIBC 1RLUA 3AY0A 3UXMA 2X42A 3K1AA 1SBCA 1D8AA 4LHYA 3RIGA 2AN3A 1ORTA 2EKZA 1J1ZA 4BO2A 1P4GA 1ATIA 5J5CA 1WEKA 1PWYE 3TI7A 4B7XA 2DEUA 4FBGA 1PI3A 3UICA 5HCIA 5G41A 3WBBA 4RZ2A 1VMDA 3A31A 4NYJR 2FCRA 5JYDA 3ML1A 1MTOA 1ODIA 2IBMA 2O2ZA 1DC8A 4I50A 1P62B 1ND6A 3KVYA 1VI5A 1CIJA 3JZAA 4TM7A 3VOTA 4B4KA 1C4OA 2C7BA 4IO1A 5GY7A 4B34A 1JSZA 4V38A 2JF0A 3BAZA 3UMGA 3R9WA 2P69A 5ITZB 5EP2A 4U5QA 1WZUA 4NU6A 1X1BA 1KGDA 2H16A 2VVTA 1UZAA 1JDTA 1BHO1 1G0NA 2H85A 2PYZA 1WABA 2AMLA 2PSFA 2X4DA 3F90A 2R6R1 3CU5A 5C8DA 4QM6A 3LNTA 3WNZA 4YALA 3HWX1 2QN6A 4FNGA 2EKQA 5MN5A 4PVCA 4F7DA 1CU1A 4EJ2A 2NSYA 2J7KA 4LEIA 1QP7A 4K87A 3I72A 2VI5A 1EDBA 3LYLA 3BMNB 2BFDB 3OIWA 1J0CA 3R75A 4BNUA 3HBLA 3TLZA 4GFDA 2QE7A 2HU7A 2C8KA 3PQ8A 4KFUA 4URZR 1RZ3A 5CA0F 1ZPDA 5JAPA 1FYWA 3NHSA 4C7BA 4JVLA 3MGAA 2GETA 3QVGA 4YDQA 3GUVA 1GQSA 5BR4A 3W6ZA 1KSGA 3T3IA 2FQWA 4JBGA 5C3MA 3EGIA 2P5TB 1NSTA 3ZWPA 2AFIE 1I2ZA 2FVXA 2VHVA 3VISA 4GX2A 4TV8B 4ZIRB 2HBYA 5AKHA 3RAPR 2COEA 3K2EA 2QUBA 3CLVA 2BC9A 2ERXA 5CFOA 1JEDA 1NHGA 5B12A 2BE7A 2NAPA 4JY7A 2B69A 3PDIA 3QKTA 4TRNA 4QOFA 2I7TA 1PFGA 3SYMA 4MAAA 1N2CA 1VPLA 4GM1A 4KR9A 3QW2A 5D51S 1OCEA 3I04A 3EB9A 3REQB 4ZCLA 1JG7A 1QX3A 1VSTA 1P5HA 3DEKA 4EL0A 2C4UA 3R3SA 4LPSA 2D54A 3NATA 3NYQA 4XPZA 3TCKA 4JXKA 1HMPA 1BVUA 5BSWA 1JEQA 3IAEA 3JAWA 3HKEB 3CVWA 1RWKA 3D3JA 1ZU5A 3H9BA 3QKSB 5AW4A 1B7GO 1XNQB 3NV7A 4RF3A 4BNTA 1R0YA 2ZKIA 3AVTA 2UDPA 3A11A 3ZKAA 1Z12A 2IQ5A 3H6GA 2XDAA 1Z06A 1G8MA 1TZCA 4IP0A 1XMPA 5I8WA 5K0GA 4MINA 1KFBB 3PGJA 4ZTZB 3PUHA 2B1IA 5FOTA 2XSZD 4F4HA 4G56A 4WOPA 3D1LA 4EO7A 4Y2JA 3W8NA 1P8JA 1Z0JA 2Z6AA 5FO1A 3CR7A 3FRIA 4MA5A 4OFWA 5E4YA 3V4PB 1MKYA 3MRVA 4GG1A 1LDEA 2Z9CA 4GQIA 2HPZA 4KAXA 5IDVA 1QBKC 3UTDA 3ES9A 3I30X 3QBJA 4FMDF 5EQTA 2EW8A 4BVFA 3ISJA 4QO7A 3CNNA 5JVDF 3BFXA 3LLVA 4QYSA 5L4LA 2OD2A 3ITEA 1JR3E 3PQEA 3FZGA 2Z04A 5EJ2A 1P44A 4CYMA 4RC9A 1XEWY 4WOJA 2YXDA 3U9TA 2PUEA 1FLVA 3EXG1 4J2TA 4N3NA 5AKIA 2R8XA 5CHYA 2X22A 1E58A 2ATIA 2O8EA 1IZ8A 2TECE 3O2SB 1V8FA 2W2VA 3ZIAD 1MVNA 5JEEA 2C9CA 1M2WA 4V0ME 2A1UB 5KKAA 3ZD9A 1TQ4A 1R0ZA 3AIMA 1UMDB 1SZJG 4K6FA 2Y93A 2ZWOA 3T1OA 3E58A 4H7EA 1GU7A 2WTAA 1L4NA 5FUBA 1KXZA 2VXBA 2AN1A 3AEZA 3K6RA 4BHTA 4HK4A 4RVDA 2RGNA 3DVAA 5GVSA 4UTOA 1SWVA 3QSYA 3V4FA 4QYWA 2V7EA 3PCTA 4F5DA 2J9YB 1Z7YA 1ZUD1 4ZWNA 1NXXA 3PEVA 5F7ZA 3SG0A 5JEDA 2MSWA 2XD9A 2WBLC 3EE6A 3R6WA 5BWOA 5IANA 3GA5A 4MGKR 4XD2A 1N8TA 4KIFA 2BMJA 5FYDA 4ZVRA 7REQA 1M6VA 3M6WA 3L4KA 3RB8A 3G7NA 3T99A 5KJCA 2XZTA 3LYHA 5ALFA 1AKNA 1SXJB 1VJRA 1BX3A 1R9GA 4ZT3A 4G01B 2Q8QA 1Y3IA 2IF2A 4QZVA 3RSQA 1UZNA 2R84A 4RV9A 3TGWA 1QIMA 1YL6A 5BOVA 1YS2X 2G5CA 1BEEA 3K5HA 3O74A 3K0CA 3QE3A 4RETA 3RSCA 4UCFA 1P1RA 4E15A 2PS3A 1JQBA 1GQYA 