1M76A

Crystal structure of the s137c mutant of l-3-hydroxyacyl-coa dehydrogenase in complex with nad and acetoacetyl-coa
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
291
structure length
291
Chain Sequence
b'KIIVKHVTVIGGGLMGAGIAQVAAATGHTVVLVDQTEDILAKSKKGIEESLRKVAKKKFAENPKAGDEFVEKTLSTIATSTDAASVVHSTDLVVEAIVENLKVKNELFKRLDKFAAEHTIFASNTCSLQITSIANATTRQDRFAGLHFFNPVPVMKLVEVIKTPMTSQKTFESLVDFSKALGKHPVSCKDTPGFIVNRLLVPYLMEAIRLYERGDASKEDIDTAMKLGAGYPMGPFELLDYVGLDTTKFIVDGWHEMDAENPLHQPSPSLNKLVAENKFGKKTGEGFYKYK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-HYDROXYACYL-COA DEHYDROGENASE
molecule tags Oxidoreductase
source organism Homo sapiens
publication title Crystal Structure of the S137C Mutant of L-3-Hydroxyacyl-COA Dehydrogenase in Complex with NAD and Acetoacetyl-COA
rcsb
total genus 119
structure length 291
sequence length 291
chains with identical sequence B
ec nomenclature ec 1.1.1.35: 3-hydroxyacyl-CoA dehydrogenase.
pdb deposition date 2002-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00725 3HCDH 3-hydroxyacyl-CoA dehydrogenase, C-terminal domain
A PF02737 3HCDH_N 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.10 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 1m76A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1m76A01
4P38A 4WLEA 3HN2A 2GASA 4KUGA 1K0UA 2Y67A 3OM9A 3JCZA 4ALIA 4EUEA 4U0JA 3O38A 3UCFA 1DC3A 1PS9A 4W99A 2NVUA 2HMWA 1Q0QA 3L6DA 2CFCA 4HFNA 4ONEA 3AUSA 4R1NA 3GMSA 4FR5A 4IJKA 4B79A 5A9SB 1KY5A 4YJHA 4CUKA 3U09A 4LCEA 1DHTA 3GAZA 2DFVA 4YBZA 3SLKA 2I9PA 3UHAA 2UYYA 3W8DA 4QSMA 4E5KA 1LQTA 4RVFA 3K9QO 1A72A 3JD3A 4A0SA 2CY0A 1ZJZA 4N5MA 3BMOB 2HJSA 3TZCA 4AJ4A 1ZSYA 3AM4A 2WEKA 1LLDA 1EMDA 1KC3A 1DB3A 4YT5A 2ZTVA 3WMWA 4ND4A 1PL6A 2CF5A 4E6PA 5JCXA 1I33A 3C1AA 1JWAB 4JJFA 4M55A 1YWGO 2FHSA 1BDBA 3RJ9A 1HRDA 1Z7EA 5IFLA 2HK7A 3HDYA 4IQ0A 3DBHB 3RKRA 3E8XA 1PJSA 5B37A 3ZW9A 4EBFA 3ROKA 3WQSB 3N74A 4EI2A 4ZHSA 4BMNA 5JDCA 3MOGA 2VHXA 4HFJA 3U4IA 1V3TA 4MVJE 4PG5A 5MGBA 2CVZA 3E48A 3AUUA 1O95A 3UAGA 2YFHA 4G65A 3WB9A 2ILTA 1DLJA 2OO5A 4RL6A 3HB4X 4TRRA 2J6IA 1KEUA 1JWBB 2ZCVA 5LDGA 3VH2A 1GR0A 3T4XA 3OJOA 3PVZA 1XELA 4XR4A 3GPIA 4R1SA 4A7PA 4NJMA 4IMRA 5JW6A 3NJ8A 4TWRA 1HYHA 1YBAA 2JFGA 5A9RA 4M54A 4EDFA 3EC7A 3LK7A 4OJNA 4RPJA 3HFGA 3RQSA 2Y0DA 2PFGA 5F3RA 2B0JA 2JD0A 3O4RA 4YQYA 3DHYA 2JJYA 3O9ZA 4OKIA 3C8MA 4E32A 3I23A 4DYDA 2ZK7A 4J7XA 1WMBA 4CQMB 1Y5RA 1F12A 3GOHA 4RPKA 4XRGA 3B6ZA 3GQVA 4YJDA 1UR5A 2PD3A 3GC6A 2CMDA 4IMPA 2PGJA 3AM3A 5GZ6A 4U0KA 1Q7BA 3BMQB 3WGTA 3ETGA 5JY6A 3EUWA 4LVUA 3L4BA 3QE3A 1GZ6A 4RORA 3KO8A 1MG0A 3CIFA 1Z6ZA 2HMVA 3M1AA 4NJOA 1EE9A 1FJHA 3QWHA 4HADA 5L95A 4ND2A 2AE1A 4DL9A 3ORFA 2O3SA 4FJ0A 5BT9A 2W90A 1GV1A 1FXSA 3DFZA 2A35A 4R01A 4WE3A 4Y98A 5CP8A 4FOSA 3VPFA 2FWMX 3F1LA 5TT0A 3DOOA 1DRVA 3ROPA 