1M72A

Crystal structure of caspase-1 from spodoptera frugiperda
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
256
structure length
247
Chain Sequence
RVARMPVDRNAPYYNMNHKHRGMAIIFNHEHFDIHSLKSRTGTNVDSDNLSKVLKTLGFKVTVFPNLKSEEINKFIQQTAEMDHSDADCLLVAVLTHGELGMLYAKDTHYKPDNLWYYFTADKCPTLAGKPKLFFIQACQGDRLDGGITLSRSYRIPVHADFLIAFSTVPGYFSWRNTTRGSWFMQALCEELRYAGTERDILTLLTFVCQKVALDFESNAPDSAMMHQQKQVPCITSMLTRLLVFGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of an invertebrate caspase.
pubmed doi rcsb
source organism Spodoptera frugiperda
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Caspase-1
total genus 80
structure length 247
sequence length 256
chains with identical sequence B, C
ec nomenclature ec 3.4.22.36: Caspase-1.
pdb deposition date 2002-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00656 Peptidase_C14 Caspase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1m72A00
2H51A 4I1PA 4QUHA 3GJRA 3H11B 3K7EA 1F1JA 1RHUA 1PYOA 1RWPA 5IAJA 3UO8B 5LUAA 4QUBA 4FGUA 4D3XA 5IBCA 2C1EA 3ITNA 1SC4A 4EHKA 3EDQA 1RWWA 2C2OA 3SIPA 1BMQA 3S70A 4EHAA 1SHJA 5IBRA 2K7ZA 1RHJA 1K88A 1NMSA 3D6MA 2P2CA 5I9BA 4NOLA 3E4CA 4M9RA 4NBNA 3R7NA 5K20A 4QUGA 3V4OA 2CJXA 4ZVSA 1CVRA 3EDRA 1RWKA 4QUDA 3V6MA 3NKFA 1RWOA 3SIRA 2QL9A 3R5JA 1IBCA 2CNLA 3KJNA 1NW9B 5LUBA 4EHNA 2HBYA 2C2MA 4ZVTA 1RWNA 1I51A 4FXOA 4ZVUA 4D3ZA 5IC6A 3P45A 4LSZA 2XZDA 2QL7A 3S8EA 3NS7A 3QNWA 5IASA 5JFTA 3H13A 1KMCA 4I1RA 4QU5A 1I4OA 2H5IA 3R7BA 4JJ7A 3KJFA 4JQYA 1JXQA 3NR2A 3PD0A 5LU8A 2J30A 2H65A 2H5JA 2XYGA 2Y1LA 4ZVQA 4HVAA 1SHLA 5IANA 4QU8A 3IBFA 1QTNA 2J32A 5I9TA 2XZTA 4EHHA 1M72A 4HQ0A 4FEAA 3R6LA 1RE1A 3P4UA 4NOMA 4N7MA 2HBZA 4QUAA 4JQZA 4QUJA 5LU9A 3V55A 2QLBA 1CP3A 4EHLA 1NMQA 1RHRA 3GJTA 3IBCA 3V6LA 2QL5A 2NN3C 3H1PA 2CDRA 4JR2A 4PS0A 3V4LA 2H48A 2H4WA 3DEKA 4NBLA 4NOKA 3R7SA 4EHDA 4AWAA 3PD1A 3OD5A 4IYRA 1ICEA 3GJSA 4NBKA 1RWVA 3D6FA 2HBQA 3H0EA 3R6GA 3DEJA 4ZVOA 1SC1A 1GQFA 4QTYA 4N6GA 2FP3A 5IARA 4JJ8A 4DCOA 4DCJA 1SC3A 5IAEA 2H4YA 3H11A 4QU9A 4JR1A 4QUEA 2J31A 4JR0A 2C2KA 1QDUA 2XYHA 5IC4A 1K86A 3BIJA 4D3YA 3GJQA 3V3KA 2WDPA 1PAUA 1I3OA 4DCPA 4N6NA 4AWBA 4FDLA 4AW9A 1F9EA 4QULA 1RWXA 4ZVRA 2CJYA 2FQQA 2AR9A 2QLJA 2J33A 1RHQA 3PCXA 5H0IA 2CNKA 5IABA 1RWMA 4PRYA 2H54A 3R5KA 4IEFB 5IBPA 4EJFA 2C2ZA 4EHFA 4N7JA 2HBRA 4HQRA 3UOAB 4JB8A 2XYPA 2Y0BA 4JJEA 5IAKA 3RJMA 4ZVPA 1I4EB 3DEHA 1GFWA 4PS1A 4N6OA 3KJQA 1NMEA 4NOJA 3D6HA 3DEIA 4PRZA 4QTXA 2CNOA 4QU0A 2DKOA 5IAGA 2QLFA 1RHMA 2CNNA 2FUNB 4QUIA 4N5DA 1RHKA 1QX3A
chains in the Genus database with same CATH superfamily
1GCIA 2FN3A 2PIAA 1RMYA 1UBJS 2YJ4A 3GRVA 1LC3A 2BKAA 4JA0A 4CTJA 9LDTA 1GL3A 1EUZA 2NO9A 3RRNA 1CT9A 2CXRA 5FORA 3ELDA 3R7DA 2G82A 3L04A 1HNNA 1MAHA 3HGQA 1I0ZA 3GC6A 4K03A 4DZTA 1Z2DA 2I55A 5HHTA 5HQJA 3T1YB 3IPYA 4AMYA 1FSZA 2JVKA 2RGNA 3P52A 1C2YA 1RRVA 1RJ9B 2YY5A 2ZUCA 3QLTA 6Q21A 1HEIA 1MZVA 3T6KA 3LHIA 4QFCA 2ZE6A 4P08A 3HRKA 4LYGA 4EP1A 2XCIA 2FRXA 4UAJA 2GD6A 3FLAA 5H1YA 3A4IA 1XKQA 1BU5A 2XRYA 1I5EA 1P1HA 3AF0A 1U2DA 2AFIE 4WUTA 3U81A 2CJWA 3TRJA 2P8SA 1P44A 1U3VA 1NFQA 3IQZA 3X2FA 3D6VA 4ECEA 2OV1A 1QNLA 4FOOA 5DXAA 3G7UA 3QUQA 1WU8A 1ZJZA 2ZB8A 3W8EA 5KUTA 3CH6A 4U6NA 2JFZA 4DQLA 1G5RA 4BCBA 2K5UA 1GA6A 4EMSA 3ZLJA 2GUGA 1NHWA 3HN2A 1VKNA 1KDYA 3ZHTA 5J2TA 3GA5A 1CUGA 1P31A 4MVJE 4O2AA 4X84A 1D7AA 4TVBA 3NBAA 2YZKA 4M8KA 2J3EA 1Q1EA 5CLHA 1LDYA 3OIWA 4YEDA 4GKBA 1W44A 3G2NA 2ZDHA 4DUYB 2YOGA 3VNSA 3K70B 2PXAA 4ON9A 4IJUA 1JZSA 2PZGA 3RARA 1JHMA 4MKIA 4OJQA 4DBZA 4MVJF 4UCQA 2VSNA 2V74B 4D9BA 2QZ9A 1EWKA 2YNMD 4EA6A 5K8IA 1HLFA 1UDCA 1NBHA 3AV0B 2NO0A 4BUCA 1BD3A 2C7GA 3L4KA 1F3LA 1NKSA 4OA5A 3RSSA 3TIVA 5JPIA 3IGFA 1T4MA 2GERA 2ZR0A 5ER9A 3RS8A 1QHIA 1O3YA 1OI7A 2YMLA 3WBKA 1XP8A 3QTTA 5FX2A 3WHPA 4BRSA 2IUTA 2GK3A 4KX5A 4EJMA 1CYEA 3VR6D 3LBAA 3L7AA 1BYUA 3O7WA 4IDAA 1JYEA 1TVKA 4L73A 3ZDXB 3VUFA 1EIWA 1MC8A 2YVAA 1L4NA 2K2QB 2O20A 3OE1A 1OJLA 1RZUA 3RUAA 4EENA 5IZCA 1XQ9A 1M6VA 1WD5A 3K9QO 4YLYA 5JQGA 1GRVA 3GLRA 1JJVA 2NV6A 1PL8A 3IXLA 5AJUA 1X39A 4ZZ0A 1RRCA 3LE8A 5FBVB 1P73A 4AJ1A 5BVGA 1C29B 1Q7GA 4US0R 4LE0A 1B74A 4ZARA 3ASVA 1R0WA 4XUGB 2AWOA 4AF6A 3JWGA 1H3NA 1AKYA 5BR7A 3ZJ4A 4Z99A 1WEKA 5FLEX 1G18A 2C4NA 2YMMA 4A2WA 5AUNB 4B6EA 2O5VA 3ILXA 1FL9A 3VFDA 4NV0A 1ZK1A 5AW7A 1TE2A 3PC2A 1ADFA 4PCVA 2AHRA 5FPYA 3FTQA 4P6VF 4OIMA 5LD2C 1A5AB 1F8XA 1JPJA 2C3MA 3U1VA 1Z6PA 4XD7D 1G8GA 2F9LA 2CVOA 3BMNA 4CM4B 1YONA 3F71A 4AC9A 2I03A 2ZJZA 4ITVA 4LJKA 4WCVA 4JP1A 2VQFB 4CM8A 1UAGA 1TZJA 3MINB 4IINA 5CLFA 1RXSA 2PSJA 1GGFA 1QZUA 4BGIA 1RJDA 1D2MA 1RWWA 1MH1A 4HFRA 2DBVO 1BQEA 2PKYX 3IA7A 3KCNA 4JFAA 2UZ1B 3EG5A 5CFMA 2C83A 2OB1A 5DEOA 3LYHA 2GKSA 2RKWA 2AX4A 4Q9IA 1HK7A 1FUKA 2IP1A 3R7NA 3CYFA 1YOVB 2EFGA 3QGMA 1RJEA 4HYQA 4P33A 3IYLW 4PIPA 5AIAA 2GCOB 3SHQA 4QUDA 4CFZA 1E7MA 3E9ZA 1ZGZA 2CEKA 3BHNA 3FLMA 3TL3A 5J4YA 4YDSA 2K4MA 4CQMA 4CDNA 5JANA 3QI7A 2R1ZA 5HBRA 4MVJI 2C2MA 5DF1A 5CD9A 4PC7A 2HDOA 1F0NA 3ILVA 4H7IA 2QL7A 1TJNA 3QNWA 5F7JA 1MMFB 4RACA 3I9KA 2ORIA 1N6HA 1ILEA 2QY6A 2QDKA 4TZ0A 2CDCA 2PU5A 1C7EA 3GFOA 5ITSA 2YIDA 