1M76A

Crystal structure of the s137c mutant of l-3-hydroxyacyl-coa dehydrogenase in complex with nad and acetoacetyl-coa
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
291
structure length
291
Chain Sequence
KIIVKHVTVIGGGLMGAGIAQVAAATGHTVVLVDQTEDILAKSKKGIEESLRKVAKKKFAENPKAGDEFVEKTLSTIATSTDAASVVHSTDLVVEAIVENLKVKNELFKRLDKFAAEHTIFASNTCSLQITSIANATTRQDRFAGLHFFNPVPVMKLVEVIKTPMTSQKTFESLVDFSKALGKHPVSCKDTPGFIVNRLLVPYLMEAIRLYERGDASKEDIDTAMKLGAGYPMGPFELLDYVGLDTTKFIVDGWHEMDAENPLHQPSPSLNKLVAENKFGKKTGEGFYKYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-HYDROXYACYL-COA DEHYDROGENASE
publication title Crystal Structure of the S137C Mutant of L-3-Hydroxyacyl-COA Dehydrogenase in Complex with NAD and Acetoacetyl-COA
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 119
structure length 291
sequence length 291
chains with identical sequence B
ec nomenclature ec 1.1.1.35: 3-hydroxyacyl-CoA dehydrogenase.
pdb deposition date 2002-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00725 3HCDH 3-hydroxyacyl-CoA dehydrogenase, C-terminal domain
A PF02737 3HCDH_N 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.10 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 1m76A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1m76A01
5H81A 3PHGA 3HN7A 4GX0A 2GD1O 1GTMA 1ZK1A 2HJRA 2C0CA 2DFDA 4R16A 4Y6RA 3OEYA 1CWUA 4QUKA 3T4XA 1Q0LA 4IIVA 5EPOA 3WQSB 1CJCA 3ENKA 3RJ9A 3ZGYA 2AG8A 4C7JA 3ANLA 4IGEA 3QSGA 1ADBA 4I8XA 1GFSA 3JCZA 3NTOA 3ULKA 4MKZA 5IN5A 2IODA 4GX1A 2GN6A 1DRWA 3GDFA 1ADFA 3KEOA 3EYWA 4JBGA 4DBVO 1Z75A 3GEMA 4OQZA 3KZVA 1XHLA 4FCCA 4KP7A 2OBNA 1ML3A 4RPJA 3T7CA 1J49A 3CIFA 4GSKA 1HDRA 1VRWA 4E33A 4YAGA 1X0XA 1JDJA 3DONA 3HQ4O 2YW9A 3R6DA 1ISMA 2EP5A 3ZWAA 4DQXA 3V8BA 4YXFA 3B20A 2GZ3A 4DLAA 4G5HA 2B4QA 3PDUA 1D3AA 1E3WB 4B3IA 4RORA 5TX7A 1EFKA 2X5JO 1LSJA 2I76A 4YVFA 1VJ1A 2VHYA 3KYBA 4M89A 1C1DB 5HWSA 1I3NA 3GPIA 1JA9A 4WJZA 5K6AC 1X7GA 3QV1A 5T5QA 2C54A 2X0IA 5JY1A 1MUUA 3GZNB 5JMPA 2WJPA 1PQUA 4EUFA 4L9RA 4ND1A 3P5SA 3ROPA 1C0KA 4BNKA 1TT5A 2HRBA 4GX2A 2IEBA 2B4RO 3EDMA 3NX4A 1DEHA 2E6UX 1BW9B 1WDMA 2WE8A 1EFLA 3FRJA 4B8WA 1LEHA 5IFLA 4FN4A 5A05A 4HXYA 4RCVA 3ETEA 2VZ0A 4J1QA 5JDCC 1Y1PA 4IQ0A 1GY8A 4HNHA 5IN4A 4M1QA 1UP7A 2ZYGA 2UUPA 4PG5A 1F17A 2GLXA 1BG6A 2UAGA 2OO5A 3OICA 4HKTA 4IZHA 5ITVA 3AY7A 4UVGA 3VH2A 3OM9A 1Y7TA 3H9GA 2W90A 1UAGA 4NNJA 1DFIA 1ZSVA 2EG9A 3H9UA 2H1SA 3GOHA 1Z73A 3P19A 2WYUA 1VJTA 1U2DA 4JJIA 3JD0A 2WWRA 2QIOA 1SAYA 4EJ6A 4CMBA 4A73A 4CMHA 5JCXA 4MIYA 1HZZA 4MVJE 4OH1A 3OMLA 4I08A 4OKNA 5GMOA 4CMEA 3FWNA 5JW6A 2PZKA 3OH8A 2Q2VA 3ZU5A 1W73A 4QSMA 3ICCA 2JCYA 3ZU3A 1YBMA 2QRKA 4FD3A 2NV6A 3TL2A 2V6GA 5DP1A 3EC7A 4CM7A 1J4AA 1C0PA 5ICSA 4XYMA 1X13A 4R9SA 2HJSA 1Z7EA 3SLKA 4WLNA 2CVZA 4AJ2A 4NBTA 3QWHA 1NPDA 3QHAA 2V6BA 4KMSA 2O23A 1TT7A 5KIAA 1FJHA 1SEPA 1YQXA 2RH8A 1PGQA 2AQHA 2BI7A 3T4EA 5G2OA 3HFGA 1IYZA 4P4NA 4RO0A 3GVXA 1WP4A 4KWHA 3DFUA 3ST7A 4FJ1A 3A28A 1GQYA 4NJOA 1K6XA 5HBRA 1B3BA 1KEVA 2VHXA 3KEQA 4U6SA 3LC7O 4FS3A 2D4AA 4RF3A 3H9JA 4CQMA 1XGKA 3PP8A 1LSOA 3W4IA 1AHIA 1BMDA 5CEJA 3FD8A 3VVCA 3RCBA 1V6AA 3IP1A 3IC5A 4ND4A 2W98A 3GT0A 4B7UA 4O63O 1JN0A 1TA4A 3D1LA 4CMAA 2CD9A 4HV4A 3HJAA 1QLHA 3RC7A 3PFFA 3PYMA 4XYGA 1Y81A 1GV1A 5BNTA 3BHIA 1RKXA 2Q1WA 1GADO 3ZV3A 3JD3A 2OHXA 5BQFA 3JQAB 3F1KA 2VWHA 3DZBA 4O1MA 1B26A 4KUHA 5G4LA 3ADOA 3DWFA 2DM6A 4LMPA 1IZ9A 3I1JA 3PZRA 1KOLA 4FW8A 1NVGA 2YUTA 4UEKA 5KVSA 2EWMA 3RUIA 3KRTA 5L7TA 1EUDA 2AW5A 5ENDA 5F5NA 3U09A 1SOWA 2FMUA 1DJNA 4BO5A 1PS8A 2GR9A 1GZ3A 1PX0A 1UDBA 1V3UA 1Y9AA 3D5TA 5ILGA 4NFYA 3VVBA 4YA6A 3PQEA 1A71A 4E21A 1DB3A 1YDEA 3ROQA 4U8GA 3JQEA 3NRCA 3Q6IA 1X1TA 4R9RA 2JHGA 3WGGA 2Q99A 4NBUA 4NH4A 3OJ0A 3LDHA 1ISFA 3C7CB 5HS4A 4MP8A 3C7AA 1HXHA 1QG6A 1U1IA 1LQUA 1ZZEA 4FQ8A 5HTOA 1C0IA 2BKAA 1U28A 4AJJA 4CM8A 2PH3A 3C1OA 4FGSA 3HDJA 1E3EA 1A4IA 2HK8A 3WSVA 1HRDA 4NMHA 1NAIA 5IG2A 1D8AA 4DQUA 2BGMA 1C0LA 2J6IA 4L74A 1P77A 1GV0A 3GR6A 3GN1A 1E6WA 4MPDA 4M86A 1ZSYA 2EJWA 1MA0A 5EERA 8ADHA 4OOFA 1VSVA 2FN7A 1ZK2A 4XRGA 4RPKA 3MJEA 2QRJA 3R3SA 4R68A 1P45A 3EAGA 1B0AA 3PRJA 4M55A 2OXIA 3UW3A 1XDWA 2BGLA 4J1SA 2G0TA 1UH5A 4NBRA 4PZEA 1OI7A 2R00C 4W82A 3K8ZA 2PTGA 3C85A 1LDBA 4ZU3A 5C37A 3UVEA 4CMCA 5TJ9A 2ILTA 2EF1A 3N74A 2VYVD 4DBZA 1U5CA 1EE9A 3OA2A 4PRKA 4QFDA 5G4KB 2I65A 4NJMA 4F45A 4NIMA 2E48A 1GUYA 2GCGA 3RD5A 4AICA 2AEJA 4IMRA 4YJHB 4XGNA 1P31A 3RUAA 4DA9A 5CDSA 1R37A 1KY4A 1QYWA 1X14A 2O50A 3PWKA 4WECA 1QYVA 1UXHA 3WOHA 3ZU4A 4E13A 2XF8A 4NK5A 1X1EA 5B1YA 4Q3EA 3OQ1A 3DBHB 4W7HA 3NYWA 4FIZA 1NFFA 2VT2A 1ZFNA 5A9SA 1LDGA 4I5GA 2ZJ1A 3CTMA 3V2HA 3RKUA 4JN6B 1LX6A 1YRLA 5JS6A 2FPIA 3M2TA 3TFQA 4XKJA 4B4OA 4UREA 4N18A 3F5QA 3F4BA 4CM1A 1B3RA 1EUZA 1U7TA 3LC2O 3GAFA 2HMWA 1VL0A 3ZNNA 3H3JA 4BGIA 4KDEA 1LDEA 1E3LA 4BO2A 4K9DA 4FFNA 4PLCA 3K92A 2PD6A 1JAXA 5JYEA 1P9LA 2H9IA 2VNSA 4WGGA 1EMDA 3DBVO 1IHXA 1NVMB 1KVRA 5TLSA 3GQVA 4HADA 1UZNA 3NUGA 4E3ZA 2W2KB 2IDZA 3CPSA 4D43A 3DAPA 3VTZA 2Q1UA 2C7GA 2VUTA 1GYQA 2Y1OA 4BMNA 4N5MA 4P22A 1DPGA 4NU6A 4XX0A 1LRKA 2G5CA 2PZJA 3GGGA 1B2LA 4FJ0A 5BSEA 1CIVA 4BNLA 4B7CA 1ISJA 