1UBKS 1QO0D 2IUEA 4PFSA 1EUZA 3BCSA 4A15A 3TBFA 4PYKA 1CRQA 4F4JA 4U8GA 3DAFA 5HM6A 3LD9A 2GNPA 3EXIA 3NM4A 2QNBA 1OXXK 3JQAB 4B73A 4RD0A 4BKPA 5ALMA 4EMSA 1ZI8A 4M1KA 4OI0A 1VHJA 4YUWA 3HCDA 2JLVA 4H3SA 3RYFA 1EVJA 4I0WB 5C34B 2QY9A 2YMLA 3MOGA 3VVLA 3AW9A 2O57A 1EHIA 2NPFA 4C2TA 1YWGO 4M49A 2HF8A 1TYDE 2AEMA 4EPWA 1FQJA 1K7YA 3N05A 1VJDA 2XAUA 3A28A 1ZAKA 3BFPA 1JR2A 2BF7A 3TTVA 5FCDA 4EA6A 2JFXA 4GUDA 3CLTC 4NYMQ 1N57A 1KI4A 1JE0A 2HK6A 5C52B 4WWHA 1O03A 1FU4A 2OCXA 3HI6A 4PLVA 1J00A 2OHGA 3IVGA 2FMIA 3ZBUA 2WJ3A 1U9CA 2OBLA 2Z43A 1CQJB 5CNJA 4MR9B 2D13A 4YUYA 1Y8AA 2JLZA 2CLHB 2J0UB 1G3RA 1H1DA 5EYPA 5HQTA 3K0FA 1JEYB 4I9UA 2GYWA 2VHYA 4W99A 1I7NA 4LF9B 3IUQA 1A9YA 3UPDA 2GLXA 1G21E 2INGX 3LHIA 3GCDA 1CVLA 3L7IA 4WAUA 1FFBA 3RVBA 2VUUA 2Y2VA 4L4ZA 1Y8RA 1G4AE 2H57A 3ABZA 5FLEX 5LA6A 2ADOA 2EW2A 2WABA 4E46A 3TXAA 1YHYA 2FKNA 2YIJA 4O2AB 5G1PA 2OHXA 4C4SA 4CTOA 3CF4A 4AL4A 3AVXA 2IU4A 2W00A 2JCXA 2PMDA 4L8GA 3B52X 1H05A 3OZTA 2WIGA 3PB3A 1E5TA 2J59A 2WZCA 3O8QB 1W93A 3P2YA 2P77A 4RADA 4XASA 4FMCB 3TTWA 4AN0A 1AH2A 4INJA 1AT1A 3FJ1A 2HZBA 5EIEA 2ISQA 4RMGA 1MQ8B 2I7CA 3DHYA 4L9RA 3P0FA 5EHXA 1NYRA 3DVAB 5CDHA 3N8HA 3H9CA 2GEUA 5IWCA 4P35A 5FL3A 2VJMA 3AJ8A 3FN4A 1C30A 1F8YA 2GZRA 3B8HA 5FI0B 1R5NA 1U9IA 1QDLB 2C78A 5AQEA 1T43A 5JO9A 3HVUA 3FH0A 4IEIA 4ND4A 4P4GA 4Q39A 3ESRA 3KCNA 1J5XA 1QO7A 1Z4QA 2RHTA 3K1TA 4L3VA 1S9DA 1OFHA 1UADA 2O1WA 4UNSA 5EJAA 4EB8A 5JSFA 4UUMA 5JZBA 4Z54A 1RRKA 4IQ4A 4JJ6A 4ZAFA 2RI0A 5K99A 3FIJA 4C3OB 2XGJA 1RHKA 3LT1A 1FPMA 1R7RA 4BKRA 1ZRSA 4LRYA 4BE7B 2ZREA 4AROA 3RC3A 4B81A 3I9V6 4G6ZA 4M9XA 2WYWA 4BQSA 4B4VA 3ESXA 3VC7A 3GLFB 1D2EA 1SXJC 2B0JA 3KZNA 4OHUA 4IXNA 3WQQA 2C2BA 2J6IA 5F2EA 3RRNA 3LC2O 4RAQA 5KMGB 3QU4A 4CQMB 4PZZA 1Z63A 2GJ4A 2Q6VA 4M55A 1AQYA 2YBDA 3T06B 1V6CA 1OILA 4YDSA 5CFNA 1C1HA 1UDBA 1HLPA 4OXIA 2F3TA 4X92A 4B3XA 3T7TA 5IKEA 2FJPA 1BROA 1F0KA 1I0ZA 1Z4IA 2C9YA 3ACBA 3BBLA 1DEHA 3IALA 3QELA 1T0JB 1FDTA 4UEJA 5K0LA 4D42A 4QXRA 2VUSA 4B6QA 4CVNA 3CKYA 3SEQA 4BFTA 4OHBA 1JG4A 3JR7A 4D79A 1ESEA 1U0BB 1MDFA 1XMVA 2GBIA 3KKPA 1KJQA 1A04A 2XITA 2P30A 3ENKA 1PS0A 4FN5A 3UUGA 5C35A 4B48A 3O92A 3BL8A 3PRJA 4GOKA 5D1HA 3H9GA 5BYAA 2XJ4A 4B3IA 1O87A 3F3YA 1OD6A 1CE8B 2J3LA 3N2GA 2OO7A 1YR8A 2HXSA 2XGSA 4HAZA 4EG5A 2A9RA 1A50B 1QGUB 2ZI5A 3ZU3A 2AYZA 4HJXA 4MWEA 3D0KA 1RBMA 3L8DA 2PMBA 1VL1A 1Y34E 2WA1A 3OZSA 5TPZA 3WHKA 1G3UA 4TKUA 3TOVA 2PL5A 1JLMA 1NYTA 2WQZA 2HU5A 4CNQA 4LYDA 2GR9A 3NDRA 1WZIA 3GGPA 4ESVA 5IVPA 1XA3A 1T2DA 1G17A 5IN4A 3P2OA 4FZVA 1ZJJA 2B6NA 5AK4A 1S2MA 4YV0A 2O8CB 3D59A 3EBOA 3VGPA 4DFDA 2VDMB 3FF1A 5IBPA 7GPBA 3ZDCA 1QGOA 2ZW9A 1N2IA 2OQRA 3MLAA 2H2GA 3G02A 2EBFX 3SNHA 5E2AA 2LCIA 4B32A 4ZGBA 4PX5A 2XVAA 2FWMX 3JY6A 