4TVSA 2G0NA 1FVOA 4PN3A 5DN6A 3P9KA 3BXGA 3T9EA 3TS1A 1N2CE 4H18A 5BYBA 1GPH1 4WV3A 4MVWA 4AFNA 5CGQB 3ZD9A 4CR7A 3H05A 2P40A 3VPCA 3A28A 4QOFA 4ZWNA 1Z0SA 1I4DD 3EMBA 3FIJA 2ZJOA 2PPLA 3P0RA 5DI9A 5EE3A 5KTPA 5TNXA 2XYQA 1WB5A 1NLZA 5C8YA 5K4AA 2DECA 1PT6A 4NAHA 1XPJA 2ZQ5A 4ACBA 1QYWA 3I5MA 1UIMA 2RAFA 2VJLA 3TTYA 5M34A 2ACEA 1CRQA 1SWVA 5KAPA 1XSEA 2CLCX 3L5OA 4NBKA 4P0TA 4RD6A 4Y6GB 4D25A 2OM2A 2EX1A 1SO8A 2ZWOA 4BQFA 4DQUA 2FK8A 4CPDA 4M9UA 1ZIDA 5HVNA 2XXAA 3PI7A 1YS1X 4G5OA 4C0SA 2R11A 1AGNA 4LXHA 1UMCB 1Z0FA 2JVIA 4JXJA 4CZ2A 1G2IA 1YZYA 4FE3A 3PFBA 4YROA 2G07A 2XF2A 2GLTA 4GSYA 4LFAB 1GN9A 2RFLA 3ZHYA 2XNHA 4CIWA 1T6BY 1B43A 3I3OA 4E14A 2WINI 8ABPA 2IJGX 3V8BA 2IL1A 5A4IS 5K5EA 1J2RA 3TEMA 1RI5A 3DGEC 3VYTB 3GOHA 2O54A 3KUXA 4U9UA 1KAEA 2CMGA 3UG6A 2C7RA 1QIHA 3BERA 3IHLA 1IWPB 2AR9A 5CPBA 3OZBA 2FRDC 4L85A 2QW1A 5TMBA 3H84A 4PRYA 1QZ3A 4E5YA 3IDFA 5H02A 2IYRA 4CLOB 5ECDA 4WEQA 5EC8A 3FH0A 1V7QA 4HWGA 4MGYR 4U2CA 1Q3HA 3D7NA 2GVNA 3IELA 3ND9A 5EKXA 5H3HA 4H0CA 1PHPA 1Z74A 3BTVA 4RFVA 3TSZA 1CUVA 5T8KC 3JR3A 4B6PA 5ARBA 1QG2A 1LTQA 2FUNB 1E2PA 3TGLA 2R5WA 1C1DA 1PZGA 3I1JA 2NUPB 2OLJA 4ZCTA 1ADJA 1ODJA 1WS6A 1AG9A 2P9JA 1AA9A 1P8JA 3T15A 1QG4A 3BIOA 3KYJB 4X8MA 1D9XA 2Q3LA 2RMKA 1U0NA 5CB4A 1IXZA 1KAMA 1VG1A 2I4RA 3C8MA 3NB0A 3OWOA 1F2TA 4KTVE 4LOHA 3E7WA 1GZ7A 4LTMA 3UHFA 2DZDA 1DKOA 1A1SA 1SWWA 2RHRA 4HMQA 4RNDB 5TXGA 3QEBZ 1L1FA 2A86A 3O9ZA 2XUGA 3BJEA 4MJ7A 1VM6A 3OHPA 4EKYA 2IHVA 4EPWA 3O2SB 1MOSA 3T38A 2YQZA 4JBXA 1WKVA 3AR4A 3ZVRA 1EBUA 1TYCA 2CBZA 2MR5A 4FLMA 5ALEA 1PJTA 1B26A 4HRXA 1I2ZA 1P2UA 4X85A 1XN4A 1E1QA 2LZ0A 4TSKA 2Q3CA 1GYRA 2FSSA 3DR5A 2JLUA 3C97A 1JRLA 2G8NA 3MT7A 1DX4A 4L4YA 4AZWA 2ZSFA 4RSMA 2OECA 3YASA 2C99A 1DMRA 3ZDCA 2ST1A 1Y7HA 5FYQA 3VJMA 5B58C 1HV8A 2G1JA 2QM3A 4FDTA 4AXBA 3M5PA 4OYLA 3BL5A 3EZGA 2WMNB 3I2KA 5AHOA 4XDZA 5AM2A 3P9XA 4ER3A 5HZKA 2MR6A 2GBCA 3DWFA 5IANA 4LG1A 1TJ4A 1RKBA 3QXSA 3DGFC 4YASA 4XE5A 3UMBA 4U7JA 5KVSA 3L79A 4LJ7A 3ZXUB 2V96A 2C9OA 3HC7A 4ZI7F 2IHNA 4FNGA 3DZHA 4CCYA 3FCYA 2O1XA 5AM1A 1YFLA 2QY9A 1NRIA 1VJGA 4PSAA 1FNBA 5AK4A 3IESA 4RH3A 4JLVA 2Q4DA 1TL7C 4W9NA 2HQBA 4G4GA 3FLEA 5K8LA 3VO1A 3HWRA 4G4IA 1A2KC 5EHNA 2ZUBA 4KE8A 3VR2A 3SEAA 4JP8A 4EO7A 4WK2B 1U5BB 2HMAA 4IYRA 2E5FA 1E2HA 1T2UA 4QDXA 4D9JA 1X7WB 3NBYC 1SC1A 4B5KA 4P1ZA 1EXVA 1Q5PA 1YASA 1VKOA 2QT9A 3H3JA 1Q12A 2RHOA 4TTJA 4YGXB 5FBRB 3UV3A 5B2EA 3BK2A 1QRTA 4RVNA 1IC6A 2CK3A 2LCIA 4RLSA 2PUBA 4Q3LA 1L5KA 3LYAA 2B92A 4MQ6A 4MRPA 2AVNA 4J7UA 3RTAA 1KO5A 2YW9A 2Z09A 2RK6A 4UATA 1BHJA 1M74A 2FW6A 2VJCA 3EVNA 5KS2A 3EVZA 4R8SA 4RK7A 1UK9A 4UVEA 1UJBA 1E2NA 1G8SA 1Y3FE 4HH0A 3E2PA 2Y2UA 2O0HA 2GNPA 2ILTA 1NXSA 2GN1A 3L0BA 3LBFA 4XUDA 5EJ4A 2GXAA 2E3JA 4CKWB 3VX4A 5LC1A 3BOSA 4DV3B 1SXJE 4WERA 4AW9A 5INTA 5GP1A 1UPTA 2V3WA 5KNCH 2RGXA 2YQ5A 3KU1A 4EKEA 4RABA 2HSEA 3K0AB 4DRYA 2JFVA 1GCOA 1NUHA 4KH0A 4Q3OA 4IEFB 1OTXA 5BRAA 2BGIA 2VHCA 1K9SA 3SC2A 4ZVMA 4QFMA 5DFAA 2VH1A 1IWBB 2WRZA 2DTEA 4OXXA 3NV7A 5DNAA 2DE0X 1LTHR 1SKUA 3PDCA 4GW3A 3KNZA 4YK7A 4QYIA 2ZWAA 5CUQA 4ZALA 2Q0QA 4BKUA 2YRWA 1YGPA 4FOPA 3ZU5A 4DCMA 3JZAA 1I13A 3D64A 4WK6A 2FWNA 3W2GA 3R7AA 3QLEA 1NULA 4PLWA 4KL8S 5THXA 1SIWA 2YVUA 1A4XA 2DYKA 2J6BA 5DGDA 4QODA 1Y3IA 5T4FA 3G5MA 2O8BB 2G70A 1T1SA 1RXCA 1Y5IA 1G16A 4Q4LA 2FZCA 1T36A 3G02A 3N2IA 5C7OO 1Q92A 1Y8CA 4CCYB 3K31A 5I4BA 1CIPA 4Q7KA 4QEDA 5T8KA 4E11A 4XB2A 2BFOA 2FPWA 2HZBA 2FQWA 2IEGA 2FFJA 3QFSA 4JT2A 4QYXA 5EMHA 5KKNB 2AJBA 3VC7A 2IS4A 2HRRA 1UWCA 3QUBA 1S5PA 2PH7A 2XMQA 1YE3A 3GAZA 1OAOC 1TOAA 5E1OA 2AK2A 2WJHA 1XDZA 5JCXA 2DY1A 1NVDA 2JFFA 4BLOA 1CVIA 4M55A 3U7IA 2WIBA 3EXIA 3QEJA 1XT6A 1C9EA 4D0RA 4JWTA 1MQ8B 2HMTA 4XTRA 1GGMA 1LI7A 3E9EA 4HQKA 1CRPA 3ZUPA 2CZQA 2NZ8A 4I4TB 5FTLA 4LOIA 2MWMA 3N0XA 4BEJA 1QGYA 3NJ8A 4PTLA 3QRWA 4JJ7A 3GH1A 2K6GA 1OLUA 4OHPA 1XELA 3FVVA 4F4JA 2OAQ1 3GLQA 2XSZA 3MWEB 4C4SA 5KCZA 5DM0A 4CF3A 3DXFA 1F7VA 5FR2A 3UMYA 1SCDA 3NIWA 2G08A 2ZRJA 4HQ0A 3T5GA 3J80A 3DDNA 3SM9A 1NN1A 2COEA 2BE9A 5K0GA 4B6QA 2P3QA 1A2OA 3NP9A 1XR3A 1BMTA 1VBNA 1LVGA 1YKFA 1K63A 3OJWA 3OH8A 1NIJA 3G89A 2CDRA 5CDTA 5IEJA 4OEHA 3U17A 3PJEA 4MHTA 5C7YA 1JL3A 4WTOA 2VLBA 3REOA 4QWWA 5DDIP 3EW7A 1RWVA 2HNAA 1XJCA 3N0VA 1U8UA 4MYSA 1MEJA 2ZU0C 2A4MA 2H57A 4ITRC 2RJ3A 3CS3A 5U4QA 1FTNA 5NLLA 5KSYA 2HKIA 1Q83A 2QB5A 2VQDA 4LK2A 4P83A 5CB8A 1LPPA 3Q87B 5GVSA 4FS8A 3N7AA 1XA4A 3HXMA 4GG1A 4DMCA 1W9HA 4HADA 1S8NA 3PNQA 5LP6C 2EYUA 1ZJJA 3ENWA 2WTBA 5DMXA 2BZSA 5EIBC 3OLCX 3O38A 1NG9A 5LP6F 2YXDA 2C61A 4F9GA 1F9EA 1QG0A 4ZK6A 4Q66C 4YRLA 1U9ZA 3ABRB 4L8GA 1CF9A 1J0CA 1BXZA 2JBHA 1ODCA 3EIXA 4WZBA 3LQKA 5AK5A 3HACA 3OO0A 1PV4A 1NVWQ 5JSQA 2XKKA 2ZYGA 5E3HA 3O4RA 4JYPA 4UDXX 1E3JA 2JGAA 1B3RA 2VZ8A 4ER5A 1QOPB 5EKUA 1E9VA 1KZ9A 2G1KA 3EYWA 5GOZA 3WE7A 2BLLA 4FJ1A 3EOAI 4YAIA 5AOCA 3S7ZA 5B7NA 3K1TA 4KWHA 4OH1A 3GVIA 5ENZA 3V9AA 4R7GA 5A4KA 1Q2UA 3MTBA 2Y1XA 3N74A 3OWHA 1ETUA 1SM4A 3TZHA 3VU0A 4DLZA 1S01A 2XTNA 5ITZA 3BIXA 5JHGB 4X20A 1G2PA 1O0CA 1WW2A 5H5JA 1N77A 1QTRA 1RWPA 2GWRA 2XUIA 1YBFA 4EA8A 2AW3A 4YWJA 5JOQA 5LOVB 2WVHA 4LYJA 2AEJA 