3DR3A 1P1KA 5HM8A 3IMFA 4A5OA 2NU6A 2X5OA 2P91A 2QZZA 3RKRA 4DLBA 3S8MA 2BHLA 4OIMA 3LK7A 2B5WA 3MJSA 3BMNA 4ILKA 3ZU2A 4E2XA 1DXYA 2GSDA 2Z1NA 1BRMA 1KEUA 2O3SA 3B1JA 3FTPA 5DOVA 3Q2IA 4YEDA 4I9HA 2X0JA 3BMQA 1NTOA 4JX8A 1WMAA 3IUPA 1L7EA 1TVEA 5KTKA 5TGDA 1EEHA 2Z95A 4W9NC 4QX6A 4TKLA 1ZKMA 1IL0A 4P4GA 3VKVA 3A14A 3I3OA 1DIRA 4WASA 5EIOA 1PZHA 2PK3A 1C1XB 4TWRA 4AG3A 3G0OA 2BMAA 4HFRA 1ZH8A 3E82A 3HE3A 2VN8A 1EVIA 3JQ9A 4K6CA 2O7QA 2I3GA 4BQRA 4EZBA 1R0LA 2YHUA 4OSOA 3RBZA 2WD8A 2O4CA 4WE3A 3U9LA 4BNJA 4TQGA 4CJXA 1QORA 1YB5A 2RHCA 3IJRA 3JQGB 4O5OA 1HDCA 1Y5MA 2HDHA 5CG2A 4P4LA 3OEWA 4CMJA 3OJLA 3EUWA 3Q11A 1SMKA 2Y1DA 3H5NA 1ZVMA 4GWGA 2GN8A 4BQPA 1CDOA 3O03A 4HFNA 1ZO8A 4GWKA 4J9UE 5CPFA 3ZWXA 1H2BA 4RPLA 3ZDFA 1N92A 1MXFA 5F3RA 5TIIA 1EK5A 4IM7A 3PJDA 5ER6A 4MINA 3EZYA 1H0KA 4YYZA 1YONA 1ARZA 1B8PA 1QKIA 1HF3A 3S2EA 1BXZA 3C3XA 1HE3A 1UP4A 2EKQA 3NT4A 3GNTA 4AJLA 4BO8A 1GD1O 1T1RA 1YL6A 2P5UA 4BNXA 1PZGA 4EDFA 3K5PA 4BKOA 4TKMA 2NU9A 4Y67A 4IPTA 3UKOA 3H7AA 5TSDA 1BTOA 3BMOB 3QRWA 4QTZA 1RM0A 4GSLA 2J5RA 2LDBA 1I0ZA 1XQ6A 3FNFA 3MJVA 4P38A 4XQEA 4ZQHA 4PZDA 2ZATA 3QWIA 2D5CA 4CM4B 3ONEA 3PI7A 5IDWA 1CRWG 3ZW9A 3CSDA 1Q2XA 4R3WA 3KYDA 1U4OA 3RU7A 3K73O 2OL4A 2ZB3A 1JWAB 3COSA 3MOGA 3WGZA 4GKVA 2YQ4A 4YTEA 2FHSA 4DXHA 2XXBA 3ETDA 1N1GA 4JBIA 3LF1A 4YJFA 3QVWA 3LU1A 1KIFA 3HZZA 4LRTB 4Z0HO 3RUEA 3PJEA 4RZHA 2ZCVA 4R3NA 3CMCO 3GA0A 1K6IA 3L6DA 1WMBA 5IF3A 3MJTA 5TC4A 1U3WA 3E8XA 3SLGA 4GGOA 3E6AA 5FEUA 1H2HA 1GAEO 1OBFO 3LLVA 1D1SA 1QLJA 4GAEA 2NVUB 4CQMD 3F1LA 2Q2QA 3ORFA 1ZXBA 4XQGA 2Y66A 4N5NA 2NACA 1PJTA 3KETA 2GPTA 1M67A 2DUUA 1T26A 2VTEA 3HUDA 2DC1A 4R1NA 1UUFA 4JGBA 1GCUA 3GAZA 1BVUA 4I5EA 1SB8A 1K6JA 1XR3A 1XELA 2PH5A 4IIUA 2WD7B 1AN9A 5IAAA 1SPXA 4WCFA 4Q39A 9LDBA 3V1UA 1B8VA 3NV9A 2O3TA 2AQIA 5AVOA 4BO1A 1H9AA 2QHXA 1ZEJA 3BTUA 4IS3A 3FNEA 4JJGA 1PJ3A 3LYLA 3G17A 3KUXA 4OL9A 4E12A 1EDZA 3RI3A 5L53A 2GN9A 1VJ0A 4LGVA 4E2ZA 1PL7A 4YB8A 3WQQA 4CQLB 4NHEA 3PDJA 5JC1A 3FN4A 3EGOA 5A03A 3F47A 3F3SA 2YHIA 2NVWA 2I9PA 3GZ4A 1ZBQA 3SC6A 1Q7BA 4HFJA 4HNGA 2UV8A 1XQ1A 1YQGA 5EINA 4BO7A 2UDPA 4YRDA 3MTGA 3FSRA 4L4RA 2FPGA 2EV9A 1B7GO 4UUNA 3CE6A 3OQ6A 3PPIA 1ZMTA 2IEDA 2V6MA 4NDNE 5H83A 1ZCJA 5C5IA 3TFOA 5KJ1A 4JK3A 4E5YA 1DIGA 2JFGA 3K9QO 4CMIB 1JQBA 2Q1TA 4TROA 4NFSA 1UXGA 2PKRA 4IQ8A 1H6BA 2J3KA 3E5RA 3C8MA 3TL3A 1PZEA 1DC3A 1HDGO 1EBUA 1LQTA 1U2GA 1X15A 5B4TA 1XCBA 4B4WA 3OJOA 3GNSA 3L07A 5L3ZA 3LT0A 2X7HA 4Y6SA 3KO8A 3UFXA 5K6AA 1HLPA 1ENPA 1PL8A 4IGFA 5JMWA 2YYYA 1L1FA 4BHTA 1Z45A 3ZN2A 4PLZA 4B4UA 5A04A 3NDJA 4LSMA 1OFGA 3PQFA 4ND5A 3UOGA 1SNYA 4YAIA 1YH3A 3HN2A 1LUAA 3U3XA 3QVOA 4LVCA 2VHVA 4Q3NA 4NPCA 1EZ4A 4GKBA 3IL2A 4C7KA 1QMGA 3FBGA 4Z3DA 1SZJG 4JIGA 2DTXA 5JBIA 1PU2A 4RF5A 4DC0A 1W4ZA 1NHGA 4JXKA 1I36A 4YBZA 5BNFA 4J1NA 5JDCA 4ID9A 4OXNA 4AL4A 1U9JA 1ENYA 2Y93A 4OAQA 5U9CA 3OP4A 3NDIA 4CLRB 3HDHA 4BGVA 2RCYA 1WLYA 5EMHA 1H6DA 3OJEA 4AJKA 2ET6A 1E0DA 3EK2A 4WCFC 1FDWA 1P1FA 4RJTA 4EBFA 5AOVA 3WYBA 4J1TA 2IZ0A 1U8XX 1NQOA 3WGHA 4CLEA 4BNUA 4IXWA 1SOVA 1PJQA 2SCUA 3O26A 4Q3CA 4YQZA 4UEOA 3VH4A 1LSUA 1DIHA 5JAMA 4FB5A 4XJTA 1W0CA 4OO3A 2V65A 3ZWMA 5DN9A 3RFVA 2I5PO 3ONFA 4KQWA 5KVQA 3A4VA 4R1UA 3PGXA 5B4UA 5KVCA 4LW8A 2IXAA 4ALIA 3DZJA 1YB4A 3RIHA 1RM5A 1LSSA 4YT8A 2BFOA 1U3UA 3GVPA 3GNQA 3WWYA 5JXWA 1QYDA 3AOGA 1UZMA 1YO6A 5B12A 2JCVA 4XA8A 4R01A 3I9OA 5CDUA 1WW8A 3K31A 4J7CA 4TVBA 3PIIA 2JD0A 1LC3A 2ZYDA 3CTVA 3IAHA 3AUSA 1I3MA 3F6YA 4B79A 4WLOA 1YQDA 2WTBA 3WX0A 1Y8RA 5IDXA 1F8GA 3E5MA 1FDTA 1QRRA 1DHTA 1NBOA 2Q2WA 4OKIA 4DMLA 3R3JA 1SO8A 4ZQEA 2A4KA 1A9YA 4OOEA 4C4OA 1U3TA 1T25A 1P3DA 3UUWA 2Y1FA 3DO5A 5IZCC 4YT4A 2DBZA 2NUAA 2W4QA 5L4NA 2HRZA 3I4FA 2O3UA 4GVLA 4CM8B 4L8VA 1HE5A 1ZNQO 1H6CA 1HYGA 1WAMA 2CVOA 1D4FA 2E37A 3O38A 3O8QA 1U8FO 4B7XA 1IPFA 1V9LA 3JQ6A 3OF2A 3RQSA 4GVXA 4UULA 1HE4A 1R4NB 4CLXA 2NNLD 1R4MA 2DUWA 5THKA 1B15A 3PVZA 5FWNA 1V8BA 1E5LA 2X4GA 3FNGA 1B14A 4Z0PA 3M1LA 3FHLA 4E31A 4BO0A 2CDBA 3WGIA 1T24A 1LLQA 2O3QA 3UCXA 2Y05A 3HHPA 1HDZA 4GMFA 3G1UA 4PRLA 4X54A 3INGA 1Y6JA 3DHEA 3DMTC 4GBJA 4BNMA 4PN3A 5L4SA 5IXSA 4BNYA 1UJMA 2JCXA 3ZH2A 3D3EA 2DBRA 4IDEA 2AHRA 4OGWA 4H3VA 4MIEA 5KJ6A 3C1AA 1Y8QA 2VOJA 2HQ1A 2EIHA 4RQTA 1V3VA 4L0QA 1Y9EA 3TWOA 3WDSA 3F4LA 5JCJD 3QQPA 3GFBA 4QT0A 4GH5A 3LZ6A 2PGLA 3RASA 3QE3A 4PCVA 4J3FA 3RC9A 2ZYAA 5BSGA 1NQ5A 3JQ8A 3W8EA 3QA9A 1BXGA 4YAEA 1EVYA 1A5ZA 1MV8A 1N9GA 8LDHA 2DPGA 2ZTUA 1X7DA 3D4OA 4BV9A 4J4HA 3DBRB 5A4DA 5GZ1A 1YJQA 1QXSA 3L9WA 5T8KC 4D3SA 4J9VA 4R5MA 1P1HA 1YGYA 1HDYA 1KY5A 4M49A 5A9SB 1O5IA 2ZKLA 3DAGA 4GLOA 3AW9A 5K0ZA 1UAYA 3DHNA 5TJHA 4I1IA 4XWYA 3NTRA 5FI3A 5ILOA 3ZNQA 3OFSA 3UCFA 1HTBA 5CFZA 3D7LA 3OQBA 4I9NA 1P44A 3WICA 4YCAA 1N1EA 5JY6A 1I5RA 2VRCD 4Z9XA 2ZTVA 2X9GA 1J0XO 2A9FA 3WMWA 2YJZA 3C24A 1AGNA 3DL2A 3PYXA 2R00A 3RC1A 4PFJA 3X2FA 1T2CA 5H82A 3GDOA 4AJNA 1ENOA 5KCZA 2O7SA 1VM6A 2P9CA 3I4CA 3V5NA 3AJRA 4IJWA 2ZQYA 3DMYA 4J4BA 2DBQA 2EKPA 2C29D 3Q0EA 4FGWA 3ZNOA 5MGBA 1PGOA 3M2PA 5DF1A 1LA2A 3ZWYA 3JQ7B 2BD0A 4MVJM 4E5PA 2DBVO 3WYEA 4IJKA 3JTMA 4R5HA 3D0OA 4S1VA 4EEZA 4LK3A 3W8FA 2LDXA 3KBOA 1TB4A 3MOIA 3PLRA 1P1RA 3AM5A 