1M76A

Crystal structure of the s137c mutant of l-3-hydroxyacyl-coa dehydrogenase in complex with nad and acetoacetyl-coa
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
291
structure length
291
Chain Sequence
KIIVKHVTVIGGGLMGAGIAQVAAATGHTVVLVDQTEDILAKSKKGIEESLRKVAKKKFAENPKAGDEFVEKTLSTIATSTDAASVVHSTDLVVEAIVENLKVKNELFKRLDKFAAEHTIFASNTCSLQITSIANATTRQDRFAGLHFFNPVPVMKLVEVIKTPMTSQKTFESLVDFSKALGKHPVSCKDTPGFIVNRLLVPYLMEAIRLYERGDASKEDIDTAMKLGAGYPMGPFELLDYVGLDTTKFIVDGWHEMDAENPLHQPSPSLNKLVAENKFGKKTGEGFYKYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the S137C Mutant of L-3-Hydroxyacyl-COA Dehydrogenase in Complex with NAD and Acetoacetyl-COA
rcsb
molecule keywords 3-HYDROXYACYL-COA DEHYDROGENASE
molecule tags Oxidoreductase
source organism Homo sapiens
total genus 119
structure length 291
sequence length 291
chains with identical sequence B
ec nomenclature ec 1.1.1.35: 3-hydroxyacyl-CoA dehydrogenase.
pdb deposition date 2002-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00725 3HCDH 3-hydroxyacyl-CoA dehydrogenase, C-terminal domain
A PF02737 3HCDH_N 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.10 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 1m76A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1m76A01
3AM4A 4FW8A 2GF2A 3I6IA 4GX5A 4KMSA 4EUEA 5A03A 1UDCA 2H63A 4WLFA 4HNGA 3CXRA 4ALMA 1OFGA 4DUPA 1N2SA 1KEPA 3RBXA 2YDXA 4Y6RA 2GRAA 3ENKA 4Y67A 3E5RA 3OP4A 1PL6A 4FC6A 1YONA 1YH3A 2O3RA 4IS2A 4GWGA 1C1XA 1UZMA 2VT2A 3MJCA 1KEWA 5JAMA 1M67A 3NT4A 1U7TA 1E1NA 1E77A 4FFLA 3L6DA 3ABIA 3WYBA 4E2WA 3OEYA 2ZK7A 4YRDA 2PK3A 3VTZA 3GY0A 3AJRA 3VHRA 1LLCA 3H6KA 4F45A 3BTSA 4YJFA 4HFJA 3NJ8A 2G0TA 1V8BA 2RHRA 2PFGA 4K9DA 4AJHA 2WD8A 2X9VA 3KTDA 1JAYA 3OJLA 4N5NA 4WASA 4ZRNA 4NU5A 5KKAA 4YCAA 3HFSA 4OH1A 4IDGA 3HJAA 4UVEA 5C7IO 3L6EA 3ZNNA 2V6FA 1BDMA 4TMFA 1YBVA 2DTXA 3GPDG 4EJMA 4D0SA 4PFJA 1IUKA 2OO5A 2JCXA 2FSSA 3K73O 4MP8A 4GLLA 4J7XA 4PLZA 5DBGA 3WGYA 4IBOA 5G4LA 1K6XA 4EEZA 1MXFA 3I3OA 4XD2A 4M49A 4AJJA 1GADO 3JQEA 4KQWA 3GVPA 2EJVA 2AQIA 1IE3A 4II3A 1WDLA 3BMOB 5K0ZA 4LSMA 4UVGA 3HWRA 1UZNA 2CDCA 4DLAA 4JN6B 1U7HA 5JW6A 2NSDA 1DAOA 1E6UA 3AOEA 2VWPA 4HFRA 4AJ2A 3F46A 3TDKA 1HYGA 3IUPA 5A9SA 4B3HA 5IZCA 1N1EA 1R0SA 4DPLA 2Q3EA 4ND2A 3AFNA 1PS8A 2QZ9A 4JX8A 5K6AC 1WMAA 2VTDA 3LT4A 3HADA 3ZNPA 3TZKA 3KYBA 1D4FA 2I6TA 3ANNA 2VOJA 5B37A 4BGIA 1O95A 4ND1A 4CUKA 4XEHA 3ZWMA 1UAGA 5JY6A 3I5MA 2HMWA 3U4CA 2HLPA 1BXGA 3PIIA 1B8VA 2QX7A 5DOVA 1RM0A 3FCOA 5BSFA 1SEPA 3E18A 3QW2A 3RUHA 3N58A 4BV9A 4RQUA 1PJQA 1HDYA 5IXYA 3HB5X 1GY8A 5BSHA 4L75A 5H83A 4BO7A 1EMDA 3COSA 3WOHA 4ZQFA 2Y0EA 1SEVA 4H16A 2FWMX 3D7LA 4O1MA 2XOXA 4YPOA 5I8WA 4CMBA 2P91A 3D1LA 4L4RA 1VJ1A 4CM1A 5U1PA 4L8VA 1SO8A 4E31A 3KRTA 2B4TO 3DBLA 3KXDA 1NFFA 5JSFA 3QWAA 1NWCA 3VPFA 2VRCD 1EE9A 3MTJA 4MVJH 4XGKA 4NMHA 4J2OA 2Q99A 1D8AA 3KYCA 4AVYA 1BXKA 4HP8A 3H65A 2IZ0A 2QYTA 1RWBA 1UDAA 3BHIA 2FPPA 3C24A 4NBTA 1H0KA 4RF5A 2BH9A 5GZ6A 5L45A 1ISIA 3WLEA 1KIFA 3D0OA 1PJTA 1GYQA 2PGJA 4XGNA 3C1OA 2HMSA 3U3XA 4WLUA 4ITUA 4BO5A 4FJ0A 4BMNA 2HUNA 3GEDA 4NK4A 2Q2WA 2NU9A 3VC7A 1P3DA 3JSAA 1PJ4A 3DR3A 4BUCA 3W6UA 3HHPA 4BO9A 4CR6A 4QEDA 3UXYA 5L4NA 3U0BA 1F12A 3QVXA 5KJEA 3H9QA 2VWQA 3KLMX 3RFTA 1N1GA 4IINA 1DHRA 4TZKA 3I4FA 4Z9XA 2IODA 5CEFA 1BWSA 1GZ4A 4MIEA 1VI2A 3H5RA 2PD4A 4E5KA 4YAJA 1DJQA 1I24A 2X7HA 4BNFA 3L4SO 5H81A 1CETA 4D3SA 4Z3DA 4DC1A 4Q3EA 2PD6A 1D1TA 2BGLA 3K2EA 5I9LA 1PJSA 4JP2A 1JVSA 3AUTA 3E48A 5L3ZA 3UH1A 1Z7BA 1X7HA 4D41A 4XRGA 4CM8B 5T57A 1YBAA 1YQXA 1ZBQA 5FFFA 1R4NB 3TZQA 1R4MB 2EKQA 1Y8RB 3AI1A 3LT1A 3QVOA 3S2IA 2EV9A 1LLUA 5LCXA 3JQAD 3ZWWA 3PJEA 5T8KC 2EERA 2IYOA 1BHSA 1QORA 3PP8A 3SBOA 4HX5A 4RDHA 4Q3CA 5L7WA 4ALLA 1OC2A 3I4CA 3HN7A 3KZVA 1MUUA 5ES3A 3V2HA 3O26A 3ZU2A 5B4VA 3ON5A 3K31A 2HRZA 1K3TA 1N9GA 4JK3A 3GDOA 1PEDA 4FDAA 2GN4A 2AXQA 4J4BA 3PRJA 2H5LA 1YS4A 2VHWA 2ZATA 4HNHA 3PHLA 1ENPA 1YE3A 3JD1A 3K9QO 3VZRA 2JD0A 2GUGA 4CM4A 1H6DA 4KTVE 1GQQA 2JHFA 4K26A 2HRBA 3R1IA 4AICA 5A06A 2CY0A 2E4AA 3WX0A 4ALJA 5A5EA 3ANLA 1H93A 4OOFA 4E5MA 2YW9A 2CFCA 1P1JA 1QLHA 1N7HA 4OO3A 4Y8VA 4BMSA 5L7TA 1GQYA 3K8ZA 2QYSA 4GPD1 4XA8A 3ZHZA 2RH4A 2GYYA 4E21A 4GVLA 1A4IA 2NU7A 3EUWA 3AY7A 2D5AA 4YQZA 1EUCA 3IAHA 4O0LA 4RGBA 3BMCA 1ML3A 4R41A 5TQVA 4JCOA 4A73A 2D5CA 1I32A 1NR7A 2ZTVA 1Y6JA 4U8GA 3DBHB 4TZTA 5ER6A 4E13A 3WWYA 1TT5A 2C5EA 3H8VA 1MC5A 1E92A 4JROA 4BOYA 2HO5A 1UXKA 3VPSA 5CPBA 4NBUA 2CMDA 5DCWA 4ZD6A 1R37A 4CMIB 1UXGA 1AN9A 3HQ4O 1BSVA 3RD5A 4R9SA 3CZRA 3CZMA 3C85A 1J6UA 5ITVA 3WXBA 3ETDA 3AI2A 3GZNA 3OJEA 3IQDB 3RKRA 5J23A 2EP7A 3GVCA 3STHA 4MPDA 1LC3A 4KDEA 1B15A 1QSGA 4FIZA 4IXTA 3ZZNA 1LXCA 3VVCA 1LDMA 3KSDO 1GL3A 4CLHA 2OOSA 3DOCA 3Q9NA 2NVBA 5BNFA 2JKVA 3ZU5A 3DONA 1BTOA 3JQAA 1ZCJA 2TMDA 4J4HA 1F8FA 4MVJE 1TT7A 1L7EA 4FN4A 4FFPA 4NFYA 4J4TA 3T4XA 1SNYA 2O2YA 3OA0A 1EZ4A 3EK2A 3IS3A 4RVGA 2X9GA 5A9TA 4RPHA 3QHAA 1LQTA 4IJVA 3ST7A 1LSJA 1PQWA 4EYEA 1BVUA 4R3WA 3HN2A 1UAYA 1E3SA 2IZ1A 1L1FA 1ZJYA 1QP8A 1MFZA 2B4QA 1NPYA 3PYLA 3U5TA 1DAPA 1IPEA 4OL9A 2WE7A 2V6MA 3M2PA 4CMGA 2X8LA 1Z73A 3ROPA 4PGFA 2QRKA 3WIEA 4D7AA 