4X85A 5HMLA 2ZCJA 5CCEA 3V9PA 4E70A 1DHRA 3TLKA 3JALB 3EZ2A 4O1IA 3WWYA 3VR4D 1GTG1 4D4KA 2RKWA 1YR1A 3LQQA 4BFWA 3KOWA 1Y6QA 1U3FA 2CGEA 3EF3A 3HKBA 3L05A 3LIPA 3S6JA 1Q5PA 4NDNE 1N7HA 2QAGB 1QIKA 1RI3A 2OMKA 4GYWA 3ZIDA 4BKUA 2O50A 3RSOA 2QRKA 3B85A 4RDXA 2WT9A 1MX3A 1F7VA 1EVIA 1UBHS 2JL1A 3F6YA 3PDHA 4O2BF 5EMKA 4DYVA 1PCXA 3E3AA 1ZBDA 5KDDA 3FTQA 1FZQA 1Y1QA 3W4JA 3GFOA 2C7RA 1AB5A 1E8MA 2DT8A 3CT4A 3UAWA 2D2VA 3RS5A 3W2GA 2I3DA 5EAIA 4HDRA 4AG3A 1MA3A 2V7PA 3TPCA 3RK1A 1IM2A 1DADA 3K1YA 1QZ3A 1X14A 2NX2A 4GOLD 3TL2A 4FX5A 2OUKA 2ZRLA 1J9ZA 3IHLA 1QRDA 3KYDB 1KZHA 3WWEA 3L0YA 1Z2NX 3FI9A 1EFVB 4OA8A 3GEGA 5LDGA 3AUFA 4KMSA 1V3UA 2LP4Y 4IUBS 2W93A 3ZGVA 1YE5A 2H1FA 1XEAA 4PC6A 4M1MA 2ZT6A 1L5KA 4LJ5A 2J9ZB 2X4IA 4R01A 2PWPA 5KYXA 2WTMA 5BN5B 2AXEA 3BTUA 2Q9BA 2JCVA 2DWQA 3UAYA 2PX5A 4REQA 2PBLA 1F3LA 3QENA 3GAAA 2JJYA 3JWEA 3VZBA 1O6GA 4CIAA 3ZN2A 5CNKA 2XQJA 3DLPX 1SVUA 3VH1A 5I6DA 3ZD6A 4MO9A 1FTYA 5SYNA 2C3OA 3B3GA 3TNFA 2MDTA 5E3JA 3HCEA 1ZOLA 3DFFA 3HVHA 1VBMA 1P7WA 1GAWA 4JZKA 4ND7A 4D1YA 1HDXA 1CUGA 2J6CA 2NGRA 3X1MA 5ERYA 2J5QA 2BEVB 4AJLA 1AGNA 2D3WA 3PEWA 1I7SB 1ZH0A 3A1DA 4BLVA 2FW1A 2O2YA 1DC3A 2VH1A 5D5QA 4Z3OA 3BEDA 3FJOA 4KO2S 4KO3S 2NTEA 1CD5A 5AKEA 5J4YA 2AHOA 1S8NA 4MV0A 5GIOE 1QO9A 2ZPUA 3CLTD 3PVCA 3I6ZA 1XAJA 3MJRA 2VDUE 3N58A 5H70A 1I4EB 2A9KA 2VHUA 4KXQA 4ER0A 1M6YA 3PTAA 4Z9AA 3CG4A 4M46A 2FQ1A 2C2ZA 2I5PO 4Y7CA 1JGTA 4RWZA 5DZSA 4RSMA 5C8YF 1NAIA 3A58B 3GGCA 3V46A 3WA7A 3U1BA 4R83A 2BRUC 1MX9A 3OFJA 1FUKA 1U5AA 2VDPB 1MUUA 2HSDA 2JCBA 4P3XA 4ZT6A 1F17A 1KPGA 3V6LA 4EQ6A 4EEXA 3ER6A 1FFXA 2O5RA 3IMEA 4QJBA 2CDNA 2G1KA 3IQWA 4TWZA 1ECJA 1QFXA 3WB0A 1SNYA 3LE8A 5F5XA 5CIYA 3SIPA 1U5BA 1YB2A 3G8AA 4QU8A 2WFLA 1EWTA 3OQIA 1V8PA 5LZ8A 4OX9B 4TYQA 1NQUA 5KTSA 3AYXB 1UZLA 5HYVA 1EZ4A 1RM0A 1U3TA 1J6UA 1YI8A 2P62A 3LBHA 3FPAA 4QIHA 4YR7A 4Z7JA 1I0IA 1ISSA 3TMYA 3GFVA 2Y77A 2Q4OA 1ORDA 2YJ3A 3B6IA 1CDZA 3KXKA 4GOMD 2PKRA 4BO5A 2QMOA 3IDSA 1NXVA 1OHHD 4XVRA 1P6XA 5IJXA 5CFLA 5J4KA 5TS3A 3ZJTA 2GZDA 2HT6A 4PW0A 3RASA 4IVQA 1QGYA 3OAAA 4BNYA 4KTVE 1SCJA 3K0FB 3EJWA 4L3OA 4C7MA 4WUVA 4PS0A 4AJIA 2RHJA 2RK6A 4MVJF 3NGLA 4IZ6A 2Y1CA 5AVZA 1NVVR 4KVAA 3DBIA 4O2RA 1N7IA 4BV8A 1FLDA 2VQFB 3QTBA 3X3HA 3A2NA 1KVSA 821PA 5IHPA 3WNBA 4B2PA 1XJCA 3BMCB 1B1CA 1P4AA 4NBWA 2OUIA 3RBZA 1UJ6A 3BB3A 4N5DA 4DCTA 5IARA 1M34E 1OIVA 2V59A 3ASYA 1M74A 1NNI1 3HCPA 1E99A 4P8RA 3W2TA 2JLUA 3U4QA 1CUUA 2XOKA 4ESEA 4MV8A 5AOCA 1RR6A 2I4IA 3P0HA 2B7BA 4RVGA 1CBUA 4WCVA 4WESB 1F2DA 4JCOA 3CCBA 3EHEA 4Z1MA 3AWDA 4AZWA 1RWVA 3A14A 3ZVRA 4G0XA 1EVLA 4B17A 1JKXA 1PEAA 4W63A 4BNKA 2VDQB 2PAAA 3KOZA 2CNWA 1B42A 1Y7PA 4LBYA 4N4AA 4YLGA 1L8OA 3ELDA 4GGMX 4I1YA 2FPRA 2GXQA 3L9XA 4YFYA 3C1UA 3W8FA 