3AOEA 6ADHA 3TRIA 3DBLA 2CSUA 3K2EA 4R41A 7MDHA 3CH6A 1R12A 4XQCA 4B3HA 3BMQB 1GZ4A 1E7RA 4IDDA 4DTIA 4Z9FA 1NXQA 2JHFA 1PZFA 4IMPA 3PLNA 5COAA 5L40A 2YFHA 1KS9A 1LU9A 4BNWA 2FPPA 2HMSA 5BT9A 3WGTA 3BXXA 1R6DA 5BSFA 3DTYA 3H65A 1H5QA 1I32A 3TSCA 1XLTA 1NFRA 3RC2A 3TN7A 2VWPA 1S6YA 3WG9A 4PG8A 1OAAA 3EY4A 4U0KA 3KM0A 1GL3A 2EKLA 1E7QA 2JFHA 3E48A 4IDCA 4BNNA 5JO9A 4WLFA 1KC3A 4ZHSA 1E6EA 3GUCA 3D4PA 2W2LA 3S1LA 4YT2A 1DIAA 4R1TA 4JLWA 3KSZO 2AMFA 3HDYA 3TZQA 4Q3BA 1WNTA 4YAJA 1WVGA 4PLYA 2TMGA 3CZMA 2BRUA 4E30A 4LCJA 3B70A 4ZQBA 1BHSA 3E9MA 4JP3A 3H5RA 3H9EO 1T2EA 3IKVA 3ITKA 4FSHA 2DT5A 1C1DA 1R16A 3ZZNA 3ZWWA 2CF5A 1RM3A 1GQ2A 3HNPA 3LVFO 2X86A 4MVJP 2VNAA 3PEFA 1NQTA 4ND2A 1P33A 1PJLA 1VL8A 1YB1A 2E4AA 4D3DA 3VKUA 2HMUA 2BH9A 3TOXA 3U0BA 4W9NA 5TF4A 3ZWCA 4IDGA 3CKYA 1YS4A 3DDNA 4OXKA 3TNLA 5TT1A 1BVRA 3B6ZA 1WPQA 3W1VA 3WS7A 1DC5A 1B8UA 1JTVA 3INTA 5CP8A 3L4BC 2B0JA 2X8LA 2I99A 1GR0A 3P2YA 2YY7A 1TLTA 3DZHA 4LVUA 4CMGA 5JC8A 1IUKA 3RWBA 1EVZA 3ANMA 1AXEA 4CMKA 2VYND 4J49A 4JJFA 3QP9A 5L4LA 3RBXA 4OMUA 5L51A 4O59O 2YDXA 2H5LA 3TZKA 1TXGA 5CPBA 3JD2A 1MB4A 1P0FA 3M1AA 3KYDB 2IYPA 1KBZA 1PIWA 4D3FA 3UXYA 2G17A 1YKFA 3AOEC 5F5LA 1NPYA 1M6WA 2YV1A 3H4VA 2X9NA 1IZ0A 2PNFA 4XCVA 1EE2A 3INRA 4YJFB 4PVDA 5BNIA 2JFFA 3G3EA 4ROSA 2RIRA 3DZKA 2IZ1A 4IY1A 5CDYA 1A27A 4KUGA 3JD4A 1AUPA 4RVHA 4FC6A 4W99A 1U5AA 4MP6A 5EQDA 5I7FA 4LCEA 1M6HA 1NHWA 2EERA 1NR7A 3DZFA 3D3WA 4KWIA 1CETA 2VTDA 1Q7CA 5LCXA 1O9BA 3H2ZA 3E9QA 5AXAA 2AA3A 4S3MA 4OHUA 1V0JA 4XQ9A 3AFNA 4M87A 4PLHA 1GU7A 4E6PA 4YJGA 1LLDA 1HKUA 3ZV6A 1LJ8A 3L0DA 4ZQGA 3NKLA 1YE3A 2X0RA 2ZK7A 4II3A 3W8DA 5KVVA 3VC7A 3CINA 3ZWVA 1XEAA 3LT4A 5T6BA 1PSDA 4HBGA 3W4KA 1DAPA 1T4DA 3OECA 5DBIA 2Q1SA 2WM3A 3RUFA 4ESOA 3OIGA 2NVBA 1M66A 2HLPA 1NWCA 2FY8A 4RVFA 2C82A 1I8TA 5AQ1A 2I3AA 1ZMOA 4TVOA 4JP2A 4XIJA 4IINA 3JQAA 3V1YA 4TZKA 3O9ZA 5COBA 3RVDA 1WDLA 5G0WA 1UP6A 3E03A 4QO7A 1UDAA 1ORRA 1U7HA 3DTTA 4CR8A 1O94A 2OZPA 4Z9YA 3EW7A 1E7MA 1T1SA 2O3RA 3ON5A 3GLQA 1GYPA 4CV3A 1EDOA 3AI3A 2E49A 2NQ8A 2XAAA 4D44A 1JWBB 3KSUA 4YQYA 4Z0TA 5B4VA 4TRRA 3RAJA 2ZQZA 1P1IA 3PHJA 2C20A 2DTDA 5HS6A 2NTVA 4WCDA 2RAFA 4XYBA 2C2YA 3QWBA 3PIDA 3ONDA 2X0NA 5JCJA 4WNCA 2DQ4A 3EVTA 4LN1A 4E4YA 1F12A 4XEHA 5I8WA 5BSHA 3BTOA 3LF2A 4MJLA 4IDAA 4J16A 3VPGA 2ZB8A 2CF6A 1DRUA 1ULUA 2POQX 2DVMA 1UR5A 3A06A 5A02A 4GI2A 1I33A 1HWYA 1RPNA 2EEZA 3GVHA 1ZIDA 2ZTMA 2HSDA 4WKGA 1MGOA 1VKOA 2J8ZA 2P2SA 1JVBA 5TQVA 2J3JA 1DO8A 3NGXA 3KOUA 2RHRA 3WTCA 1ADCA 3I5MA 1HE2A 4LSWA 4MDHA 3VPSA 3EVNA 3WFJA 4EW6A 3IS3A 3WNVA 1NAHA 2VRCA 4XGIA 4YPOA 3Q2KA 4GGPA 6LDHA 3NJ8A 5CDGA 3KLPX 3KHUA 3GN2A 3JQDA 1ENZA 2NTNA 3IJPA 4DMMA 3ZHBA 1ID1A 2B83A 5U4QA 5KNLA 4FFMA 2FSVA 1FDSA 1WXDA 4FFOA 3WLFA 4XDZA 4KOAA 4TSKA 1K5HA 4ND3A 3DOCA 1G0OA 4II2A 5JAZA 4JROA 4A10A 3VPHA 3B1KA 1DRVA 1Z7BA 2P9EA 1UDCA 4UVIA 4YDRA 1E77A 1TI7A 2B35A 3DZIA 3FR7A 1VLLA 3MWDB 4CL8A 4J7UA 4M8SA 4RPHA 3GK3A 4WLEA 5JYDA 3DAFA 3PYLA 2GDZA 2GUGA 3TZCA 1N7HA 4YJHA 2WDZA 4KZPA 4NK4A 4BS9A 2PZMA 4QEDA 4I5FA 1NQAO 1KVTA 1P1JA 3JQFC 4RVDA 3GDGA 1ISGA 1PJ4A 4AJIA 4CLDA 2D2IA 2DTEA 3SJ7A 1YL5A 1ZXLA 2AG5A 5CEFA 3W6UA 5KKCA 4R4JA 3N7UA 3AI2A 3RU9A 3RFXA 4XYEA 3FPLA 4ALMA 1CERA 1DFHA 3DB2A 1DBVO 4ALJA 3UF0A 4MP3A 1F8FA 1I01A 2BGKA 5DDIP 3VZQA 4AJEA 5DZSA 2X23A 4MVJD 4OYRA 3L4SO 5EQFA 2P4QA 5LDGA 4RVSA 1LBEA 4NG5A 1R0SA 3OIFA 3WBBA 3ENNA 3D5QA 3UCEA 4D0RA 4DYDA 3IIEA 2NU7A 4E5NA 2VZ8A 3AU8A 3SEFA 1XSEA 4WLUA 1TT5B 1Y5RA 2W2KA 3GVCA 4MVJI 4OXYA 2CY0A 2BLLA 1ZK3A 2GGSA 1GQQA 4BVAA 5IDYA 3AK4A 1B16A 3BTVA 4JCOA 4CM5A 2OFPA 4IS2A 1T2FA 4CLOA 1MC4A 3LLSA 4TZTA 4IXTA 1RWBA 1O6ZA 4WPGA 3WSWA 5JDIA 3C7DB 5MDHA 3HDQA 5G0UA 2EW8A 2D8AA 4H15A 3TOZA 3VZSA 3NT2A 4ZQFA 4DWVA 4DIBA 1KVUA 3GPDG 5T67A 1ULSA 3SBOA 1AHHA 4EUHA 2PD3A 3L9XA 4MO2A 1NX6A 2HK7A 3UICA 3LC1O 4E5KA 4MOWA 2W2LD 4BO6A 4DPMA 2IXBA 3H2SA 3STHA 2C07A 3WMXA 3ETGA 1DLJA 1Y8QB 1ZEMA 1ZW1A 4CODB 4BOYA 1D1TA 4AJPA 2FRDA 4MIOA 2V7PA 2O48X 4BNIA 2JL1A 4BL5A 5ITWA 1E1LA 4J0FA 3PWSA 5GZ6A 2EW2A 4KQXA 1VSUA 3JYLA 2VYNA 3RUDA 1ZUD1 4IJVA 4I5DA 5IZCA 2JJYA 1BWSA 1SEVA 4FOOA 2DFVA 3ABIA 3EMKA 3G1TA 2EGHA 1L7DA 5JNLA 3GC6A 3JQ8B 2X5KO 2F1KA 4LISA 4Y98A 1F14A 3QVSA 1BXGB 1UXJA 1N9GB 5L45A 4EJ0A 3PZBA 4UVEA 1KETA 2X9VA 2A94A 4IZIA 3AM4A 4WOJA 3JQGA 1HL3A 5CAEA 4DUPA 5AYVA 4ZN6A 1GEEA 4WLVA 4CM6A 1LDNA 3WR5A 2VWQA 4BKRA 5LC1A 2PLAA 3H8VA 3E9NA 2PKQO 2X1HA 2PA3A 2J3HA 4Y6PA 4J4TA 5A9TA 3UAGA 3RJ5A 2G82A 5JO0A 2AE1A 3HG7A 4ZA2A 3OSUA 1CEQA 1KVSA 4UVDA 4UUMA 4RVUA 3E1KA 3RFTA 3L6OO 4U5QA 3W4JA 5CDTA 2RH4A 3DMTA 1O0SA 4MVJH 4CQMB 4DRYA 5J23A 1AE1A 4WEOA 4FFLA 1M76A 1Q0HA 3UN1A 5JPIA 3ZNPA 3R1IA 4URFA 4PZCA 4ZVVA 3QWFA 2YV3A 1KEWA 2HU2A 1E92A 4XDYA 4BNVA 3CMMA 3OA0A 1P74A 3WGOA 4DPKA 1N2SA 4CV2A 1G6KA 4RGBA 2J5KA 3BMCA 2VWGA 5EJ2A 4FOSA 1OC2A 3ROMA 1I3KA 2X58A 4YWJA 1PGPA 3BMOA 4KDFA 3CXRA 4MVJG 1I30A 2VUSA 5DULA 4BUCA 1HLDA 4TRMA 5I7SA 3G49A 4CM4A 4O0LA 5T8KA 4E32A 3DBLB 1E1NA 4CV1A 5JFOA 2PR2A 1BXKA 3I23A 5I9MA 5JDIC 3K2BA 4M54A 1MXHA 1QV7A 1Z82A 2FR1A 3IUSA 3NJ4A 5JAQA 1ZJZA 4CLHA 4FJ2A 1YXMA 1G1AA 1T4BA 2QZ9A 4XD2A 3Q3CA 2PWZA 5DBGA 3VZPA 