1GTMA 1J0XO 4J43A 5L53A 3RWBA 4OQYA 1EBUA 4OGWA 3OJFA 1FDSA 3RVDA 1IZ0A 3HDQA 3WGHA 3QWHA 1U4SA 5TLSA 3CTVA 1GCOA 1UXIA 2VHXA 4N54A 4D42A 1MC4A 4IQ8A 5GZ3A 4R01A 5KVQA 3MCVA 3AK4A 2BRUA 5F1OA 2ZB8A 1QKIA 4GI2A 1ISHA 2P4HX 1H6BA 2PY6A 1L7DA 3I9MA 2PKRA 3WGQA 3FBGA 3FF4A 1EBFA 2OUIA 4UVIA 4FFMA 2IXBA 3FWZA 3OEWA 3R0IA 2X58A 2O4UX 1P0CA 1RYEA 2X0NA 4Q3BA 2PNFA 4PLPA 2UUPA 1HE2A 2J3IA 3X2FA 4N5MA 3W4KA 1NM5A 3GH3A 3ZV3A 4B7XA 4BNLA 1P74A 4FSHA 3WMXA 4NJMA 1Q7CA 3CUKA 4GBJA 5TF4A 3IL2A 5AXBA 4DRYA 3LVFO 4RLHA 4ZRMA 1NP3A 1NFRA 5F1KA 2D1YA 4N7RA 4NDNE 3MWDB 3UUWA 4E2YA 4FR5A 1NVGA 3DBRA 4PG8A 5I9MA 1UH5A 4XZ3A 3ZWXA 4BQRA 2RHCA 2X5KO 3G79A 3DZFA 3RFVA 3BMNA 4FFNA 2Y1DA 3FTNA 2RIRA 1I3KA 1QXSA 3CIFA 3DZJA 1D7OA 2OBNA 3GDFA 3IJPA 5TJ9A 4CV1A 5JY1A 4WNCA 3DMTC 5G0UA 3H9EO 5DOZA 1P1KA 4YRBA 2PZJA 4E5PA 1I2ZA 3C8MA 3FHLA 2R2GA 3M6IA 4BNNA 2QW8A 3GMSA 1DC5A 2FY8A 4AJIA 1E3WB 1MB4A 1NAHA 2Y0DA 3DZHA 2Z1MA 4DVJA 2DC1A 4WCDA 1CJCA 2Y67A 1LI4A 3AI3A 5BSGA 3S8MA 1NHGA 4PLWA 3LU1A 4NK5A 4OXKA 1R0LA 4XQGA 4RPGA 2EP5A 4CLOB 4XYEA 5TNXA 4P38A 4K6FA 2FRDA 5IN5A 5DN9A 4AJKA 3KETA 1XKQA 1IULA 4IIVA 2E49A 1PJ2A 3TRIA 1LC0A 3AU9A 4U6SA 4DLLA 5A3JA 4A26A 5TJHA 3WFIA 1B14A 2BLLA 2DM6A 2FZWA 1LRJA 4OYRA 2HMTA 3AU8A 1C1DB 4QT0A 4JJFA 4RORA 3UAGA 1Q2XA 3RUIA 1TB4A 1VLLA 7ADHA 1ENYA 4B7UA 1HDGO 1VL0A 3F5SA 3OHSX 3KYDA 1SCUA 4DPKA 3H9JA 2BI7A 3DWFA 1PGPA 1PZFA 3INRA 3GRKA 4QUKA 3FNHA 3INGA 2BHLA 2FR1A 4Z0TA 3KV3O 4U0KA 1P1RA 2IDZA 2Q45A 4P4GA 5CHEA 3PIDA 3PGJA 4AJ4A 2VCYA 5BSEA 5IJZA 2NNLD 4EGFA 3TZCA 4YT8A 3LQFA 5IG2A 1I10A 3DC2A 2DFDA 3N7UA 2O3UA 4KOAA 3LC7O 2IEBA 3P5SA 2VYND 3SXPA 4OHUA 4WNIA 3ZHBA 2UYYA 3K30A 2B4RO 2AW5A 3CEAA 4MO2A 3GAZA 4OKIA 1U8FO 3DAFA 3PLNA 2IZZA 3D5TA 3W4IA 3WLFA 5BQFA 5AXAA 4JNKA 3IP1A 4R69A 1V35A 1NXQA 5L7YA 4J2HA 4KP7A 1XCBA 1EK6A 4BGEA 4XX0A 3V5NA 5TSDA 4J91A 3ZW8A 4WOJA 4CPDA 1DRWA 5FWNA 2LDXA 2VT3A 2WD7A 1HLDA 1MXHA 1RJWA 2CSUA 4HADA 4BNJA 1WDMA 2X9NA 4CM3A 1GEEA 1ZSNA 2DBVO 3DL2A 1H94A 4TKLA 5T6BA 2VZ0A 4XB1A 4L74A 4IDFA 1HXHA 4IMRA 2CDBA 5IDQA 4GSLA 5TT0A 1FDTA 5F3RA 1ZEJA 3AOEC 1K5HA 2JCVA 4LK3A 4CMKA 4DPMA 1RM5A 1U3UA 6ADHA 3HUDA 1C0PA 2NADA 1YQDA 2PGLA 1ISFA 4K6CA 3SC6A 1M66A 1Q0HA 2BELA 3RAJA 4CQLB 1W0CA 2E37A 3D3WB 4BKRA 1GUFA 3JD0A 1PX0A 1O9BA 1G0OA 3OIFA 3PK0A 3NDJA 1E7WA 4LVCA 2Y66A 5HBRA 3TFOA 1JQBA 3NUGA 3PWZA 3MOIA 4AFNA 2VRBA 1HE3A 1PS0A 1WP4A 2YFHA 4PG7A 3HG7A 1ZEMA 4J0EA 3Q6IA 5G4KA 2CVZA 4BNMA 1Y9AA 1KYQA 5MGBA 3PWKA 4J6FA 1TLTA 3GVXA 2P68A 2DTDA 4RF4A 1Y1PA 3BXXA 1YOVA 2EEZA 3B1JA 3RQSA 3M2TA 5F5NA 1V6AA 2P4QA 4BNUA 1UR5A 3ASUA 1M2WA 3SLKA 5EN4A 2W2KB 2JAPA 4I5FA 4CLDA 2A4KA 1YL6A 1P77A 5ILGA 1JTVA 1P1IA 1EUDA 2BI8A 5ENVA 4OXNA 3E1KA 3DMTA 1DIHA 4WCFA 3AOGA 3NX4A 1E3IA 4AJEA 4NQZA 3RJ5A 4N18A 2HJSA 4W82A 1H6CA 4R54A 1E3LA 3RUEA 1DIRA 5COBA 5BR7A 2P9CA 1I3NA 1BW9A 5I7SA 1I3LA 2AE1A 2Q1SA 3DOOA 4CLRA 3PI7A 2P9EA 4TVOA 2YHUA 1I5RA 2EHDA 3ZH2A 3NKLA 3DQPA 2AG5A 3H2ZA 4YJHA 1ZK2A 4IQ0A 1XSEA 2GN9A 1HF3A 1DOHA 5JMWA 1F0YA 4MJLA 1NFQA 1A9YA 2QHXA 3I9LA 1G0NA 2R00A 2PZKA 4DL9A 4J1NA 2FSVA 1SOWA 4Y6PA 3JQ8B 4F3YA 3KSZO 1ZXLA 4BNVA 4GWKA 2YQ4A 3I9JA 4R1UA 2NVUB 3RC7A 4CV2A 3Q1LA 4UUPA 1GAEO 4KWHA 5A02A 2POQX 3FR7A 4TRNA 5CG1A 3JD3A 3DOJA 1LDYA 3U09A 4CL3A 4GX1A 2X22A 2C59A 4BB6A 1Y8QA 2Q4EA 3EYWA 2Q46A 1ZSVA 2P9GA 3TPCA 4IPTA 4M89A 5COQA 3RUAA 1LLDA 3NT2A 1GZ6A 4BKUA 3HDJA 1YJQA 1G1AA 3GFBA 4PG4A 4BO3A 3RJ9A 4BNKA 3GFGA 2O7SA 3FNEA 1I0ZA 2FR8A 2NLOA 2EKPA 2P5YA 3UVEA 3F9IA 4BMVA 3TN7A 1PZGA 1UDBA 1NR1A 1ULSA 1CYDA 1OOEA 2I3AA 4RV9A 3MJTA 3SEFA 2J5RA 3SVTA 4FCCA 4PG5A 5TIIA 1GU7A 4OMUA 2ZKLA 4K1LA 5JCXA 3UOGA 1HRDA 5IDWA 3OQ6A 3WQRA 1T2DA 1DIAA 3FPLA 2B36A 4I5EA 1Y81A 3P2YA 3BYZA 1OC4A 4FS3A 3FTPA 5B4TA 3H9UA 4B3JA 3ZWVA 4RVSA 1XELA 2GN8A 4BNXA 3GQVA 1F17A 1P33A 2O23A 4KQXA 3V8BA 2J3JA 3JQBC 4NR0A 5CDTA 4JP3A 4XDYA 3TSCA 3RU9A 5B1YA 5CDYA 4WLOA 1LEHA 3GC6A 1FDUA 4D79A 4IDDA 3TFQA 1B26A 1E7YA 4J1SA 5CDUA 2ZJ0A 4R51A 2A35A 5HS6A 1R12A 4ZQGA 2OL4A 1MG5A 4GAEA 2PV7A 1Q0LA 2Q4BA 3GA0A 4XJTA 1T2CA 5B4UA 3TZHA 1K6IA 3WBFA 1B0AA 3DB2A 2C82A 3UHAA 3DZGA 4L0QA 5THQA 4YBZA 3WTBA 5JXWA 3TOZA 1PSDA 2QG4A 3DTYA 2JJYA 1TEHA 2BFPA 3JD4A 4LSWA 2W90A 4ALKA 2O50A 1JA9A 4C7KA 4BNYA 3JV7A 3Q2IA 1A72A 4IIUA 2H1SA 4PN3A 3MJSA 1ZK4A 2I67A 2X0JA 1CEQA 3MZ0A 4RJTA 5ENDA 2VZ9A 1ZFNA 2YV3A 4HWKA 5C3MA 3QWIA 3WIDA 1NYTA 1FDWA 4KUEA 1DLIA 1BVRA 2CUKA 1KERA 2PR2A 4CR8A 3ZU4A 4YT4A 5KVVA 1NQTA 1R0KA 3EZLA 2EGGA 3KOUA 4DLBA 3ITDA 5HM8A 2X23A 3BMOA 5HS4A 2ZB7A 5EQDA 1LRKA 3D5QA 4XQCA 1H6AA 5DBIA 1P44A 2J5QA 4A10A 4IMPA 1DB3A 1C0LA 2Z95A 1OAAA 3PHIA 4I9HA 4KDFA 1BGVA 5KIAA 2UUOA 4B4UA 4E6PA 5EPOA 3UN1A 3PFWO 3QJ5A 2Q50A 3HFGA 4PZDA 2QZZA 3E03A 4KTTE 1JKJA 3AWDA 5AXDA 1HYEA 1ZKMA 3PHGA 2AG8A 3ZWAA 3U4IA 3K96A 3WBBA 1YQGA 1E7RA 3I9OA 1W73A 4QFDA 3EGOA 1PJCA 5U9CA 4Z3KA 2YFQA 4QTZA 1BRMA 1HETA 2D3TA 4ESOA 3TWOA 1LU9A 3RUDA 3ZNOA 3VZSA 3I9NA 4O6VA 1BMDA 1SBYA 5KNLA 5TGDA 2O3JA 1Y9EA 3QVWA 4UULA 1X7DA 3H7AA 4GMGA 2IRWA 2FZEA 3ZWYA 3QE3A 4IJWA 1JKIA 2J3KA 4W7IA 4QFCA 5ER9A 4TRJA 2ZCUA 1B8UA 2VNAA 3AUAA 3UCEA 3MJVA 1LNQA 4YA6A 2BGKA 2FR0A 3U4HA 