3KLPX 3I9KA 4R3WA 1X1EA 3ULKA 5L7TA 4WOJA 1XHLA 2Q4EA 4R1TA 1E92A 2NV6A 3DBHA 4MVJG 4RZIA 3ZHZA 4FJ2A 1LRJA 3AWDA 4IDBA 3UKOA 3JQ8B 1O9BA 2OBYA 3BTSA 5CHEA 3ZZNA 1E7SA 5A5FA 3KETA 2ZCUA 3VH4A 4DBZA 3FNFA 2UV8A 2FN7A 1UXJA 4MVJD 4M87A 4CLHA 4CQLA 2YHIA 1TXGA 4EUHA 1I2BA 2P9CA 1R0KA 2QIOA 4Q39A 4QX6A 2AQ8A 3LT4A 1C1XB 2ZATA 5DCYA 4BNZA 3ONFA 2AA3A 3DO5A 2H9IA 1HTBA 3JQ6A 1LC0A 4GI2A 2XXBA 4XD2A 1SC6A 2EGHA 5EIOA 3MOIA 2BMAA 1NFRA 2BFOA 3G17A 1XU7A 1HYGA 4NFYA 3PHJA 2P4HX 5A9SA 3RC2A 2NTVA 1IZ9A 5ENDA 1YQDA 4YWJA 5AVOA 3FNHA 4N5LA 2GN9A 2I5PO 5DCUA 3K2BA 4CMEC 3NTOA 4IIVA 3Q3CA 1L7DA 4ND5A 1H6DA 1GYPA 3OSUA 3QA9A 1KVUA 1X13A 1XYGA 1P1RA 4CMJA 2ZJ1A 2VRCA 3SEFA 5ER9A 3F4BA 1OC2A 1R0LA 1RM4A 4MPDA 4J1TA 3TL2A 2C59A 1GUZA 3GGPA 4KP7A 1H0KA 1GPJA 4NNJA 1E7RA 4ZU3A 1M6HA 1E3JA 4YEDA 3JQ9C 1LRKA 3DOCA 3FNGA 1WZEA 4U6QA 3JYLA 2DLDA 5T57A 5ENVA 2ZQYA 3HWRA 1GD1O 3G49A 5DN9A 1MA0A 2ZB8A 1C14A 1P3DA 2YQ5A 1LLQA 1YOVA 3KXDA 4K28A 2VUUA 1ORRA 4P8RA 3L4BC 2CVOA 2RH4A 5BSHA 5DNAA 3OICA 2FZWA 4RDHA 3GDOA 4FQ8A 1HDRA 1HDCA 1VJ0A 1KEWA 4BNJA 2NADA 2G76A 1U1IA 1W4ZA 4PLGA 4FB5A 5A3JA 4TRJA 4Y67A 4YAEA 5FF9A 4DMLA 2W98A 1PTJA 3MJTA 3DAPA 3B1FA 4PG8A 4ZRNA 1P77A 2O3JA 3QVSA 4MVJF 1B0AA 1LDBA 2Y68A 5TRTA 5I9LA 2O3TA 1I3NA 1H94A 4BO7A 4J7UA 4I5GA 4IY1A 2WYUA 5G0SA 1XU9A 3D3EA 4HP8A 3TQHA 4I9NA 5K6AC 3C1TA 5KWEA 3RUFA 3L0DA 2NU8A 2FY8A 4GSLA 1LXCA 1PSDA 1WW8A 1Q0HA 2R6JA 3DZFA 3O03A 1WDLA 3Q2KA 2VHWA 4NR0A 2WTBA 5EL0A 4OMUA 4AJJA 1UP4A 1YONA 5KJ6A 3MJCA 4OL9A 4GL4A 4TSKA 1NQOA 4XQCA 4OQZA 1E1KA 1T2CA 3VVBA 3PPIA 3QW2A 4OXNA 5U1PA 4YAJA 1EUCA 9LDBA 4W82A 3PWKA 3JYOA 1BW9B 3CEAA 3OBBA 1VRWA 1IHYA 4BQPA 5DT9A 2JCVA 4BNIA 3DZGA 3WGZA 3SXPA 3QP9A 1ZSVA 5A9TA 4CM8B 5CEJA 4KUHA 3LC7O 3I9NA 5ER6A 3BMCA 3JYNA 4NH4A 2BI7A 2E6UX 2V6MA 3QRWA 1DOHA 4LSWA 4CM9D 1QYVA 3GA0A 4IGFA 4O59O 5JC8A 1DEHA 3RROA 2QW8A 1ZCJA 3RJ5A 3RI3A 3U3XA 2G1UA 4UUOA 7MDHA 3QV1A 5F1OA 3L77A 3AOEC 4JQCA 4UVEA 4JXKA 3HNPA 3PFFA 1ARZA 4J7CA 4CMIB 4D3DA 4ZD6A 3E6AA 3F46A 3WYCA 5ICSA 3NV9A 3M6IA 2B5VA 4EJ6A 4RJTA 5HBRA 3WNVA 1E7MA 1WVGA 4BNYA 3ITKA 2VT2A 4WUVA 1P0FA 5LCXA 3FTPA 2ZTLA 1ADCA 1H6AA 5BSEA 3EMKA 2P9EA 1LDYA 1U4SA 4E21A 4IXTA 4HWKA 1Q7CA 3KYCA 1DFGA 4DLLA 3U4DA 5TJHA 1E1LA 5I8WA 1HYEA 1ZUD1 2YHUA 4AJ1A 4YT8A 1ISHA 3BYZA 1M66A 4KTVE 2EGGA 2BD0A 2PD4A 4BGEA 1ZH8A 4IINA 1UAGA 4BMVA 2Q1TA 1PZHA 2SCUA 3SC4A 1JN0A 2H5LA 1DIRA 3PLNA 3IDSA 3CH6A 2R2GA 3ENKA 3FR7A 3K5PA 4NBVA 4JGBA 4EYEA 2CSUA 3G3EA 3OJ0A 4MVJM 1OBFO 3FN4A 3NTRA 4BKQA 1WLYA 4BNLA 1GUYA 1HDOA 1VL6A 1PQUA 1I32A 1GV0A 1GCOA 2EP7A 3IUPA 4BV8A 4CV0A 1BTOA 5TJ9A 3PYXA 1W6UA 3A06A 4EJ0A 4U5QA 3BA1A 2Q49A 1N2SA 1U28A 1V6AA 4AL4A 3GZ4A 2F1KA 2GNAA 3U62A 2VNAA 2CF6A 3GUCA 3FPCA 1A7KA 4A03A 4BO2A 3DZIA 5EN4A 2PKQO 1PQWA 1PWXA 2Q2VA 4YA6A 3UICA 5IN5A 2BI8A 3UN1A 3VZPA 2GF2A 3DMYA 