4L75A 1BSVA 3FBTA 3AU9A 4K26A 3M6IA 5AXCA 4ALNA 3V2UA 1C14A 5A3VA 4J2HA 3SX2A 4JNKA 1PS9A 3GF4A 3GMSA 4H16A 4FFPA 4BMSA 3B1FA 3WLEA 5CHEA 1CYDA 4MKRA 3IKTA 2HK9A 1YL7A 1OC4A 4FR5A 4UVHA 4YRBA 2VCYA 1QR6A 2GZ2A 1YJ8A 1E6UA 1TEHA 3AUAA 4BNFA 4F6LA 2NVUA 4P8RA 4E2WA 3BA1A 2Y0CA 3DEYX 1YOVA 4J2OA 4J7XA 1BGVA 3ANNA 1IHYA 3GHYA 3DHYA 1F06A 2QYTA 3RROA 2VHZA 2J3IA 3JYOA 3FR8A 1ZK0A 2WD7A 3UH1A 2AE2A 4Y9DA 1K2WA 4CUZA 2Q45A 1DDOA 2PZLA 4GQAA 2Y0EA 3ICPA 5DT9A 2R2GA 3JQAD 3C1TA 1NR1A 1E7SA 2AXQA 2PD4A 3NGLA 4FFRA 3GH3A 4PLTA 1HSZA 3JQBC 3PGJA 1MX3A 2C2XA 4PLWA 4AJOA 2X6TA 1O8CA 2AQ8A 3JSAA 4GX5A 4DYVA 1NVTA 1I10A 1I2CA 4KTVE 3I9LA 2VUUA 4ITUA 4CQLA 2FWMX 1DHRA 4RZIA 5TNXA 4DIFA 5I9LA 1ONOA 2BFPA 2VOEA 3F5SA 3ROKA 1X7HA 2BF7A 4IUYA 1HT0A 1RYDA 3KYCA 5ENVA 5A5EA 2GRAA 3AY6A 2ZCUA 5FI5A 4IQGA 4PVCA 3NT5A 4IDFA 3TDKA 5L95A 1EK6A 2CDAA 5T64A 1LDYA 1LI4A 3H5AA 3SJUA 3ZCXA 5HA5A 2ZB7A 4OM8A 3I52A 1Z6ZA 4NJMB 2NM0A 2B36A 2Q3EA 3KB6A 4FBGA 3KLMX 2NSDA 5TRTA 5KWEA 4HP8A 2DPHA 4CMIA 5F1KA 4QFCA 1LXCA 4K6FA 3Q9UA 4DREA 1HYEA 2CZCA 3ZV5A 1RYEA 2GO1A 3AFMA 3SXPA 1Q0QA 2VHWA 1JU9A 4UUOA 1MFPA 3MJCA 5ICMA 4RPGA 1HDXA 2C5AA 2BFMA 4F46A 4BGUA 2WMDA 3DOJA 2A92A 1YDWA 3U4IA 1DLIA 3K30A 4GLLA 4AFNA 4PIVA 1MLDA 1PR3A 4PLVA 4U6QA 4DPLA 3T7EA 2Q4BA 1KERA 4ZRNA 3ZV4A 4A27A 3D3WB 4BIIA 5G0VA 4BV8A 3L4BA 4A2CA 1E1KA 1H94A 1NWHA 5DP2A 2BI8A 3ZHXA 5JE8A 4GPD1 3IP3A 5EN4A 1J5PA 2GNAA 4BNGA 1QYCA 4YJGB 2CUKA 4MVJA 4YACA 2H63A 5KJEA 1I24A 4L4XA 4WK6A 1GUFA 4OQYA 3LT1A 4D7AA 5KJCA 4CLRA 3DOOA 3V2GA 1H9BA 1LLUA 2FR8A 3RUCA 1PEDA 1NM5A 3ZHYA 5TS3A 2ZIZA 2BFAA 5L7WA 3BMNB 2E82A 3FF4A 4R54A 2HO5A 3ASUA 3U62A 1PGJA 1X0VA 2O2SA 3PWZA 1U3VA 1QYXA 4HFMA 2VT3A 2JAHA 3KXDA 1XYGA 3HWRA 1IOLA 3Q9NA 5B37A 3V1TC 1T2AA 3MEQA 2OUIA 5L9AA 1NPTO 4WOKA 4BGEA 3KVOA 1P0CA 3PK0A 2HMVA 1Q1NA 3G79A 2VQ3A 1M75A 4CR6A 1A9ZA 1EUCA 3H3FA 4N54A 4OJNA 4KUEA 1EQ2A 2GYYA 1OOEA 4NBWA 5JAIA 4DIOA 1UXKA 3CZRA 1LNQA 2NQTA 4E5MA 3GY0A 3AUTA 1ONPA 1UZLA 2Y0DA 3FTNA 3MWEB 1PQWA 4NFHA 3WB9A 1XU9A 3ZI0A 3BZUA 4NR0A 2IZZA 3DQPA 4CPDA 4TMFA 4YR9A 2XPCA 5K9ZA 1DC6A 4LMRA 3D64A 3PJFA 4EUEA 3PFWO 2NU8A 3VAZA 1E3WA 1I2ZA 5C7OO 2VZ9A 2IRWA 2OOSA 4J43A 1ZJYA 4U7WA 4A7PA 4AJHA 4DGSA 4RF2A 4OSPA 4Y8VA 1OZAA 3GUYA 4IJUA 4ZJUA 4BKQA 4L73A 3ZWOA 3WGYA 5C7LO 5ES3A 2YDYA 4BO3A 4CMEC 4NQZA 3I83A 2HMTA 2UUOA 3GZNA 2IE0A 2PFGA 3UHAA 3TZ6A 5IJZA 3PHLA 4PG6A 1G0NA 2FOIA 4N5LA 1SB9A 1GYRA 3PTZA 4BO4A 3PQDA 1DFGA 4TRJA 3S2GA 2I66A 1E3SA 2OGUA 4UUPA 3AWDA 1R4NA 4RF4A 1AXGA 1BW9A 2OP0A 2XOXA 4GMGA 5FF9A 4RDHA 3GEDA 1F0YA 2P68A 1PWXA 3QIVA 3F46A 3RUHA 2TMDA 3O4RA 4B8ZA 1XKQA 2CNBA 4ZICA 1CQJA 4ZD6A 3WQRA 1VE9A 3DFZA 4W4TA 3TQHA 1Q7GA 5A3JA 4XR4A 4RVGA 1PL6A 3BHMA 3OJFA 4J90A 1D7OA 3QJ5A 5U1PA 3SVTA 2ZJ0A 3S2FA 3U5TA 4W7IA 2UVDA 1OMOA 2P4HX 2B5VA 1EVJA 2CFCA 2F00A 2Y1CA 4K1LA 3GEGA 2DLDA 4A03A 4ALLA 3LT2A 3NEPX 1SBYA 2WYWA 4HY3A 5I7VA 2EJVA 3PJGA 5FFFA 1H93A 3L77A 3ZWNA 1FK8A 2D3TA 4BB5A 1GDHA 4A0SA 3E18A 1HEUA 3VDRA 4UEJA 1A7KA 2O2YA 1XIVA 2QRLA 3JV7A 3U4CA 1QV6A 1DIBA 4R69A 2A35A 1DSSG 4XJSA 2Z5LA 4ONEA 1C3VA 1N7GA 4PLPA 3DBRA 4RLSA 4RV9A 4UAGA 2Y1EA 1CF2O 1WWKA 5IXYA 1E1MA 4HX5A 4PLGA 3WGQA 4BNTA 5KKAA 3WJAA 1BDMA 1NASA 1ZSNA 1W6UA 3WNQA 3HSKA 5EL0A 3ZHZA 1LTHR 1IPEA 3S55A 1V3TA 3QWAA 2I6TA 4Q9NA 1MC5A 3TF5A 4WCFB 1A4UA 2GZ1A 5F21A 4DQVA 1NP3A 2B69A 2FSSA 3PXXA 3QVTA 2HAEA 5T57A 3AUUA 1PQPA 4PGFA 1MG0A 1GEGA 3CUKA 4CM9D 3EHEA 2AEMA 1ZK4A 2CMDA 5C3MA 3BYZA 2OBYA 4D45A 4ZRMA 2ZTLA 1O89A 3P2OA 4BB6A 4QECA 1JAYA 3I9KA 3QLJA 1DC4A 2D0IA 2XXJA 1K89A 3BAZA 3LQFA 5DCYA 1W8DA 3I6IA 1PS0A 4DC1A 2YHIB 4Z3KA 1HDOA 4D79A 3JQ7A 5DBFA 3IQDB 2C7VA 4CLOB 4PG7A 3HB5X 2NTJA 3EZLA 3BIOA 1ISIA 3MJ4A 4F3YA 4MVJF 4BKPA 2YV2A 5A06A 5G0SA 2YZ7A 3A9WA 3JQFA 3VHRA 4CV0A 1R15A 1VC2A 3AI1A 3JYNA 3FWZA 5A9RA 3I6QA 7ADHA 3GMDA 5LDHA 3S2IA 4D41A 4MKXA 3ZWBA 1DOHA 4XZ3A 1A72A 3WTBA 1ISHA 1E3JA 3N58A 2C5EA 2FZEA 1NYTA 1PJCA 2H6EA 2WSBA 4BNHA 5GZ3A 4DVJA 4Z6KA 3ZWPA 1H6AA 4G81A 1GZ6A 1U4SA 2CDCA 5THQA 5JSFA 4QQRA 2JAPA 2QG4A 3AM3A 4BNZA 3TPCA 3GHHA 4D46A 1DAOA 3FPCA 3QY9A 4NBVA 2O4UX 3NDRA 4IDBA 2EHDA 2FR0A 4DL9A 4RQUA 2FP4A 3GGOA 1KEPA 1SCUA 2OP1A 2GF2A 3I9JA 3JD1A 3HFSA 4NZ9A 1T2DA 2UYYA 3I9NA 2DAPA 3ASVA 3WWZA 3MCVA 1K0UA 1YBAA 5DNAA 1HSOA 4I9UA 1YBVA 1PGNA 3VTFA 1JKIA 5A5FA 3FCOA 3NAQA 3HADA 3OETA 5F1PA 2JD2A 2V6FA 1MG5A 2C59A 3D4NA 2P9GA 4BKUA 4ZGWA 3VZRA 4KTTE 4PLFA 1KYQA 4EGFA 2PV7A 5L7YA 1GPJA 1A7AA 5IZ4A 3WXBA 2QX7A 1WZIA 3OHSX 1JKJA 1HETA 4NI5A 5COQA 3BMCB 4XR9A 2PY6A 2EXXA 1IULA 3TJRA 4EITA 5DCWA 5GY7A 1S7CA 4YJDA 1V35A 3DZGA 4U0JA 5ADHA 5I7EA 3OBBA 3MZ0A 3QW2A 1PR9A 4QO8A 1K3TA 2IYOA 5G4KA 2P5YA 4HWKA 3A1NA 1IE3A 1PJSA 1IY8A 2FZWA 3I9MA 4AJ4A 3HB4X 5F1OA 3VPXA 2G1UA 4E2YA 3ADPA 1LRJA 3GVIA 4CL3A 3RBVA 3GFGA 4XRRA 1MFZA 3IDSA 2CVQA 4WNIA 2I67A 4BO9A 1VKNA 3DBHA 4JQCA 3U4HA 1XWFA 2J5QA 1QSGA 3MTJA 1XU7A 2W8ZA 1J6UA 1VL6A 4J6FA 3U49A 4AJ1A 3FNHA 3VPFA 4Q3AA 2YQ5A 1Y8RB 2GERA 2NADA 3KSDO 4R51A 4AVYA 1R0KA 3GRPA 4J91A 3NTQA 2Y67A 5HRUA 1MP0A 1N5DA 1GUZA 3DXFA 1ADGA 2WEKA 4YAKA 2NLOA 1NFQA 1I3LA 3JYPA 2Q49A 4CR7A 2Y1GA 4Q3DA 1E7YA 3WIEA 5IDQA 