5EINA 4EITA 2CZCA 3DEYX 5G0VA 2GR9A 3WNVA 3OF2A 1GV0A 3R6DA 1DXYA 3RC2A 3WNQA 3I6QA 1U1IA 2YHIA 1A4UA 1CERA 4GGPA 1GUZA 5A4DA 2X5JO 4E30A 3U9LA 2W4QA 3L77A 4MVJP 1ARZA 2V6GA 2NU8A 2GERA 1ZJZA 1R6DA 1LQUA 2F1KA 3A1NA 4G5HA 4ROSA 2IYPA 4NFSA 5BT9A 3T4EA 1JVBA 4XB2A 3HE3A 2NTJA 5F21A 2B35A 3VZQA 1YL7A 5A1TA 9LDTA 1DEHA 3VPHA 4I8XA 3FRJA 1LDNA 2J8ZA 4WE3A 3WYEA 1E5LA 3ZGYA 3ZV6A 1YVEI 2VRCA 1WAMA 4OSOA 2YJZA 3PQFA 1LLQA 3JQBA 4KUHA 4YXFA 2E6UX 5THKA 4ZJUA 4OKNA 2O3SA 1KY5A 3NDRA 4J1TA 1MGOA 4AJNA 1PZHA 3LLSA 2V65A 4PVCA 2IEDA 2EJWA 1LSSA 2WWRA 2O3QA 3G1TA 4R1NA 3OIDA 2E82A 3QVSA 1TVEA 2VNSA 5DULA 3RUFA 3VKVA 3WMWA 1NASA 1NTOA 2ZYDA 2A94A 1K6JA 2PZLA 4TKMA 4UAGA 3OQBA 5JFOA 4ILKA 1XU9A 4XYGA 3GZ4A 1O89A 4CM8A 2PWZA 2PKQP 2HU2A 3DZKA 1R4NA 3I83A 4BNGA 4CMHA 4MIOA 1R4MA 1U3WA 1Y8RA 4JJGA 1PL7A 2HK8A 4NU6A 4A7PA 1EFLA 1ADBA 2DT5A 3JQ9C 4WK6A 3OH8A 1ONPA 2HK7A 1XU7A 3RBZA 3ONFA 2EW2A 3VKUA 3W6ZA 3UCXA 3KBOA 2I5PO 3SC4A 5JDIC 2VHYA 4GKBA 5EQFA 2C0CA 3DHYA 4R5MA 3LYLA 5TS3A 4D44A 2VYVD 1PZEA 1HKUA 5CPFA 3ZN2A 1LDEA 3ANMA 3UFXA 3F4BA 3NTOA 1ID1A 1LTHR 2X4GA 4MP3A 4MVJI 1XIVA 1Z6ZA 4XWYA 3R3JA 1KS9A 4D3DA 3OICA 4TQGA 4IY1A 4AJLA 2VOEA 2Z1NA 1DO8A 3BMQB 3ZW9A 4YYZA 3R3SA 5C37A 1P1HA 2DAPA 1U3VA 2JFGA 1XHLA 3GG9A 4WPGA 4IZHA 4NI5A 5CDGA 3PZBA 1VKOA 2PTGA 4LW8A 3MTGA 4BQPA 1AXEA 3GAFA 4WEQA 3DBHA 3IKTA 1VC2A 4E0BA 4RF2A 4I08A 1ZNQO 1IOLA 1TA4A 2CNBA 3NTRA 2DVMA 4O5OA 3Q9UA 2D2IA 1KVRA 5A05A 3KUXA 4BL5A 3GVIA 2OZPA 1E7MA 2GCGA 2ZB3A 3RKUA 1W6UA 1FMCA 4YAIA 1LSOA 2VQ3A 3ICCA 5I7VA 3CSDA 3E8XA 4W7HA 1XQ1A 3RASA 1B16A 1QYDA 4MKRA 2C20A 2Y1EA 2AQHA 4G2NA 4RPKA 2PLAA 1UP4A 4HV4A 4RVUA 5B12A 3L9XA 4MKXA 3E9MA 5F5LA 5JC8A 4U7WA 5DF1A 1MLDA 1NX6A 2OFPA 1PQPA 1PTJA 2JHGA 4CM7A 3I23A 5DCYA 4BVAA 4XIYA 3A4VA 4ND4A 3QV1A 3DBRB 4E12A 3H3JA 1E5QA 3DTTA 3FI9A 3AY3A 3QA9A 3WB9A 5ADHA 5JAZA 1HTBA 3ROKA 4YJGB 1XWFA 1ZO8A 2VYVA 3ADOA 4H15A 3AUSA 4PLTA 3F5QA 4DQVA 3OJOA 1N92A 1EVZA 1EK5A 5KVCA 4CQMB 3PWSA 2B69A 3EAGA 4YT5A 4B4VA 4Q39A 1QLJA 5JPIA 3EVNA 3GN2A 1ZH8A 3OA2A 3GF4A 4IJKA 2VHZA 3U4DA 2HJRA 4J9UE 4NG5A 1JDJA 4YWJA 2B0JA 2NU6A 1DJNA 1XEAA 2XAAA 2J6IA 5GY7A 1GPDG 3O8QB 4WLNA 4Z0HO 1Y5MA 4URFA 2W2LD 5ITWA 3FR8A 4XQ9A 4KWIA 3GMDA 4XJSA 4ID9A 4NNJA 3DFUA 3ZWNA 1VL8A 1ONNA 1OMOA 1U9JA 1UP6A 2ZQYA 1U3TA 4UVHA 4WCFC 1MA0A 2DUUA 3TOXA 4DYDA 4EUHA 3C1TA 1M76A 3KVOA 4FOSA 1KVQA 2C7VA 4MDHA 4P22A 3VVBA 1KC3A 1C14A 4IUYA 4QO7A 5KJ6A 4A5OA 3JCZA 2VHVA 3L4BA 5KWEA 1VJTA 4J7CA 4LCJA 2I9PA 3AY6A 3GNSA 2PH3A 3WDSA 1Y7TA 1B7GO 2VN8A 3A9WA 1SC6A 3QWBA 1E6EA 1PWZA 4ZVVA 3E9NA 4EW6A 1U8XX 3KSUA 1RPNA 1XQ6A 3ULKA 1SB9A 1QMGA 1U28A 1PR3A 1DSSG 4YVFA 1KBZA 2CDAA 4JBIA 3JQ9A 4X54A 2R00C 4A0SA 1DLJA 3PJFA 1VSUA 2DKNA 1T2EA 2NM0A 3QVTA 5JO0A 3EC7A 3GNQA 3BTVA 5C7LO 4FPXA 5JDIA 5KOIA 1QR6A 5A3VA 4PLHA 3RBVA 3MWEB 1RYDA 1TXGA 1FF9A 1M6HA 5COAA 4W99A 4CMCA 4P4NA 1H5QA 3W1VA 4CM5A 2OBYA 1YRLA 5AVOA 3VTFA 4B4OA 2PH5A 4LISA 4BKQA 1KVSA 4YEDA 2RAFA 4CL8A 1ZZEA 2YV1A 4JXKA 4QO8A 1WMBA 2YDYA 1P45A 3JQGB 4RO0A 1MP0A 2WMDA 1J5PA 3E82A 1WLYA 4R9RA 5JCJD 3JQ7B 2WJPA 1CF2O 4FOOA 3WWZA 2YYYA 4ZHSA 4Y9DA 2C2YA 2BFOA 3HNPA 5AQ1A 2B5WA 4CLOA 1AHHA 3F47A 3GHHA 1Z74A 2P2SA 3PFFA 4S1VA 1MFPA 2FN7A 3NGLA 4O63O 2A92A 1CWUA 4PRLA 3WG9A 4DIBA 4GX0A 4F46A 1F06A 3D4NA 2BF7A 3ONEA 2PA3A 1IHXA 3JYQA 4BO4A 5KKCA 2AQ8A 4IDBA 2VUSA 5HA5A 1NQOA 3GLQA 1C1DA 1JKFA 3NJ4A 4D46A 4QQRA 3GDGA 1HE5A 3L9WA 4BKOA 3NEPX 4LRSB 3ITKA 3ZCXA 2DPHA 3WQQA 4QXMA 7MDHA 1HDCA 3ZV5A 1EVJA 4DTIA 1NAIA 3GNTA 1JAXA 3LSYA 3GUCA 3T7EA 3VDRA 1ADGA 4DA9A 5A9RA 4MVJF 3ADPA 3PHHA 4MINA 4CM6A 5JAIA 1QV7A 3BA1A 4CMAA 2XF8A 1V3VA 4XIJA 1DRUA 2JFHA 1YKFA 5AXCA 1X1TA 3NTQA 4CM9D 5LDGA 2GNAA 2C2XA 5L51A 3ENNA 3Q3CA 1LJ8A 4OJNA 5JAQA 5G0WA 4FGWA 2GN6A 2DTEA 1UJMA 2WYUA 4JJIA 1E6WA 3NV9A 2Y05A 3VH4A 5HRUA 4XR9A 2G17A 2HMUA 1P1FA 3C1AA 3F1LA 1PJ3A 1PL8A 3GK3A 4Z9YA 4B8ZA 5I7FA 3IP3A 1PGJA 2FP4A 1DIGA 5ICMA 3WICA 1HDRA 3HZZA 2VUUA 2WTBA 1SAYA 1XR3A 2Y99A 4M54A 4DC0A 4W4TA 2GO1A 1T26A 4AJ1A 1YB1A 1YB4A 1E1LA 4BNIA 1X13A 3ICPA 4E4YA 4IM7A 3K6JA 1ZMOA 3JQCA 2C54A 4ONEA 4BB5A 1DBVO 2EXXA 3VOSA 4MIYA 2VYNA 4D3FA 4L9RA 3PPIA 4H3VA 4YJHB 3I52A 3WSVA 1XYGA 2WDZA 1HDZA 2GGSA 4JGBA 1U4OA 3W8EA 1AXGA 2JCYA 1ZXBA 3RSHA 2O4CA 1KEVA 1GCUA 3DZBA 4RF3A 4RZHA 1G6KA 5TRTA 3ZHYA 3F6YA 2OORA 3INTA 1SPXA 4YT2A 1V3UA 2Y1GA 1X7GA 1QYVA 3BTOA 1DC6A 1NNUA 1T1SA 1T4DA 3WGTA 1C0IA 3TJRA 3GGOA 2EGHA 4J16A 1P0FA 3D3WA 1PIWA 2EKLA 2HMVA 1A7AA 3UKOA 5EJ2A 3RROA 1D3AA 3BAZA 2EIHA 5BNTA 5IN4A 2PZMA 2R6JA 4WGGA 1C1XB 4J1QA 4CV0A 4OQZA 3GEGA 5JC1A 1GEGA 1X14A 5DT9A 4AL4A 1ZK1A 5ILOA 3I9KA 3NDIA 4FGSA 2BFMA 2H9IA 5EIOA 5CG2A 3IMFA 1S6YA 4YAEA 1M6WA 1IPFA 4CM9A 5DCUA 2HK9A 4GH5A 3OSUA 4YJFB 2IXAA 3MOGA 3L0DA 3V1TC 4OXYA 5DDIP 2ZTUA 1GPJA 2DLDA 3VPXA 5AOVA 2RBEA 3BHMA 4BO6A 5JDCC 3ZV4A 3RCBA 1KETA 1ZK3A 2Q2VA 4BO8A 4U6QA 3DXFA 3QY9A 4YR9A 2GLXA 2VUTA 4NIMA 4QX6A 3RI3A 3IUSA 4UUMA 3T7CA 3HB4X 3FSRA 2Y1OA 1Q7BA 1DFIA 1NPDA 1J4AA 4PLGA 4J90A 4CMEA 4G81A 3V1YA 3LLVA 2W98A 3ETGA 3RUCA 1YO6A 1NWHA 2C29D 1IHYA 2O48X 2I3GA 3IKVA 5TC4A 4Y98A 1XA0A 1ZUD1 2GZ2A 4WUVA 3OMLA 2PKQO 1DC3A 