2D4AA 3U4HA 4ENVA 3PT9A 3HEMA 2ACEA 1IDOA 2GQ0A 4XWWA 2KS6A 2YN4A 2BUBA 3M34A 4YVFA 1RPTA 2I6TA 3CKMA 4D82A 1TKAA 5JSQA 3CV3A 1THTA 4NJEB 3SBOA 3AVUA 4CMKA 2EOAA 1SCAA 3T5DA 3B13B 2P6RA 3RIEA 4U2EA 4RORA 4U8HA 2EG9A 1U7OA 2REQA 4Y2GA 5J5AA 2K4MA 4N3BA 3OJCA 4A10A 3Q1KA 4AX4A 4L2IA 3NHJA 4UHHA 1P74A 2F1OA 1L7NA 3UIEA 5KYYB 1UZMA 3UJDA 3VR6H 4F6LA 1UT5A 2F48A 1TM2A 5LKRA 1KI1A 3DGFC 3FR7A 3VR0A 2FWPA 3TRKA 3COJA 4M83A 2HU8A 5EUBA 2JHAA 2FN4A 4UUAA 3L84A 4KYIB 1GTVA 3PGA1 3SPXA 1GPJA 1SAYA 2PX4A 3NXSA 3RVLA 1YXMA 1U5BB 1XXLA 3ZCPA 4R3WA 5A4JA 1U9ZA 3GG2A 1WXQA 3H11A 3MGKA 3L8MA 2FI1A 4XYMA 3GA7A 4MIKA 3OZAA 1XZLA 4BBJA 3KVVA 4MMYB 4UU8A 1LA2A 4CIBA 4AI6A 1YD7A 2P1RA 1C3OA 1JLRA 2O48X 2XLBA 3V80A 1I3NA 2XH8A 3BWBA 4FOPA 2PQMA 2OV2A 4JLVA 1R9JA 2B7LA 1RACA 3FRJA 1RYBA 5K01A 4XDYA 5F76A 1Z73A 2H54A 4PSUA 1KSHA 2OOSA 2ODBA 3MSXA 2H2HA 4MR8B 4N7MA 3DWGA 1E9AA 1XCGB 4DTCA 1VMKA 5SYMA 4URYR 1T29A 1Z35A 1H0RA 2BI7A 3ETDA 4C7OB 2XV1A 1FTWA 4O4LB 4H0FA 3D5QA 1CJCA 1WSDA 3G5TA 3H8JA 4H2DA 2J0SA 1CNEA 4HX9A 5JCOA 5IXYA 2C4WA 4N48A 2WFZA 3ZKWB 1KMHA 3KXDA 3LBAA 4BBZA 3OTOB 3CX6A 4DCSA 4IDOA 1ADFA 2PFSA 3F96A 3O8NA 2CFRA 4JBLA 1ZWKA 5B58C 1G5PA 2J4CA 5G1OA 1T3TA 4DLSA 1M2EA 2GAFA 1QQAA 1VB3A 3GARA 5I51A 4BNFA 5JCJD 3HNPA 4JP8A 1PNTA 4BQRA 4UAVA 1NOIA 4E30A 3MHPA 5EJ8A 4EG8A 1BKYA 1B15A 5DT2A 3LTNC 2QDXA 5CJJA 1YKFA 1P2GA 3MJFA 3GRUA 1MOSA 1O4VA 1SCUB 1GSAA 1WCYA 2OC4A 4ND1A 2RHRA 5F2OA 3RK4A 3CSSA 3S7ZA 1K6XA 1XZKA 2IEAA 3OWHA 3ZE9A 3HKBB 5HKAA 4UAUA 5MDHA 4OHYA 3WLQA 2D1FA 1YQDA 2CBZA 2ANBA 1NN1A 1A2QA 2QL7A 4GEKA 4HUJA 1TJ4A 3DNFA 2P2NA 4OQ4A 1RLIA 3AVQA 1JQEA 4XDHA 4EFKA 3ABOB 3N8IA 5EN4A 1XTSA 1HYGA 2O8BA 1WB4A 2NTJA 3KT3A 1R27A 3DOIA 5IJ9B 5HJ2A 1ZD2P 1PT7A 3R7FA 1A2BA 1XXHB 4H0CA 3UAXA 1V9SA 3X1XA 3GPBA 2WWXA 5JXWA 1H94A 4HDRB 3VNRA 5LU9A 3BMQB 3QMPA 2OT3B 3PKJA 2OAP1 5CW2A 5A03A 4FK8A 1DLIA 1HT0A 3GJRA 4S2UA 3TZ6A 1NG1A 1ZUNA 1J2YA 1P3Y1 3CPHA 3ZW8A 3KLBA 4F8EA 2X5JO 2AH5A 3QLVA 5BQFA 3CX7A 1O08A 3V55A 2RJ3A 3GUYA 3RBXA 4CL0A 4EUHA 5LOVB 4XVHA 1JA9A 1DG9A 3IHWA 3WS7A 3VYWA 1XPRA 3PX7A 1GPDG 1R64A 4KQCA 3MAGA 3T5BA 2FUEA 3DWEX 5E8RA 2ZVQX 3IYLW 1NIPA 2A57A 3ZUPA 3FUXA 2Z3VA 4NSNA 2OFWA 2CFTA 3X1DA 4KLNA 2A84A 1ZMRA 3VHLB 5I9BA 1ADBA 1HZZA 1QHGA 2W6JA 1OBHA 2LZ0A 1JB9A 4CKCA 4ROSA 2CT8A 4TQAA 1U3CA 4B3HA 4X61A 4RIFA 3DMTC 4CV0A 1T0HB 3INNA 3JYHA 1T5SA 3AVOA 1GGKA 3MWJA 4BNJA 4JXZA 1OVMA 2WEKA 5AO9A 3T9AA 1B2RA 2YDYA 3P71T 1R2QA 3PUKA 4IPTA 2LCQA 1UBGA 2C99A 1PT6A 3M1IA 4UD2A 4M9QA 1Z6YA 5A0TA 1TTHA 1ENOA 5JJKA 1UBSB 1XK6A 3CJQA 4BFSA 1EUYA 4AZTA 3O4IA 4K3UA 3K70C 5DFAA 3T0IA 3UHFA 3VU3A 5DEIA 2B2NA 2I9PA 3EVBA 3OCXA 1HRKA 4YRBA 5BOSA 1U2QA 4CRWB 1ZP6A 3LFTA 5CVVA 3TD6A 3U6BA 1SKBA 1XEWX 