2PKQP 5AXBA 4CUKA 4EEXA 3GG9A 1YOVB 5DCUA 5JLAA 1KC1A 2NWQA 2Q50A 4J0EA 4YRAA 5KOIA 2D59A 3ITDA 2WYVA 3X2EA 3JQ9C 1GCOA 2R6JA 3PHHA 2Q46A 3VOSA 4O6VA 3O8QB 1JVSA 4JBHA 1FDVA 2B4TO 2Y99A 1HZJA 3L6EA 1LRLA 1R4MB 4R1SA 1E5QA 2QYSA 4EYEA 4G2NA 2B37A 1FDUA 3PHIA 4FC7A 4A26A 4F6CA 2DKNA 4G65A 3R0IA 3F9IA 1FMCA 3W6ZA 4NU5A 3VDQA 2RBEA 3IOYA 4XGKA 3U4DA 4N7RA 1M2WA 1RM4A 2QW8A 5KJFA 2JD1A 3GGPA 4QXMA 5I9NA 1SC6A 1XG5A 3ZW8A 1XA0A 4CUJA 3KYCB 1E7WA 1O95A 2AQKA 3KTDA 1YVEI 1NNUA 2OMEA 2HKIA 4GL4A 4CM3A 2DU8A 2PGJA 5EESA 3SC4A 4L4SA 2JKVA 1CQIA 3CEAA 1JKFA 2D1YA 3BTSA 1C1XA 3TZHA 4WEQA 3WIDA 4RDIA 4E0BA 1DJQA 2OORA 1N8KA 3KV3O 9LDTA 1EBFA 3OIDA 3VH3A 2Y68A 1QP8A 3LSYA 4YT5A 1ONNA 1JLLA 2WE7A 2VRBA 2ZB4A 3FI9A 1LDMA 1PJ2A 4XIYA 2X22A 1VI2A 2Z1MA 5BR7A 2HUNA 3JQCA 2EP7A 2Q4EA 4W6ZA 4ALKA 2VYVA 3K6JA 4B3JA 3WYCA 3JQBA 1IB6A 4DLLA 1PJBA 3GRKA 4WUVA 2AEFA 1FXSA 2PGDA 4LRSB 3WFIA 1FF9A 1LC0A 1WZEA 2EGGA 5CEEA 1PWZA 3H9QA 5DOZA 2GASA 3Q1LA 4K28A 1UXIA 4D42A 5TT0A 4IBOA 1HYHA 1PTJA 4FPXA 1RJWA 1R66A 2YFQA 3JYQA 4RL6A 3WJ7A 3K96A 4EI2A 5C7IO 3H6KA 4XB2A 3GG2A 3VH1A 1KVQA 5AXDA 1VPDA 3AY3A 3BHJA 1I2BA 4EJMA 3WBFA 4B4VA 1WDKA 4L76A 4RLHA 1EQUA 3RSHA 1LLCA 2QQ5A 4INAA 5ER9A 2GN4A 2O3JA 2G76A 1BDBA 1YWGO 4XB1A 5FYDA 4XYLA 5CG1A 3UGKA 5A1TA 1Z74A 4H7PA 4PG4A 4CM9A 4BMVA 4FDAA 2D5AA 5G0TA 3DC2A 3P7MA 2HCTA 1E3IA 4HUJA 3QVXA 2BELA 5I8ZA 4D0SA 1GPDG 4TRNA 1JW9B
chains in the Genus database with same CATH superfamily
4PBTA 3PHGA 1P72A 3RDPA 4L5JA 1SUCA 1NT4A 2FW8A 1NJ5A 1KAHA 1ZK1A 2W6JD 4GMKA 1X1CA 4HEA1 2HJRA 2C0CA 4Y6RA 4LBYA 1IQPA 5HKKA 4OX9B 4Q9JA 1B41A 4CIDA 3V1LA 2XJ9A 3OPNA 2FPPB 2WR8A 2AG8A 3NKFA 1VIYA 3G2QA 3L4EA 4OGKA 3ANLA 2Z2JA 4NSNA 4I8XA 3JCZA 4MV8A 4W1SA 3SYKA 3ITNA 3ULKA 5LMNB 5IN5A 2BFCB 3G6WA 2GN6A 2QR3A 3AL3A 4QYIB 3GDFA 3LNCA 4JBGA 5ECGC 3GAAA 4DV1B 4FCCA 2P2GA 4OQZA 4KP7A 1PUXA 1G5QA 1Q0ZA 1RHJA 5IYZB 4RPJA 1XVIA 4W5TA 3KQMA 4GSKA 4BMZA 2VJMB 3N07A 4FWBA 4OEHA 3DR5A 2YW9A 4WNAA 2EP5A 1GN8A 3EBLA 4H0FA 4DV5B 1BDHA 3K0BA 1N6PA 2GRUA 3V8BA 2C2HA 1RBYA 3JWEA 3B20A 4CDNA 5FUMA 2B4QA 3FHOA 5DXAA 4B3IA 2P5TB 3RWOA 1EFKA 1U2GC 3M6LA 4ZVOA 5JAPA 1EQAA 1P17A 4MWTA 4XWOA 1VJ1A 1M2OB 1TF5A 3GRCA 4BFZA 4KITB 4MGIR 4LJ5A 3N2IA 4JU8A 2WZCA 5CT5A 4WJZA 4NG4A 3D31A 3ZQJA 5C80A 5IT9A 3PUJA 2HW8A 2Y9ZA 3OLVA 4BWFB 2J4CA 5HJ7A 5JY1A 1GPMA 1MUUA 1KJIA 2ECFA 3C1UA 1V5EA 2RH5A 3HR4A 4L95C 5EAIA 5JOQA 4G0WA 3C0KA 2P4EA 4ND1A 2XEDA 3P5SA 2FPXA 4ZMRA 1KAEA 2H2FA 2G9RA 2WU0A 3IDOA 4BNKA 4IG9A 2MINB 3L8YA 2I8LA 2ZYVX 3CLTD 4UMDA 4BEVA 4E2FA 5CK4A 1JI3A 1NBME 4IXDA 3IEKA 4KOEC 5H4GA 5G1NA 2WE8A 2XE7A 2VDLB 2C4WA 3IPXA 3SE0A 5AW1A 1EFLA 4KMMA 3DAOA 4DMFA 5HNKA 4ICIA 1VG8A 3ZK8A 5IFLA 4FN4A 4HXYA 4NPAA 1R88A 2Q3HA 4F4IA 1MCZA 1X8LA 4KCGA 1K7XB 4J1QA 1CE8A 5JDCC 3TTYA 1SWWA 3QFRA 5IN4A 1NMQA 4M1QA 2ZYGA 5B57C 3K71B 4W5JA 4MTLA 2UAGA 1Y6ZA 8LDHA 5F7OA 1J99A 2IX3A 2IHUA 2QLNA 1Z06A 2WPNA 3NIFB 2BR3A 4G4IA 4JT9A 4QEKA 1GAQA 1QK5A 3EEYA 2W90A 1CP3A 1DOAA 1G6HA 4F72A 1DFIA 2TS1A 3H9UA 1N5IA 3FG9A 3GOHA 5DGCA 3OAAD 3DG9A 3P19A 4G26A 4HEHA 2WYUA 3TE6A 1Z0ZA 5IJ9B 5EIFA 3HCEA 1ZVKA 5LQCA 2QUKA 4LWQA 2WWRA 4ETWA 1SAYA 2CXSA 3BQMB 3IHKA 4PANA 4UMFA 4DBLC 1D6MA 4EJ6A 4G97A 2XQIA 3JWGA 2Q1XA 4CMHA 3DL7A 2XB9A 1YZ3A 4CMEA 4MVJE 5CURA 2DG2A 4I08A 3UJHA 5L3SB 1T3GA 3FWNA 3PDIA 4OQNA 5CYFA 1DP4A 1GQOA 1DDGA 1TPYA 3LO5A 4HPXB 3ZU5A 1W73A 1IAQA 1Y3AA 3ICCA 3REGA 3T1TA 1HBJA 3ZU3A 5C8VA 1E96A 3BAFA 4BNDA 4CM7A 2FLVA 3CB4A 4HS4A 4MRVA 4XFJA 5C34B 4ZK2A 5ICSA 5K8CA 4XYMA 1CZOA 3P0RA 4FNGA 2I4IA 2O8CB 3F5MA 1RQNA 1FNDA 1X13A 1YFLA 1HEIA 2YHBA 1Z7EA 2N1BA 1OX5A 3IFSA 1P4HA 4WLNA 1IG3A 1NXWA 1O58A 2BV3A 3TIFA 4KMSA 4LQ4A 5MN4A 1A95A 2ZWMA 1U7PA 1SEPA 1G8GA 3PUYA 4DR2B 1OLXB 1CXZA 3LKZA 1PGQA 1IWPB 4IP0A 4KIGA 5G2OA 4RO0A 2D7CA 2A0KA 4G67A 5FAKA 3WQHA 4KWHA 3ST7A 3LHIA 5LBUA 3HZHA 3T5PA 4PHGA 1GQYA 4NJOA 4YRKA 1JTEA 2VHXA 4U6SA 2JK1A 1N25A 3GFPA 4N03A 4MR7B 2BAGA 2QORA 4UU1A 2D4AA 3EDRA 4RF3A 1R5OA 1T8WA 2CLIB 3D7NA 2R751 5BR8B 1VE3A 3PP8A 1NN1A 4KVFA 2OV6A 4TN5A 4X6XA 3T9CA 3W4IA 5DM60 1SXPA 2ZLBA 3FD8A 5DASA 3VVCA 2WNSA 1UBMS 2G80A 4PZ9A 3KVRA 2FNAA 3H9CA 2XYPA 4BASA 4B7UA 2WQ6A 1MW8X 1JN0A 2M6LA 3ZOKA 2CD9A 4X62B 4LRQA 3E81A 4MGEA 3S2SA 1FXWA 4E3WA 1S2NA 4N39A 3TOVA 1FE8A 3KBBA 5BN1A 3VHQA 4M1WA 2NO5A 1NVWQ 4KSCA 2XTJA 2JGJA 2UZ1A 1TEZA 4ABTA 1QIEA 1XXLA 4KAXA 1OLUA 4JT8A 1TW2A 4QUIA 1TZ2A 1VDMA 3GXOA 5BQFA 1U1FA 1S9HA 4DEVA 1VKJA 2JVKA 1O3YA 4O1MA 2C9OA 3W5CA 1ST3A 1PNQA 3KL2A 2HA4A 2DM6A 2BDUA 3I1JA 1XRNA 4MUFA 3Q9LA 4I2NA 1MF7A 3SOPA 4FMBB 5B6IA 4RHYA 4F21A 2B3TA 1MENA 3T1NA 4F5WA 5AI5A 1K5GA 5F5NA 2FMUA 1HDIA 4QPJC 5BW6B 4Z4GA 3VNSA 1QWOA 3H2JA 1PF7E 1ORDA 3B60A 2OV4A 1V3QE 3PHBE 4NFYA 3VVBA 4B3FX 4YA6A 1A71A 1PKEA 5ARDA 1E4EB 1R8XA 2AFRA 5J2UB 4BAGA 2FJ0A 5CFMA 2O8BB 2PYDA 2VP2A 3M5WA 4RIHA 4ZO8A 4BZXA 5M7EA 2C88A 4R2MA 4R9RA 3RRNA 4G89A 3O0TA 5I9TA 2HJ9A 5FNVB 4OU5A 4R3UC 4NH4A 2ZRMA 5C8YB 2RAVA 3DF9A 2WFZA 3PPYA 3RRXA 4JAVC 1CUGA 1V47A 4WOPA 4YP7A 1QG6A 1R5NA 4JD5A 2G06A 1YSCA 4QWWA 1C3EA 1ESMA 1L5FA 2VPPA 4EVRA 2RHBA 4QJ4A 4FQ8A 1G5HA 2FP4B 2O8VA 3A1FA 3D02A 