4Z0PA 1F14A 2A9FA 1K0UA 3ETEA 3H2SA 4U0JA 5FYDA 3RIHA 1ZW1A 4S3MA 1V9LA 2G76A 1UXJA 5CEEA 3JQ8A 3NAQA 1UZLA 3KO8A 4NHEA 1U5CA 2NVUA 4M86A 3P19A 3RU7A 4DXHA 1YB5A 2AE2A 5A9SB 4TRRA 4YAGA 4MVJG 3VH1A 3FPCA 3UICA 1HDOA 3DMYA 3E6AA 1ZIDA 5G2OA 1A7KA 3CMCO 1Z75A 4ZICA 2ZYAA 3DHEA 1WDKA 1KVUA 1R15A 1B3RA 1KOLA 1A9ZA 1QG6A 3ROMA 4IJUA 4BGVA 4GVXA 3O38A 1BXGB 2YV2A 4CMJA 5JYDA 4YDRA 3WJAA 3WYCA 1LDGA 3F1KA 4R5HA 3ZWPA 4UREA 1FXSA 3PZRA 2B5VA 3TZ6A 5JS6A 1YL5A 2NV6A 4ALNA 3DZIA 2FPIA 5IFLA 2ZB4A 2X86A 1AGNA 1H2BA 2WSBA 4DBVO 2AHRA 1NHWA 3PQDA 4IXWA 3CH6A 2EWMA 2EW8A 4IGEA 4B4WA 3JQFA 3HSKA 2OMEA 3S55A 4M8SA 4M1QA 2BD0A 5DBFA 3CPSA 3DBLB 3KEQA 3A28A 1ISGA 1HSOA 3H3FA 4GQAA 4JIGA 4FJ2A 2OP1A 5L40A 4WLVA 1PU2A 5GZ1A 2WYWA 1F8GA 3D64A 4EJ0A 2G82A 2VZ8A 4JQCA 4PLFA 3OM9A 4ZQBA 3IDSA 4GGOA 3ZHXA 3KYCB 4R1TA 1ULUA 4G65A 3E9QA 5L4LA 3BZUA 4FBGA 3WR5A 3G17A 5DNAA 4JLWA 4L73A 4R68A 1Q0QA 3G1UA 1YXMA 3C7CB 4ZQEA 4A2CA 4L4XA 3H5AA 3MEQA 2HQ1A 4PLCA 2XXBA 1X15A 3F4LA 5KJFA 4WEOA 2W8ZA 1C3VA 2YY7A 2GZ1A 1WW8A 4L76A 3ASVA 4HKTA 2YQ5A 4C4OA 1CQJA 1SOVA 1CRWG 4BKPA 3PYMA 5MDHA 4RCVA 3ZWOA 3VH3A 2JD2A 4GSKA 3WGIA 4QECA 2GSDA 1OZAA 1GD1O 3K2BA 3ZU3A 1CDOA 3QIVA 4PLVA 3JYOA 3ZNQA 2JFFA 1NQ5A 4U5QA 1M75A 2JL1A 1GZ3A 4J7UA 4WKGA 3LDHA 1WVGA 3JTMA 4ZA2A 1Z45A 3W4JA 1HEUA 1DRVA 2YHIB 4AG3A 3D4PA 4MVJD 2I99A 4D45A 2AEJA 2I65A 3DHNA 1Q7GA 4DQUA 4TRMA 3GEMA 3IOYA 5TX7A 5JDCA 3IC5A 1HZZA 4HXYA 4IZIA 3LC1O 2CVQA 1WPQA 1PGNA 1HSZA 1QV6A 3CMMA 1KEUA 2ZQZA 2NTVA 3MJ4A 1EDZA 4HFMA 4XYLA 1N7GA 3W8FA 4JBHA 3A14A 1WZEA 4YTEA 1H2HA 1E1KA 2EF1A 1O0SA 4BGUA 4LVUA 2V7PA 1W4ZA 4E32A 4PZEA 1XGKA 5L95A 1DC4A 2ZJ1A 4LMPA 4W9NC 4FD3A 2Q2QA 3VPGA 4DWVA 1Z82A 1MX3A 1N9GB 1I2CA 5AYVA 1D1SA 5EERA 3BIOA 4LRTB 3LT2A 2G5CA 3W8DA 4YJDA 1HWYA 3EMKA 3S2FA 4CM4B 3TNLA 5CFZA 1LRLA 1DPGA 4BNZA 1N8KA 3OQ1A 1T4BA 8ADHA 2FOIA 2J5KA 3GT0A 4FFOA 4DGSA 3K5PA 1VSVA 3WSWA 2OHXA 5JYEA 4RZIA 3GG2A 5L9AA 1PGOA 4J9VA 3U49A 4CUJA 2GD1O 1HDXA 2DQ4A 5EMHA 3RC1A 1W8DA 4D43A 3FWNA 3RFXA 4EBFA 5IF3A 4TVBA 1P31A 2H6EA 1HL3A 3BMCB 4NH4A 4R3NA 2DUWA 1X0VA 1LX6A 1VE9A 2CF5A 3AUUA 3EW7A 4UEJA 4NFHA 1T2AA 3PLRA 1TT5B 3G0OA 8LDHA 4DREA 4FB5A 4K28A 3HDYA 3L4BC 5HWSA 5HTOA 1LSUA 4D0RA 4UUNA 3FNGA 3KEOA 4B79A 1QYCA 4XR4A 4Z9FA 1Y5RA 2NWQA 1RKXA 3K92A 3NRCA 5I7EA 4ZQHA 2QIOA 2D0IA 4MVJA 1VKNA 3GZNB 1ORRA 4I5GA 4ND3A 1ENOA 3WGZA 1XLTA 2B37A 2YUTA 1ZK0A 1P9LA 1FK8A 1O94A 3GRPA 4UEOA 4WLEA 1KVTA 3DDNA 4IDCA 1E3JA 2Q1WA 3JQAB 4YB8A 4YAKA 1LBEA 4CODB 3UW3A 1A27A 4Q3DA 4XCVA 3OECA 5IDYA 4IQGA 5K6AA 5KJCA 4W6ZA 3WS7A 1NQAO 2BFAA 1U2DA 1ENZA 5K9ZA 4IGFA 4ZN6A 1BDBA 1DIBA 3M1LA 3GGPA 2CD9A 1IY8A 3ONDA 3SLGA 1V0JA 4DQXA 1WNTA 2DPGA 5CAEA 1E3EA 2Y0CA 2ZCVA 3RC9A 2XPCA 1H9BA 4GX2A 3FBTA 2C07A 3B20A 4ALIA 4B7CA 5JLAA 1VRWA 3EVTA 4GLOA 1EDOA 1RM3A 3OIGA 4CUZA 2UDPA 4HUJA 3QLJA 3SJ7A 1CIVA 3B1FA 4OM8A 2Y93A 5IXSA 4DMLA 2CF6A 3B70A 3OJ0A 4QSMA 2OGUA 3CINA 1EVYA 4TROA 5C7OO 3ZWBA 1T25A 4LMRA 5DP2A 3TF5A 5FI5A 3OFSA 1O8CA 4WOKA 4Q3NA 3L07A 2HSDA 1U2GA 3VDQA 1B8PA 5IAAA 3D3EA 3QWFA 4TSKA 4OAQA 4WECA 4HY3A 1UUFA 4E2ZA 3H4VA 4TWRA 4EJ6A 3IIEA 3LC2O 4AJOA 2Y1CA 4CMIA 4J3FA 3GR6A 1LUAA 1VM6A 4JBGA 4FQ8A 4P8RA 3WGGA 4BO1A 3NGXA 5I9NA 1B3BA 2Q1UA 1UP7A 1I3MA 3PYXA 3JYPA 4CQMD 3DAPA 4M87A 4HBGA 1O5IA 4PRKA 1YWGO 2Y1FA 4R1SA 1EUZA 1EE2A 3EHEA 3UGKA 1VJ0A 1I2BA 5JMPA 1DFHA 1DFGA 4XYMA 3TQHA 3GUYA 2DBQA 4I5DA 1K89A 3BMQA 4LGVA 4NJMB 1R16A 3OETA 4XDZA 3O4RA 1VL6A 1O6ZA 3NYWA 4PLYA 2HCTA 1KY4A 2JAHA 3C7DB 4XYBA 2IE0A 1MG0A 4MVJM 2X0IA 3JQDA 4FC7A 3D4OA 4W9NA 1IL0A 2G1UA 3WFJA 1XDWA 1DHTA 4L4SA 4RVDA 4DIOA 1TI7A 1AE1A 3AM3A 3BMNB 1IZ9A 4RL6A 4RDIA 1PWXA 1HZJA 2BKAA 3S2GA 4B3IA 4XKJA 1E1MA 4IDAA 2BGMA 4B8WA 3PTZA 1NBOA 3G49A 5U4QA 3GPIA 4XQEA 1KC1A 4I9UA 1PJBA 2GASA 4UUOA 2ZYGA 3QP9A 3KB6A 4A27A 2X1HA 3U62A 2D4AA 3CTMA 3NT5A 4A03A 2LDBA 4WJZA 4LN1A 5T67A 3G3EA 4N5LA 1PQUA 4RQTA 4LCEA 1HE4A 5FI3A 1GQ2A 4CV3A 3ORFA 4PCVA 3AFMA 5T5QA 1ONOA 1JLLA 2ET6A 1I33A 1ZVMA 4II2A 5T8KA 5KTKA 3FNFA 1B2LA 3QQPA 2QRJA 3IJRA 1WXDA 3QRWA 1JWAB 1SZJG 3JYLA 1BXZA 4E3ZA 1CQIA 4NJOA 5G0TA 3SJUA 3CE6A 2O2SA 4YJGA 1PR9A 4O59O 3S1LA 3JD2A 3F3SA 1BG6A 4RVHA 1UXHA 2O7QA 3B1KA 5TT1A 4CQMA 3WQSB 3KYDB 4E2XA 5KVSA 3TL2A 2HKIA 4DYVA 3C3XA 2WE8A 5BNIA 4EZBA 2WEKA 4CLEA 4Y6SA 2ZIZA 5A5FA 4E5YA 4IS3A 2HDHA 4P4LA 1PGQA 5LC1A 1EEHA 1YBMA 5KCZA 2FMUA 3O8QA 4OSPA 3UF0A 3X2EA 3DFZA 1SMKA 3EZYA 2C5AA 9LDBA 1K2WA 4INAA 3PEFA 1DDOA 1IB6A 2XXJA 3GVHA 2AMFA 1E7QA 3PXXA 1Q1NA 3V2UA 2AQKA 3M1AA 1I36A 1JU9A 1GDHA 3KLPX 5DP1A 3OBBA 3LF1A 4NZ9A 3VAZA 3B6ZA 4DIFA 2Y68A 1E3WA 1H9AA 2QQ5A 1GV1A 2CVOA 1AHIA 5ICSA 3CKYA 5A04A 1T1RA 4BO0A 4CMEC 5CEJA 4RVFA 5EESA 4BV8A 2O3TA 2WD7B 3BTUA 3WGOA 2D8AA 2B83A 4NBRA 3MJEA 3PVZA 3Q11A 5G0SA 1E7SA 1PS9A 4MKZA 3TL3A 4E5NA 2W2LA 2RCYA 2DFVA 4YQYA 5KJ1A 1ADFA 2GZ3A 3SX2A 4R16A 5JO9A 1S7CA 3DAGA 1I01A 2VWHA 1HYHA 3EY4A 3BHJA 1NVTA 1QYXA 3L6OO 1C0KA 3GGGA 5FF9A 4CLXA 4PG6A 2AEFA 4PVDA 4BNTA 4J0FA 3JYNA 2Q49A 4UEKA 1QRRA 5JE8A 2HAEA 5I8ZA 2QRLA 2X6TA 2ZTMA 3LK7A 3LZ6A 1T2FA 2OXIA 3V1UA 2UVDA 5IZ4A 1GYPA 1JW9B 4KUGA 1OI7A 2V6BA 4GMFA 5GMOA 3P7MA 3ZWCA 4EDFA 