1QHEA 4EO4A 4MRAA 1MFPA 4TM8A 5C4IA 1TEZA 1I2AA 4UBIA 3FPFA 3DT8A 3H5WA 1UF9A 3BCUA 4N7RA 4QNRA 1RC1A 2L19A 2QN3A 4CV3A 3IUBA 1I4DD 3BRCA 2ODAA 4HNUA 2P2SA 2GPTA 3KLNA 1IOZA 2EERA 5LMCA 1P0QA 3SXPA 5KBYA 2CK3A 5T4EA 3OU7A 2G88A 4URXR 4P22A 1QQ5A 1R6XA 2V55B 3DSRA 5TVGA 1CULC 2Q6TA 4BMPB 5DHRA 3HSSA 3STUA 1FP4B 2IF0A 3EDMA 4BFZA 2Y0CA 3VX4A 2GZAA 3ESDA 1HYEA 1SKYE 2NWQA 3L6BA 4MKGA 1KYYA 2VA9A 2XTJA 1EFPB 4JT2A 1OBVA 1R50A 4BQQA 1ZQ9A 5K03A 4RK1A 3VMFA 3QZUA 1TT7A 4QGAA 3UK7A 1I3MA 1GKYA 5DYNA 1JXAA 2GPAA 3TOCA 4LK3A 2HMVA 3L0PA 1BA3A 4B3SB 2CDAA 2AF3C 3S29A 5HKKD 1JJFA 3NTXA 4F2DA 1I3OA 1BNCA 4N9QA 5D5PA 2RGYA 5K3FB 4GYKA 3UT5A 1U1FA 3VR3D 3ADDA 4JI0B 1F1BA 5K1ZA 5DW3A 1JLLA 1Q57A 2Y68A 1UMBB 3E7WA 2NZVG 1R4AA 3QOXA 4IQ0A 4ZHQA 2FGJA 1OREA 1I33A 3C0KA 1ECFA 3F97A 4LHXA 5T8KA 1REQB 1TUGA 3UK1A 2VZLA 5JDIC 2C9MA 2I4RA 3D7LA 1ZNXA 4TMVA 1Z33A 2RD2A 3WWPA 2JI9A 4H77A 4S35A 2P0EA 4FWBA 2Q3JA 1QPBA 2I0FA 4IG4A 4EJ6A 1MLDA 2BGRA 1GG9A 1SUIA 3UA4A 5IKXA 3IJRA 4PAMA 3BJEA 1CP3A 3B1VA 2AFHE 4FYWA 3LCVB 4G26A 4DCGA 2ERCA 1T91A 2BONA 3G82C 3OCCA 2AJDA 4R7TA 3PEYA 4MQEB 2B4RO 3PSAA 4GD3Q 3CXUA 4IV0A 3M89A 4NHEA 4DPMA 4LY3A 1XO1A 1G2PA 1HI9A 1XTKA 2GJSA 1O89A 1QTIA 1JPNA 3CH7A 2WD7A 3EXHB 3FYDA 4A1FA 2CWDA 3I39X 3GRAA 1D03A 5KSPA 1ZRMA 1YULA 4R2JA 2FPXA 1MBZA 2ZEJA 4QO8A 1YR7A 1XPOA 1YE8A 2A1IA 4TWAA 1H2YA 1WEHA 1ZICA 3UHOA 1ABBA 3EDYA 2DPXA 4N3GA 2K6GA 4QNMA 3WK8A 5C8ZA 3JQDA 1KR2A 3JQBA 1QHHB 4ND5A 4ZVKA 5JASA 2BT4A 3MVEA 2X13A 3R44A 4TRRA 3WNVA 2WPDA 4FFSA 3ADKA 3PEEA 4P9NA 3I5UA 1FSPA 2YZNA 1XKTA 3S2SA 1SBTA 1XB2A 2MR5A 4BJ5A 4KXUA 5JNRA 2OLKA 3FIUA 1YKGA 2VJYA 2HO4A 2EF1A 2ZJ2A 3N2EA 2YY6A 4BP3A 1IAVA 3G9UA 5K9ZA 1V3TA 1HOTA 3HGQA 1MB2A 5THXA 1N9KA 2AEEA 2SCUA 2ZRQA 2OWEA 3BXOA 4FYKA 3USCS 3QV1A 2I22A 3Q3HA 1P4HA 2C5FA 5FDFA 1A8PA 1N6HA 3C2QA 4NYJQ 1PJLA 3EPRA 4U3JA 4BAZA 3KDAA 3GLTA 3R5JA 1SXHA 2FZKA 3MTEA 2IPOA 4G5XA 4PAWA 5JYBA 4KNYA 2IIQA 1ISHA 3G9ZA 1RRFA 5K8UA 3D8SA 2ZZMA 2G9NA 1CZHA 4RF5A 1NQWA 1YUMA 1XCOA 2C7OA 4M37A 1PJTA 4RL4A 2NZJA 16PKA 4W7HA 4PF1A 2P5SA 4GI3A 1MIOA 2AZMA 2D62A 4UU0A 1CJKC 4OXYA 3NTQA 4MUMA 4BATA 1JG6A 3GT3A 4GL4A 4RH0A 2AOTB 5KYVA 3T9BA 4E31A 1O95C 4XH9B 5AQ1A 2QMQA 1VKJA 3RTEA 4JDUA 1ITZA 3AEXA 3ONVA 3OT1A 3Q7SA 3VR6D 1LPNA 1OZAA 2DRIA 2VHJA 4N82A 4XJTA 3WGTA 4DG9A 5LLTA 2Q4RA 3PG5A 3T35A 1OX5A 1OXKB 1M2NA 5DSTA 2OP0A 4YP6A 4E3ZA 1E2DA 5H68A 4B6SA 1NY6A 3V8QA 1TO1E 1A2KC 2C8JA 5HE8A 1J90A 4GLFA 5CDFE 5IAEA 4E5PA 4PGAA 5LMZA 4JMPA 4Y6LA 1ZISA 4FHFA 1EP1B 3QVMA 4EUEA 1JHUA 1C7ZA 5GJCA 3D4LA 2XVXA 1L6RA 1GFSA 3GOQA 4UM9D 4ZEMA 3X43A 1R6AA 5EJMA 1EJ6A 4UMEA 4D92A 4MAFA 1UBTS 5JOQA 1H9BA 1TTQB 1EWVA 2Y2UA 2FK8A 2O3JA 3IOEA 4DRYA 5JAHA 2HADA 5IPFA 4H7DA 2XCSB 