1R37A 3I2IA 3LG2A 4R3WA 3SF8A 2A9VA 3D2BA 1Y4SA 2H4JA 3AESB 3GGSA 3WGUA 3UT0A 4DUZB 2YQ4A 4RKRA 3WBJA 4N49A 4AJPA 1A9PA 4QGHA 2PKWA 4XLLA 4C2AA 3OFVA 1DTEA 2IXTA 3ZHOA 1IZYA 4G37A 2E4YA 2VKQA 2OHHA 2WZDA 3IIEA 5AVQA 1MV5A 2UZ1A 3U26A 1IY1A 1GAJA 2G5GX 4Y3UA 3K35A 3ETGA 3PRYA 2NU8A 2I3ZA 4LJYA 3TCNA 3IHTA 1DC7A 5J59A 1H9AA 2NNLD 1K4MA 4XX0A 2Q4EA 3PDJA 4L8FA 2YJ3A 3FPJA 4W8OA 2O3RA 4GXTA 1XRNA 1ZJ5A 4YAFA 2BELA 2C8VA 3D6JA 1F4VA 4I1VA 3JASB 1W36C 3QVKA 3UK7A 2Q0HA 3K0KA 4DYHA 1Q0UA 4OBWA 2QMYA 1Z2OX 3ROTA 3ZNOA 5F98A 3S2SA 2X3UA 1U2PA 1U0JA 3AJ9A 4LJLA 4BO0A 1CZUA 3DNMA 2RH8A 3LC0A 1RAFA 3ROMA 2O1WA 1NXWA 2RB4A 1HYHA 4MP8A 3TW8A 3IBFA 3HO8A 4BJ3A 4YJFA 4QVKA 4H0FA 1SURA 5AQ1A 4BZQA 4QGGA 1X1CA 2VF8A 2EDCA 3PGMA 3R3UA 1IQUA 4U3JB 4UDYX 2F67A 4IQ8A 5SY4A 2ZRAA 3EZNA 3B5JA 4FS3A 2BM0A 3BHMA 5FNVA 2YFYA 3NPAA 1ACMA 1XAJA 2BDTA 3GH3A 5EIXA 3LCCA 1AZLA 4DSAA 1NI3A 1P7WA 5E4TA 4XVUA 2GM4A 2HL6A 3QJYA 3S6JA 4QDKA 3FHCB 1YZ3A 3FA2A 3ZZNA 1RBMA 1XEXB 3CJRA 4DB4A 1GQFA 1M2FA 1U5AA 2XOKA 4DSOA 5F5XA 3FB1A 4MDFA 1XCGB 1B6SA 1P5HA 1U2GC 2DGDA 3JV7A 2VZEA 4MJXA 2IYAA 4L8LA 1I7NA 1ND6A 4BVGA 4MS3B 4URVR 2Q46A 4JS0A 2CC2A 3VBCA 3OPVA 1MUUA 2ZUVA 3NTLA 4LDNA 1ZPDA 1ZBDA 4TLBA 3NHMA 3WDKA 3ZV7A 3PEVA 1XEAA 4PQRA 1AKQA 1T5IA 2YUTA 3C98A 3WKDA 1Z17A 2I2BA 2ZAOA 1GARA 3E7FA 1B1AA 5A5FA 5JSKA 1WQ1R 1ANKA 1L7PA 2QZPA 4C4XA 4KQFA 4OJNA 1I7SB 1SKMA 3HP4A 1LWOA 2LRHA 3BM5A 4YRFA 1X8KA 1AQYA 4ZQHA 2GNOA 4MIEA 1CY2A 4AMBA 5CMLA 1CZOA 1ZICA 5REQA 2IHBA 4P22A 2X4IA 2GJ8A 2Q49A 3UYKA 1WBDA 3QFHA 3F6YA 3O8OA 4IDNA 4JJEA 4RHCA 3AUYA 3QKTA 3C3PA 2YDXA 1T25A 1DIOB 2PYZA 5AI0A 3KHSA 2FJUA 3FOAA 3KDPA 5JYCA 2FZLA 5DLQC 2A5LA 2XQGA 3CLRC 3COJA 3IHKA 3GGJA 2B2XA 2CNBA 4S3MA 4HDSA 5I9LA 1FJGB 4RLFA 1Y37A 4NE2A 2FMFA 1K8ZB 4ZOBA 3JVDA 2ONYA 2XYVA 3MJVA 3KXIA 3HXTA 3ZHQA 4ZMBA 5IVHA 5EMLA 3LQ2A 1EFPA 3UCXA 4B47A 3PX7A 5EE1A 1Y3HA 2SCUA 3DC2A 3BRSA 3GRAA 5HK8A 4B3MB 2ZZNA 3S5UA 1JFFA 3BH0A 3EZ2A 3ROFA 4HVCA 5I8PA 4WFKA 3TOZA 3I28A 4BTVA 4PO8A 4R81A 1QPZA 1C1XA 2RGCA 2I2AA 2DEUA 4HAWA 1OBFO 1FXWF 1TNDA 1ZYUA 3AWDA 4P3PA 3GFGA 2JH9A 4X20B 3RAGA 1TECE 3H2KA 4C89A 2WWYA 1FTYA 4KXWA 1GOTA 4JSYA 1UOEA 1UJ5A 1O95C 4Q12A 1UKEA 3OZFA 1FLDA 3DLBA 1C3LA 3LHKA 3G0BA 5TEVA 1DP4A 2B2NA 5TC4A 4HQFA 4GMGA 3ZU3A 1THTA 5JXWA 1QRDA 2W42A 4BRZA 3LX8A 3F6CA 3LCUA 1VHLA 2VP9A 2CLKB 5AKXA 2PX4A 4PYRA 4JQYA 1N2GA 4M1MA 4OSOA 1YBMA 2X1LA 4RKEA 5CH3A 5G2OA 2PKXA 3TBHA 4CR8A 2X7HA 3B1KA 5AVSA 2NU9A 2YV2A 3AINA 3H9BA 3LUJA 4RTQA 1KXJA 2BGGA 4U6QA 1ISSA 4N7MA 3VJRA 3KKKA 5GPBA 5KTYA 1F12A 1GP2A 2AZ4A 1XCPA 2DFTA 3A70A 5ILGA 3D0KA 5DM70 1VCIA 5A5DA 2P4UA 3U6BA 4JR2A 1G63A 1ZGGA 1JG6A 1Y3DE 2BJVA 2H1HA 1RQGA 1V5IA 2GEVA 2WU0A 3AL3A 3EMKA 4I3FA 3QFCA 2HIMA 3DE1X 4ND8A 4WKGA 1LPAB 1Z73A 3AFHA 4G6ZA 4LTNA 1TC1A 4Y6QA 4QECA 4B9EA 1OZ0A 3CXUA 2HLPA 4K0KB 3ZTTA 3DQZA 3GK3A 2JHFA 2JJ8A 5KO2A 2UAGA 2NX2A 3L40A 3O8QA 4O4HB 4XQ0A 4G5FA 4RTJA 4JDPA 3C4VA 4XDHA 1KVSA 2C20A 1OQAA 2DPGA 2JARA 2XB6A 3G7SA 3R0VA 3VVBA 4DIMA 5B55A 3GX1A 2PL9A 2D5AA 5TDHA 3THRA 3AX6A 3V8PA 3DFZA 3PUKA 1XCOA 1I1OA 4ZRNA 3QEKA 1UKYA 1S89A 1A96A 4JI7B 5P8WA 4NX2A 5TE9A 4UTRA 4I19A 3VVMA 3DFIA 4ALKA 5C5IA 4UU8A 5CNKA 3HKDB 3JXEA 1QHYA 2JIZD 4NBTA 1QVVA 1T8SA 4HBZA 3FYDA 3H04A 2BF4A 2F6RA 2GCNA 4RIGA 1FQKA 3SAJA 1GWNA 1EFKA 4DUPA 1NF3A 2QAIA 2RGYA 1Z8DA 4X93A 4FONA 2EJTA 3LQ1A 3VSCA 1A9QA 1YDHA 1USWA 3OVMA 5AFSA 1LPOA 3I04M 4HMPA 3VR4H 3ITKA 1UPUA 4MGKR 3CLUD 3RROA 1P33A 2FEAA 3HDTA 4MZXA 4PS1A 3IE1A 5IYZF 4HPXB 2Z1DA 5GV8A 4EZIA 3OCUA 2W6MA 3DEIA 3HP7A 2B8TA 3KTAB 2QUAA 2XUQA 4Y0AA 1FP4A 2QZ4A 1U5CA 2YR0A 2OC9A 1OH5A 1PIWA 2JA2A 3E03A 2Z58A 5CXUA 4AKTA 1X7XB 2BGTA 4I1PA 4FFMA 4PQEA 3TAHA 4ZZ1A 4OQQA 2A8YA 2AGVA 2JAUA 1PYOA 2PT5A 4MPPA 4EAQA 3IP7A 5BUSA 2G4LA 3R24A 4HF7A 3IDSA 2IDJA 4GX2A 4QX6A 4XYGA 4FCVA 3QW4B 4DJEC 4IIHA 1DQRA 5G3YA 5JZBA 3IEMA 1WHTB 2FA9A 2DVMA 4FZRA 2FUG1 4KEAA 3ZX4A 2EFYA 2E4VA 4DTIA 3DUFA 3BGWA 4K9OA 4YUYA 2IH5A 3BHJA 3K09A 3LXRA 3GT0A 5EFOA 1JDZA 1G98A 3DG9A 3KKQA 4WZAE 4XIIA 2GBLC 4DRXB 1RZ3A 3JYQA 4NEHB 1ZM7A 5JSYA 3WQQA 5K8UA 5LKAA 1N2BA 4FHDA 5K20A 5IVPA 5HWSA 1K5GA 1IVNA 3D8BA 4ZYZA 1G41A 4R1QA 3HR8A 4OA8A 3M1AA 4ZCIA 2O5RA 3DDHA 2UUBB 2YFHA 1QHHB 2ZJ6A 3QPDA 1V4VA 2C8LA 3PZBA 1FC0A 2PYIA 3K96A 2ID9A 5GGXA 5KSOA 1QR2A 1SUDA 4XX1A 3U7RA 5TPZD 5BSEA 2EW2A 2QRJA 5JFTA 2W2VA 3TR6A 3NW9A 4P4SB 1REQB 3HB4X 3W2FA 2H5IA 4L02A 2VJPA 4CM5A 5BSWA 2WT8A 5F5LA 3O75A 3RRFA 4R2IA 4F56A 1N3YA 4DR4B 2F3PA 2P4SA 4Z7NB 1D8TA 2FUG6 3C3DA 1DCFA 2GK7A 3DCYA 3F90A 4PQFA 1X9HA 2R65A 4U2FA 5F7OA 5KNDD 2IEAA 1NXPA 2AMVA 3KXPA 3O4GA 4REMA 3IV6A 4RAOA 5E2AA 1N2OA 3SKVA 1WJGA 4NXMB 4RWEA 1Z45A 1A8UA 3MQ4A 5ECWA 3GAAA 2FZWA 1S2GA 4FGZA 3RTBA 2I4IA 4LDJA 3V4LA 1KZGB 2AT1A 3PENA 4BL5A 2BMAA 3KZMA 4G01B 2ZZKA 1N33B 1W19A 1ZUD1 1U2EA 2FG5A 2JK0A 3D5QA 2ZIVB 3H4IA 1U8EA 4G9EA 2E1RA 2QRNA 2XRFA 2ZI4A 4HQOA 1NONA 4N47A 3WZLA 2G5TA 3CA8A 2ZJYA 3KC2A 2QVXX 3F6RA 4RFSB 1NX9A 2VF2A 1BKDR 3O84A 4RU1A 1TEHA 2JFWA 2QD4A 3JQBC 3SYLA 5EVJA 1RYMA 1OWOA 3C5WP 2CWWA 2VTVA 4KRFA 4IIEA 1UIRA 2EJCA 4LEIA 