5C5IA 2WM3A 4YRAA 2YZ7A 3JQGA 3WTCA 3GOHA 5IDXA 1GYRA 1ADCA 2EG9A 3PGXA 3JQ7A 1V3TA 2Z5LA 3DBVO 1VPDA 2NTNA 4F6LA 2C7GA 1I8TA 1GR0A 1XG5A 4J49A 5G4KB 2FHSA 2RH8A 1IYZA 3ZDFA 3PDJA 2AA3A 1X1EA 1HLPA 4EEXA 2OP0A 4EUFA 4M55A 1GFSA 5H82A 4GKVA 2VWGA 1LDBA 1YOVB 3O03A 3PHJA 4R4JA 5FEUA 1SB8A 1ZSYA 4BIIA 4KZPA 4NPCA 3V2GA 3P2OA 5T64A 4BHTA 3PJGA 2SCUA 3JQFC 3KM0A 1QYWA 2Q1TA 3LT0A 4XGIA 4F6CA 4I9NA 1MV8A 3HDHA 2DBZA 4WCFB 5IZCC 1X0XA 1NPTO 2PGDA 4PIVA 3ZI0A 4AJPA 5JCJA 3A06A 4DBZA 1NVMB 3AW9A 3QSGA 2DU8A 4CJXA 4MP6A 1BW9B 1EQUA 1N5DA 3FD8A 3VZPA 4DMMA 4CLRB 4IDEA 2NUAA 4NBVA 2X0RA 3E5MA 2WYVA 3PJDA 1JWBB 3PQEA 3ROQA 3GN1A 2UV8A 2GDZA 2GPTA 4MOWA 2J3HA 4ND5A 4RPLA 5CP8A 1J49A 1A71A 1ZMTA 3C7AA 3GHYA 1LA2A 4Q3AA 5DZSA 4BO2A 1R66A 3H5NA 2I66A 2VTEA 2NVWA 4EI2A 1JN0A 2JD1A 3UCFA 4BNWA 5LDHA 4ZU3A 5CDSA 2D59A 1EVIA 4ZGWA 3EDMA 1ISMA 1EFKA 4I1IA 1A5ZA 1EQ2A 1I30A 3N74A 3Q0EA 1FDVA 4OIMA 3WJ7A 1ISJA 3DO5A 4BNHA 2ZTLA 4H7PA 4CQLA 3I1JA 2BMAA 4NBWA 2P5UA 5L4SA 1U5AA 4OOEA 1Y8QB 3O9ZA 4CR7A 4FJ1A 2E48A 4HFNA 2TMGA 4FFRA 4PZCA 1GUYA 1YDEA 2NQTA 3LF2A 6LDHA 2AEMA 3PDUA 5EL0A 5JBIA 4GL4A 5JNLA 3KHUA 1WZIA 4YACA 4Z6KA 3Q2KA 3JQ6A 5F1PA 2UAGA 1WWKA 2ILTA 3S2EA 4BS9A 4E33A 1PJLA 1AUPA 1FJHA 1Z7EA 2X5OA 2PD3A 3H9GA 1YDWA 4C7JA 2W2KA 2F00A 4RLSA 2NQ8A 4RPJA 4UVDA 2I76A 1RM4A 1YJ8A 2NACA 4XRRA 1HT0A 3FN4A 3VH2A 1T24A 3AM5A 1OBFO 1YGYA 2FPGA 4Q9NA 1E0DA 2DBRA
chains in the Genus database with same CATH superfamily
4FW8A 5KHOC 4E7OA 4KMSA 2PLNA 2GM9A 2JBAA 5AOBA 1AZLA 3CXRA 1DARA 2JJMA 4ZU1X 4ALMA 3B1YA 1N2SA 1KEPA 4FE7A 5AM1A 3ABZA 3ENKA 3QX7A 2ILVA 4FQ5A 5DEOA 3T12A 1SN7A 1SIWA 3G5TA 5AI6A 4TS4A 2ASVA 5JR3A 2ZCJA 2F4NA 4MB2A 3GJ3A 1UBUS 2BEWA 2G09A 4YRJA 1XCJA 1ST3A 1V48A 1IJBA 5BQPA 3KQKA 5AESA 5CLFA 4FQ7A 4GWGA 4V0KA 3RSFA 4AZ0A 5EJGA 2ZUFA 3RK1A 4YC7A 5EIXA 4H27A 1M67A 3NT4A 1U7TA 4G5YA 5JAMA 1E1NA 1V4BA 5DASA 3T9CA 4OK6A 5EJ4A 2GI4A 3OEYA 1RWMA 2OC4A 3O0TA 4HEHA 1X74A 1SVLA 3HYSA 3OZSA 4I6JA 4BQIA 5A0TA 5LQRA 1LLCA 4LRWA 2I80A 3AVQA 3SOPA 1WF3A 3BTSA 5JT1A 3DF9A 5K3AA 4HFJA 3L7KA 1RPJA 5I4BA 4DJAA 3KK0A 5KSWB 2RHRA 3K0CA 3AHGA 2PFGA 2Z6AA 1NVAA 2JCSA 2BFDB 2QK4A 2ZWVA 3KTDA 3EB9A 1XC7A 4ZRNA 1N5KA 3ICVA 3QEKA 1RZRA 3C87A 4OH1A 4AUKA 4PZPA 4D02A 2FPIB 3QU4A 3BXEA 5EIBC 2NPFA 3ROTA 5AJWA 5I9IA 1Y3CE 5CDHA 1BXRA 2YYZA 3B48A 3DGEC 3GW8A 5BWCA 3BSSA 1YB6A 2WPDA 4ZO8A 4Q4CA 1Z6YA 3ODGA 4EJMA 3A31A 1U3FA 1UEXC 4ENQA 2A7XA 4J6EA 1NSTA 1O96B 4MP8A 1NI4B 2ZI7A 3LKBA 3WRWA 4BFCA 1JAHA 3DVSX 3WGYA 4IBOA 1K6XA 2UKDA 3UJ7A 3FOFC 1L4EA 4MKFA 3I3OA 4XD2A 1WE2A 1KMNA 1RI5A 4LZNA 1N4AA 3B5JA 4F5ZA 4AJJA 3NBKA 1E5VA 4DARA 3WIUA 1XKXA 2GWRA 2X2OA 3GVPA 5JJCA 5LSAA 4BX0A 1JDUA 1PFYA 3AG5A 3BERA 2A5JA 3PD7A 4URXR 2COUA 3R3UA 3IB6A 5B1DA 3NTVA 4NWIA 1N77A 4UUQA 1HG0A 3OM0A 5BYKA 3HWRA 2IYRA 3BXOA 5BO5A 3HXTA 4DIBA 1Q92A 1DO0A 5HK9A 1U7HA 1Z56C 1TJ5A 1R50A 1VBFA 3QF4B 4GNRA 4HYTA 1E6UA 3AOEA 4QYWA 4HFRA 3U31A 3IO3A 4AJ2A 3HYCA 4FWTA 5LQDA 1HYGA 3IUPA 3FFAA 1ML4A 3PQ4A 2QTTA 3NC1C 1N1EA 1R0SA 3PQ7A 2Q3EA 4WXPA 1AS0A 1PS8A 1T2UA 3OQPA 1SVSA 1X7YA 4US1R 3RIXA 4EVSA 3AF5A 1F4VA 4WOCA 4N5IX 3LT4A 3HADA 2CVFA 2OZVA 3DCYA 4KX3A 1R6AA 1U2DC 3HEMA 2J67A 1D4FA 4L5CA 3R7FA 1KTIA 4U2BA 1OA0A 2I6TA 1BIFA 3LLUA 1EK1A 2C83A 3FWYA 3NRBA 5LVAA 4RGYA 4ZT4A 1CQJB 5ALLA 5TARA 1NSYA 2CFRA 1VP3A 3L8GA 5IAGA 1Q19A 1N78A 1QONA 3LQ4A 16PKA 3K70B 5ILQA 3KJNA 1XQVA 1NF3A 1CT9A 5FI0B 1XPUA 1Q91A 2QX7A 1J56A 3F96A 1UL1X 4EJSC 1WMDA 1EZ1A 5ITZA 2G1KA 2TMYA 2ADMA 2ZAYA 1PJQA 1OXXK 4QDOA 5FORA 4F86A 2FG6C 5ETJA 2J9YB 3FMVA 5DBHX 4IGIA 1L9XA 3B38A 4BP3A 3TX2A 3TR0A 3HXPA 4XM2A 1P18A 1PYGA 3H7IA 4M8KA 2BJVA 1KI3A 5BP7A 2ZPAA 3COSA 5AK5A 6AT1A 3AONB 3RFCA 3ER9A 3LX8A 2X4LA 1LJUA 1UMBA 1QF7A 2Y0EA 2FN4A 2FXIA 4ARZB 1W47A 1U2TA 3VHXA 4B6FA 3RADC 4OUDA 3MJFA 3NIGB 3GLIA 1EI9A 2F8LA 1VJ1A 2ZJFA 4B45A 4H1WA 3N6VA 3ET4A 4DMKA 5BUZA 1SO8A 1JFLA 3NZEA 3GLKA 1CUYA 4E31A 3KRTA 4NV3A 3ZBQA 5HMMA 5HQ3A 1KEEB 4E22A 1CR2A 2IYUA 4OLFA 5HHTA 2J48A 4R8KA 4QSHA 2WNHA 1F6WA 1NBAA 5FBRB 4YQEA 5BMVA 3E1SA 3M3DA 5H9WA 4KQ6A 4KMOA 4Z7JA 3KKKA 4J2OA 4R3UC 4TT3D 2XITA 5H02A 3WGLA 1N3IA 4ZDJA 1IHPA 5DHFA 3RG8A 4PNEA 4PW0A 3T06B 1MJGA 5AFSA 3V46A 2QRHA 1E3TA 3QXGA 1UDAA 4PS1A 3C24A 1R0BA 3CX4A 1H0KA 3M1IA 3OX4A 2Y6UA 3Q3GE 4RL4A 4WZBE 4YFYA 1KXZA 3K1AB 4OJTA 1KMQA 3L6BA 2PV0A 3Q7RA 2AD1A 1PJTA 2PGJA 1BJRE 3D0OA 4XGNA 4YJKA 5JNTA 2IBTA 5J4VA 1E2DA 2HMSA 3H04A 4TLCA 3VUEA 3F4KA 1BHO1 1L5HB 3PENA 4QLBA 2HCRA 1EFCA 4JVMA 4Z4GA 5LQCA 3CO0S 3AR6A 5DRTA 4BUJA 3VC7A 1A2BA 1NUTA 1P3DA 4F8YA 4OQMA 1EVQA 5CM8B 1CULC 3E2PA 3DR3A 3QG1A 3MGGA 3ZHTA 3HHPA 1CUHA 1LVGA 4HAWA 4CR6A 1OGIA 3RIYA 5C8VA 3UXYA 4LHWA 5L4NA 4H0NA 1F12A 3H9QA 5EJ8A 5CT5A 2FFBA 3T3PB 2BMWA 4IINA 4TZKA 4Z9XA 5EUCA 4DXDA 1B41A 3V9PA 5CEFA 1XXHE 1VI2A 2VUHB 1SQGA 3D6HA 3UK1A 1M0TA 2CLKB 5E6RA 3TLZA 5BV2P 1Z07A 2QEQA 1VZ3A 2QNRA 4MGIR 4HUQB 3WJ2A 2I1LA 4DC1A 2YW2A 2V7WA 2FWNA 4Q3EA 2C2KA 2GJ9A 2CL0X 4KXXA 5C52B 4FYWA 1JL3A 2VL7A 3FPEA 3ZDXB 1FMTA 1YBFA 2RJNA 4X84A 1JVSA 2C03A 2H8KA 4N0MA 3UH1A 3W34A 2I8CA 1PUJA 3DQZA 4FD2A 5DM60 4D41A 4Z0NA 1QE3A 4XRGA 3WK7A 