1WPQA 1JKFA 1PQPA 1QORA 4J1SA 2OFPA 5DP1A 3DFUA 1AE1A 2DBVO 1RM0A 2O4CA 3H5RA 3A9WA 3KV3O 1BW9A 1UH5A 1NAIA 2NM0A 1JVBA 4DC0A 2FMUA 4B4WA 2FPIA 4R9RA 4DC1A 1I3LA 3PHGA 2EHDA 1KERA 4M1QA 5IDYA 4BGUA 3AI3A 4IZHA 4PVDA 3ZW8A 3QVWA 5CAEA 5KVVA 1KEVA 1KC1A 1E7QA 2Q1SA 5JDIC 3ZU3A 3V2UA 5FWNA 1E5QA 4CMBA 4GMFA 4Y8VA 1U3VA 2JAPA 2WE8A 2FR1A 1E3LA 4Q3CA 1D8AA 2IZZA 4J1QA 1VPDA 1OMOA 1D4FA 2O4UX 1Y7TA 4ZJUA 4Y6SA 1NNUA 2LDXA 1I24A 4CLOA 1VL8A 4I5FA 3WYEA 4CMKA 1J0XO 1PS8A 5ILOA 1BXGA 1HF3A 3PZBA 3ZNOA 3DONA 3RUHA 4JP2A 3TZ6A 4MVJP 5I9MA 2X5KO 2QX7A 2HMTA 1VSVA 3V2GA 1JA9A 3DBRA 1X1TA 2V7PA 2DM6A 4WCDA 1P31A 2QZZA 2IXBA 3WBFA 1X0VA 3E18A 2PV7A 4BIIA 6ADHA 4N54A 4GX0A 2AQKA 5AXCA 2C5EA 3SLGA 4YAGA 5A1TA 3MJ4A 1XA0A 1HWYA 4RPLA 2X58A 2PKRA 3ETDA 4E30A 4XGIA 3WTBA 1BG6A 5JAIA 4IJWA 4F46A 3P2YA 1NPYA 2VCYA 4QECA 3UF0A 3OQBA 4HKTA 1WAMA 5CG1A 1W8DA 3AW9A 3SJ7A 3VZSA 5FI5A 1DC5A 1KVRA 5A04A 3PLRA 4B4VA 5A03A 1ONPA 3QWBA 4JBIA 3ZNNA 2JAHA 3K6JA 4TKLA 3K96A 1ZK0A 1J49A 2EKPA 1LDNA 2D59A 3WNQA 1LRLA 2X0JA 2P5UA 1MGOA 4D0RA 4ND1A 1P45A 2D4AA 4ILKA 2B5WA 4J1NA 2E4AA 3BTOA 5JCJD 4QEDA 1DDOA 4QQRA 3WSWA 4BVAA 3FWNA 1PS0A 2VYVA 1XSEA 2VNSA 3A1NA 4D44A 5F5LA 1A4IA 4K26A 4R54A 5L4SA 1M67A 4CV3A 1ZEJA 4CQMA 5EJ2A 3H3FA 5EQDA 1Y8RB 5IF3A 3I9JA 4Z0HO 2QYSA 1IB6A 3LSYA 1W73A 2VHZA 3MWDB 2Y0EA 3AUTA 3PHHA 1NHWA 1ISFA 2O3QA 4DREA 1Z75A 3O8QA 1YB4A 2ZTMA 1R4NB 1H9AA 1ZVMA 2NUAA 2C54A 3I9MA 1KEPA 5ES3A 3IL2A 3GFGA 2BFMA 4GMGA 3GK3A 1ZFNA 1IL0A 2HJRA 2Q3EA 2VWHA 4KWHA 4IDDA 2EP5A 2PK3A 1E3EA 2YY7A 3FD8A 1VJ1A 2A9FA 4HUJA 3TOXA 3ZWPA 9LDTA 1UZNA 4R5HA 3E82A 2VTEA 3SVTA 3ASVA 4XQEA 2WYVA 1DLIA 3UCEA 3UH1A 2ZB7A 2GLXA 3WLEA 1A9ZA 5TF4A 2IZ1A 1EVIA 2GYYA 2Q99A 4BNHA 1SEVA 1PJQA 3ONDA 4NG5A 3I83A 5KVQA 4IM7A 4BNFA 1Q1NA 3JQCA 1YJQA 4O63O 4B3IA 1KS9A 1XQ1A 1EBFA 2DT5A 3A4VA 3RUIA 3QIVA 4DLBA 4F45A 1CEQA 3FF4A 5TS3A 1SEPA 3F47A 3ZWWA 1F06A 1JTVA 2VUTA 3OIDA 3FR8A 4L75A 5FFFA 2EKLA 3ZWCA 2AQHA 4ZICA 1C1XA 3RKUA 8LDHA 4BO3A 1EUZA 2WD7A 5I7EA 1BVRA 1E1NA 3EYWA 2ZB4A 3W1VA 1SB8A 4E13A 2GRAA 3SJUA 3BMOA 4CQLB 3DTYA 4DLAA 3F5QA 3WFIA 3WTCA 1W0CA 1ENPA 4D3FA 1NPDA 4M8SA 4YCAA 4XGNA 3RSHA 1LEHA 4D41A 2PA3A 1H6BA 2ZYDA 1S7CA 3GDFA 4CR7A 4CLXA 1Y1PA 3WXBA 2DTXA 3KSUA 4NBWA 3DAGA 1V3VA 2Y1OA 4FDAA 4QXMA 4FOOA 2W2LA 4W7IA 3Q1LA 4ALMA 4CV1A 4R5MA 3JQAA 3ENNA 4CMCA 1U5AA 4IIUA 4YACA 1WZIA 4M89A 2UVDA 1HE3A 3BHMA 1NWCA 3DZJA 2CNBA 3D64A 1IZ0A 4P4LA 3SBOA 3CINA 4UREA 2PGDA 3KBOA 2GCGA 4ALNA 1B15A 4QUKA 4BS9A 1HZJA 2IYOA 3ZU2A 2YFQA 1B8PA 2X6TA 4Y9DA 1ZZEA 3GVIA 2ZJ0A 3B1KA 3R3SA 4F6LA 1C0PA 1KVQA 2JCXA 1XLTA 3HHPA 4RZHA 1XKQA 1ZXLA 2YDXA 1O6ZA 2G17A 4WLUA 4KDFA 3QSGA 1GPDG 4OH1A 1SO8A 4BNGA 4Z3KA 4IQGA 4Z6KA 3P2OA 3ZV5A 4X54A 5L3ZA 4CMAA 1UXHA 3GH3A 2ZYAA 3ANMA 3CUKA 3GMDA 4B3JA 5BNIA 4N7RA 4RF5A 3IC5A 3JQGA 4BKPA 4YJFB 5IDXA 2AEFA 