3TNDA 5IM4A 1C0IA 2GCPA 3HJCA 1OYYA 1P7ZA 1K06A 3P32A 1U28A 2PVSA 2DR2A 1MTOA 4F86A 5GGYA 5L8VA 1UBOS 5IEBA 3C1OA 1RHRA 4MR9B 2ZM6B 1KS2A 3U17A 4KVGA 4NMHA 3EVEA 4E1BA 1V6SA 5ELMA 1OASA 1C0LA 3F5DA 4NECA 2QTVB 2J3MA 3DMGA 3EXAA 3OZVA 4JLPA 3JVIA 3FCXA 1GKLA 4RMGA 5CLLA 3VTAA 1V39A 3PGVA 2VTVA 1WMSA 1ZSYA 4M86A 4B74A 2EJWA 3ZWDA 4IFBA 2JJMA 4LDQA 4L4ZA 1PV4A 4EFNA 1FLNA 1JLKA 4YO7A 3ZD7A 1VSVA 1ZK2A 3F6SA 4BE7B 4HN9A 2BGGA 1NVUQ 2DY1A 2IXTA 1SQFA 1FPMA 1Z8FA 3OJXA 1F2UA 1XE3A 1U3CA 1P45A 4P2BA 3C41J 1JL3A 3EZ7A 1PV2A 3PRJA 1U7XA 2O1SA 5FL7A 1LI7A 1XJ0A 5DI9A 1F6BA 2BGLA 4RZSA 4KXFB 4TWZA 1UH5A 2HDNB 3N2LA 1G2QA 4ZAZA 4UTNA 2AJ8A 4RMJA 1OI7A 2K87A 4YRTA 4WBXC 1Q7EA 3TQIA 4IV5A 3C5HA 4XUGB 1QOZA 4LAFA 1DQZA 5ESDA 2CDRA 5C46F 1SOMA 2ILTA 2EF1A 2I3ZA 3CX8A 1CD5A 4N48A 1U90A 2C7PA 4O4JB 4Z4FA 4GOLD 1Z6GA 3Q5GA 4QFDA 4AMBA 2YNMD 4G5YA 3AG6A 4M6WA 3HL4A 3IAM1 3JALB 1VIVA 4O4HA 1RZUA 2GCGA 3ETNA 3KPJA 4RSGA 4Y2SA 3S44A 4C0LA 3O2NA 2IKSA 1KDRA 1KY4A 1R37A 4HDSB 3DDSA 2Y0BA 3F7NA 4KNWA 1QPBA 2O50A 3DHVA 1ZN2A 1G8YA 2JRCA 3KJXA 1T15A 5EOVA 3NEYA 3ZU4A 5D3QA 3AVVA 1X1EA 4QG3A 1IWOA 1GZ7A 1K6MA 2VHJA 2XT0A 3SSMA 1SCQA 4O5AA 4W7HA 4CCWA 4FIZA 1P5RA 1NFFA 1NSYA 1J22A 3E05A 1XHFA 5A9SA 3N9IA 1VMEA 1M1YB 4JN6B 2JIBA 3WMFA 3LP8A 2IIBA 3RBAA 3TFQA 4XKJA 2YVKA 4N18A 2XDQB 4DSTA 3F4BA 4CM1A 2AFHA 1WCV1 4OQDA 3AH8A 3SXUB 3GAFA 5H59A 3PHCA 3UYLA 1RAEA 2EWVA 2HJWA 1XEWX 1E66A 1VL0A 2HMWA 4BGIA 1AO0A 3D9QX 4KDEA 3VKWA 4Q3OA 2XRYA 1XYYA 3BICA 3QJGA 4QUAA 3G0BA 4TS9A 3OZCA 4DUGD 2PD6A 1R1DA 3NCHA 3CH7A 4KGXA 4YI3A 2H9IA 5JYEA 4OI0A 1NN5A 1BMQA 1TCVA 1FZQA 1H69A 3DBVO 3GW8A 1IHXA 3ETHA 1NVMB 1KVRA 1Y37A 3HWWA 1NC3A 1TTHA 1UC4B 3BRSA 4E3ZA 4HVCA 3TTTA 3GI1A 2P4SA 3C3KA 4YAWA 5EXDA 5KOJB 4JBYA 3DAPA 3IE2A 5B7QA 2VRWA 5E6UA 4QODA 5HKLA 4QJ3A 5HUQA 3SYRA 3HP7A 1KQNA 2WWYA 1JV2B 1A9XB 3ZD8A 4NU6A 3AJDA 1LRKA 1QHIA 1XB2A 2H2WA 3GGGA 4FJ0A 3AZPA 5LP6C 3NIGB 3LOPA 1A2OA 1SHLA 2GBIA 4TOIA 2G9UA 2WKSA 3NNSA 2DT8A 4A5OA 3ESDA 1RVV1 2I1WA 2Z2IA 2GEBA 2AJCA 3G7NA 3GJ8A 3IR6A 5TARA 3T4UA 3WISA 4CMJA 5I8PA 2B0CA 3NLLA 1U8ZA 2OFXA 4PYIA 5HFAA 1BRMA 3ZBUA 3TLYA 4W9MC 3K09A 4D9EA 3Q2IA 2GKSA 3O7MA 4L7QA 4PO1A 1CRLA 4I9HA 4X90A 5EZSA 2JG3A 2CXNA 1NTOA 4JX8A 5JZOA 1ACJA 3W5JA 1TIBA 5B5SA 3ZTYA 4HX2A 1Y5LA 2XRMA 1NDHA 1TVEA 2GETA 1KDPA 4KRYA 4WZAE 3TDNA 3S2YA 2RGBA 3BE4A 4JJKA 5FUWA 1EEHA 3GH1A 4PYRA 4W9NC 1BN6A 4QX6A 3BKXA 3BGVA 3H2BA 1IL0A 1Z2OX 2OD7A 4ZEWA 5JS2A 2BGTA 4KREA 2FWBA 3UHPA 4DJDC 1T1GA 2ZQ5A 3ECSA 4WASA 2O1WA 4QYTA 1CVLA 5LLDA 2QF7A 3QUTA 3NP7A 3IPLA 3E82A 1M0TA 3L1HA 3ZCQA 2PYIA 1EVIA 5EHIA 2I3GA 5BNZA 4TKUB 1ODLA 1R0LA 1T3HA 1I0IA 2B78A 5CLGA 3RBZA 4DA8A 2YC4C 1O8BA 2O4CA 2ZRIA 2BKVA 4MA0A 4WE3A 3C2QA 4TQGA 4X0EA 3TD2A 5CDFE 2XCRB 1EG7A 1KAOA 2YWDA 3UPUA 4D9NA 1THMA 3LIPA 3K0AB 1M2KA 4P4LA 5BN4A 3OEWA 1DJLA 4O2LA 2Q29A 1XZIA 2PBLA 3EUWA 3K1AA 3C45A 4WV3A 2JCGA 4YAFA 5DB4A 2XMCA 3DLAA 4HZUA 4ZCSA 2JA2A 4XVRA 4DRXA 1U9IC 4J0IA 4I1UA 1T34A 4GWGA 1NE2A 3RNLA 3QTLA 2BTEA 1US8B 1RABA 1TM4E 4MW1A 4G0UA 2NV0A 4L2IB 4P3PA 5B2EA 5AW8A 5THXA 4A5SA 2Z5FA 3FLBA 4J9UE 1SKBA 2KSQA 3LA6A 3NHWA 4JSYA 2C03A 4ND8B 5CPFA 5FUXA 3GDWA 3HEAA 5F3RA 3AIOA 4MI1A 3H5IA 4IM7A 3PJDA 2D2EA 5K0CA 3RARA 1WMEA 2LKDA 4ND7A 2X0DA 1U11A 2PKXA 5JQWA 4H1HA 1JRLA 1G4HA 3D6AA 1T0BA 1T9AA 1H0KA 4FFWA 1OBVA 4NZNA 3AV0B 3K94A 1TM7E 2O59A 4EHJA 5DYNA 4X20A 1HF3A 3L5OA 3FPAA 3VGPA 5LDDC 5I3CA 2XLBA 3KXPA 3OESA 4TV8A 4Z8XA 3FXAA 1F48A 1UP4A 1N4AA 2EKQA 2VCEA 1WD5A 2JI6A 2ZE8A 4HRXA 1DI0A 4TTSA 4AJLA 3C15C 4BO8A 4OK6A 1GD1O 2YHSA 1IHPA 1YL6A 2P5UA 3H86A 4C30A 4BNXA 4EDFA 3J80A 4YJ2F 1IXKA 4V0KA 2BEWA 2G09A 2ZRGA 5E2AA 1NUAA 1CK4A 3AO0B 2LDBA 3ND9A 4XQEA 4ZQHA 3MJVA 4BWYA 5D5HA 1ODIA 4X7PA 2G1JA 5HK9A 2QB5A 1RXUA 3P4UA 2ZATA 3AEQA 1W2HA 2FUCA 3MSCA 4FVTA 1VIAA 1YMUA 3ONEA 5DBOA 4CM4B 1GGKA 3HB0A 3CSDA 2XIQA 4A91A 1OX4B 3KYDA 3M8KA 1RXEA 2X0EA 1C5KA 2OL4A 3C74A 2IITA 3K73O 1CUAA 3KQVA 3COSA 3MOGA 4HXEB 4P5EA 1W47A 1NBMD 3EXEB 4GKVA 4WGFA 4X1YA 3CVXA 4NONA 1N1GA 3FOBA 4JHXA 3HXQA 4YJFA 3QVWA 4NYJQ 5KI6A 1IOZA 1DKPA 4UUBA 3KWJA 3IE0A 5LOVF 2FUKA 3CF2A 4FIDA 3WRYA 3ONNA 5LD2C 2F43A 4N6NA 4O4IF 1C7EA 2YBDA 3E8XA 2YJTD 4OLJA 1W59A 1WSAA 1XMXA 4HAXA 2QUJA 1H2HA 1VHLA 3HL0A 1XRSB 1CUXA 3LLVA 5FFNA 4YP0A 4ZVMA 3F1LA 5FHQA 3CV3A 2YVLA 3HLKA 3NKVA 2UKDA 4XQGA 3OE1A 1X9GA 3DLCA 3K5WA 2NACA 4DT1A 2Q21A 1IUOA 3KETA 1M67A 4OQFA 1T26A 2PCJA 3W7VA 4RD3A 2PJZA 1JSRA 5K3FB 2I54A 2QROA 4R1NA 9GPBA 1UUFA 2A86A 2J7PD 3GAZA 4BWVA 1KY3A 1SB8A 4B3RB 1XR3A 1XELA 2H0QA 4X8HA 4URXR 1ULBA 1AN9A 3KPWA 2ODBA 1SPXA 4WCFA 4Q39A 5EUQB 5IAAA 1HG0A 3V6MA 3DDZX 3IKMB 4BO1A 4D8VA 5LUBA 2IPLA 1MX5A 1EI9A 1ZEJA 3LWDA 1JR4A 1FU7A 4IOJA 3FNEA 1W1UA 4NHOA 3QOWA 5F23A 3LDGA 4ABYA 1GPKA 2FUG1 4FDMA 3RI3A 2IXGA 4J16C 4AY2A 4NJEB 1JIVA 3U6KA 2A1UB 1DWUA 3H2HA 3SJBA 3G7SA 3VR6H 2G9QA 1JXQA 1P5FA 2GB4A 4WK4B 4FWTA 1JG1A 1JQAA 1T5LA 1KZ9A 4NHEA 4XCXA 3PDJA 4FLEA 5A03A 1SM4A 3KQNA 2IYFA 2C0PA 1KH2A 2BLNA 2FN4A 2G25A 4LF6B 3WL7A 4HFJA 4A82A 4HNGA 1CIPA 1BJKA 1XQ1A 1KEKA 1N34B 1Z4LA 1OWNA 2COUA 2GCOB 1LFAA 2UDPA 4XDGA 2R68A 1CUDA 3IAXA 2NT3A 