5EWJB 1OR8A 1NM5C 4IHJF 4QYIB 4BFXA 3GJ0A 3UQYS 2UZ4A 3OEEA 1ZBQA 2QAGC 2Y2UA 1EFRD 1R4NB 2A0WA 3AEZA 3TZQA 4FB4A 4YI5A 1IXKA 2EKQA 3JVUA 1ZRNA 4AG5A 5JPDA 2EV9A 5CCXA 4A36A 2WFAA 2RHOA 4UM5A 3R7WA 2VK1A 3FKSA 5T8KC 4ZYWA 1BHSA 1ACMA 1DAEA 3I6YA 3PP8A 3SBOA 4RDHA 1E5DA 4Q3CA 1BVYF 1P0PA 4X94A 5GM2A 1LI7A 2J32A 4P1ZA 5A0FA 4IF6A 3W78A 1OC2A 5CJJA 4S04A 3KZVA 3PRHA 4DJJA 1FS5A 3LHSA 2DR0A 1J8YF 3QA3E 3O26A 4KZKA 4KJZA 3MCTA 1T9GR 2YVUA 3ON5A 3QUTA 1OFIA 4Q34A 5B4VA 5JBQA 4JK3A 1FP4A 3GDOA 1ZR2A 2ZPTX 5EI5A 2GN4A 1M2OA 2AXQA 2ODAA 4J4BA 1YS4A 4MUHA 4EGCB 2C0PA 3IR5A 1XPOA 1ENPA 3IBYA 4J0CA 3JD1A 1M8JA 3AJEA 4Y9UA 3UFXB 2JD0A 4CM4A 5JAOA 4KTVE 3V8PA 2AG6A 3FGOA 1Q1ZA 4AICA 1VCOA 4N03A 4CEJA 2E4AA 3WX0A 3EWNA 4D4IA 1SIBE 4JJ8A 3VV2A 4MCIA 4OOFA 4FHCA 3D7KA 2YIJA 2YW9A 2CFCA 4PWYA 3G8CA 5AI9A 4L8FA 2XD9A 4OFZA 1ESCA 4WESB 4GPD1 2ORYA 3HP4A 4H59A 1CEXA 4R9NA 1ACJA 3JZAA 1RC1A 3CZPA 3EUWA 2AKYA 4AKIA 2FRDC 1J20A 2QT1A 3BMCA 3NBQA 4R41A 3UV7A 3E7WA 2OQ2A 2HQOA 2VF2A 1ZX1A 5MF6A 2FMIA 4PQFA 2R47A 5B5SA 1Y6JA 3DBHB 3EGCA 3UV6A 1WCIA 4TL8A 4TZTA 3DCIA 2GPNA 4E13A 2WJWA 1TT5A 3R9IA 1RQPA 3WWYA 5LZ9A 4Z4QA 3PC7A 2F1JA 4EYQA 1G98A 3KDPA 4EJSA 2MMCA 2HIMA 4PCLA 3IEUA 1E92A 2GHQA 2N47A 2PSDA 1UXKA 1U2PA 4JROA 4WNYA 5F78A 1ZJ4A 3AP3A 2RHBA 2CMDA 4G0QA 5DCWA 3BQMB 3DT6A 3ND9A 1XROA 5FRDA 4ZD6A 3U7JA 1A5TA 1DADA 1NW5A 2QAIA 1BSVA 4X64B 1TD9A 3V4RA 5DX8A 4JJ4A 3GLGA 3VR1A 2GPYA 4B3CA 2EBUA 4XTCS 3WXBA 4R1MA 3T35A 3AI2A 3D6MA 2FN9A 1JHYA 3OJEA 4O4JF 5AVYA 3TLYA 3UMRA 3STHA 4A6DA 1OGYA 4F9GA 1IM8A 3KQHA 1QSGA 3ZZNA 4IDOA 3TSZA 4KXMA 2DEUA 1LXCA 3VVCA 4EF5A 3N75A 5DGHA 3HDGA 1LDMA 2WDPA 3NKVA 4LZLA 4Q48A 3WLRA 1GL3A 4R1QA 4RJ2A 1YMVA 4K87A 4AAYA 1SCAA 2UXCB 3M81A 4MVJE 2HO4A 4BXOB 1DUIA 3R3ZA 4JQYA 2EWVA 3G2PA 4J4TA 4UM9B 4QVKA 3PCRB 4CTNA 1SNYA 2O2YA 4HRAA 5HBGA 4LYAA 1G9XA 5DTQA 4EG1A 2YOFA 3LYAA 2Z56A 3WYFA 1JDBC 4NEHB 3VC2A 1B6RA 3HKEA 5FPKA 4UU0A 3AEYA 5C5DA 4TTQA 1UJCA 5FOTA 1UAYA 2CNWA 4XSHA 1E3SA 4OQQA 1D9ZA 3F0TA 1ZJYA 4GZMA 1FP2A 3CLUC 1FXWF 1QJ4A 1TCVA 3F5FA 2I2FA 4IGKA 3L79A 3CVOA 1VL1A 3CZ9A 3IYLW 4R8RA 3BWDD 2X8LA 1Z73A 2HLDD 3MCWA 5E1OA 5HGJA 3ESQA 4DSUA 3WIEA 4D7AA 2CXNA 1RMTA 4BVEA 1J0XO 1K8QA 2BL4A 1RHUA 1D4OA 1R10A 2NU6B 2RK6A 1VJGA 1L5NA 2F3TA 1CUAA 1E5TA 3LHDA 5JANA 1D9XA 4WHMA 2IYFA 3EMBA 2QRGA 3L4EA 2VF5X 4I36A 2J33A 5CTAA 2ZXFA 5EE1A 4XAQA 5GVSA 4ARBA 1XDUA 3ZXYA 4DC9A 3AK4A 1DX4A 1IDOA 2IYEA 1UZAA 1JLLB 4C6TB 3E4CA 2WILA 1QKIA 3O90A 2JLZA 3DXYA 2QQ0A 2NZ8A 1ISHA 1XK6A 2AWNA 2O8FA 3ESZA 3X2SA 1P3JA 3TW4A 3FF4A 1EBFA 2E6KA 2XOKD 4FFMA 1BWPA 1FNBA 2ZE8A 3DZCA 3OPXA 4GMKA 3T7AA 2VLBA 2ZRHA 3EXHB 2PNFA 4IEFB 4NZOA 1VGRA 3DNFA 2UUPA 3QPBA 1HE2A 1N0HA 2FDXA 3OLYA 1YUNA 2R7AA 4PQEA 3X2FA 5LFAA 3E1GA 5HIKA 1K63A 3B9RA 1NM5A 1DXOA 2OD9A 3FE2A 1WVMA 2P0EA 5LZ8A 5HF9A 4BNLA 3E15A 3NW9A 1VYUA 2FEXA 2I7DA 4NJMA 4BCBA 3TNJA 4CIWA 3OD1A 4L5IA 3TM4A 3TRDA 4B6JA 1COWA 1OROA 2ZPUA 4QAJA 1XAJA 3LVFO 1KYVA 4ACBA 3KQWA 1NP3A 2HJGA 1FMFA 4LQ4A 4WXHA 2GSWA 1ZUIA 4MICA 3UUWA 5KYYA 3DBOB 2QTHA 1KMIY 5I9MA 1GTRA 4QT4A 2V7EA 3LQQA 1AKQA 3K8QA 5FTNA 4NCBA 2R7NA 3BMNA 4RD1A 5DYYA 3FTNA 3RRNA 3IJPA 1D7OA 5TJ9A 3RYFA 5DU2A 5CNKA 3OBIA 3C6BA 4US0R 1FUIA 3DMTC 4JEHA 5G0UA 5DOZA 4ZWNA 4AZSA 1UBKS 1YI8A 4CF3A 4ZAFA 2PZJA 4TKVA 4G0UA 4EG3A 4JUDX 2OG2A 3ZJUA 3U4QB 3FHLA 4Q9DA 2R2GA 3M6IA 3GMSA 2A0KA 2GESA 2HCBA 2QVZX 3A1WA 3EE6A 3KQOA 2FY8A 3PFNA 5PNTA 4OXXA 3QXCA 4AJIA 4NRDA 1MB4A 3MS2A 3RVKA 2R0QC 1ZR4A 2Z1MA 3FZEA 4QPCA 4DVJA 5BNWA 1OXTA 1MRZA 2PKYX 3CUVA 2JBHA 1YE5A 5BSGA 3NNDA 621PA 4YAWA 3TTVA 1NHGA 4PLWA 1WRBA 4OXKA 4G8DA 5K0JA 4XWGA 5JD5A 2DB3A 4B40A 3FUTA 1FDOA 3QFRA 5TNXA 4NABA 2FRDA 3R3HA 1ESDA 2F64A 2YCLA 2WYHA 4OBBA 5LBUA 1IULA 3AHFA 4CEIA 2E49A 1H8EA 3MW8A 4LHSA 4EG6A 2FSVC 5IBCA 3U7IA 3ZCQA 5E2AA 3A8TA 3FSGD 4I14A 5HVNA 2XT6A 2HHAA 3VKGA 3GLFA 1Z4KA 3CUUA 4G67A 3WFIA 1WTAA 4M1ZA 1C1DB 4J0KA 4CF7A 4IOJA 3OPYI 2VVTA 2RB4A 1EVEA 3LXUX 2ZM6B 3LUJA 2J08A 5BV0A 7ADHA 1WMEA 3QBTA 5LLDA 2BFNA 1QU3A 4B7UA 1IM5A 1JR3E 3OHSX 4DRXA 3PQ3A 1SCUA 1ZW6A 5U4XA 2ZB2A 3MSXA 1G8KA 1Q12A 4B33A 4K86A 4BLOA 1E4EB 4GMDA 2BHLA 2CCGA 3C3DA 3CHYA 1BKDR 3KV3O 2MSCB 2GKGA 3I0NA 2Q45A 2AKAB 4XD7D 2BONA 3PIDA 1QGDA 3PGJA 2XTZA 4L8LA 4DCCA 5KQMA 2X0EA 2QVYX 2NNLD 3G0DA 4RZQA 4UM8B 3UANA 4YT8A 5FUQA 5LXTB 1FW8A 1I10A 1M2HA 2WP0A 1L5LA 5DLQC 1PQYA 3RE1A 4KOAA 1MZPA 2IEBA 4IFTA 4PSVA 5GOZA 5ICCA 2P6OA 2VYND 3SXPA 2PS1A 5D8DA 5THQA 2AXEA 2MCFA 3HY6A 3C6XA 1X77A 3PDIB 3GAMA 5GIPE 4OPMA 3A4MA 1YZTA 3TQIA 3X1WA 2AW5A 4IQ4A 4NJEA 3PLNA 2IZZA 4NL4H 2Q1XA 1I13A 3UOWA 5I3CA 3HM9A 2VJDA 4MI6A 4AW9A 3W7AA 4JNKA 3GEEA 4KYUA 3RVQA 2PMWB 2AJCA 4R69A 1NXQA 5L7YA 2PMDA 4KP7A 2WFZA 2BM8A 2OO5C 4V1CA 3I2HA 4U7JA 4J91A 1E9DA 4WOJA 3N2GB 1DRWA 1Z2NX 3P8ZA 3RF7A 1CE8A 5K3BA 3SF8A 1AKWA 4RJLA 1XYYA 1DDIA 1XDGA 4CN9A 2JVIA 2AFIA 1MXHA 1KDRA 1UQUA 4MA5A 4DWWA 4OP2A 3H18A 3EIWA 3FSEA 2CSUA 1J0BA 1HT3A 4B4KA 4JLUA 4CM3A 3ZDDA 5FO1A 5FLKA 3I76A 4KPUB 2H9YA 3W2TA 1I7SB 3AIIA 1Q0RA 2VZ0A 4QODA 4L74A 5JAHA 4CL2A 4LF4B 3N70A 2FQQA 4IMRA 3FTQA 2IHVA 2ATCA 1Q50A 2GJ8A 2QTBA 1FDTA 4B35A 1ZEJA 2IX9A 