3Q11A 5D8DA 1IYZA 3QHPA 1FXSA 1ZYUA 1VJCA 2VLBA 3NEJA 1N8KA 1KIMA 4QEZA 1WCIA 3UWMA 4MZDA 1G9XA 2H7XA 1XIVA 1Y6FA 1NW3A 1T8PA 4Y67A 1GZ7A 1TC2A 1EVEA 4E03A 1Q17A 4W1RA 1I94B 1DFIA 2OMEA 4J0FA 1GCIA 1TA4A 3L6DA 3GOHA 2OHOA 4XARA 3C7TA 4F46A 3ZI4A 3NIWA 1RPAA 3F5SA 2R00A 1K2WA 3HDGA 3LP5A 1H9CA 4RVNA 4GBGA 3TSWA 3I2IA 2EU8A 1MJ5A 5A9RA 2UUCB 3DR5A 2YFYA 1KAGA 3JQ6A 4I1VA 5BRNA 4TVSA 2OHHA 2A59A 1CS4C 3A04A 2C98A 4J03A 4MWGA 3B20A 4U2BA 3EXHC 1L6IA 4Y2SA 1LBSA 2SKDA 4FLFA 3CJRA 1L1EA 4BMCA 1J97A 4C2UA 4C0QC 3RUDA 4YK7A 1ZK3A 1IOLA 2JATA 4HZUB 3C8DA 2ZS9A 1E2IA 2X2EA 3DAHA 3ZQ6A 3CINA 3OMXA 4C4XA 4NNJA 4LQCA 4GP9A 4DNFA 3NWBA 1YBAA 5ICEA 1S3GA 1SVSA 3A2KA 2V65A 2HWUA 1EA7A 2P67A 3LQ4A 4R2WA 3VYRB 1YGPA 3IJEB 3MHTA 2PO5A 4M60A 4R05A 3EMBA 2H8KA 1YAHA 4GNKA 2QW1A 5C5DA 1KE1A 4DC1A 4XIFA 1TTTA 4I9HA 3GBSA 2GPWA 4QU9A 5AI6A 1TT5A 4TLBA 1YJ8A 3K70D 4UU1A 2YVLA 3H1EA 1OLSA 3I9V1 3W7VA 1GKIA 3K9FC 2QZSA 1UFOA 3PDWA 1RXWA 3V2IA 1MOZA 3L0SA 4KMOA 1L5MA 2BH2A 1J2EA 3NEAA 3VVCA 2C07A 2F8LA 3OJXA 3PC7A 2ZZKA 4S0ZA 1QTNA 1IVNA 3MRTA 1EVQA 3Q40A 3QX3A 4MOWA 3V1NA 3BYZA 5CPFA 2IUUA 1D2NA 4RQBA 4DJ5X 5BV0A 2C57A 2UUPA 3G0OA 1QR6A 1Y80A 4QC2A 3LI2A 4OH7A 3BWYA 1L4UA 1O5TA 4N0EA 2YRWA 4CQMA 4TZTA 1KJWA 4YPOA 3EVTA 1PNRA 1K3TA 2WHRA 1O5OA 1Q1BA 1DKNA 4F2HA 5FTNA 1W4CA 1J0AA 1P2UA 1QYCA 4FE7A 4KWTA 3F49S 2ONJA 1XU7A 3IKJA 2H4JA 2JZCA 4V0NA 3TLGA 3H9UA 5G0VA 1TEXA 3BIOA 1RMTA 3RGGA 2WWIA 3P26A 2Y67A 1EG7A 1O6ZA 4P38A 1ZGAA 5G2OA 3RIXA 1AHNA 3TRIA 5LOVF 2DFVA 3BXPA 3FD8A 3FUUA 5DGTA 3AF4A 1JP7A 4Q02A 3LOQA 3FOFC 2Q29A 3AIKA 1SG6A 1YUBA 3BWDD 2JAWA 1RWPA 2E7ZA 2PUJA 4ZVNA 4CKWB 3VOAA 4WHMA 3SHWA 4XYBA 1S01A 1IBKB 1A5ZA 3KCQA 1Z0IA 4KPGA 1IPFA 3DO6A 1CWUA 3MGBA 3WJ1A 2OP1A 2P68A 4NX2A 4S1VA 4CDGA 2HQRA 2IPNA 2Q99A 2F7SA 2GOYA 4DJTA 5JWOA 4G8JA 3K53A 4EFNA 3ME5A 3SBXA 3A70A 2A9FA 3KZVA 3TWOA 3RADC 4PINA 4FR0A 3AFHA 4NICA 4ZV7A 2EC5A 4PLCA 3WIOA 4C4YA 4DG5A 4DADA 3I52A 3ZWAA 1W36C 3CSUA 1Q11A 1X6VA 4WIAA 5J58A 1QRRA 2G36A 3FA2A 2Y1XA 1CC1S 1VBKA 2AN5A 2NUPA 5IZCC 1PT9A 4NL4H 2O2JA 2H63A 3H2JA 5HGJA 5I7UA 4DA6A 3B1FA 3F3SA 1GYRA 2D2XA 4G5YA 3SXUB 1CF9A 2G0NA 3DKPA 3OSUA 3MWKA 4X63A 1YB6A 4QYIB 2WUFA 1XZGA 5ALGA 2WSIA 5B1SA 1F06A 1FMCA 1PFQA 1C1DA 3OUZA 5CT4A 5B6PA 1G3MA 3ZC3A 3ZNOA 1YH3A 2YHBA 3EEOA 1M5UA 4U2KA 1C5KA 1Q0QA 3X0DA 3EVNA 3B36A 3ZK9A 2JH3A 1TL7C 3LDAA 3O3MB 2Y76A 5TIIA 2IPMA 4ZCSA 2QLMA 1M0WA 4YXWD 1EJBA 5IKPA 3CX4A 5ULLA 2O1SA 3QTTA 2ZUWA 1IPHA 4M38A 2P3OA 4ISCA 4O2AF 1CUWA 3RT1A 4DC9A 2J09A 2I71A 4J0CA 3ZDYB 1WDMA 5BWMA 5I7RA 4C0AC 1JTVA 4Q9DA 3NU1A 1J1UA 3URKA 3KLOA 5EHQA 5JMOA 1FRNA 2PWBA 3V1LA 4ZOLB 2BR4A 3T9DA 1G64A 3C6BA 4XEUA 4ZOQI 4RA9B 3DLTA 2FW8A 5F3WB 3V8PA 1C3OB 2ZXFA 4NCBA 4LJ7A 