4YRDA 1SU8A 2CD7A 1R64A 3FSRA 3MTGA 1USWA 4OHPA 5BWOA 2FPGA 4MA5A 1JPVA 1IDN1 1G41A 1ECLA 2V6MA 4JB8A 4ZRDA 5C5IA 4HJXA 3TFOA 3UTCA 3KSBC 3EG9A 1Z3CA 2JFGA 1SGWA 4J0KA 4FHEA 1CZHA 2Q1TA 2ZAYA 5A5GA 4BE9A 3TYXA 4NFSA 1UXGA 1WL8A 4C6TA 1P0IA 2HU7A 3E5RA 2J41A 3AL0C 4RTSA 3TL3A 1PZEA 1SFRA 4B75A 1U2GA 1TQ4A 1J0BA 2E2WA 2ST1A 3MCZA 1K92A 4CIXA 5J5AA 5K51A 3IAFA 1CZUA 1I1OA 1KXZA 2A3NA 2XZLA 1C7FA 3U4QA 2BEKA 3LECA 4IF4A 5HZMA 4X85A 3V32A 2Q4OA 3NP9A 2QVCA 2YYYA 2CYBA 3R5TA 1WXXA 4FR0A 5DM0A 1L1FA 3WK8A 2CXUA 2BJWA 1NNI1 3I1YA 4LSMA 3M6FA 4HB3A 2HJVA 2OE2A 4QOFA 5LQAA 4FDUA 4BFYA 2H51A 1YHZA 2JFBA 4R8LA 3C6XA 5A7FA 5I01A 4JFRA 2Z2KA 2ZT7A 1IN4A 1LUAA 1EXNA 1U0SY 3AMVA 1M8GA 3OTGA 2FU5C 2YW2A 4WJKB 4LVCA 4X3CA 2FSIA 2HIGA 1T0UA 1X2BA 1P4RA 5ALVA 4NXNB 3IULA 1MPXA 2X8BA 4JIGA 2Q0XA 5FL7D 3V1KA 2VDOB 3SFTA 4M53A 4MGYR 4AJ9A 4RK5A 2CW5A 5BQ3A 1TK3A 1PU2A 2C83A 1W4ZA 1NHGA 3BK7A 4GOJA 3UMBA 3I2YX 4OYLA 4EF5A 2GAOA 1E0AA 5JDCA 2G4VA 4O2AF 1PEYA 3QU7A 5CVUA 2PANA 3AEZA 4KZKA 2HRRA 2Y93A 4M2LA 2OVBA 3G6KA 5MN6A 4LZNA 4ZQCB 1DBRA 1M54A 3AWIA 3E35A 3RM3A 5F51A 1H6DA 1GZSA 3OJEA 4AJKA 4Q5IA 1ULAA 4NCJA 3L4KA 4BU1A 1UKVY 4ZT6A 1P1FA 4KXMA 2GLTA 3QKSA 1WPGA 4JUCA 1Y98A 1FUKA 3DL4A 2IZ0A 3WGHA 4YV7A 3BUSA 3BCSA 4EHHA 6GPBA 3TNYA 1BEZA 3O26A 1X9HA 4Q3CA 2OAGA 4POOA 1U8CB 2H4YA 4YDSA 1MB0A 3C7KA 4GPBA 5JAMA 1TO2E 4FB5A 4XJTA 2MDTA 3LYUA 5LA6A 2V65A 1BMFA 1G8FA 3UAVA 4ER0A 1CY4A 1SBQA 1ZRNA 2G07A 4H1UA 4W5NA 4JV5B 1XV5A 4UFOA 3KHTA 5ARBA 3B8HA 3A4VA 4R1UA 3PGXA 4IIDA 4EG7A 1YB4A 1V2GA 1IDOA 2A5FA 1LSSA 1NYQA 3AEKA 2HXSA 2BFOA 2JGNA 3OPXA 3Q7TA 1U3UA 4ZCTA 5LUAA 3GVPA 3S7TA 4OQPA 3GNQA 3GLIA 4UBKA 4C6HA 5HX7A 1CZRA 1LKZA 1XKXA 4C01A 4DIMA 5JXWA 1A88A 1UZMA 1YO6A 5G40A 2ZITA 2Q5OA 2DULA 1E94E 1WW8A 3A7DA 1XA4A 1RD4A 3MCWA 4J7CA 4N0DA 5IJAA 5F77A 2BFDA 4YMTA 3IAS1 4QOHA 3VPCA 3ERCA 3EGXB 3CTVA 2H54A 4ZYTA 1I3MA 2ZAIA 1XD2B 3OTWA 3TCKA 2ZZMA 1C7ZA 4V0NA 5BSUA 1YQDA 4P92A 4A2PA 4TZ0A 3CF6R 5IDXA 4RA6B 4RDXA 4U2BA 4EB6A 3W2FA 2JFOA 2QQEA 3TEFA 4INPA 5J59A 2GN2A 1T3SA 3S28A 4HN2A 3OTOB 1E2LA 3OOEA 4BZWA 2PL3A 2XVXA 5DI3A 4DMLA 3R3JA 1SO8A 3ZQ6A 4ZQEA 1A9YA 3CS3A 4OOEA 5DISB 2IHYA 2BUAA 1FUUA 3UUWA 3DO5A 1QNLA 3QI2A 1QG2A 4YT4A 2DBZA 1A97A 3I4FA 2O3UA 4GVLA 3VYRB 1PT8A 3FFXA 1W52X 1HE5A 3KP1A 1GT91 3RS2A 2CVOA 3ILXA 1D4FA 4N49A 1J90A 3O8QA 5CXXA 4ZANA 1JVNA 1IPFA 5TVGA 4AMZA 4B7XA 1R4NB 3MXTA 2HPVA 1CVRA 4CLXA 1OFUX 2QY9A 3AHEA 5IH3A 4AS2A 3RH0A 4EBBA 2WT9A 2NNLD 3IKJA 1U2EA 2ZRFA 1CR0A 5THKA 2JS7A 3GFOA 2JLYA 2QTAA 2K2QB 3Q12A 1E5LA 4ZYZA 4ZKEA 4EFLA 2ABWA 3A36A 3FNGA 3B13B 3M1LA 1QIGA 4JP8A 3TKYA 3V6LA 4E31A 3S2UA 3VR6A 1I2MA 3FGOA 1FP2A 4GNKA 4NY1A 1LLQA 2AYXA 4TLLB 4P3XA 1HE8B 3N8GA 4CT0A 1KARA 4LYGA 2H11A 4LHWA 1B1AA 1EFDN 1IZYA 3G1UA 3P9PA 3VX4A 4XFKA 1OV4A 2BEJA 3EFOB 3QE4A 4BNMA 3PNVA 2Q3JA 5FUYA 2J33A 3W3ZB 3DP9A 5IXSA 2JCXA 3DDCA 3IPYA 3NH9A 2VF2A 2DBRA 1IEXA 3D7SA 3TOSA 4OLAA 4Q1CA 3ABSB 2RHJA 3HKCB 2WJJA 3DVQX 1C9YA 2HQ1A 4RQTA 4RLQA 2WV9A 1Y9EA 1Q1EA 2X6RA 4X8MA 3VV3A 4LRUA 3LLCA 2MMGA 3DGEC 5JCJD 3K70C 2GBLC 2L69A 2PGLA 5IC5A 3UV7A 3SF8B 1E0SA 2I71A 3D0RA 2Y27A 5C4GB 1PI3A 4EY6A 2MSKA 1RRPA 3RC9A 2D7JA 3EFHA 1MV8A 1ZINA 2ZTUA 1AGYA 3DV0A 4BV9A 1BE1A 2J0UB 5A4DA 1YJQA 1QXSA 2ZBQA 5AKXA 5T8KC 3MJRA 3S7ZA 4OTZA 4Q9AA 4D0LB 1SBCA 2EP8A 2F9FA 2ODNA 3H0CA 1T6ZA 3HUUA 3LBIA 3SMVA 4IUBS 1XAIA 3WK9A 5BUQA 1HDYA 2ADOA 2BMJA 3PC8C 4ZVNA 4CKZA 3DAGA 3O31A 1JIJA 1SCKA 1OD6A 1LTQA 1UAYA 2JAOA 5TJHA 5JRDS 1FZTA 3O8RA 3RS5A 2HFKA 2UZ3A 4WY2A 2NXJA 3FGPA 3Q8XB 4GQBA 3UCFA 1L0BA 4BN0A 4QTUB 4B4KA 1J0AA 4KNVA 1OVMA 2HHHB 3OQBA 4HGZA 5FA5A 4I9NA 3LSTA 4NU8X 3WICA 2GD2A 1PX2A 1R00A 3WADA 1EVLA 4UZEA 2C58A 2IUUA 1VSBA 2ZTVA 3I6MA 2A9FA 1O96A 4G0NA 4L22A 5HOEA 4PRYA 2Z8ZA 2VFAA 3K0CC 1UBNA 3NUZA 4PFJA 2ZRNA 3X2FA 3ORSA 5H82A 4ETMA 2BISA 2Q27A 1ENOA 2IHJA 4S1WA 4MAMA 3CEPB 4UHEA 1AKYA 2JKYA 2YWHA 2YWEA 3C14C 2BFBB 4QXAA 4RQAA 1N2JA 3DMYA 4EUSA 4H1WA 1H4VB 1QFSA 1Z13A 2EKPA 3H2GA 1ZCZA 1UM9A 4JUDX 3X1DA 5MGBA 2CWDA 4XVCA 2HI0A 2IEZA 2R65A 1IM5A 3NBYC 4RPIA 5J58A 3EPRA 4B3MB 3D3KA 4NQRA 2C96A 3PNBA 4P93A 4E5PA 4PPGA 4F5YA 4N12A 3BF7A 3N2GA 3DMDA 4R5HA 2W6CX 4ZTBA 4RY2A 2FRVA 1N9KA 1K3FA 5FLYA 4NZOA 1L7MA 1NU8A 3PLRA 1P1RA 1QIKA 3ZBTA 3TRIA 5IX8A 4GLJA 1BXRA 1N6NA 1N2BA 1V8DA 1A8HA 2CSUA 2FF7A 3OY2A 1R12A 4R41A 4B3HA 4ZODA 4NZYA 1GZ4A 1E7RA 1H5NA 1XZLA 2PO5A 3L8FA 3OWOA 3RR2A 3SD7A 4KMOA 5BMVF 4HNUA 4DV2B 2I6XA 2PMFA 1QCZA 2P9BA 4OF4A 4US1R 5K3CA 2ZZNA 1UC9A 1C3JA 2YFHA 1KS9A 1Q83A 1ZRSA 3C4VA 3WKAA 3L7AA 5BT9A 4LHVA 1SHZA 2IXDA 3MYYA 4ZP1A 2OESA 1QQ5A 4ID3A 3DTYA 1XMOB 4FCTA 5JJCA 2PCLA 3PXEA 3LRXA 4UMEA 3TN7A 3CX4A 2WIAA 3GJ0A 2Q0SA 2VKQA 4PO9A 3ZI7A 1VCHA 3SX0A 3LZDA 5BSGA 4PZPA 3OQVA 3KM0A 4AG6A 5GJBA 1KPIA 1NVFA 3N75A 2Q9AA 3PDHA 3QXXA 3E48A 5JO9A 1XL0A 2RGNC 1UMCB 1GAWA 4YT2A 1KJWA 2CC2A 4JLWA 4IJQA 3OU2A 3UM9A 2GH1A 2W42A 4CG1A 4P4UA 1P19A 5EGSA 2AMFA 2V0NA 3MELA 4MYTA 4Q3BA 5AK3A 1F9AA 1WNTA 3D6MA 1AK9A 3AIKA 1P62B 2CL7X 1YR3A 5LP6A 1IPHA 2Z2XA 3CZMA 3IQZA 4E30A 1KORA 2Z8YA 4LCJA 3OT5A 3VNAA 2O9JA 3JASB 5EXXA 2MT9A 4JP3A 2CFRA 4MNTA 1SK9A 2YMPA 