4KRXA 4DPMA 1W34A 1RM5A 3AZOA 4YCSA 2YOGA 3U0VA 3N3BC 4X20B 2QV0A 1FTYA 1Y0BA 4KQHA 4D9BA 2VDKB 1II0A 1MDFA 6ADHA 1SQSA 4K6CA 4Q02A 5FTWA 4O4LB 4BFYA 2IOQA 2H7XA 1NU6A 5NLLA 2E18A 3A7DA 3RAJA 1GL9B 1GUFA 1TU0A 5A7FA 4RXTA 1O9BA 2ZYWX 5K3FB 5A0VA 1WPXA 2Y66A 3L0SA 3MOSA 3B5EA 1JQBA 3NUGA 4ZV7A 2BHTA 3PWZA 3DHVA 4S1TA 2FRXA 3O1IC 2UU9B 1E59A 1HI9A 3NYIA 2Z58A 1YE8A 1APBA 2G4LA 3RG2A 1WP4A 4FGZA 3AIKA 2P6NA 2X8JB 1ZEMA 5A6SA 2O8CA 4IKOA 1Y89A 5G4KA 3CE9A 5IEBA 2ZSHA 3HNOA 3SBDA 1XLWA 3RWOA 3GVXA 2ZIFA 1Y98A 4KNWA 3L8YA 3G0GA 2KWIA 3BXXA 3CRZA 3DVQX 3L0OA 4GGMX 1YOVA 2EEZA 3X0DA 1WBBA 2P69A 3RQSA 4KC0A 3KT3A 1V6AA 2P4QA 1XZMA 5F5NA 4HMPA 4GDFA 2W2KB 1WNFA 2A4KA 1JR4A 4YROA 5ILGA 3C74A 3RKSA 3TW8B 1J25A 1SXJD 1QZTA 4GRIA 4HI0E 4YMSA 1U81A 2V9ZA 2ZVDA 1TIBA 1I4LD 3DMTA 3E1KA 3PBKA 4WCFA 5EKSA 4Q7QA 3NX4A 1EBBA 3DHWC 4I55A 1GN8A 5FBQB 4AJEA 1ZWLA 2BDTA 1XE3A 2HXSA 5ARDA 1XQ9A 1WXGA 2I0FA 1XDZA 3U7QA 3FYTA 3BCHA 2ENWA 4GI7A 5TMBA 5BR7A 2A33A 2IUFA 5F76A 3IDAA 2EFJA 1I3LA 2Q1SA 2ZRPA 2GKSA 2POCA 2B3DA 4JHXA 4YNBA 2IYTA 4CDRA 4CLRA 3E7DA 1V11B 2VCEA 1T8WA 1SBCA 2AI2A 4LA4A 2WWWA 3PX2A 2AG5A 4YJHA 4I81A 5J5CA 1NNSA 4IQ0A 1XMQB 4E1AA 3HY3A 1Y37A 4MWBA 2TS1A 1QLWA 4TT8A 3M5CA 1A9YA 4JBLA 3IOBA 4GU5A 1V16B 1ATZA 2YASA 3FUCA 3C3BA 4FE4A 1N5IA 4C05A 3KD2A 1LFDB 3ENVA 3JWHA 4QQFA 5F2NA 5F98A 2FSVA 3NNSA 4DA6A 1XQYA 3HA3A 3JQ8B 1TF5A 4P4TA 3U44A 1M6EX 4R1UA 2GHTA 3I9JA 2PKWA 2Z4RA 1OWOA 3N2IA 2DFLA 3PQCA 4QTTB 2PQ2A 4LTDA 2POQX 4OHZA 3JD3A 3DOJA 1LDYA 1JEQB 1VTKA 2PCJA 2ZULA 2BUCA 1SQ0A 1VDZA 3LP8A 3QJGA 2C59A 4BDSA 3KJFA 3G2KA 2Q4EA 4B74A 2UZ3A 4C5AA 2WT8A 4OHKA 1DAGA 2EP8A 2VPTA 1GRCA 4S1WA 1LLDA 1YS1X 3SG0A 5BYBA 3SZRA 3V8EA 4P3PA 2BKXA 3L8EA 3TTTA 4P7KA 1Z39A 3KAPA 2XVZA 2F3QA 3HXMA 1CRPA 4JC5A 2X9QA 1VCHA 2EKPA 4AI6A 2HR1A 3UVEA 4HZUB 5ALZA 1NMQA 2EBWA 4LHVA 1RQRA 2NXEA 4MQEB 4RY0A 1ABFA 4QASA 3ZZMA 1E8NA 4WN9B 2YJ4A 3PUYA 1CYDA 4LC1A 3S2YA 4TYWA 4C3UA 2FUKA 1NW9B 3ELUA 2J5RA 1INLA 2XYPA 1QQ7A 3R6LA 5IM5A 4ZCPA 1E1RD 1RBMA 2ZKLA 3MT0A 1WVIA 3RIMA 5J58A 2Q3BA 4I50A 1CQXA 4ZV9A 5JCXA 1YC5A 5KNBA 2E5LB 4C1NA 1DIAA 4ZPXA 4ZAYA 4I5EA 3P2YA 3BYZA 2IKQA 3OZCA 5B4TA 5EJ5A 2TECE 4GEKA 1NXSA 2G63A 1KI7A 3REGA 2HJ9A 3CA8A 1T9DA 1R6VA 2ZRNA 4RVSA 5DM2A 3ZBUA 3I5XA 4EMBA 3ZDAA 2PU7A 3LQ1A 1F17A 4KFCA 1P33A 2O23A 1C9KA 4KQXA 4QE3A 4WZBB 5JVDF 4ZEXA 3JQBC 4XDYA 4B3XA 1OH5A 1E8DA 3RU9A 5AMXA 4TYYA 1KZYC 4OYYA 4KXVA 3R9WA 1FDUA 4MR7B 5IJ0B 3DKRA 3UATA 5KINB 1SCJA 2CFIA 2DPLA 1G17A 3TFQA 3VR2D 1B26A 4MPJA 521PA 4QHYA 4MS1A 2XTMA 2A35A 3UJ3X 1LJLA 1A69A 4GAEA 3B3GA 2PV7A 3CLTD 4MAFA 4YWHA 2BHSA 9ABPA 4JI5B 1DBRA 4UQLA 2Q4BA 5F5XA 1SU8A 3V7UA 4Z51A 4XCXA 3A6JA 1S8FA 1TQHA 3AL3A 3ZUGA 2QJOA 4HWTA 4F1JA 1EVLA 2M98A 3DZGA 4ETMA 1C9JA 1FYEA 1XXHB 3AILA 2Z4TA 1P6UA 3KUKA 4LHXA 1QBGA 1V4NA 3B78A 1WB6A 3HI6A 1JHOA 3DTYA 4ZJPA 1VKRA 1TEHA 3BXZA 3CX8A 5ALJA 2AOXA 3WNCA 1E8MA 1YZHA 2O50A 4ALKA 4GOLD 2BGUA 1QO0D 1F6BA 4FKBA 2I67A 3OM1A 4NE2A 4QAQA 4IVNA 3NP7A 3UJ6A 1O4VA 5AW9A 1N2CE 3KKZA 4BWVA 1MD9A 2YV3A 1QPZA 1PT7A 1WS6A 5C3MA 2ZT5A 4DEYA 4RSRA 3SM3A 2PR2A 3EQ9A 1OWMA 3UT5A 3ZDZB 4ETIA 2I33A 1SGWA 4U2EA 4P53A 4E51A 2Y3IA 3KOUA 3VPSA 4DLBA 3A9CA 4LY0A 4NAHA 1EJ6A 1VRCA 3ITDA 1UT8A 5E6SA 4EECA 2C9CA 1RKQA 2R8BA 1LRKA 4XSGA 2OV8A 5CFMA 4B4DA 4M3NA 5DBIA 3VGJA 2JI9A 4A10A 3DR5A 1SH7A 1X80B 5FWXB 1Z38A 3BH0A 4TWJA 2VJPA 4B73A 4C0WA 4KDFA 1L2TA 1VKHA 2E21A 1M83A 1VB5A 3EIOA 4L22A 4Q00A 4ER6A 3DFFA 5EPOA 4MH0R 2K87A 4KR0A 3LCMA 4PX3A 2C3OA 3HFGA 4GQIA 4BJ6A 2ZJBA 4PSKA 1H1TA 2WIAA 1L4GA 5REQB 2PRSA 4JEIA 4N8DA 1HYEA 4DV4B 1PWEA 3ZWAA 5MN4A 3U4IA 1RWPA 4TMYA 2AN9A 3WBBA 3WNBA 5EPUA 5BSWA 1NNI1 4EZEA 4G9GA 5CIQA 1H0HA 4QTZA 4PICA 1JTFA 3ZLVA 4F8EA 2D3TA 1ISSA 2OFWA 3ZNOA 2GEFA 3ZJTA 1BA3A 2HY7A 3PT9A 4YUYA 4ZMSA 1RAIA 1SHZA 3V00A 4ASUD 2OZKA 2YMQA 3A6ZA 3UO8B 2G5PA 3QVWA 2GARA 3L41A 1MW9X 1X7DA 1EK2A 4EVQA 3EXEB 4BZXA 2PS9A 3ZWYA 3KT0A 5LP6F 3QE3A 2ZE6A 4IJWA 4LXGA 4DM3A 4EFNA 2CJFA 1MIOA 1PG5A 1NE7A 2QLTA 4KE6A 2CKDA 1T0HB 3WNDA 4HHEA 2Q4RA 1ELOA 2E85A 2R97A 4MLPA 4NCIA 2VBIA 5IDVA 4NQRA 4KEAA 4KE7A 3AUAA 5K99A 4H3KB 2I2CA 3ZWQA 3KOMA 1F2UA 1ZD1A 3MJVA 3N39C 4RV5A 1LNQA 4HDNA 3WLJA 4YA6A 1VMAA 4NLLA 1NJ8A 1PTJC 3AXTA 1FCJA 3M4JA 3R5FA 4XDHA 4RJKA 4CKWB 4L5JA 3GLIE 3QPAA 4PYMA 1GJRA 2CZCA 2R79A 3FMPB 4JLJA 2GR9A 3OF2A 3R6DA 2UXDB 3BIJA 1CNEA 2MINA 3PICA 3W7BA 3G2LA 3T7IA 1U1IA 2BCGY 5JU6A 5LD2B 3N8KA 2VTBB 1E79D 1FTQA 4A9AA 2ABWA 3L1JA 3U9LA 1VBNA 2YKGA 4AZ3A 4LFAB 2DF8A 1JR6A 5FPPA 2GERA 1E9SA 1R6DA 4FSXA 2G9RA 5DVZA 5FUVA 3RFUA 2BKEA 2IYPA 5C80A 3A3KA 4LBVA 1O0CA 4F2HA 4RS3A 4YUWA 1A98A 3FNBA 2JJQA 3MTAA 3L7BA 1CUBA 4PPFA 3ED1A 3S5JA 3TD9A 1RRCA 2PYIA 1RYYA 1QAQA 1YL7A 5C4GB 5A1TA 4ZEVA 2H9AA 4I8XA 3ZV6A 3VA7A 1UM9A 5EWLB 4IV8A 2YJZA 2QX8A 2XUFA 2CMKA 2I3DA 3JQBA 4X7RA 4KUHA 1W0KD 4XUCA 3G0CA 2XMDA 2GVNA 2P9JA 3VYVA 2FPKA 4ZHQF 10MHA 1TZMA 1MGOA 4F4HA 4F3TA 1UWKA 4H9GA 4Z54A 1J22A 3MMNA 2FZGA 3LQKA 4UFOA 5ECGC 4B6PA 5EWMA 4E5UA 4Y2YA 4ZVRA 2O3QA 3RFFA 3G1TA 3HK2A 2IIVA 3EAQA 1Z4IA 3CSSA 4M21A 1OPXA 1N2JA 2L18A 3GT3A 3P9XA 3B6KA 3WMWA 3L6CA 4GBED 1AH2A 4G41A 