1EQAA 1DKPA 3GT7A 4PAGA 5EERA 5H9VA 3AETB 3LPDA 2BHNA 3O94A 4OKNA 4GZMA 1LFAA 5FNZA 3ZTWA 1QK5A 4K9KA 5FOWA 2W2LA 3H1GA 2I29A 1PRYA 4OHCA 4ZEXA 4C0XA 2V4MA 4F84A 221PA 4UMVA 5FWAA 3RC9A 2EKDA 3DL2A 4GQAA 4B4UA 4AO7A 2FWAA 4NU0A 4UCXA 2GPNA 3E8XA 2HI0A 4L9AA 4JLBA 2EJWA 1EP2B 4PCLA 2HF9A 4FZ3A 1M2EA 3D4IA 5JDCC 4ENUA 5IWAB 1O5TA 2J9XB 2ZSJA 1TAUA 1X1RA 1YS9A 4V0OA 1QQ6A 1O95D 2HF7A 3ORQA 4UD2A 2JGLA 1GRCA 1TVEA 3GFPA 3LC1O 3PPWA 4ZAWA 1RIFA 4BO1A 2GN0A 2RGRA 2B6HA 3SKYA 2G71A 3VTKA 1UMCA 4HYYA 2I66A 4N6OA 1AV7A 4RELA 4Y2XA 1M8JA 2X0FA 3KAPA 4JC4A 3SQNA 1XZBA 2PRYA 4AXXA 1OU4A 1G8YA 1KETA 2AJLI 2V5VA 2EKBA 1L7QA 2ODPA 3NTRA 3PU6A 1GZUA 4PICA 5I7UA 4ALMA 3WAJA 3OM1A 2P68A 3TEJA 1DJPA 1SVKA 3IAS6 2QYOA 3G0GA 3W6UA 3G8AA 4J7AA 3RYFB 4E03A 1VTKA 1OIXA 2B3TA 3CEJA 2K7FA 5C32A 4IYJA 3SDZA 1R0BA 2WUWE 4XQ9A 3V1YA 4BATA 3AVXA 5BN5B 4M38A 2HQSA 3CN7A 3KUDA 3E2IA 2E85A 4J29A 3IKTA 2M6RA 4GYKA 5AM4A 5A9SB 4JJAA 4R1OA 1L8QA 1D07A 4WXPA 1JEEA 2PYDA 3G1TA 1SNYA 3GUYA 3SIPA 3TFOA 4B3TB 4EK9A 4JBNA 3HEMA 1PSWA 5AVUA 3FM9A 3MUNA 3KHTA 2IF2A 1WSDA 3D3NA 1OYYA 4CF5A 5GADl 1KORA 1T4CB 4IRUB 2QTRA 3D3EA 3IQWA 3ZWPA 4B79A 4BNVA 5A1TA 5AWFC 2Q9CA 3UMRA 5LDHA 3O82A 4DZZA 1GUYA 4W7IA 3UMMA 5KYKA 4RENA 4ZGWA 4UM5A 2JLQA 3SR4A 3T0FA 2PH5A 3K1JA 4BY9E 1GQSA 2UZIR 3LY8A 3E5NA 3HJRA 3GLFE 3D6NB 3O9MA 4XD2A 4F93B 2A67A 4YTEA 4KQIA 1JQAA 2C4MA 2H1VA 4IHKA 1T0HB 3WAKA 4PWZA 1JMVA 3RHZA 4QYWA 1NR1A 2C92A 2QRVA 3B2QA 3FWHA 1GJRA 1RYZA 3VH1A 3AHFA 3EUAA 2VHUA 3CEAA 3H1EA 3RASA 3U31A 5AESA 4G81A 2Y68A 3RLFA 2HQRA 2I1VB 1PL6A 4S0XA 1CP3A 3G49A 1DMSA 3L02A 2YRXA 3DCJA 3Q9NA 2I4MA 4G65A 4YRNA 4EA7A 2GYVA 2GPYA 3C4JA 4I8DA 1IEWA 3L6DA 3BF8A 4RVHA 4IWNA 4W4TA 4E51A 1YC2A 5HFJA 3OTOB 3SHWA 1EK0A 1GKIA 1MIOB 1U7WA 1BVUA 4M37A 4YRTA 5D3QA 5FPPA 3UT6A 5GOTA 5JT1A 1W2WB 3C24A 4GQIA 4GX1A 4NK5A 1YJBA 3WL7A 4CEHA 4KAJA 3DM9B 4OK5A 1BX3A 3MLAA 2XDWA 5TMDA 1WA5A 5C8YB 2E4ZA 2II6A 4ALLA 2W00A 3V8MA 4F5WA 5BMVA 4Q7LA 3RVMA 3OF5A 3OT1A 4YWHA 2GA8A 2Z0MA 3B7PA 3R0ZA 1AKEA 2IHUA 2HRBA 2EP7A 2XUFA 5EYPB 1JB1A 5HEKA 3RHFA 4X1KB 5HYVA 3NIBA 4AWBA 4EG6A 2YZGA 1DTWB 1KR2A 1KFBB 3DMTC 1KI1A 1TKBA 2Z4SA 3D3KA 3KSDO 3CHYA 1JKJA 1IN5A 1Z4LA 3O31A 4WWHA 1IONA 1KEWA 1LW7A 4P0PB 1IN4A 4PYIA 3NZEA 2JG3A 1Y82A 6CHYA 1JJFA 2EJUA 3PLRA 4WAUA 2J7KA 3LUBA 4WKBA 4E1VA 2VPWA 4DXDA 5J4LA 3FSJX 4ED9A 4YI3A 2DQSA 4QQFA 1VE1A 3BT7A 3IPAA 4DQDA 1A9RA 1DC4A 4J0EA 1UBFA 1KTVA 3DDZX 2DX7A 2VNIA 3A06A 4LRQA 4NPAA 2NO6A 1U1DA 3K9NA 2JLWA 3CX7A 3OJOA 5HX7A 3CR3C 2R85A 3G0OA 1VPLA 3OPNA 4QLOA 4J1QA 1NVAA 2G25A 2IUFA 1BIFA 3WGKA 4D8XA 2GUWA 3OLYA 3BWDD 2PGNA 3QTBA 4K2HA 4KFSA 1SR8A 1SXGA 1JQEA 4PFJA 2P5YA 2Q8NA 1YSCA 2XNDD 3UO8B 1AH2A 1K1EA 2OO7A 2XGOA 1S2IA 3BEOA 3D3JA 1NLUA 2ES4A 3F8SA 3NAZA 3OU2A 2OFPA 4NCKA 5HF8A 4DC9A 3I2HA 2F1IA 4LOKA 5LDGA 1Q57A 1JE0A 1S1CA 3JTEA 3RVLA 1GPJA 4D74A 4ZREA 1Q15A 5ETJA 3CUSA 5BMOA 1BGXT 3D54D 2IEYA 4CLDA 1H4SA 1NMSA 1N5LA 1U3CA 2CVZA 3WMXA 4BO7A 1QR6A 2H00A 1DAIA 4KIUA 2W98A 2FMKA 4JC8A 3RIEA 1YMVA 4C0BA 7ABPA 4HTFA 3E0XA 4N3GA 1MC4A 5T3UA 4A82A 4EWLA 1OGYA 1Y81A 1UBSB 2Q2OA 1Q11A 2OQRA 3RSOA 1RJGA 2QQ0A 2V7EA 5KTMA 5BUZA 2LDXA 4PYKA 1VLVA 2KHZA 3ENKA 5BO5A 2XUOA 5L3VA 4OYRA 3NDPA 2PRIA 4BWYA 5AW8A 2V65A 1DRKA 3VDMA 2MYNA 5SYMA 4ZEMA 4GUAA 3TLBA 4UTVA 4CKBB 4QPPA 5TMPA 1G64A 2QPAA 4MV9A 3TZCA 4EABA 1KOJA 5K0NA 4BMNA 2YOHA 4MUMA 1B6RA 1LX6A 3HCDA 3DA8A 2I76A 2O3JA 2D00A 3F1KA 4IBOA 4PAWA 2I6FA 1TQHA 3OICA 1LDBA 2B8NA 5DYIA 4MWCA 1SG6A 1WXQA 4BMYA 4R2XA 4N4AA 5D5PA 2N1MA 4BWVA 1Y1KE 4CLRB 3OCXA 1YZQA 4LOLA 4MQ5A 2VQ3A 1RT9A 4OXIA 2FOXA 2LXNA 3KE9A 1T6NA 4PZ9A 1FBNA 2YYYA 3MF4A 1O6BA 4MUHA 4R68A 5ICMA 1E1QD 4HQLA 1ZFNA 2ZVJA 1Q17A 4H4CA 4DLUA 1V5WA 2XRZA 1O95A 3D6FA 4V0SA 1JTEA 1WXDA 4B2LA 3SXUA 4CKWA 4F86A 2YMQA 1VSBA 3C5EA 3CUYA 3HUFA 1TF2A 3QYPA 5JNUA 1ADGA 2R8XA 3GP8A 1VG8A 4PN7A 1F6BA 3DVAA 2FWBA 2D7CA 2VWGA 3CUKA 3V2HA 2ZRGA 1H8HA 4C87A 4RK0A 1IH8A 2P9QA 3O8QB 3CX8A 5C37A 1J24A 3BBPA 1YI8A 2P0YA 4DF3A 5KJ6A 3M6XA 1H9CA 2R4UA 4BV2A 4YAKA 5L6MB 3D31A 4HFNA 1NG1A 5D00A 5K8TA 1AM4D 5LD2B 2UUOA 4FYXA 1GCUA 4R3UC 4CFYA 1RKVA 1PVVA 5CA1B 1KBQA 2B4RO 3GF4A 5AJHA 2NXCA 4XVQA 5EFZA 3SVZA 5C9ZA 3L49A 2ZBPA 5CM2Z 4BCDA 3HK2A 4IF4A 2F62A 4PFKA 5EZ5A 4Y2UA 4BBJA 2HDWA 3I23A 1FUUA 2G06A 3QUTA 1J99A 4TVOA 3PDIA 4JB8A 4Q4AA 4KG7A 4MQFB 1W36D 2SKDA 3P0EA 1LJLA 4JT8A 3GVXA 1D4ZA 4GAEA 5HKOA 3RS3A 3E18A 1BN7A 2HEIA 1O5OA 1AQIA 3ICOA 1NVKA 3C4QA 4N76A 4INOA 1YJCA 3IQGX 3C5VA 1M5RA 1FFXA 4BEVA 4RTRA 3IBSA 3TPCA 4LSWA 3WB1A 5A4MS 1WWKA 3KRTA 1BCSA 1JAIA 4ZICA 1GFZA 1CR2A 1UMKA 3ABZA 1CRWG 3MZ0A 4LZWA 4ZTZB 2IW1A 2Z5VA 1HNXB 2OO3A 3SSAA 2P62A 3CSDA 4OM8A 4BJHB 1WP4A 4P58A 1HORA 2UZ3A 3IDZA 4XGQA 4ZPXA 3K5HA 1Z34A 4DWOA 4KN5A 2GCGA 5I9NA 1VJ1A 4IG9A 3VR5A 1SAYA 3MHPA 5I7HA 1Y1TA 2J4DA 4U9IS 5GAJA 4AUMA 1V8OA 4GRIA 5LB4A 4AP6A 3G9UA 5LQSA 2AFHA 4HDMB 1I0LA 2IRWA 2ZPAA 2CZCA 1C41A 3M9XA 1MNAA 2ECOA 2Q3EA 3E82A 1FMTA 5T6BA 8LDHA 1IK6A 1RVV1 4RC9A 3I76A 2JFXA 4PE5B 3KQTA 3Q7PA 1XVUA 2PKCA 1ODSA 2P2YA 2YVKA 4A6DA 4P7KA 5JR3A 1GSAA 2OZLA 5H83A 4HUTA 