5C3MA 1Y9EA 3DHNA 4NMHA 4I9UA 5IDQA 3NJ4A 5F21A 1YL6A 2C5AA 2AEJA 1E6EA 4UEJA 2CDCA 2PWZA 2QRJA 3GAFA 4DYVA 1JLLA 4C7KA 5ADHA 2FR8A 5CFZA 1SAYA 1DSSG 1WMAA 2J3IA 2Y1CA 3MJEA 3GNTA 3PJFA 4FN4A 5F5NA 2HQ1A 2FZEA 2P9GA 4FD3A 3PGJA 3RASA 1P1KA 2HDHA 1WXDA 1YB1A 2PZLA 1ZSNA 3ZHYA 5A3VA 2VWGA 4UUMA 3ZI0A 1I5RA 3WLFA 4D43A 3B70A 3IKTA 2HLPA 4DPKA 3V5NA 4E2WA 4DPLA 2AW5A 1R0SA 4CM7A 2R00C 3RC1A 2WD7B 2Q50A 1MB4A 4XIJA 2FPPA 3I4FA 3D4PA 4YJFA 3GHHA 1EQ2A 1UDAA 1YKFA 1U8FO 2O23A 4RPGA 4JBGA 4D79A 4KTTE 4II2A 3B1JA 1I3MA 1DC6A 1OOEA 4A27A 4XX0A 1NWHA 3HADA 1G0NA 3WS7A 3PK0A 4NJMB 1I01A 1B8UA 2GGSA 1NFQA 2X0RA 4PG4A 4P4GA 4CUZA 3O8QB 2CDAA 4EJMA 1OC4A 2HUNA 3MJVA 3L6OO 5IDWA 3ADPA 1LDGA 1PJ3A 2D2IA 1CQJA 4KQXA 2O48X 3MZ0A 3LYLA 2BFPA 1TI7A 3BAZA 3B20A 5JXWA 4NBUA 3ANNA 4BKOA 3L07A 1KVTA 4AG3A 2V6BA 2WJPA 4H3VA 3ZU5A 2F00A 3H4VA 3MTJA 3NT2A 4TQGA 5DULA 2JL1A 4LMPA 1ADGA 4PZDA 2X0IA 4A5OA 5FEUA 4YXFA 5AQ1A 1PGJA 4LRTB 2YYYA 3Q11A 2DBZA 3VTFA 1SNYA 1E5LA 1H6CA 2VN8A 4O0LA 1T24A 2VWPA 3TZQA 1NXQA 1UZMA 4AVYA 3AK4A 2E48A 4NFSA 5EQFA 2YJZA 5KJ1A 3W6ZA 2VUSA 3OA2A 3WDSA 1ONNA 4HBGA 2FRDA 3H9JA 4XZ3A 4RVDA 5G0TA 3INRA 1R4MB 4ZN6A 4HNGA 4PCVA 4FC7A 4RLSA 5JO9A 3H2SA 4BO5A 3VKUA 3I52A 3RU7A 4CM6A 3DZKA 4H16A 3W4IA 3NYWA 1J4AA 1FDWA 1KY4A 2ZYGA 2IEDA 2X5JO 3FSRA 2EJVA 4FBGA 5MDHA 3C7CB 1B16A 2VT3A 5G0VA 3ZNPA 4PZCA 3M2PA 4HNHA 1GEGA 2XXJA 1G1AA 4FFOA 4YRAA 4K9DA 3WQQA 1TVEA 3E03A 5L7YA 1I30A 1PJCA 1IPEA 3MJSA 5JPIA 4UUPA 3AU8A 4QT0A 3RWBA 4L0QA 2QZ9A 3I6IA 2P5YA 4TVOA 4UULA 4BNXA 3I6QA 3IIEA 4BNNA 5IXSA 2EW8A 4FFRA 1BXKA 4PLYA 3GRKA 4UUNA 5COBA 1SBYA 3D7LA 3WR5A 1V35A 4RDIA 1CETA 1YQGA 4WEOA 4CUJA 4BO1A 3K8ZA 2HU2A 4OSPA 4A73A 3SC6A 2EEZA 3H9EO 3KYDA 4DA9A 5T8KC 1QKIA 1EDOA 3T4EA 3DQPA 5I8ZA 2GSDA 3G1UA 3V1UA 4DQXA 5CPFA 3GFBA 1ZIDA 1HDYA 2DU8A 1ZMOA 4AFNA 2CDBA 1U7HA 4MVJI 3CTVA 3NDRA 2RH8A 3INGA 4RO0A 1HLPA 3T7CA 1EQUA 5K9ZA 1MFPA 1PJLA 4RVGA 2Y05A 5BNFA 3IJPA 1K6XA 5C7LO 2GZ3A 4RVUA 1N92A 1ONOA 1HE4A 4FIZA 1N7GA 1BMDA 2C29D 4J4TA 2EXXA 3PJGA 4XWYA 2D8AA 3ICPA 4BL5A 1VSUA 2X7HA 5G4KA 3PP8A 2ZQZA 1DIBA 2HK9A 4XQ9A 3W4JA 1VKOA 1Y81A 1PL8A 4R41A 3JQAB 1K5HA 2NU7A 3GUYA 4UAGA 3FPLA 1RKXA 1GYRA 1QYXA 2O3UA 4Q3DA 1DC4A 4K6FA 4Q3BA 4BKUA 4YVFA 3JQ9A 2W4QA 3ZV3A 4HFRA 2OZPA 3VPHA 4WCFA 4NDNE 3DDNA 3KUXA 1IHXA 4JX8A 3FNEA 4UVHA 3PZRA 5I7FA 2Y1DA 2HK8A 2PGLA 1R4MA 1GQQA 2C2XA 3OIGA 1QRRA 1UXIA 2O3RA 3ZWYA 4YAKA 4R1UA 5DBFA 1UZLA 2NNLD 4GKVA 1O94A 4YRBA 3OJEA 2TMDA 3F4LA 3UVEA 4L8VA 2JD1A 1HZZA 2V6FA 3QWFA 1PZGA 1QYWA 2FOIA 4CV2A 1TT5B 4D45A 5C7IO 3PFWO 1PGOA 1SOVA 2VHYA 3UGKA 1JDJA 3IUSA 1P9LA 1LQUA 3QLJA 4NK4A 4WCFB 4NI5A 5L4LA 3EVNA 1ZKMA 2J5KA 5U9CA 2GUGA 3TF5A 3DB2A 4YR9A 1E6UA 5HWSA 1YGYA 5BSFA 1LSSA 3JQBC 5CEEA 4L73A 5KIAA 2Q2QA 3QQPA 1PIWA 1F0YA 5JBIA 4E0BA 4PRLA 3GVCA 3PI7A 3BHIA 1Y9AA 1EK6A 4BQRA 