3HK2A 4QT4A 2F67A 4L3OA 3WLPA 3C6BA 1C1DA 2I29A 3GJ5A 1UKEA 3ZWWA 2CF5A 2IHBA 3LY9A 2DY0A 3HYLA 4IOKA 1GQ2A 3HKDB 2X86A 4ND2A 2VNAA 3N39C 5B53A 2WD9A 1UFVA 1KEEB 1D6JA 1YACA 3A6FA 3DEJA 3FDIA 3HXTA 3CKLA 3IIKA 5JZMA 1Z62A 3ENQA 1RXCA 1KK0A 2PX0A 3U0BA 4W9NA 3MTIA 1EFUA 1HT1E 5A2GA 4XARA 3TNLA 2ESRA 1YTLA 2XCUA 3BH6A 3FPBA 1Z2CA 2FMXA 3B6ZA 4O4LF 3W1VA 2CT8A 1JTVA 3INTA 3RYIA 4FMPA 3L4BC 2LP4Y 1F2DA 5JROA 5KTRA 3GLGA 3IEPA 1GR0A 2D74A 3ICQB 2YY7A 1IH8A 2ZGVA 4JBWA 4YCJA 2ZJ2A 3UG7A 2PTHA 2WTXA 2WKPA 3EARA 4JLSA 2P7HA 3FTCA 1L5HB 3HJRA 1G5FA 1AXEA 1EA5A 2VYND 2ORED 4F3TA 2G70A 2G36A 2ZRCA 3F3YA 2NNWB 2A78A 3RBXA 1FBTA 2E89A 1UPFA 3CEHA 5CPBA 1EWKA 1MB4A 3WDKA 2GEUA 3M1AA 4I55B 4JLDA 3ZY3A 3AXSA 3LXXA 4K9OA 1PIWA 2QPOA 4NV1A 4BAUA 5C18A 1NUHA 1U9IA 3UXYA 3AOEC 5EJ8A 1UDXA 3KTAA 1M6WA 4MHSA 3IO5A 1D03A 2OHJA 2AK2A 3EYAA 4FMCF 2J3QA 2MIIA 5DTMA 2VPXA 4FYJA 5BQOA 1VYVA 2JFFA 3G3EA 4FDVA 3MWKA 2HYDA 4NEHB 1DEOA 4BRSA 1SBHA 1R8JA 3IA2A 2OMKA 2QV7A 1UBKS 1J8QA 5ESXA 3T12A 2H1VA 4BMCA 2V7WA 4F0JA 3E27A 1TVCA 2ETVA 4KUGA 1QV9A 1W35A 5K0FA 1I6KA 1OBHA 1OWOA 3LGAA 4MP6A 2HEIA 3WMRA 4JGIA 2FYTA 3AKDA 4RYLA 1RP7A 2EERA 2WUEA 3FOWA 3TQQA 1Y6FA 1RBQA 1MZPA 3A6DA 4G25A 2W83A 8ATCA 2ZREA 2ZE6A 2WP0A 2AA3A 1QIMA 4L0DA 2PS0A 4RE5A 5GOZA 2CK3D 4XD7A 3L8DA 1I4TD 1AN0A 2FZKA 3DT6A 4E6PA 2BE7A 5LU8A 1HKUA 3OQIA 2BCEA 3IP6A 3ZV6A 1TX4B 1UPUA 3ACCA 4UBLA 3ETJA 3ZE6A 2ARKA 1QGYA 3RTCA 3NKLA 4UFPA 2PUWA 5E3HA 3EEIA 2XDYA 2VCHA 4WL0A 3VC7A 3AKYA 1BN7A 1XEAA 3ZH9B 3KQTA 4H6XA 3ZWVA 4V1CB 3I5XA 1DAPA 4ARCA 3LX5A 1T4DA 3CZCA 3KZXA 1BE6A 4QOGA 3RUFA 4ESOA 5HKBA 3BWEA 1N33B 1M66A 2PUCA 1UOPA 6CHYA 1JFRA 2RJ3A 3QEBZ 2HLPA 2ZE5A 4HATA 4IV0A 1JXOA 5AQ1A 1KYYA 4KPUA 5CJ2A 1W88A 4V0SA 1ODKA 1ZMOA 5AHOA 5IK2D 3I6ZA 1X8KA 4F92B 3NEJA 4F3NA 3QU9A 1RAIA 4PZLA 3JQAA 4JASB 3BN3A 4TZKA 2W9XA 3GGDA 5B1SA 1NJ6A 4G4JA 3JWJA 1EGQA 3UJ8A 3D4LA 4AZSA 2JLCA 4R7GA 4I1VA 3F6EX 1U7HA 2O0JA 4Z9AA 4CR8A 1CQIB 2OZPA 2FQYA 2H4JA 3EW7A 2H52A 2ZBGA 4X7BA 1T1SA 2O3RA 4K88A 2JHCA 3EMDA 3PXBA 2C5GA 2FA9A 3QELA 1AKEA 3ZDQA 4YCNA 3EA4A 1WBJB 3PBKA 3PD7A 3KSUA 1RAHA 4Z0TA 1JLLB 1H2EA 4B81A 4IJ5A 4UEWA 4TRRA 2R7NA 3RAJA 5KYWA 1G4UR 3RVJA 3V00A 1YUBA 3R6LA 1P1IA 5F7ZA 1D4AA 1ZOLA 2FSUA 4YP1A 3T94A 4KXNA 3R5XA 4EZIA 4EKIA 5JASA 5HS6A 4TTQA 1USKA 1K4YA 3QXJA 4Q7JB 4JI3B 4CHTA 2I80A 4LXHA 4H6PA 5EXPA 3T7AA 1OWPA 1KEZA 2C2YA 3IBTA 5K4HA 3TMAA 2Z04A 2WAAA 1T29A 2CHGA 3E5HA 1JYSA 1F12A 3RLIA 1JHPA 3O4FA 4XEHA 5BSHA 1QHEA 1QHNA 3NEAA 1S8NA 3AP1A 1XWWA 2EFHB 4IDAA 1FYEA 4J16A 2KX7A 5D85A 4F2HA 1JWLA 4JJEA 1KTVA 5IJ0B 1B73A 1ULUA 1IC6A 2POQX 5FX2A 4PC6A 2DVMA 3VR6D 3T5AA 4B43A 5A02A 2MYNA 1I33A 2G6BA 3GT4A 4S2UA 3GPCA 4J3JA 5AJXA 1GNPA 4B73A 2O5VA 4YJ3F 1DMRA 1ZIDA 1L4EA 1B43A 1SG6A 1YZVA 2XRFA 2ZTMA 4FFBA 4WKGA 5LXTB 1CJVC 1VKOA 1L7PA 4YMLA 2J3JA 1DO8A 3SDSA 3WYGA 4LJRA 1AKRA 3I5MA 2J46A 3HGMA 3NZEA 2F3QA 3OF3A 8ABPA 4KWTA 1VYTA 4MDHA 3WFJA 4X84A 4AZ3B 4R71A 1UWKA 1J9ZA 1JHUA 4KFUA 5IULC 1E9FA 2FFAA 2EU8A 1KOFA 4LHYA 3WOVA 3IMGA 4ZVUA 3UHOA 3BJZA 2LR0A 4YPOA 3ZGNA 3ROGA 2AKYA 4HX9A 4N3AA 4LZAA 1A8QA 2I4TA 1J33A 3ZKWB 4CVNA 4G9EA 4D4MA 5LQUA 4Z51A 5CVDA 1ID1A 1L7AA 4MYRA 4YHHB 3U4GA 3B8EA 4FFMA 1L4UA 2QMOA 2TRSB 2O54A 1PW5A 4FFOA 2CJFA 2SCUB 3SM9A 1QHFA 2B34A 2WA1A 1WHTB 1U80A 3JQPA 1K5HA 2VYFA 3EPPA 3HU3A 5AM3A 4H7HA 4J6EA 3WGVA 4C4AA 3C70A 5F52A 4AUKA 3STUA 1XO1A 4UPEA 4IGAA 4EAAA 2P9EA 1YB2A 4UVIA 1T91A 5KDOA 5CD1A 5CCDA 3ETCA 1F5NA 1VLLA 3DZIA 1PW7A 2ACVA 2OQRA 4OQMA 4RPHA 1ZR2A 3FPGA 3THXA 4GI3A 5JYDA 1Z4PX 4IHJA 2GDZA 2FPSA 2XUGA 3IILA 3OZEA 4YJHA 4KZPA 3WIBA 3ZE0B 4F9FA 2VDWA 4MQFA 1J09A 1QQBA 3U44A 1XLWA 3HBAA 4MW0A 3U56A 3ZS8A 1YR9A 3EODA 4RVDA 4D74A 1AS0A 1NZDA 2AC2A 3HVKA 1PJ4A 2PX6A 2A59A 2VXBA 3I92A 4WKBA 3L3BA 2AG5A 5K0NA 5T4HA 4E5SA 5KKCA 1NSTA 3N7UA 5DIZA 3RFXA 3FPLA 3W7BA 1CERA 1DFHA 3DB2A 1DBVO 3CLUC 3GRFA 3UF0A 4MP3A 1OB5A 2JIMA 2E55A 1I01A 3MQ4A 4L08A 3CLRD 1OWLA 3IT2A 3HBLA 1MAUA 1HKHA 2PRZA 3L4SO 4AECA 2X4IA 2YWCA 4KIFA 2P4QA 2FQQA 4M8LA 3CA8A 4X41A 1R0SA 2F1HA 1HI9A 3ENNA 4LF8B 3AFIA 1WS6A 4D0RA 5FFMA 3FWKA 3C6QA 4BPRA 1GQSA 3ZDCA 4I3FA 2DWUA 2JEZA 4X97A 1SD1A 2VZ8A 4HNQA 5HGJA 1JR3E 4A0GA 2WABA 1YS7A 5E4TA 4OI1A 3SEFA 3GL9A 5BWMA 4WY5A 4PHTA 3U3KA 2W2KA 3SZUA 2QQ0A 4ZFNA 4WTOA 2JGEA 3VKGA 4MHTA 2J32A 1KO4A 1WV1A 1B6SA 1N0UA 2XWQA 4NZMA 3W6OA 2PUTA 1WSBA 1DEKA 3NHJA 3RYHA 1QZUA 2ODWA 4UCQA 3R7FA 3TR6A 5DVZA 1YQ9A 4KG7A 1BQEA 1B16A 3E9RA 1YFZA 3AR4A 3IJ5A 5G41A 4Z7OB 4ZOBA 4P0PB 1IN8A 5FOQA 1R9JA 3G89A 4B2IA 4IXTA 3OJCA 1MRNA 4XWKA 1O6ZA 1TD9A 4WPGA 2VH1A 3G85A 3WSWA 3HDQA 2ZUEA 1BWPA 1CE8B 4OAOA 2FW0A 3NT2A 5BOVA 4AKGA 4FZJA 4DIBA 3GPDG 4B3GA 4U63A 2AJTA 3C4QA 2BFEA 4R7TA 3OY7A 4U7PB 3I01M 4A8HA 5CFOA 2XYVA 5H70A 2PKYX 3KKZA 4L3WA 4POAA 5WRFA 3BE5A 3CRNA 3BQ9A 3STWA 3PEVA 4N7MA 4RUKA 1U9YA 4OHCA 3TMYA 3WDLA 4R7ZA 4BO6A 4DPMA 4DIUA 1VL1A 3H2SA 1Z4KA 4KYUA 2C07A 3ANTA 3FMOB 5IAGA 3ETGA 5M5BA 1DLJA 1ZEMA 1AHPA 1FCJA 4W5RA 1JZSA 2GAFA 4PSCA 2V7PA 3D5EA 3SS8A 3GEBA 4OHFA 3GRRA 2J1LA 1E1LA 3PWSA 4INJA 1J20A 4KHZA 4YAOA 5GZ6A 5ITWA 2QVZX 3UXHA 1Q22A 1VSUA 3JYLA 3PDIB 5B6JA