1MG5A 1XZAA 1BWRA 3ND7A 4AZ0B 3ZD6A 3PHCA 3Q5GA 1HDZA 1D2GA 4JL5A 4R8RA 2FGKA 1YCDA 2C9MA 3QKUA 2K2WA 5K8VA 3E9NA 5KCMA 2CUTA 4DDHA 4M1EA 5JSZB 4RPLA 1MJFA 3W3AD 1YHNA 3GEHA 2BMJA 4NMWA 1JFVA 1SOAA 3FOZA 3CLTD 2ZI3A 2IKSA 1LDNA 5IZCC 4U7FA 4Q3AA 4DLLA 2NIPA 4H31A 3RLIA 1ECCA 1PUJA 1MVNA 1NXOA 3HRIA 5JRDS 3IBCA 1PWEA 3TM5A 1T91A 2OP0A 1EINA 3INNA 3DZGA 4F7DA 2QQEA 1AY0A 1RDFA 3I4FA 3IEPA 3PRJA 3RIHA 4BFZA 2ECFA 4DB2A 2UXCB 5EKSA 1POXA 1AT1A 3JX9A 3L8HA 1IJEA 1DI0A 3CPSA 2Q5FA 2NXWA 1JUDA 5CEFA 1R74A 1NUPA 3T7IA 1G17A 5IKPA 1OV4A 1JILA 1XU9A 4MUXA 1SUBA 1WDWB 4DLSA 4QVIA 3MMSA 4B7CA 4RF2A 3VO2A 1X42A 1FTGA 2ABWA 2IYUA 2P2SA 2VJMB 1ZK2A 2W8ZA 3R75A 5LLTA 2PQ6A 3EGDB 4P86A 4EVRA 4K87A 1T5TA 2GN4A 4IO1A 5CLLA 4G67A 2Z5GA 1DVRA 4Y2YA 1H4QA 5F9FA 1XRRA 3CTPA 4BLRA 3NC4A 1ELOA 2IBMA 2OSVA 3PD7A 4RO0A 3AOEA 2ONKA 3AILA 4EUKA 5TT0A 1PGJA 1P3DA 1S2NA 2H2GA 4EVQA 3WK8A 2XNCA 1ZISA 1S1MA 3GVPA 1XMVA 1MJNA 2FW0A 5LLSA 4A15A 5AW9A 2R6ZA 3EGEA 2XMZA 3DL0A 5EWMA 3Q0EA 4BLTA 3KCQA 5KJFA 1SA0B 1U0GA 3I9FA 2OSBA 1KZ6A 3WTCA 1E7YA 3D6TB 3NPMA 1T0IA 4D0NA 1QYDA 3RJMA 3WY9A 3W5AA 5KWEA 2VOEA 1Y6QA 3GY0A 5KTSA 4NDAA 4LWOA 2ZXFA 1L5OA 2M6SA 1KEEA 1UJCA 1NP3A 3KBOA 2R48A 4I9NA 1V5GA 3IV9A 3L7OA 1XWWA 3ROKA 4CG1A 5ISMA 1R00A 3LVRE 2Q1XA 1U0RA 4B74A 4FFBA 1QOQB 2REQA 1W59A 3IAUA 4NNOA 1EQUA 5JJ5A 2F4VB 2I8CA 3BJIC 4XX0B 4HLCA 4D8UA 1ZK4A 2IBTA 1QH8B 3KT8A 2D5CA 4B3FX 2JIPA 3QMMA 3W8NA 3F8WA 5CB4B 4FGWA 1XL1A 5DBHX 3O3MB 1HDGO 2Q2QA 3O9VA 4JVNA 1F17A 2B1QA 3L46A 3KB2A 1RRMA 2Q6KA 1E62A 2OCKA 5ESXA 1RAIA 4OQYA 3R8XA 1WX1A 2WQ7A 4KI7A 5CEJA 1ECGA 1LSJA 3GMDA 2WIFA 1DAOA 2LWIA 5TR9A 3F5DA 2R751 4WLVA 1J1UA 4PAOA 2I71A 3NTUA 5LVAA 2EEZA 3NVKI 3EWNA 2PO5A 2GT1A 1KY4A 4FGSA 3RUIA 1JV2B 5G1PA 3SE7A 2A0XA 2O5EA 5EXDA 2VK4A 1W85A 1OLSB 4MICA 4Y9SA 1GNLA 4KBGA 3SQMA 1OGIA 1KF0A 4DIUA 3OPYB 2CSXA 3I62A 2HHHB 1H9BA 1HY3A 2B83A 2I2WA 3NHPA 3LHDA 1C3OB 4P4SA 2Q5EA 1XE3A 1XMQB 1AUVA 3PFFA 3R0JA 2HFJA 2YC4C 2XJ4A 4HSGA 4UZSA 1JF8A 1T13A 2E48A 3RBAA 4ENTA 4FI3F 3I6ZA 4BLPA 4CRWB 4D4JA 5HIKA 1BS1A 1RAAA 1XD9A 3OUUA 1AA6A 2C7PA 1VRCA 2ZPTX 4KXQA 2QTLA 1RE1A 1KHHA 2PG3A 2SKEA 3OX3A 3HSYA 1VGQA 2FPPA 2QN1A 2VYQA 2AN5A 4GKVA 5CLGA 5DBGA 1NTRA 4F4HA 3M5DA 5JTUA 1CJVC 2GBPA 1Q0PA 1XX6A 3EF1A 1UJ2A 3HNRA 1QQ7A 1ZHOA 2VO1A 3UWSA 4NFSA 4E12A 3PEWA 3E3NA 1VDZA 3PYXA 5IUNC 1JG4A 5B3JA 3KQHA 3UUEA 3VVCA 3M9WA 2XH8A 3ZWWA 3N6XA 4LXGA 2JRLA 2FP3A 2PHZA 3L7MA 3HH8A 4X95A 1FE8A 4IDCA 4AICA 1BMFD 1SC3A 2BEWA 4BWGA 5ICGA 4KI0A 2D62A 1XHEA 2PGAA 4B8ZA 2EF0A 1GVNB 3KZKA 4IDDA 2H4XA 2Y0PA 4QKQA 1Q19A 1R0RE 1QIDA 2VHYA 5DM60 2FJ0A 3DHEA 4YRMA 1NVXQ 1F2TB 1OJ7A 1YQTA 2ROQA 5KTTA 4LV8B 1FSSA 4P82A 3T8YA 1R16A 2AKEA 1FJ2A 3N2GA 2GQ0A 3G17A 3IKVA 3ZCQA 3BD6A 1BRTA 5C8ZA 2WTMA 3QQPA 4H15A 3IURA 5BYKA 2P7HA 3HYNA 2P67A 5LQUA 1MO3A 3UMFA 2O8CA 1QANA 2VDWA 4K26A 4PTZA 4W99A 1UEJA 2PZJA 5FULA 3W5UA 4HT3B 1LEHA 5C5EA 2ZKLA 5IABA 4FT2A 5DX8A 4N0EA 5DCUA 1IZ9A 2WUFA 2G6BA 4MW7A 4O2RA 1SCUA 1XVVA 3DE5X 3LU1A 1TIPA 5ALKA 2PMEA 3TMYA 2C2HA 4YQFA 5CBPB 3QUAA 1I9CA 3H1BA 2Z2JA 1R0LA 4QOEA 3AI3A 2ZRKA 4IRXA 3FDIA 3AF1A 3HY6A 1EK5A 3RIYA 3OLXA 2OWDA 3LPLA 4BKQA 1DEOA 3UV7A 5L3SB 2ESRA 2PRJA 1JQLB 4PLFA 2P9CA 2AV6A 2WKQA 4Z9BA 1ISJA 2O8BA 1E32A 1RTKA 5ADWA 4M7OA 3RGGA 1YMQA 3CVVA 2JEYA 4W5TA 1YOBA 3RG8A 1CR4A 4OV6B 3BF7A 2YN2A 2P5UA 4X1IB 2OCYC 5KINB 3S70A 1MTOA 4ZHSA 3ER8A 2QIPA 3DE2X 4EKDA 3W5CA 2WJPA 2GXSA 4NEGA 1WG8A 3FVRA 3RRBA 1ZSNA 3Q3JB 3VU8A 1JHRA 2GZMA 1FDTA 1Q7EA 1AUXA 1D6MA 1V8BA 2SBTA 3CB4A 4L28A 2DRIA 1Z4MA 3HKBB 3SX4A 4I14A 2PV7A 3V4OA 5EKTA 4YIHA 1T9HA 4BVEA 1XL0A 1JFLA 5EJ2A 3VPFA 1D3AA 4NCXA 4BVJA 1NZJA 2GLXA 1RWNA 2HRDA 3DW1X 3HCFA 4OP3A 2XT0A 4OHWA 2X15A 4L2IB 4LJAA 2I62A 4AF7A 3UJHA 1X77A 3MYYA 4WBNB 3K0EA 5EINA 4I2VA 5CRIA 4J3NA 3DFKA 2ZAGA 3KPYA 2B1JA 3P4XA 2ZIFA 4AYTA 1U6JA 3AFIA 3BJZA 1QTQA 3NWEA 3EHEA 1J42A 1SZPA 4FLFA 1J25A 5KJEA 4A7PA 1DU4A 2I65A 2YXPX 3IB3A 1HFEL 3I0NA 2WK1A 4M6WA 3MJTA 4EHLA 1E4YA 5LP6B 3TNFA 5H16A 4I55A 3U2QA 5MN4A 1G7CA 1XRMA 4L76A 4JLWA 2AKAB 2I4LA 3F9RA 3QYAA 2O7NA 5KWVA 1HF3A 1M75A 4DM3A 2W2LD 3T34A 2RGUA 5IPFA 5TGTA 1ICEA 1YACA 3R4VA 1ISIA 5DHQA 3CGWA 4C7VA 1P4AA 3MGAA 4GF5A 4WJKB 5C1OA 1EFHA 1IN1A 3UJDA 4RV4A 1ZK0A 2I6XA 3VZCA 2WYOA 3QXCA 1W35A 4GMXA 4ARIA 1W5FA 1G4AE 2VP6A 2OY0A 2YN4A 4W9RA 2PX6A 3L4EA 3RYIB 1CBUA 2BKVA 3FTNA 3WX0A 2X4GA 3AIOA 3HGTA 4BE7B 1VL0A 2B4TO 4JC0A 4UUBA 3SSNA 3TN7A 2KS6A 5HOEA 4XFKA 4Q9DA 1JG2A 1YRYE 1H2WA 2DUWA 3C87A 4UVHA 5F9MA 3T7RA 4KNYA 2D59A 2HF2A 1U4NA 2HMSA 4B2IA 3N0WA 2UZAA 4TYNA 1W36B 1NF2A 2IHTA 3D7SA 5EIEA 5AW6A 4BPBA 3HB1A 1KERA 4O2AB 5ITVA 2FNAA 3ILHA 4DCGA 3R77A 2HDNB 3EIWA 4OI2A 1Z36A 2QENA 2WA2A 4KO4S 4BC0A 3I45A 3KKMA 3Q1LA 2OUIA 4FHGA 4AQDA 1A76A 1C9NA 2FCAA 4N03A 4P3KA 3OP4A 4RVSA 4B4WA 4MGZR 4RMHA 2B3DA 3HBJA 1PGNA 3AZOA 3KVRA 4E15A 2VPYA 4NI5A 3W3AH 4A2QA 4PHCA 2M32A 4GLJA 2NZUG 4MI1A 5H8WA 1KI9A 1TU4A 1U7UA 1ZKDA 3AEUB 3PNBA 4U5QA 5C34B 5IVIA 4TXHA 1VJRA 4DDVA 3GOQA 5CX1B 3RVNA 2BGLA 1LF0A 2QLFA 1PGQA 1DFGA 2VAXA 3L7DA 4G2TA 1X7YB 2FMUA 3AR7A 5DBIA 2JZCA 4YPFA 