3PRJA 1B3RA 2YV3A 4DGSA 1ML3A 2QG4A 3V1YA 1KETA 4FFMA 3VC7A 2GO1A 2FSVA 2HMUA 3O26A 3RBXA 3KLMX 5T8KA 1P0CA 3FTNA 1GU7A 4EITA 5HM8A 1TT7A 2O50A 4GLOA 5T5QA 3S2IA 1JVSA 2GZ1A 4L4XA 5THQA 4QO8A 1GQYA 2QYTA 1GEEA 2PY6A 4BV9A 4ZA2A 5A06A 3WGQA 3VH1A 1AHIA 3EW7A 1P1JA 1YH3A 4AJOA 5IG2A 5JAMA 3T7EA 2EKQA 1PU2A 3IS3A 3QVXA 4NU5A 3MWEB 1XQ6A 4CMIA 3BMNB 2ZB3A 1NM5A 2AQIA 4XDZA 2GPTA 2DUUA 1BGVA 3VPSA 2IE0A 4XR9A 1LA2A 4JIGA 4DIOA 3BZUA 1YVEI 2A4KA 1G6KA 4BHTA 2NTJA 4TMFA 4PLCA 5J23A 1T4BA 3GNQA 5KNLA 4KOAA 1NP3A 1U9JA 1YBMA 4GGPA 1J6UA 5TLSA 2UDPA 3TN7A 4G5HA 3ZDFA 4IPTA 4KDEA 1KYQA 5BSGA 1B26A 1DJQA 2OORA 3WQRA 2WSBA 3WGOA 4TRNA 1UP7A 3ZWMA 2G82A 3BMNA 3DWFA 3S8MA 4I08A 3AFNA 2R00A 3OEWA 1D7OA 1OFGA 3OH8A 3TOZA 4BNMA 3KYDB 1ZK2A 3NTQA 3R1IA 3TZHA 3RUDA 4YJGA 4GKBA 2OP0A 5BNTA 5BQFA 5L4NA 2HKIA 2D3TA 1JAYA 4R9SA 5TGDA 4J90A 4J43A 1B3BA 1M75A 4XEHA 4RVHA 1D1SA 1NVTA 1YS4A 1OZAA 3M1LA 3LT1A 2B83A 3WYBA 2Q1WA 2PD6A 3PJDA 4L4SA 4J16A 1PL7A 1PJ4A 3VZQA 4FW8A 4Z0PA 2B4QA 3WWZA 4E3ZA 1GDHA 3WWYA 2YV1A 3QWIA 5JAZA 2PR2A 1XG5A 4WJZA 1PGNA 5T6BA 2J8ZA 2Q45A 1B2LA 2B4TO 3K31A 4N5NA 4MOWA 4CODB 5CG2A 1NYTA 2XF8A 1N7HA 2GD1O 3BIOA 4O5OA 3JQEA 4XIYA 1DRUA 4ESOA 3GHYA 1FMCA 1LUAA 3AY6A 1QLHA 1DO8A 4R3NA 3LT2A 1X7GA 3VZRA 1PJTA 5DZSA 1AXEA 4BO9A 2VYVD 1U7TA 1RM5A 3RC7A 3KYBA 3FBGA 3CTMA 1HEUA 1VLLA 4E2XA 3VHRA 4Q9NA 4HXYA 3OJFA 4Z9FA 2I76A 3D5TA 4OAQA 1HE5A 3U9LA 1Q2XA 2AXQA 3KRTA 5AYVA 1GY8A 3ZHXA 1V3UA 5JNLA 5KJFA 4L4RA 4R68A 1U2DA 3TRIA 4BNUA 4MKXA 3WICA 2GN6A 1E0DA 3JD2A 2P68A 3ZWVA 4B4OA 5FYDA 2FPGA 1GZ3A 5JDIA 2IEBA 3LLSA 1CQIA 4NPCA 2Y1GA 4RLHA 3ZWNA 1DIAA 2A94A 3IAHA 3DZBA 1AN9A 3GN1A 2C7VA 3HJAA 3G0OA 3DR3A 4Z3DA 7ADHA 2Z1MA 3E9NA 3KHUA 1NX6A 4CM5A 1YL5A 4LRSB 4OGWA 1ADBA 3SX2A 4JJIA 4IBOA 1QLJA 2BFAA 3FI9A 4K6CA 3VTZA 1AHHA 5B12A 3F9IA 3GGGA 1TA4A 2QRLA 4H15A 4XCVA 3FRJA 4B8ZA 3CPSA 1EEHA 4E2YA 3KTDA 1T1RA 1ID1A 3PEFA 3HFSA 4JP3A 3H3JA 1EUDA 4LMRA 3FCOA 4EUFA 4DPMA 3GR6A 3WFJA 1RPNA 3PHIA 2PZJA 3I9LA 4J2HA 3TFQA 1LDEA 3WMXA 4IQ8A 4GVLA 5B4VA 1E7YA 3IP1A 3ROQA 3S2GA 5KVCA 2OXIA 5JYEA 1MXHA 5IAAA 4KMSA 5CDYA 1F14A 3JQ7B 3N58A 4WNIA 3TZKA 4J4HA 3PIIA 1X7DA 2VZ0A 3ONEA 4IDFA 2UUOA 3CMMA 5EINA 3GG2A 1X14A 4LW8A 5JO0A 3LU1A 1SPXA 1F17A 1EVZA 4UVIA 1C0LA 4BGVA 4ALLA 4XYLA 2O7SA 1MLDA 2Q1UA 2P91A 1HL3A 2GERA 3DHEA 3NEPX 4NIMA 2JKVA 3AOEA 2OL4A 4IZIA 4EEZA 4LCJA 3PYLA 3GZNB 3MTGA 4PRKA 4QO7A 1SCUA 4ID9A 3V8BA 4WCFC 4XYEA 3Q2IA 3H8VA 4J9VA 2W2LD 4R4JA 1D3AA 1LI4A 5LDHA 3OMLA 1Z82A 1KVSA 3JQAD 3LZ6A 2WDZA 3PHLA 1VJTA 3DEYX 3KEQA 2X5OA 2ZKLA 4YPOA 4E5PA 2EIHA 2BH9A 1E1MA 3KYCB 3E9MA 3K73O 2ET6A 1H9BA 1Z73A 5EESA 4PIVA 4CM4A 4JJGA 3RBZA 2NQTA 3GVHA 2VYND 3LF1A 3NAQA 4WLVA 2X9GA 1GAEO 4MIOA 1HSZA 5A5EA 2VTDA 1LX6A 1E3WA 2POQX 2QQ5A 4EZBA 3R3JA 4IDCA 1ZK1A 1XIVA 3ZHBA 1X15A 4WKGA 1T2EA 5IJZA 5KTKA 