1R8SA 3FCUB 3V34A 5JCZA 1NR1A 1Q44A 1MMFB 1NXPA 1W2HA 1WULS 3ZJUA 2UVPB 5EIAA 3CLUD 5EPEA 5J2UB 1JA1A 1Z08A 1JHDA 4ZI3A 4K05A 4M9UA 3EC2A 4JC0A 4ZO4A 2ATEA 3S2FA 4CLEA 5ER9A 4F71A 3NO4A 2Q1YA 4CF3A 4GVPA 3NKLA 4OHZA 4DMRA 1QSGA 2LE0A 3C16C 3F73A 3FTEA 1XHLA 2VR1A 4L5JA 4ZI7A 3RC9A 1BXKA 3AOEC 1WAMA 3K31A 1U1EA 2HXYA 2QDKA 2QUZA 2D59A 4AYWA 5KQRA 3ISTA 1WDLA 3L0DA 4YCNA 3MMNA 1F8FA 3FPLA 1DXQA 4I5GA 3P5BA 3H4TA 2O23A 2DHCA 1BQ3A 2HCTA 3MLEA 1YS6A 1E3SA 4B84A 3EZNA 4CLDA 4FBMA 4MIOA 4R68A 2RH8A 5DSZA 4UCQA 3IKTA 1NQ5A 2V0CA 2VKTA 2YOFA 4Q3BA 1FW8A 1ONOA 2JAQA 2YC4C 1NC1A 2BP7B 3IFSA 1KH2A 5HKOA 1I6WA 4RPJA 1VBFA 4HDOB 1QCCA 3IKLA 4JEHA 1EQUA 3E0XA 1K8XB 1J7JA 2EIXA 4I5IA 1NBMA 1C0PA 1M2VA 1MOPA 1EYZA 4TVBA 4ZP1A 2W6IA 5DGDA 1Y5LA 5FBZA 4QBIA 2BFFA 1B14A 2H1IA 5T67A 2RAFA 3C8UA 3NWJA 3TTXA 1JQ3A 1E5QA 4NS4A 1P4SA 5JS8A 3RK0A 1W36B 4YI3A 3Q9NA 2X9NA 4M7OA 2OE2A 4GP6A 2ZRFA 5DNWA 3RM3A 2P9YA 3R3JA 3O3NB 4J75A 4WCFA 5CA0A 3RC8A 5EIXA 2WHPB 2HJHA 4UHJA 4MYDA 1J23A 1PL7A 1US8A 3R24A 5EFZA 3N8GA 3FOZA 3M5PA 4LZWA 5GPBA 3L7NA 1P60A 2QL6A 4HEQA 1DIRA 3TNDA 2HY7A 1OC4A 1XZCA 2OTCA 1E7WA 2E4XA 3HN2A 2ZYVX 2A33A 4NZPA 3SZLA 3BT7A 4ILEA 4CTKA 2HWYA 2HTFA 3IUSA 1Q0HA 4R8VA 3ECAA 4S05A 2WTBA 3G8DA 2H9YA 5CBPA 1KQNA 1LF5A 3VJKA 2WR8A 1B0AA 3LY5A 3GQBA 3HKEA 2HV9A 2ZSEA 4B4WA 1GU0A 3OTIA 5L3SB 1IZZA 3DEHA 4FT4A 3BGSA 3U3ZA 4BO3A 5E6RB 2NTNA 1JBKA 2XA2A 2JI6A 4M7WA 3W2HA 5LQRA 2ZT7A 1UC4B 1ORRA 2WZBA 4NE7A 1RKBA 2I54A 4AJ4A 4AZ3B 1ZHOA 2H1WA 2XXAA 3C1OA 2WMNB 1TM7E 2OESA 3FG9A 4YACA 4OIFA 5KC8A 2VF5X 1KZ7B 3AEQB 2EGGA 2ZB3A 3HJUA 4DWJA 2P9HA 4KLCA 1EXDA 3O4VA 1UBCA 4IIJA 5BSHA 1L4EA 1CJTC 1P2TA 5DNVA 4F3YA 4CEIB 2W8ZA 2WIJA 4OHVA 1JWLA 2RG1A 4KXFB 1W30A 3E9DA 5KWEA 5EQFA 1T2VA 1CP2A 2ZPAA 4BNVA 3GMSA 1YDHA 4MULA 4J0IA 4L4SA 1ISPA 2EFEB 2VAPA 3KUUA 3CNLA 1QAQA 1EE9A 1Z75A 2R7NA 2XA9A 4I55A 2B92A 1AQLA 4W1QA 4HWGA 4BVAA 2HA3A 4FEEA 4J49A 4JX8A 5JS2A 5AM3A 3IBTA 1J5EB 4LTNA 1HDYA 3KQWA 4EMUA 5DN6A 2E55A 3AVYA 4AMUA 1XVUA 2GO7A 4G1EB 2CYCA 4QAJA 4EPVA 5M29A 2BKVA 5KX5B 1HOXA 4HLUC 3W4KA 3KB8A 5CG2A 3SP1A 1LPMA 3A10A 1R15A 3R9KA 4CKEB 3LW8A 3RS7A 1FP6A 2ON6A 4YJFB 2P7IA 2SHKA 2R96A 3LUCA 3W2FA 1BHQ1 1QIGA 1UOPA 1ID8A 3TINA 3BK1A 3OOEA 4D99A 1XAIA 2RK3A 3DCYA 4QRIA 1Y4AE 5DISB 4CZ2A 5JUWA 2XBMA 5B4TA 4X24A 2XR1A 3RCBA 3SIWA 3RNLA 3DPIA 3GG9A 4V2IA 3LGXA 2KQUA 3QE9Y 3L8FA 3R3XA 1QP4A 2Y3IA 1BFDA 3FTNA 2B4KA 3RIYA 1ZKDA 3T3OA 1EX1A 4Q5IA 2FN9A 4ID9A 4OCZA 1Z26A 4PR3A 5ADHA 1JAYA 3J81A 5J2TB 1SC9A 4O4HB 1L1RA 3FNEA 2GASA 2PUGA 5BYKA 4Y9UA 1J7KA 1QH9A 3W9SA 3K1AB 2HCJB 1UC5B 1Q2UA 3OIVA 2QUAA 2WHPA 2WJVA 4W6ZA 3RGWS 3JYOA 1I7PA 1KNQA 3H0CA 8ATCA 1K8YB 1DIBA 2AEFA 2X14A 2BDEA 2FW0A 4QVGA 1F9EA 3SKVA 4EG4A 