3RYHB 2H1FA 4GOXA 1LB1B 2NPIA 5TPZA 4HJRA 1USVA 4D9NA 5C8VA 3TPFA 4LF6B 3FUWA 1TVKB 1VL1A 3ICPA 1U28C 2XZOA 2V6IA 2ZRLA 5K7SA 4ML3A 2NUBA 1N6KA 1A8QA 1SU8A 1U1EA 2W6QA 4E4YA 3H4VA 4EAAA 3ISTA 2OV8A 4GR4A 5DTJA 4GC5A 5BN3B 5JDCA 1XD2B 3ELUA 3T3HA 3L2OB 3GLHB 4G85A 4DMUB 3ZWNA 2GEJA 2NG1A 1WMAA 3HZOA 5C3UA 3WJ7A 2CJXA 3A9SA 4URFA 4BNMA 1Q91A 4L5JA 3A27A 4KBYA 2BPOA 4BKPA 1QKKA 1FDIA 2C5LA 3OZEA 4EGFA 3IUNA 3Q5DA 4Q1DA 3OZGA 1FFYA 1TPZA 2JJQA 3R3XA 3VOAA 4QREA 4UNRA 5A2GA 5JAQA 3EA5A 4J16C 2CVHA 4YDQA 1RYNA 2BBOA 3GNTA 1Q3KA 3OEED 4YJGB 3PNVA 1EGMB 1GD1O 2IU6A 1UKVY 4ESHA 2J30A 4M36A 4X5OA 3QE4A 2HWKA 4PFSA 3VI3B 3L4BC 1Y0BA 2WAOA 4J6EA 1CUFA 2RH4A 2XXAB 2XQIA 3RB8A 4QUAA 4CQLA 3N2KA 2G1UA 1AKWA 1VPDA 1HKUA 2V7QA 4RKQA 4YV7A 3O3NB 4KOAA 4W7HA 1Y42X 1ULHA 3CF4A 6REQA 3CE9A 2R97A 5EWLB 1RQXA 2C4TA 1PP4A 1S4MA 3GRUA 3L92A 5CEEA 4DY6A 5A7FA 1TO6A 1Q6YA 2DLDA 5TQ0A 3FWYA 3FWKA 4BO3A 2ARKA 2VHVA 5JAOA 4PRKA 4EMBA 3FI9A 2C3PA 4FZ5A 3FAKA 1FXUA 4O5OA 2W6PA 4JQSA 3WOVA 1SHZA 2WD8A 1R15A 1XQ1A 2FFRA 1U7PA 4MHOA 4PCUA 5F2NA 2Q0SA 2J0SA 1XZ8A 1SQFA 4QPZA 5FUYA 4OAOA 2D2EA 4TT8A 1XLUA 1E0JA 4A8HA 4OXRA 1MENA 3ER6A 3AERB 3IAFA 3UWMA 4DBVO 3C0KA 5JAIA 4KMOA 4IMPA 1H6BA 3VNAA 4LF4B 1GXSA 1J0XO 5E0OA 4EPTA 3ZGZA 4AF8A 1OI4A 1A69A 3OJEA 2W6CX 3QOWA 4HDAA 4I1IA 1E1KA 3UJ3X 5CA1A 2WY2D 1XTJA 5CBKA 1YQXA 2GYYA 3S2YA 3OUTA 5KB3A 3B1FA 2IYWA 2OFOA 3G6KA 1FNCA 4EKGA 4CEIB 3KEMA 1I6MA 3NT5A 4DANA 3FNBA 2C9BA 1YK1A 1YZHA 1RP7A 3KXKA 3MJRA 4DHEA 1E79A 3A6ZA 4FGLA 2WE7A 1IN7A 2CN1A 3GV0A 3MCVA 2P3LA 1AK2A 3C8ZA 3LX5A 1XN1A 4NS4A 4Y1RA 3J7AC 1JR3D 4X6XA 1L4EA 2JNWA 3P0FA 3R5HA 4UM9D 3WYCA 2JCSA 4TL8A 4I2NA 3QITA 2HSDA 2XWQA 1R4MB 5K3AA 1K2VN 3D1LA 1PR4A 4LXXA 1DLJA 1QVWA 2CB9A 2QYHA 1LBSA 3I6YA 4KB5A 1MT0A 5IJAA 5KKAA 4RUKA 3SEZA 1MHPA 4TV9A 4L7QA 4Q47A 2Q3JA 3EGOA 3WJ1A 2HCRA 3MERA 3E8SA 3Q8MA 3THYA 1U9YA 4NU6A 1ZH4A 3QKSA 1PR0A 2GBIA 2WTAA 3O73A 4N82A 3WK4A 1OBCA 5KEIA 2JA1A 4OKIA 4XR9A 4Y9RA 1BC5A 3AH8A 4DLNA 3HA2A 2QJFA 4GX5A 3WJ2A 3I6QA 1E0DA 3OZAA 4XSGA 4D8TA 1UC4B 2B4QA 2M6KA 1BXGB 3S29A 4D3SA 1Q14A 1ZJYA 1TX4B 3QTLA 3TKLA 1JAXA 3VH3A 5BSHA 2GCPA 2W6OA 3QHQA 4DV4B 1U0BB 3UICA 4M9SA 4G41A 1H1DA 1O94C 3PFNA 3KOYA 1VXRA 3BULA 1GPMA 4ZV9A 3FLBA 3NRCA 2OZPA 2PK3A 4RFLA 1Q1ZA 1ZUIA 5DLPA 2IH2A 4OHYA 3CEPB 3EZ7A 2PH1A 3N05A 1PWZA 4S1NA 3BFKA 5G0TA 3BS4A 3H5AA 1U2GA 1XZCA 3H7IA 5DN9A 3DE3X 1YMUA 2GZHA 4EPYA 3IP8A 5JYDA 3LLSA 2NVOA 4Y0NA 2QRQA 2OYCA 4WCFC 4B6RA 3PICA 4IDOA 3GRYA 4DJ5X 3AFOA 3HP1A 3MEQA 2QI9C 3DPIA 4AJ4A 1KYTA 5JZSA 3W4KA 1LCIA 4NYIR 3PPYA 5L3QB 1G5TA 1KEZA 3DMNA 2VATA 4UUMA 4DJDC 2O8NA 1A9TA 2OQ2A 4DQVA 1L7BA 3PNKA 5F76A 2OZKA 4JI2B 5KZMB 3BXOA 4KLNA 1H8HD 3AEUA 4K1XA 1UJ4A 4PVDA 3ZGNA 2FX3A 3DVQX 2FOIA 3UQYS 4GS5A 3MJ4A 1ZH8A 1PJBA 4YMWA 3LY5A 4UUQA 3RVDA 5K3EA 2AFIB 5CPFA 2G4VA 4G1BA 2CLOB 1ZL2A 3A7DA 1S3IA 4J4HA 3A1SA 5TARA 4OMUA 1E3SA 1JW9B 2VJMA 3VC2A 2Y4OA 1V7CA 2J31A 3VNRA 3THYB 2BFWA 3NGMA 3OQVA 4I4NA 1Z25A 2VPIA 1ZW1A 3MA0A 4FKZA 1JBQA 4GYJA 5AJYA 3V4FA 5JNWA 1VMIA 5J58A 3HABA 2PNJA 2GAFA 1QH1B 2Z04A 4PC2A 1S7CA 3K5IA 1GZDA 3EG9A 1WUHS 3U4DA 5D3ZA 1DIAA 5NULA 2XQKA 3JD2A 3L7KA 1SBYA 1V6SA 1BHSA 4Z7QB 1TMKA 2YZ2A 3OU6A 3ZCSA 5MFZA 4MAMA 2R6JA 1TUBA 5ECYA 2REXB 4N54A 5C53B 1R50A 1MFPA 1OI3A 1YZUA 1DXHA 1QONA 4GZ5A 1JFRA 5A9SA 4RJ2A 2RONA 4FE7A 3C7TA 1GLGA 4CHTA 4BEWA 2FPPB 4KAFA 2XE7A 3DKRA 3BSFA 4FVTA 4A0RA 3ZI7A 4KHZA 1MW9X 3K72B 3P32A 4GP7A 3G2LA 2NV2B 1II8B 5I3CA 3LUKA 2P9ZA 2WAXA 3FUUA 3CEMA 4L0DA 5JVDF 2QRKA 3A11A 1L7EA 3OKAA 1D04A 3I1YA 4X90A 1D1QA 3TTTA 5DOZA 3QEMA 4IOLA 4LPSA 3M82A 1A7KA 4NE9A 2RH9B 3TX2A 4HNAA 3TJRA 1QDLB 3QM1A 2LIVA 1J5EB 2DWQA 3HXQA 3EZ9A 4EB8A 3H9GA 2WM9B 4E30A 3OLQA 1JXOA 4LZAA 1R2QA 4ENVA 4XVCA 1DO2A 2PJUA 2X3YA 3C3XA 3I64A 3NHYA 4MYDA 3II6X 5KOYA 4WKNA 3E7DA 1D5WA 1FYDA 1NKTA 2C8KA 1NW5A 2E6UX 1QCZA 3BFPA 3CF4G 1C9YA 1G66A 5KDLA 2QRVB 4C4ZA 4DEXA 4F4UA 1KVRA 4YY3B 3R44A 1JIJA 3SM3A 2PS3A 2PMBA 1W4CA 2XOXA 4L9SA 2WNIA 3PC8A 3HCAA 4FYJA 5E6SB 2G9NA 1AC5A 3S1LA 4RM2A 1VE6A 1E2IA 1JLLB 3WYEA 5KYXA 1RQ2A 1UEIA 4OY3A 4WD3A 4DLAA 1OTHA 1X87A 4TWBA 3BGVA 1GLNA 5LIRA 5CA1F 1CUBA 5IJ9A 1M3SA 4UBKA 1MGPA 2H7CA 1HT0A 3GMIA 2ZWPA 3C5HA 3KV3O 3TXAA 3GLFB 1REQA 3DYIA 4IMIB 4PLTA 2GYUA 3JD3A 2FZVA 5CT4A 2FQYA 5CB4F 1YOVA 5SZHB 1MEOA 1YL7A 2NW6A 1NJ2A 3BB3A 4QBTA 1QOZA 1PZEA 2HU7A 2G40A 2ORWA 3HU1A 4TWAA 5CCDA 4EFKA 4Y1RB 2QEQA 3MT0A 1L5ZA 3MK31 4OU4A 3CLKA 1BWPA 3QLJA 2ISQA 3COYA 5ALJA 3V55A 3EZ6A 1XDSA 1NNUA 3IVXA 4DR1B 4UW9A 2X8WA 2EW8A 5MN6A 2H48A 2YXNA 1VG0B 3L6UA 4ZT6A 4INZA 4JI1B 4HDRA 1C9DB 1RAHA 4A0QA 4I55B 1U2ZA 1NYTA 3KZOA 3DEJA 4RA9A 2JHPA 1NFRA 4JNKA 1HQCA 4ARUA 5JEDA 4LFBB 1V96A 1HYQA 1GIAA 3KXDA 4M46A 3JS5A 2HZ7A 4TSFD 3UZUA 4C06A 1XRPA 5DJ5A 2D4AA 3M3PA 1PU2A 4J1SA 3HCWA 4FJ0A 1UMDA 2C3OA 4RVUA 5IG2A 2B1IA 3ASYA 4GPEA 4MVXA 3N76A 5J5CA 2FR8A 1QLWA 2JGDA 3FW1A 2BKXA 5AK0A 3O95A 4M49A 4O2BB 4R9SA 3FUCA 3GPCA 3NHSA 3T7TA 1XTIA 1EUCB 2PBFA 2PFKA 3IIJA 3KPWA 2LPMA 2NZWA 2XVXA 2Z2IA 3LT5A 3QBTA 1Z5VA 1FYWA 4G25A 2V54A 5PNTA 4LY0A 3TTSA 3IH5A 1KEVA 2AQHA 