1GFSA 1LLCA 4RPHA 1I10A 3NX4A 1RWBA 3VAZA 4WLOA 4WEQA 4FGWA 3H9GA 1WNTA 4PZEA 4GH5A 4URFA 5IN4A 1L1FA 1S6YA 5JC1A 1Z45A 5B4TA 2NTNA 2Y1EA 4BO0A 2NVUB 2NU9A 2PH3A 4J2OA 2QHXA 1ENZA 4INAA 3GT0A 3STHA 1FDTA 1ADFA 2DTEA 4CM8A 2YUTA 1MG5A 2WD8A 5AXDA 4YQZA 2JHFA 4PLWA 2DVMA 1Z74A 3EK2A 4FFLA 2VOJA 3NDIA 3CXRA 4N18A 5JE8A 2EV9A 3Q6IA 4PFJA 4RGBA 4U7WA 2C07A 2Q4BA 2IRWA 3JD1A 4FCCA 3R6DA 1K2WA 1QYDA 3TNLA 5JMPA 3VVCA 3L6EA 1DXYA 2NACA 3OQ1A 4J9UE 3JQFC 3ZCXA 4GX1A 5FI3A 2J5QA 1XEAA 1QV6A 4TRMA 3K30A 1M2WA 5F1PA 2X8LA 3RFTA 4XB2A 2BGKA 3NT5A 3AFMA 1YE3A 3RCBA 1JKIA 3E1KA 5H83A 4GQAA 3W8FA 4ROSA 2NWQA 2EJWA 1MC5A 2AE2A 3F3SA 3K92A 3ZWOA 4F6CA 3KB6A 4QFCA 1JAXA 3HB5X 5G4KB 5HA5A 1E7WA 1VI2A 3NRCA 5JYDA 2A92A 2I66A 2J3JA 3ITDA 3GNSA 1P44A 2EWMA 1PZEA 2NU6A 1PGQA 3NGXA 2I65A 2WWRA 4RF2A 3PQEA 1ZO8A 4IDAA 3S55A 3C1OA 1ISGA 4FFPA 3EAGA 4H7PA 2W8ZA 5CDTA 5L9AA 1N5DA 3ZH2A 5KKCA 2HAEA 3I4CA 3MCVA 5KJEA 1YXMA 1I2CA 1A5ZA 3K2EA 3AI1A 1LLUA 3BHJA 2ZIZA 4AJPA 2RIRA 3H6KA 4ZQHA 2X4GA 4CR8A 1MUUA 1HDGO 2QRKA 4E5MA 5HTOA 3AI2A 2NLOA 1ZNQO 3NDJA 1Y5MA 2IYPA 1NTOA 3KVOA 1NVGA 2DC1A 1E3WB 3TPCA 3EZLA 1FDVA 4NU6A 4YDRA 4UEOA 1Q0LA 1JKJA 4GWGA 5K0ZA 4C4OA 5ILGA 5DCWA 3CKYA 2RBEA 3IKVA 1PEDA 3JQFA 1VE9A 1UAYA 2J3KA 1PR9A 5TC4A 4E5NA 1CYDA 1B14A 3HSKA 1K6JA 4QFDA 5TX7A 1UDCA 5C5IA 2DPHA 4NHEA 3ST7A 3ZU4A 1A71A 1PJBA 2VRBA 1T2AA 1GCUA 3Q9NA 1A9YA 1P1IA 4W9NC 3X2FA 1DJNA 4OQYA 2JHGA 1EFKA 4Z9XA 5KCZA 2BRUA 4IDGA 5L7WA 3GZNA 1X7HA 3C85A 3JTMA 5GY7A 4AICA 1IUKA 1EZ4A 2X9VA 3RUAA 3VKVA 3N7UA 1R37A 4M86A 2DQ4A 3P5SA 1ULSA 4CM4B 3L9XA 4D0SA 3X2EA 3GEDA 3HN7A 3UOGA 1NASA 3TL3A 1E77A 5DBGA 4AJEA 1Y8QA 4BNWA 3JQ8A 4CJXA 1U4OA 1P74A 3VPXA 4TVBA 1PX0A 4OIMA 3RD5A 4LVCA 4RCVA 5C37A 3RU9A 4IUYA 4TZKA 4GVXA 4B7CA 1CJCA 1EVYA 1TLTA 4E4YA 4GLLA 3ZWAA 1NFFA 3DBRB 1IY8A 2DKNA 3HG7A 4DIFA 1LC3A 1C1DA 4WK6A 2Q46A 4K1LA 2H1SA 4S3MA 3EHEA 3F5SA 3S1LA 3D4NA 2HCTA 4B4UA 1HKUA 2C7GA 4XJSA 8ADHA 1HDXA 1HXHA 3W4KA 2DAPA 1M76A 1GADO 3S2FA 5IZ4A 1FDUA 1MX3A 4E12A 1IULA 1HSOA 3AUAA 2NVBA 4XKJA 1OI7A 2AEMA 3EDMA 3E9QA 5TSDA 4IDEA 3JQBA 4ZQFA 1K89A 1EBUA 1ZMTA 1U8XX 2D1YA 5JMWA 4CLDA 3W6UA 3BTUA 3U0BA 3GPDG 1BXZA 3UCXA 1CIVA 4JROA 3ZNQA 3DMTC 4ZGWA 4G2NA 1HETA 3TWOA 1U3TA 3HE3A 1J5PA 3WG9A 2FSSA 3HZZA 1T4DA 4BO4A 4CLRA 2BKAA 1H5QA 2J3HA 4OXKA 4W4TA 5G0UA 4O6VA 2AHRA 4D7AA 4J0FA 4JBHA 4QTZA 3KM0A 4J0EA 1VL0A 4DWVA 1P1HA 1ISMA 4EW6A 1EVJA 3H7AA 4FS3A 4XYGA 4MP3A 3MEQA 3WJAA 5AXAA 3LT0A 1D1TA 2NQ8A 2X23A 4YTEA 4B7XA 3NT4A 4IXWA 3UUWA 1VKNA 3P7MA 5AXBA 2CD9A 1Y8RA 3AOGA 3PDUA 3WBBA 4IJVA 1I2ZA 3OEYA 2DTDA 3JSAA 3QHAA 4Z0TA 1BDMA 3GF4A 4Q3NA 1I36A 3L4SO 2NSDA 3EY4A 1NQ5A 2DFDA 3E5MA 3OF2A 4YJHB 2VZ8A 5IZCC 3IMFA 4I9HA 2RHCA 4XQGA 4CL3A 1G0OA 4BNKA 4AJHA 1AUPA 3A28A 3OETA 2IODA 2BHLA 2E82A 4LGVA 1ENYA 2BGLA 1E3IA 3CSDA 1UJMA 3OIFA 4B3HA 3WGIA 