1Z45A 4LYGA 5FTLA 1WQ1R 3PXAA 4JSRA 5JHHB 2ID7A 3S68A 3GP3A 5AW8A 3OP4A 3CNEA 2LD4A 3ONWA 1G8YA 4ISBA 5F3DA 4HVLA 2FSGA 2QIOA 3MERA 3N7UA 3VPDA 1Z0FA 1O0CA 5ETJA 1VE5A 5D01A 3HCAA 5BMVB 3ZZNA 3ZCUA 3WI7A 1UPFA 4GYJA 2JKYA 3K8OE 3QVXA 4M8SA 3WV5A 3U16A 1Q84A 5DNYB 1A7KA 3EC1A 3PFCA 1P5RA 2G0TA 1H1TA 3CO0S 4UD6A 1HR0B 1P80A 1ZUIA 3O9ZA 4Q3DA 3DMFA 2OLEA 3M5CA 5SZKB 2A94A 3AEUB 4ZJPA 2LW7A 1M7BA 3U4IA 4YC7A 1W19A 3ESBA 4GX5A 1OX6A 4V39A 5KTYA 3Q7QA 4PHFA 4JB3A 5HIKA 4YAUA 3DM9B 4PLGA 1DDGA 3L49A 4EVRA 3D7SA 3DMGA 1S7GA 1J20A 3KHTA 2A7QA 1LNQA 5K05A 1UH5A 3GV0A 2GYYA 4NMXB 4X7BA 4Y0AA 2FMFA 2O5CA 1Z6XA 1GZVA 4MYHA 3LYUA 2K2WA 3MMSA 1T5LA 1VRCA 2C0CA 5GZ6A 1KY4A 3PNSA 2CMDA 3VNAA 1WQ3A 2JGDA 4Y6OA 3O94A 1JYFA 3Q0EA 3CVJA 3ECSA 3QFFA 3EG9A 5K2OA 5ARBA 4PV7A 4ARCA 4MUIA 4LISA 2NQ8A 3UJ6A 4HYYA 1SD2A 1QVVA 2WLTA 4DE5A 3SEZA 4F3RA 3T61A 2MSNA 2CNBA 2H31A 2NU9A 1FRFS 2H7CA 2XQIA 4AK9A 1MQ9A 2X9LA 3B70A 4R69A 2ES4A 1J5PA 3MJVA 4DA0A 2ZR0A 2V5AA 3CVYA 2RH4A 3NKVA 4GXQA 2JJ1D 1YE3A 4JEIA 2VQSA 3NYWA 1IRIA 5B7NA 2IGBA 1OB2A 1ZLXA 2I7VA 3G68A 1KVTA 4G4IA 4KFRA 4XDGA 3UC5A 4R0MA 2QD3A 4H4CA 1CUDA 1D6MA 4ALNA 4EG6A 1OU4A 3BA1A 4EQZA 5EE1A 4I4NA 2QMZA 3DKKA 4F21A 3DV2A 2BJHA 5ICGA 1C8LA 1JZSA 4LY0A 4LXXA 4V3CA 4X9XA 1YQWA 2OGUA 3CB2A 3DT6A 2CVPA 4RAOA 4ZOAA 4JJ7A 4UAGA 4CCSA 5CT5A 5FUXA 3UXHA 4UEOA 3V1TC 1QIEA 3MPUA 1NONA 1X0VA 1D0SA 4RDCA 1VL8A 2OVBA 5COBA 2RIRA 3IJ5A 5EKXA 5INTA 5G40A 1SUDA 4ZYLA 3IO5A 1ZMXA 4IVRA 5DYGA 4E6PA 4IILA 1N0IA 2CXNA 2HA5A 3BD6A 3LX8A 5ITSA 5KTMA 2VSNA 3SYRA 4NBTA 3THWB 1OAAA 1V1MB 1BWQA 2JJ2A 1E8NA 4LQ4A 3B60A 4F97A 4RCYA 4MS4B 5ADVA 4OI1A 2WAYA 2X7HA 1RBQA 4AB1A 4G3XA 3PI7A 2X5OA 5JSKA 1AQNA 2G08A 2WAAA 1JAHA 2G4CA 2NN3C 4UMFA 5LYJB 5IBQA 3BTSA 2V7VA 1N5IA 3HE3A 5DHSA 4DIDA 4G2NA 3GL9A 1S1CA 1UKBA 2D0IA 2EF0A 2I6SA 1CZLA 3OCJA 2WYUA 3U39A 3WJ2A 3ZYZA 1G5TA 3VPBA 4OG2A 4ZZ0A 1T5DX 1MDBA 3U3KA 4CEHB 4H59A 3HACA 4TLEA 1TU0A 1UR5A 4EKDA 5KWVA 2QYHA 1UANA 3EQ7A 1NVGA 4NV1A 4Y30A 3RV3A 3TTYA 2I6UA 3VU8A 3FLEA 1FMFA 5EJ4A 4BWVA 1RE0A 3QEKA 1XTJA 2OV8A 4MKRA 1ZKMA 5HP4A 5B7QA 1WWKA 1H0KA 4UBNA 4H27A 5CITA 4FZ3A 4QTXA 1B76A 4XUCA 5DM0A 3AB3A 4ZODA 3ZWQA 1S8AA 1FSSA 1GZ3A 3SQNA 3I3OA 4M89A 1G98A 1LTHR 1FP4A 3EVCA 2FK7A 4HUTA 1FQKA 5CYGA 1CV2A 4M0LA 2PKCA 3BH6A 4BUZA 4JLSA 2I80A 3AKDA 4R7ZA 2DY0A 3L1VA 3T5TA 4O4LF 3KD2A 4WKOA 1Q14A 2HPVA 2IX3A 5K3CA 3U4MA 9GPBA 4YMLA 3DEIA 3B1JA 4P0PB 1PRYA 3N7TA 1GD1O 3OC6A 3BRWD 3O8LA 1JH8A 3P9QA 1TYEB 1YJ5A 2LKDA 1G55A 1E32A 1N5RA 1SG0A 3CHYA 3I4CA 4BCBA 3WYAA 1NFQA 1G1AA 2IKSA 3AIIA 5B1DA 5KWJA 1DXYA 2RJOA 3JQFA 2J6BA 5AK3A 1YR2A 2IXTA 2W2PA 3WK9A 1C3EA 3V32A 2IIVA 4WNCA 1C0LA 3AYZB 3UMCA 2E4YA 3PRHA 4GMXA 4X1IA 3TH5A 5EE9A 1WUIS 5LNK1