4HR7A 3VTAA 2RGNC 3RSQA 1RWMA 3AF6A 4S1VA 5DRYA 3DTVB 2C2ZA 1FNMA 2OUKA 2QJWA 4PZ0A 2FWJA 4M60A 5AI4A 3SQWA 2P2ZA 3JY6A 2Q07A 3DEHA 1XU7A 2R8ZA 3E27A 4K0RA 4A3SA 4EYKA 2QZZA 2HMUA 2EFCB 1E9FA 1IOZA 1JVSA 1Z6XA 4F9FA 5TJHA 3SS9X 1DWUA 4OB8A 3FYUB 3WLSA 1NVGA 3ZC3A 4QUIA 1E2JA 1EGVB 1C3VA 3CUWA 4RCYA 1J0EA 4MA5A 4ZCQA 3GJRA 3K7EA 2JGEA 2Z1NA 1QV7A 2BE7A 3TW6A 4D7AA 1FU8A 2CFCA 3NHUA 2VN8A 2Y0DA 3WRYA 4B7ZA 5BWCA 3PUVA 4R9RA 1QFJA 3EIOA 4HEJA 3WWYA 1R6BX 4F72A 4RTKA 3R8CA 1P2TA 5EIFA 2DUNA 1RZRD 1SHJA 1ZVQA 1G6HA 1EKXA 2AOUB 1Z2PX 2F48A 2O2JA 3QNUA 1BFDA 5E8RA 4B85A 1NVUQ 1U9JA 3P9SA 5EIBD 4ZEWA 3S8YA 1S9DA 2PTGA 1V41E 1Z8HA 3U56A 4JOQA 1JHYA 3K3PA 4Z3KA 5JI3E 1N5KA 1Y89A 5KQSA 1E1LA 1H8EA 2W6JA 4MVJH 3QKIA 4YDHB 4HN9A 1HDEA 4U1RA 1RFGE 5IAOA 5JXHA 2Y1CA 3FETA 4BP9A 2ZFUA 3TUJC 4LGYA 4MRRA 1OYVA 4DLRA 3DOJA 3VR0A 3SXUB 3DDSA 4OCZA 1Z16A 2HRZA 1VZ2A 5DW0A 4QJ3A 3DO6A 4XFJA 5FWXA 1B1CA 1ECPA 3ZYCA 2H65A 3TLJA 1YDWA 2YWEA 1Q1NA 3N6VA 5JBIA 1T8YA 4Q37A 2NZXA 1QIIA 1GILA 1YC5A 3K1AA 3DMRA 4LAFA 3RI3A 1P4HA 3VSBA 4QDOA 5KNBA 4EGQA 5LCXA 5JRJA 2LGJA 4DG9A 2X5KO 1UF9A 4Y9TA 4ZODA 1C8VB 1XQWA 3P7MA 3HL0A 3JSXA 4F6RB 3SXJA 3FNGA 4V2IA 4Y2GA 3ZPXA 3SU8A 1WHSA 3GEMA 1D2EA 3HDYA 5EGNA 2DPLA 1LVUA 1HWYA 3KJIA 1EYZA 3LF2A 3PQ7A 4HYTA 1H69A 5IXYA 4QPNA 2FZKA 1JFTA 1OZHA 4FIZA 2R0QC 3OQNA 2XMRA 4Z0TA 3FYHA 1GUZA 4ILKA 3F2VA 5ALDA 2HGSA 4D43A 4Z1MD 1ZKMA 3L7YA 4N7RA 3DNPA 5LKRA 1HLDA 3O0TA 1AMUA 2YFKA 1P17A 5H70A 3N53A 5BY2A 4QJ4A 4TWRA 4WN9A 1WPXA 1ZWKA 1PK8A 3OLZA 4S1PA 3ZVLA 3D3WA 3HJGA 3JVUA 4UTZA 1TMOA 2IYSA 2BBWA 1FS6A 1RBQA 1RKXA 1OROA 4TT3D 1KJZA 1JDVA 1Z8NA 4MOWA 5J3JA 4TV9F 2HADA 4RS4A 2C9CA 2XUPA 2RGGA 4M0CA 1JDBC 4WNCA 3WTBA 4YV2A 4AJHA 5JC1A 1JLLA 1QIFA 2FN9A 4PONA 3D8TA 3NXKA 1FS4A 4H3HB 4HWPA 4S1WA 1KNXA 5BT9A 2KBEA 2YJ5A 1XCLA 1OWMA 1PW7A 4MR8A 2V7UA 4JQCA 1IBKB 2V1UA 1CD5A 2H0RA 4WXRA 4TL6A 4AYWA 1PTJA 5JXGA 1DAKA 3D81A 4XJXA 4OHXA 3D6HA 4FK8A 2C94A 1H1TA 5DLEA 3UT5A 3GCZA 2VF5X 1NJ5A 2ZT5A 1GPDG 1QNFA 2AHOA 4XVRA 5JFOA 1WMSA 3EUWA 3FFAA 1VDMA 2O4UX 4BXOA 2H2DA 3F4KA 3D4BA 1CUWA 4YBZA 1K75A 3I0MA 3IKMB 4BV9A 2C00A 4FMPA 3EXEB 1N1DA 2YXBA 2A1TS 1QHGA 1Z7GA 1FSFA 2VHZA 3RIMA 1KQ3A 3LP8A 2G5CA 5BN4B 1E6CA 3ORHA 3KFVA 1W581 3FE2A 3ZN2A 1N2HA 3VAAA 3RS2A 1ZU4A 3MLEA 5DM2A 4INJA 1ONNA 3NANA 2YWCA 3CNBA 1PFVA 2F17A 2HTFA 3R5TA 2XUAA 4Z1OA 5JADA 3JRNA 5TB5A 3ZK7A 4JXZA 3RDPA 2VT6A 4X1YA 3LECA 4PO1A 1E2MA 1I2AA 1C7FA 1P9LA 2PKQO 1EUQA 3K8YA 4XJTA 2A84A 2CLMB 2OAEA 2R62A 5C0OE 1AMOA 1I7DA 1NVEA 1SXHA 3BMCB 2I87A 4IUYA 1VCMA 3F4BA 3WKEA 4BZWA 3GLIE 2XNKA 3UHAA 1Z63A 3DEAA 3KJHA 621PA 1N6OA 1KO8A 1XJQA 5BVHB 3NEAA 5EHXA 1R0KA 4MB6A 4GMFA 3EFBA 4W1QA 1RXIA 4HDSB 4YJDA 5CXSA 1ICIA 3JWJA 1RBYA 3CLRD 1TLFA 2PRZA 2RHCA 1O0BA 2DSTA 3VPAA 3G0CA 2CXSA 3FKSD 2J8ZA 3ITEA 4V0LA 3U3KA 4ASUD 3WQRA 1QHXA 3LUFA 5EJ7A 3A6PC 1OXBB 2QHXA 2RE8A 2QLBA 2QTCA 2SCUB 3GN1A 3GA7A 3T5CA 2JKVA 1ZD2P 1NQWA 2QRHA 1O94A 3GZTB 1SBTA 1HPLA 4HS9A 3W8FA 2OHGA 1ISMA 3VSAA 3A3PA 2A92A 3EASA 4GFDA 1BXGA 1PUXA 1P0MA 1Q95A 3E22B 3HO6A 4B34A 4BYGA 3AP1A 3Q2IA 1RLUA 3UJAA 3DHWC 1QGUA 1I7PA 1XZNA 4DLKA 4QTYA 2JS7A 5E0KB 5EWMB 1U9IC 4C14A 4CKXA 1E8NA 2CW5A 4QRDA 3O8DA 5BW6B 3W1EA 3KYIB 1UT6A 2LDBA 3LD9A 5FIUA 4ESVA 1AU9A 2FFBA 3SE0A 2B6NA 3F4LA 2H2FA 2QRLA 2X8AA 1UDRA 1LNZA 2H8KA 1O6FA 2OMEA 4EG5A 1WZUA 4HWOA 2QM0A 2GAIA 2O2CA 4ZQCB 3N7TA 5EZYA 3ZWKA 4Q3KA 3K6SB 1TM5E 1ZUWA 3C5CA 5TQ2A 4MR7A 3LUPA 5KX5A 5KYUB 4LHWA 2CFIA 4RHYA 4PZDA 4NONA 5FDFA 4GWGA 3O8BA 1JPVA 2QXYA 3IOBA 4LCEA 2FMHA 2W0MA 3EXHB 1LBHA 4MS4A 5EAIA 3RU7A 4GUDA 4J0GA 3HWSA 1OUMA 4ZYVA 1WV1A 3KLBA 3EIHA 2G80A 4KXMA 4MITA 2YH2A 3FNHA 4ND8B 3I1IA 4YT2A 2QJTA 1PGOA 4J0QA 1CS0B 4L57A 1LS6A 2QMQA 5AW2A 4KREA 4KXUA 1JHUA 3FNEA 1L2TA 1C0PA 2H17A 2INGX 5G0VA 2BSXA 3AM5A 4CMIA 4ZI5A 3FZEA 3AZQA 4FN5A 4C5BA 2CNNA 2QE7D 1CY0A 1RRFA 2WC1A 1VJCA 2FHSA 3K1AB 4BZZA 3ZW7A 1S96A 2DTXA 2WNSA 2QUHA 5M2QA 3UWPA 2BH2A 2G04A 3DB1A 3ZGYA 3F67A 3ZBTA 1CQXA 2PQ0A 1XO1A 3GJYA 3GT4A 4WW0A 3BXEA 3M5CA 3RAPR 2N1BA 3B85A 3W9UA 4YH1A 3JYPA 1PJ3A 3GELA 5AI8A 2OXIA 2XX3A 2A9FA 1TM7E 2PSEA 2WHXA 2JGFA 4M0EA 5FA8A 2UVPB 3THOA 2WJJA 1ZMRA 2W2OA 2CHVA 2B30A 4KACA 3GGPA 2IQIA 2DFDA 1K2WA 2VNAA 4BNGA 1A50B 4Z53A 3CNHA 2G63A 2O57A 2QL6A 3RC3A 2QE6A 2XIJA 3UMCA 2HHLA 1VJTA 4R2WA 1A2QA 4AQYB 3D1JA 1MB9A 4EHNA 4MIYA 4PGAA 2HBYA 4I8IA 1WSBA 3MBIA 2DY0A 1JP7A 3RU2A 4GD3Q 3RV3A 2D5BA 5LB2A 4WLUA 4HAYA 1MO5A 2LKCA 2I3AA 4QDTA 5SV2A 5U1PA 2Q1WA 3M6UA 5LZ7A 4M0PA 1AUPA 1I4OA 1I5RA 1OZAA 1KYYA 2XRMA 3HSKA 4O4IF 4P4GA 1R6VA 1I0IA 5LM3A 1OXKB 4A8PA 4CTNA 1BVRA 2VNHA 4G8JA 2Z8XA 4CGYA 3VPDA 1YFZA 5AT1A 1MR3F 1UMBA 1IQRA 1FU4A 1N0HA 1Z2CA 1RYDA 5EGSA 3RE1A 1PO7A 1XTKA 4MR8B 2ZR8A 1AK1A 4W8GA 2XDYA 5LU9A 4RZHA 4HP8A 2HO4A 4UHFA 4LJRA 3AW8A 1NOKA 1QP8A 3A6HA 5BVGB 3OE7A 1TT7A 3HG7A 3H1PA 4LW8A 4H6PA 4PCAA 3QQ5A 4DA9A 4RULA 4J7XA 1X1SA 2ZJ8A 2EC5A 1KXZA 4KR3A 1FNSA 1S3FA 4Z8YA 5LXTA 1P4GA 2I34A 1R7RA 5K99A 1NUUA 1YVUA 1L6IA 4KPEC 3HO1A 3JQAA 4A73A 3OQIA 1WOMA 3B12A 2B94A 2Z5LA 2G28A 4FW8A 4U2EA 3DQQA 3LDGA 1KFCB 4JJIA 