3JQ7A 4NZ9A 6LDHA 2VHVA 4HY3A 1B7GO 2OBNA 1BRMA 1EK5A 3F6YA 3TSCA 4TZTA 1ZW1A 3GLQA 1LTHR 4MJLA 4W7HA 1ZEMA 4AJIA 4E2ZA 4E5YA 2HSDA 4HV4A 1Q7GA 4I8XA 3V2HA 3Q0EA 3LC1O 2WM3A 4L74A 1UDBA 2D5CA 4XA8A 4PLVA 3NKLA 1C0IA 2P2SA 2IZ0A 3DBLA 3KSZO 3PQDA 4W6ZA 1O5IA 2AG8A 1YBVA 4A2CA 3RC9A 3H65A 4GSKA 1MP0A 4PLHA 3C7AA 3QWAA 1Y6JA 2B35A 2O7QA 3DL2A 5CDSA 5CDUA 5DP2A 5EERA 3ZWXA 4F3YA 4PGFA 1V8BA 2O2SA 2EF1A 5JDCC 4J3FA 3D3WB 2HO5A 4JK3A 2H6EA 1HDZA 4CPDA 2V65A 2VZ9A 1K3TA 3WJ7A 2BELA 3NGLA 1BXGB 3DTTA 5C7OO 1K6IA 4WASA 4L76A 3U4HA 2YV2A 3OJLA 4JNKA 1KBZA 3U5TA 1QSGA 1YB5A 1GZ4A 2BGMA 4CLOB 1BSVA 4BNTA 1N1EA 4XRRA 3INTA 3LLVA 4YT4A 5KOIA 1RJWA 3H9QA 4R51A 4NBTA 3TDKA 4DQUA 2XPCA 2Y0CA 4Y6PA 4MINA 1T26A 4MVJA 4WOKA 2XOXA 5B1YA 3TJRA 2PLAA 4WPGA 4DBVO 2Y93A 3LQFA 4JLWA 4XB1A 2X1HA 4IS2A 4NFHA 1RM3A 2X9NA 2G0TA 1CERA 3GEGA 3OFSA 4OXYA 3QVOA 2WMDA 1YJ8A 4ZRMA 1F8GA 1N1GA 1R6DA 4ND3A 5COQA 2RAFA 3DC2A 4IS3A 2OUIA 4P4NA 1CWUA 4XGKA 3WGGA 4CM1A 4D3SA 3ROMA 2E37A 4RF3A 1H93A 3ZGYA 3DXFA 3E5RA 4DRYA 4WLFA 2DPGA 4R16A 2PNFA 1E3SA 5TNXA 1F8FA 3WIDA 2VRCD 2B4RO 2GR9A 4DTIA 1BHSA 3GRPA 4AJLA 3HDHA 4Q3AA 4FSHA 1CDOA 1ZK4A 5I7SA 3LDHA 2HRBA 4R69A 4YYZA 5KJCA 1UXGA 1LJ8A 4Q3EA 1NPTO 1T2DA 3RBVA 4CM3A 5JSFA 2C82A 5COAA 3JV7A 2FP4A 4JCOA 2O2YA 4M49A 1I0ZA 4NQZA 3WX0A 1T25A 1ZXBA 2B37A 1XWFA 1SB9A 1A7AA 1U5CA 5L53A 4I5EA 3DBLB 1RYDA 1N9GA 1TT5A 4PN3A 5CEFA 4CLRB 3AJRA 2GN8A 4TKMA 1R66A 4JN6B 4WNCA 1KOLA 4UVGA 4PLFA 1DAPA 2UAGA 2Y99A 4U6SA 5EPOA 3LC2O 4LK3A 3GDGA 1XR3A 3CMCO 3GVPA 1DAOA 1RYEA 4BNVA 3JD0A 1N9GB 1HT0A 3RFXA 4W9NA 2C20A 1PR3A 4B7UA 4BO8A 4D42A 1B8VA 1E6WA 1YDEA 1M6WA 1YQXA 1BVUA 5T64A 4MIYA 2VWQA 4OM8A 1QXSA 4FFNA 2OHXA 3ICCA 5F1KA 3FWZA 4NBRA 1C1DB 1LSUA 1EFLA 1IE3A 2XAAA 2YDYA 2YQ4A 4YRDA 4BB5A 3VOSA 1NR7A 1XCBA 3R0IA 1NVMB 4DXHA 4MVJH 5TQVA 4II3A 1MXFA 1I8TA 3ASUA 2PZMA 3GGOA 3H5NA 4PG7A 1EE2A 1U3UA 2JD2A 3QY9A 1NHGA 4DQVA 1XDWA 1H2HA 3H2ZA 4GPD1 1I3KA 1ENOA 2D5AA 1A4UA 1ISIA 3PQFA 4A26A 3UXYA 2I3GA 3ABIA 3V1TC 3ZWBA 3QVTA 4YT2A 1JQBA 3BMCB 4PLZA 1X0XA 4CM9A 3ZN2A 3IP3A 1MV8A 4CMHA 2LDBA 2RCYA 5I9NA 2AG5A 3P19A 5DOZA 1QMGA 3Q9UA 4WLNA 4E33A 4C7JA 4CLEA 2VOEA 4OKNA 1IOLA 4BUCA 1GL3A 3HUDA 3VPGA 4RV9A 3CZMA 1R15A 1O89A 4YAIA 1OAAA 4U8GA 4O1MA 2OOSA 5L45A 1LDMA 3PXXA 1CF2O 4Y6RA 1LSOA 3GVXA 3DMTA 4LN1A 3CE6A 3VH3A 3WSVA 3G79A 2IDZA 2BF7A 3ETEA 3RFVA 1C3VA 1ULUA 5G0WA 4DIBA 1SOWA 2PZKA 4CR6A 5GZ3A 2Z5LA 3M2TA 2JCYA 4J4BA 5H81A 3AU9A 3RUEA 5ITVA 1WWKA 1YDWA 1PWZA 3OECA 1HE2A 3PGXA 4DUPA 4J49A 5IZCA 3I3OA 3JQGB 1ZK3A 4GAEA 1T1SA 3RVDA 4DMMA 3PTZA 4RQUA 2EERA 1VM6A 3I5MA 3HDJA 4GWKA 2Q2WA 4ZQBA 3KOUA 4XJTA 4IJUA 3EVTA 1SZJG 2DBRA 1GTMA 1DIHA 3IQDB 4MIEA 5JAQA 3C3XA 4DVJA 4PG6A 1YOVB 3JYQA 2DUWA 4RF4A 3KEOA 4KZPA 1V0JA 2B69A 2VYNA 1CRWG 3COSA 3WIEA 5A05A 3W8EA 1QV7A 1KIFA 1SMKA 4WECA 3ANLA 