2P9FA 4NONA 3T5CA 4LI3X 3U81A 4BQQA 4QFBA 1H5NA 1QFMA 2ZSDA 1JR2A 4UAGA 1C9NA 3OQBA 5IPFA 5JFOA 1RTKA 1U0TA 2IGBA 1RJGA 2NTYC 2VEDA 1U65A 4XYGA 3N86A 3IRVA 3QEAZ 2QR5A 5TPZA 1JJ7A 3UBTA 1RLJA 1CB0A 3ADDA 2QQEA 1SBQA 4PANA 3K0AB 3PUXA 4UHEA 2PKQP 2W2OA 2HU2A 1G3UA 1NNEA 1E89A 2RGBA 3STXA 3DZKA 3VZBA 3I83A 1NVDA 2Q6VA 3GUHA 1R4MA 2EBHX 4LC0A 4NCHA 1LV7A 4BNGA 2HK8A 3BD6A 2GAJA 1W48A 2PRKA 2VQDA 1EFLA 3FDZA 3G9ZA 1ZNZA 4UJ3A 1MJ5A 3ZY5A 4QTXA 4BMZA 2FGJA 3W9UA 3SIPA 1FMJA 3ONFA 3SM9A 2JA1A 3VKUA 4Z49A 5K7SA 5CYOA 4GSYA 2C5FA 3KXKA 4L07A 2Z2IA 2PAAA 3GPBA 1L7OA 2V96A 2VHYA 4ZAZA 1LWOA 4QYSA 5EQFA 2QU8A 4NOJA 3UJPA 4IJ6A 1E69A 2W70A 2V7VA 4DWOA 4B3RB 3QU5A 2PA0A 4A3SA 1OTXA 2ZBPA 3HEBA 4RETA 5BN4A 1X39A 2R5NA 4IH4A 1NY6A 5JS1A 2HZBA 5K0CA 3LUDA 1M2JA 4OBEA 3O0DA 1F8UA 2GEBA 1WUJS 1A8PA 1J8MF 3F4BA 1NQUA 1ID1A 3SC2A 1LTHR 1GN9A 2X4GA 4MP3A 2RHWA 1XIVA 3MGCA 4BJ1A 1KS9A 5GAJA 3KSRA 3UPDA 3VKFA 4TQGA 3ZQUA 4AJLA 4DDTA 1KWKA 1DO8A 4W5HA 2WSYB 4RTKA 4R9UC 4WXYB 2BI4A 3QYPA 2IPMA 1RYHA 2O9JA 2I4OA 1JFSA 1AXRA 2Q29A 2DAPA 2J9RA 4C1BA 3GLVA 4M6WB 3EEIA 1UJNA 1W96A 1XHLA 2WABA 5E7JA 5SZHB 4NI5A 3WC4A 4YFVA 1DGQA 4EY7A 4LW8A 1YZFA 1S2GA 4PINA 2CV0A 2WJ3A 1N32B 5FBWB 4CF6A 2GF9A 2EX4A 3C3WA 3CPJB 3S8YA 5JQGA 5E4JA 1YZGA 3NWBA 3NTRA 3VXKA 1U1GA 4PCAA 4BEWA 2IYNA 2PVCA 2X14A 3DUFA 2D2IA 4FFSA 3KJXA 1O6FA 4FMCB 1KVRA 4H1VA 5A05A 1O58A 3KUXA 3GVIA 2Z43A 1X86B 5E4TA 5LOVA 3N8NA 4XH9B 4DRZA 4WFJA 3RAEC 2UVQA 1LSOA 2VQ3A 2O0MA 3CSDA 1YZUA 1W1UA 4W7HA 3ZYCA 3AETA 3A3NA 1QP0A 1QP4A 4MKRA 1AKUA 2C20A 4QVGA 1EJ2A 4DSTA 5K20A 1DQZA 5KSZA 2XUOA 2NUTB 1UP4A 3H2BA 4Q47A 2CJWB 2LW7A 4HV4A 5B12A 4D4KA 1JG3A 1M2NA 4WRRA 5JC8A 3GLGE 5DF1A 3P9RA 4AG6A 1NX6A 2OAEA 1PG2A 1U94A 3I28A 3TTYA 1PQPA 4M98A 2W2PA 3VDXA 4Y7CA 1FPQA 5HOEA 1PTJA 1WUKS 1II8B 4ZI7F 5TB5A 2W42A 2W6QA 4BVBA 2XLBA 2WUGA 4X45A 3GUZA 4LZPA 2XTJA 3IJ5A 1Z8FA 5DCYA 1TYBE 5BN3B 1Q7EA 1UQTA 2OILA 3QV1A 4QU5A 4E12A 2XODA 1E5QA 2R1UA 3B3QA 3MQ4A 5EKXA 1HTBA 3ROKA 4YJGB 4JU8A 3WYAA 5T4HA 3ADOA 1A9QA 3UMMA 2J07A 2IY9A 2QLJA 3F5QA 1EVZA 2XSZA 1EK5A 4YMGA 5CYPA 4GZLA 4F97A 5KVCA 3AZPA 4CQMB 3PWSA 3HKBB 1QLJA 3EVNA 3GN2A 3JZDA 4S1PA 3OA2A 3GF4A 4P4UA 1SA0A 1DE0A 3VNRA 1XALA 4E7PA 4CBVA 3CF2A 2PX4A 1X1DA 3K5WA 3OEHD 4MUIA 4YWJA 2G0AA 3WGNA 1DUVG 1GPDG 1H2WA 4BMPB 3ILSA 1VMDA 1P5HA 3D2LA 2RFLA 3QEMB 2LPMA 4G4SP 2DERA 1Y5MA 2P9HA 1RXIA 1QH9A 2Q5QA 3FR8A 1PYDA 3BE6A 4GPTA 2J6BA 4XJSA 5DWDA 5AHWA 1BDIA 3WLPA 3K4HA 2H29A 1VL8A 2JH8A 2Q2OA 2W71A 1K3UB 1KZ1A 1OMOA 4OA8A 1U3TA 3HU1A 2DZDA 1MA0A 4DDKA 3GP5A 2G71A 3K3PA 4ABYA 1CZRA 3KVOA 3JALA 4FOSA 1KVQA 4P22A 4ERXA 1Z37A 2BTOA 2R6R1 1C14A 4IUYA 5EE9A 2BFBB 4A5OA 3HLYA 3SSMA 1QE5A 1ZH4A 3A1SA 1SBHA 3F2VA 3ENWA 5KWEA 4BB9A 2NO1A 1TZBA 1WD5A 1OVGA 5I9BA 2A67A 1JFRA 2PH3A 1A8SA 2HLDA 4O08A 1SUDA 1ZESA 2ZR0A 1KYWA 3A9WA 3G82C 3N3AC 4XW2A 3IODA 1JECA 1M54A 3DE4X 3K0FA 1W94A 4ZVVA 1JSZA 3CF6R 4MPRA 1U8XX 3KSUA 4R7GA 4AC9A 1RPNA 1XQ6A 1SELA 1IUOA 4ZOLF 2OCIA 1PJAA 5LB4A 4EZIA 2VJQA 1EFPB 2O8VA 1U28A 1G8SA 2VPQA 2QX6A 1RJ9A 5DT2A 4JBIA 3P27A 2NO7A 1RRVA 1QZUA 2WSLA 3OZXA 1MU0A 3PJFA 4KQGA 2FGKA 3AYZB 3BQ9A 1T2EA 2G5TA 3EOAI 3QVTA 5JO0A 2PQ6A 1RDFA 4LHYA 5LWQA 2OQIA 4JSRA 4Q4AA 3KXIA 5KOIA 1J33A 2Q07A 5A3VA 4PLHA 1HTTA 2I78A 3F7OA 5J40A 1KO8A 1M6HA 2IOYA 4W99A 3A3YA 3PGMA 1E2IA 4CMCA 3W1VA 3KELA 2OBYA 2XOKA 4RZXA 3V7NA 1ZVJA 3NOOA 5AVOA 2IU6A 2QS9A 2C96A 2PH5A 3IEKA 3L1VA 4B4OA 1KHTA 1KVSA 4PZYA 1CDZA 1XZJA 1JHRA 4I99A 3MRVA 2JFBA 4QJ4A 1ZZEA 2YV1A 3O92A 4JL5A 1EJ0A 2ZT7A 1F2VA 3FLEA 4GOOD 4JXKA 4QO8A 3TD2A 4EF4A 2FR8C 3DJFA 4S2EA 5K5EA 4CIXA 1KORA 5E7QA 4BQSA 4D6XA 2Z9BA 4S24A 4FOOA 3CRMA 2GZDA 1OJLA 4C0AC 4ZHSA 2YRWA 3EFOA 1BS1A 4FKZA 5EJMA 3O7WA 4GF5A 3X1ZA 2AOUA 3P4XA 2BFOA 2AN3A 2O14A 3TQOA 3WZLA 2P1RA 4TXNA 4I8IA 1M5RA 1H4QA 2XCOA 2P2SA 3AV0B 3BGOS 3I58A 3FCYA 2FN7A 3EC2A 3MJRA 1CWUA 1SG6A 4FEYA 1YASA 1F06A 3DYBA 1PV1A 4IL5A 2GXAA 3RQIA 3SZMA 3ONEA 1NOIA 3UMVA 5AKJA 2EEPA 2WBLC 4PC2A 3GARA 1SXJC 5KEIA 2W2TA 4MYDA 5D7NA 4BO4A 2F1RA 4P54A 5F7JA 3RDPA 3SU8A 4G23A 5HE8A 2AQ8A 4IDBA 3OG9A 5HA5A 1NQOA 3OF3A 3OCJA 1GZDA 2E4YA 4V3CA 5A4IS 1NLYA 4YMWA 5IC5A 1OT5A 1N6KA 1A8QA 1MDBA 3EGXA 4PAMA 4QQRA 4Y2XA 5KREA 3L9WA 1Z5OA 4LRSB 2DWUA 1XB2A 3ZCXA 2J4CA 3TMKA 1FA9A 4ZYXA 4RE6A 1HDCA 3SEZA 1EVJA 1SFRA 4MRPA 1Z4JA 3GNTA 3AHDA 4UBLA 3B9BA 4FEEA 4B5LA 3N8IA 3T7EA 4YJ2A 2FJPA 4PHGA 4DA9A 2JLCA 3REOA 3I9V6 4M2LA 2NVOA 3CU5A 1N25A 1GPH1 2ZUTA 3GCDA 1F5NA 3BA1A 4CMAA 1V3VA 3QKIA 4D0NA 3L43A 3Q8KA 2NXWA 3VPAA 3KTAA 4O25A 1YKFA 1W2GA 2GZAA 3KU4A 1QK4A 1X1TA 2XVXA 3SR4A 4TSFD 2CZQA 3CCCA 3WL4A 3OOJA 2R4TA 3RTAA 3IQXA 3C8UA 5KI6A 1WQ1R 3ENNA 3Q3CA 1LJ8A 5EMMA 1G5RA 4LDQA 3K7EA 3KJGA 5ESDA 4ZVKA 3U6KA 3IDQA 2GN6A 4XDGA 3UB2A 1UJMA 1X7ZB 3RTGA 1ABBA 2OV2A 3KSAC 2I8AA 1E6WA 1C50A 1MEEA 3NV9A 1H85A 1NYQA 2YWDA 1IEXA 3DW3X 4RNDB 1QGUA 4OHWA 3UJDA 4YYEA 1UKCA 1C80A 3WBKA 4BVJA 4D9MA 3C1AA 3I0MA 3ABRB 1RLIA 1UKVY 1PJ3A 5IP5A 2VQ6A 4IHJB 3PE4A 5I7FA 4EW1A 1AC5A 4CN8A 1C3JA 4S35A 2O5CA 3IHKA 3AERA 3FPHA 1NXTA 5CM2Z 2AX3A 2XZPA 4G85A 4YRSA 5ICEA 3J81A 1RQLA 1AB5A 2VUUA 4E3WA 4DC0A 5C1PA