4RPJA 5G0SA 3O8LA 3U62A 4N5IX 1WCWA 1XTSA 1NQOA 1OKKD 1NVMB 2J6HA 2XITA 2FZ5A 2P4EA 2ACWA 4Z86A 4XWWA 3TSOA 4R7ZA 4I5IA 2EHJA 1RCUA 3L18A 3I1FA 1YKSA 4RIEA 2JAXA 1RQNA 3QYFA 4Q4DA 3T0IA 1VMAA 2GK6A 2DB3A 1GRRA 3FWZA 3IJRA 4KN9S 5TQ0B 1Z7EA 3IIIA 3LUDA 4I4TF 1ID8A 4B7XA 5AJVB 4C6TA 3ADPA 4GLFA 4Y2RA 5CVEA 4XD7A 4M22A 3W2TA 1JLSA 3VGPA 1S2LA 1MB4A 2CYBA 3CZ5A 3QENA 4MW4A 2MOKA 4RMJA 3SBOA 1DV1A 2JHCA 1ZD1A 2OKGA 3Q7RA 1XF1A 2HFKA 1KZ7B 2Q3DA 1GPKA 2BUBA 2YWHA 2IX9A 2TSYB 4Z4FA 2F1KA 1Z7BA 2PPVA 2QA5A 3NEJA 1P6XA 3G2KA 5BN3A 1OA1A 4OB6A 2FZGA 1HL7A 2IPXA 3OZTA 1VMDA 3QXGA 2CNDA 4L4RA 1USKA 1DARA 3G8CA 4IDGA 3RCBA 3SP1A 1NN5A 4ER0A 2QI9F 4W1SA 3J81k 1ATIA 3DWIA 1RACA 5E9WA 1DO0A 4Y9UA 5DK6A 1O6CA 1IEQA 4KRGA 2OXTA 1BDIA 3AHHA 1PW5A 1YB1A 1SC4A 4XYEA 1NVVR 4RKYA 2FJPA 4PLZA 3IO3A 1NR5A 1LJUA 1AXGA 2WHPB 3D0QA 1OFIA 2WYUA 2OVFA 4TQ9A 8ATCA 5C51B 5CIYA 6ABPA 5GGYA 5MGNA 2V03A 2R3SA 1J8MF 3JU3A 2FN7A 3KOZA 2WG2A 3LQFA 4ISCA 1VHDA 1BX0A 2RHHA 3EIQA 4H4DA 1DKLA 2RHJA 1F4PA 2BLNA 3IOMA 1BH6A 1R4MA 1M2HA 2B5VA 2ZYUX 4WRRA 1BYIA 3SX0A 1EFVB 4YRQA 3X1DA 5BORA 2D3WA 1PSZA 3DF7A 2NYRA 1FUEA 4HAVA 3GDGA 1QAQA 5TT1A 1ZITA 3DVLA 2CLEB 4MINA 4JVOA 2B0JA 5F3RA 3NALA 1M7HA 4JJ6A 2WTEA 4HDNA 4E6EA 6YASA 4DBLC 2HT6A 1NR7A 4LBWA 1N3IA 2GA9A 4L4XA 3GUVA 2YHUA 5B1EA 3VKVA 2JI8A 5BP7A 5GJCA 4QQKA 1VECA 1ZO8A 5CYGA 1UBTS 2XGJA 3U7HB 2WFLA 1GLVA 1XDUA 4PWYA 2GRAA 4V0ME 5THQA 4YPVA 1E0AA 4AKSA 1A9XB 5D86A 3UK0A 1FYEA 3F6PA 2R8BA 4YMGA 1GVHA 2PZKA 4NYIQ 4NABA 4RA6B 3RBZA 2A9PA 1GPUA 3HR7A 1M67A 1VSVA 3C16C 4K81B 3ZR4B 5CB6A 4Q1FA 3DZBA 3HDHA 3IB6A 3SD7A 2QORA 3FI0A 2IODA 3NJRA 3WMWA 4D44A 4JUAA 4O0MA 4EUHA 2C2WA 2H1LA 3N87A 4EGAA 5JY6A 4ZRMA 4CMCA 1T4BA 1CRLA 1N92A 4F85A 4HDCA 1CZRA 5TIIA 3NHBA 1Y98A 4EG0A 3IX7A 4CM7A 2G4CA 2HK7A 2R7MA 2VJBA 4RJTA 3C3AA 2WR8A 1ZH2A 2FWIA 2A0WA 2ZWVA 3AMVA 2OENG 3JQQA 4R54A 4RK6A 5L3QA 3ZY3A 1PJ8A 3MLBA 5FQNA 1P0IA 4B3IA 4GLBA 1Z22A 4BNUA 6REQB 5EJ9A 1A4RA 1E4OA 3ND5A 5T6MA 4DQ0A 1P7VA 1A8HA 1SHTX 1UBRS 4RMIA 3SZUA 2EBWA 4HWSA 1DRUA 1U0OC 2JZOA 3M83A 3KQNA 3GYBA 4H59A 3D2CA 2PTHA 4YONB 2ENWA 1VIMA 3SDBA 4EB6A 1FFDA 2ZYTX 4OXNA 1S02A 4PZAA 3GA0A 2OPBA 4UUNA 4EO4A 4ZOQI 4I1SA 3C1AA 5ALGA 3NI2A 3GFFA 3ESZA 4K6GA 2QG9A 3TDKA 3UWOA 4NSNA 3STWA 4BMZA 2JGNA 3VTZA 4WA7A 2Q1TA 3BDAA 1NVBA 1VYHA 2AEFA 3TZBA 4QHYA 5IN5A 3ZCTA 3GN2A 4YT4A 1JWAB 1Z8FA 2H1SA 2OLEA 4GX0A 1ORWA 3ANYB 1I4EB 3X2EA 4ESEA 2NYUA 1GU1A 2Q5HA 2V58A 4GDMA 3IP5A 1HX7A 1DHRA 3CH5A 4E3WA 1K8XB 3AYZB 4QSHA 3W5BA 3UF0A 4Z7OB 2ZKIA 3ZWDA 4IQ0A 1IE3A 3FNFA 4XCVA 4IJ6A 5FA5A 2AE1A 2IPMA 3QG5A 4Z4GA 1S8AA 4CEIA 4U7WA 2GF9A 4PM4A 5AOBA 3ZDFA 2VZ9A 5LNK6 3GEGA 3HEBA 1KP3A 3S68A 4MW6A 1US8B 4QNRA 3PTZA 3R3ZA 2W2TA 1M1ZA 3F7NA 4R05A 3CONA 3ISJA 4CM9D 3BFVA 1PJ4A 2QRUA 3LWNA 1N57A 3IEKA 4LCJA 2J7PD 4FILA 3U16A 3GUUA 4L15A 4DUGA 3QU9A 4JVSB 1JJIA 3O4FA 4H7PA 1I7LA 5AQEA 4H7KA 5FOQA 4LQCA 1CEEA 2GM3A 2AJDA 1MKYA 3ZLBA 3M1IA 4I5GA 1ZWLA 1E5LA 2NTEA 2ZQYA 3GXOA 5JS7A 1OFHA 4QUGA 1XK6A 3T06B 3FBGA 5AR1A 1A4IA 2C03A 2V0GA 4UEJA 1NVTA 4J2TA 5FLKA 5FUWA 4RADA 4HNUA 2C59A 2YCBA 2WIDA 3MMZA 1V39A 4YT5A 3AKCA 2IIPA 3BIFA 4X1YB 3GW8A 3SZMA 5M5BA 2NSJA 5FBKA 1YJXA 4ZKEA 5IDXA 3PQ6A 1XWFA 1S2OA 4LZOA 3ISVA 4I81A 3EX7C 1P81A 3T7EA 2TMKA 5UKDA 4O8CA 4TQGA 5E9QA 3N2LA 4WCDA 4WK4B 2YBDA 3KSBC 1I10A 4OHOA 4OHFA 3TOVA 4BASA 2RGDA 3HS3A 5IJZA 2HJHA 3GCDA 1BROA 2VYCA 2JLRA 3CPEA 5SZJA 4HVAA 3NWOA 4DWWA 3HB7A 2YN0A 3M33A 4MWTA 2WB4A 3CB2A 4F5ZA 2N3ZA 2VCHA 1DCMA 4MI3A 2CK3D 2F4NA 1DIBA 2GHQA 2JIRA 5JI2E 4ERNA 4KGZA 3Q8WA 3KV1A 2I67A 4M1OA 4TYQA 5AVKA 4UOZA 5EEGA 3NXSA 1MX9A 1MU0A 3HZRA 4LVUA 4K6MA 2A9QA 3R7SA 2B25A 4BO8A 2DU8A 3U3DA 3CRZA 5EKDA 5BV7A 2BFBB 2IGTA 4LUCA 3T3OA 1CJSA 2HREA 4TT3A 3O5AA 1FFHA 4FFPA 3DKKA 4LYEA 4NESA 4TMWA 1WM1A 1T1RA 2MDTA 4RZQA 4YB8A 3TD6A 1C9JA 1M10A 3HXLA 2YRFA 4NFYA 4X94A 4Y7DA 3GARA 3ELBA 4PIVA 3KT6A 5FI5A 3ESAA 1BE1A 4U4AA 2GTIA 4CLOA 4KXFB 1E66A 1WB6A 2QQ5A 3I9V1 4IDFA 4WN9B 3OUZA 2GSWA 4ZVKA 1IB0A 3UBTA 1PAUA 1BS9A 3OZIA 3RAFC 3L4SO 2WE8A 4FHEA 4CL0A 1YRWA 3ESQA 1V11A 4PYQA 3ZCVA 3VX3A 4J6FA 4CKYA 3R5XA 4MPTA 4NL4H 1FFXB 4ER6A 1GU7A 2AFRA 3R4CA 4OHRA 4ZAYA 2CV1A 2JJ2A 3U7JA 2FPIA 3ZHXA 1BMDA 4O4IA 4RVGA 5IJ0B 5IM4F 1UBGA 2QKYA 2OL4A 1K6IA 2G09A 1Q6ZA 1ZP6A 4JX9A 4MCAA 4Q01A 5F5NA 4R40A 1GG9A 1P1FA 1EFDN 2RHMA 3CKYA 1RJFA 1I8TA 3TAUA 2R2AA 3JQ9C 4G2NA 5ILOA 4II7A 2JASA 4GM4A 1KKMA 2ECQA 1SG0A 1Z33A 1NJGA 2ZJ1A 4QDZA 1O4VA 4TYPA 2F8LA 2ANCA 3DE6X 4QPCA 4LV6A 4NBSA 4OI4A 2BGUA 4Q19A 4WZAB 4QTXA 1V6AA 3FF4A 2CL6X 4B76A 4HEA6 2HIAA 3HCRA 3BZWA 4JV5B 3UHPA 4NBUA 4D5EA 4US2R 3TUZC 3URMA 3Q6IA 3VH2A 1ZOLA 1NBAA 3NATA 4XTCS 2Y9MB 5FA6A 5SZIA 4B1FA 4JGGA 1TTTA 2O8DB 3MTJA 2BD0A 2XKAA 2QK4A 1YZNA 3EDQA 3HUTA 4O4HF 5AHXA 1YKGA 3ZGVA 5BSMA 5FOTA 3ZYZA 3FKQA 1SUEA 1L4YA 2HPAA 1P8AA 2MYTA 2PCJA 3HPRA 3LTEA 4NZYA 3FZGA 2XWSA 3ZIAD 2NSDA 5BSVA 1G8PA 3O8NA 5EPOA 1RQLA 5TQ2B 4MV4A 2QGZA 1QP7A 4YACA 2WWFA 3I2GA 5HIMA 3ID6C 3VR4A 1FF9A 2J08A 4BQQA 3EPPA 3FYUA 4X7MA 2BI8A 4FKBA 4F91B 1T5BA 3AJ8A 4YJ3B 2QRGA 4GRDA 3TE7A 5KNCA 2H11A 1FVX