5DDIP 3UFXA 5HRUA 2I6TA 4BMSA 1TB4A 2YW9A 1A27A 5AOVA 2OMEA 3NUGA 4MKRA 3ON5A 1V9LA 4MKZA 2DBQA 4I1IA 4AJKA 3H5AA 4UEKA 5ITWA 1NQTA 2I67A 2JFHA 2P4QA 1R16A 3D3WA 3PDJA 4MO2A 2B36A 1FDSA 5HS6A 4S1VA 3IJRA 1JW9B 2I99A 3I9OA 2C0CA 5GMOA 3PYMA 2WE7A 3OP4A 3QJ5A 4MP8A 2GN4A 4HX5A 3UW3A 2RHRA 3BTVA 4NK5A 1HLDA 2AMFA 3D1LA 4PLTA 2YZ7A 2EG9A 1DFHA 1ZJYA 3EGOA 4KWIA 1P33A 5H82A 4GX2A 2BLLA 1NR1A 1DIGA 5TT1A 3U4CA 5L51A 1PGPA 3C24A 5ICMA 1ISJA 5BR7A 4EGFA 4OOFA 4YB8A 3RAJA 1P1FA 5L40A 1DBVO 1H2BA 1DHRA 1LNQA 1LU9A 4OYRA 2WYWA 4J91A 2HRZA 4RQTA 4GGOA 1L7EA 1R12A 2Y66A 3AM5A 1NBOA 1NQAO 2D0IA 3DAFA 3I1JA 4BO6A 5JLAA 1T2FA 1GUFA 3OHSX 3VDRA 1IPFA 2X86A 3L9WA 1QYCA 5DOVA 4PLPA 5U4QA 4RVSA 1VC2A 2ZTUA 1JU9A 4Z9YA 1U3WA 1MFZA 3HDQA 4CMGA 4TROA 2W2KB 4FGSA 3JQDA 5EMHA 4CMEA 2YHIB 2CVQA 4MDHA 1MC4A 1UUFA 4ITUA 3OA0A 4ZQEA 5IXYA 4I5DA 1GYQA 5TIIA 4XYBA 4OSOA 1DFIA 1WDKA 4KQWA 3VDQA 4AJ2A 4WGGA 2PH5A 3KSDO 3DOJA 1IYZA 4XYMA 3RIHA 4BOYA 3PIDA 5KVSA 5CDGA 3DZHA 1FK8A 3JYPA 3EZYA 4YJGB 5I7VA 4GBJA 4ZVVA 2CZCA 1UP6A 3BMQA 2E49A 5LC1A 1AXGA 3AY7A 4E31A 4XDYA 3GY0A 2FR0A 3F1KA 1LBEA 3D5QA 3KZVA 3U49A 4BB6A 1LSJA 3D4OA 2X0NA 4IGEA 3AY3A 5G4LA 2H63A 1UXKA 2CUKA 2OP1A 1DRWA 5B4UA 3BXXA 4LISA 1WP4A 3ZV4A 4J6FA 1QG6A 1PZFA 4FPXA 2HMSA 5JS6A 3LF2A 5DF1A 1EDZA 3G1TA 2EW2A 3GG9A 5JFOA 3OQ6A 5JCJA 3LVFO 4HFMA 4LSMA 3PJEA 4BKRA 1QR6A 3DBVO 4P22A 1YRLA 2Z95A 3FBTA 4OO3A 5THKA 3WGHA 1YO6A 1FF9A 2X22A 4FJ1A 3RUCA 2W2KA 3JD4A 1YL7A 3FHLA 5A02A 3WGYA 5A4DA 4EEXA 4UVDA 1ZBQA 5K6AA 1TEHA 1QP8A 4CQMD 3CZRA 4BGIA 4G81A 3TFOA 3WOHA 2V6GA 4B8WA 2J5RA 2TMGA 2I3AA 4ZQGA 5JY1A 5GZ1A 2NVWA 2IXAA 4FC6A 2Z1NA 1NAHA 5HS4A 1Z7BA 4AJNA 2JFFA 4L9RA 1C0KA 2GZ2A 1BWSA 5T67A 1XGKA 1R4NA 4OOEA 2Y1FA 3D0OA 2PKQP 4ALJA 5DBIA 3C7DB 4CL8A 3GN2A 3PWSA 3ADOA 3GEMA 5CPBA 3HQ4O 4KUEA 5KKAA 3PWZA 2VQ3A 1GQ2A 1N8KA 2UUPA 2GDZA 4D46A 4GX5A 1Y8QB 4ALKA 1DPGA 2OGUA 1WDMA 3A14A 3ZV6A 2C2YA 4A10A 3H9UA 1AGNA 1O0SA 2G5CA 1PJ2A 5G2OA 3S2EA 1U2GA 2PTGA 4PVCA 1O8CA 3IOYA 4OHUA 4MP6A
chains in the Genus database with same CATH superfamily
4L7VA 2A9VA 2E89A 2L69A 1G9XA 2IP1A 4JZYA 4P38A 5HHTA 3E84A 2GASA 4ROTA 5KSPA 4ECAA 4BX0A 2WKSA 2CKMA 3A4LA 3C7TA 3AIMA 1KK3A 1Y3CE 1IC6A 3CQ9A 4U0JA 4W99A 2HMWA 4C5CA 3I61A 1Q0QA 4Y0AA 3DOUA 4EHKA 4ONEA 5D6NA 1ZH6A 1EA7A 1NMQA 3OCZA 5GONA 2D6FA 2F9LA 3AVYA 3BFXA 2Q28A 2ACKA 3IAXA 2X41A 4KLZA 5EQTA 2C5HA 2UUBB 2I1VB 1TPZA 5CH5A 1DAIA 3CNLA 5K09A 3A1EA 2RAUA 2XB4A 2DFVA 4I55B 2QQFA 4YBZA 2GHTA 3UHAA 3TDNA 1I7QB 1ZXXA 4Y2SA 1V48A 4QSMA 4E5KA 3K9QO 3JD3A 3PC3A 2Q1XA 1WW3A 4X20B 2JZCA 3NWJA 4P3KA 2XSZD 2FZCA 1K4MA 5FOWA 3HP1A 2ZIXA 3SYNA 2HJSA 1JIKA 1IM5A 1QIMA 1ZSYA 1Y4AE 1EMDA 1KC3A 1O03A 3Q7QA 3IVMA 4Q7EA 5DIZA 3E53A 4D9HA 4MHTA 4KQ1A 3MINB 3ET5A 2J1LA 4IYRA 4E6PA 3RF6A 1DQZA 1SKUA 4Q15A 1U0EA 2FHSA 4U3JA 5F1YA 1XZJA 2WOJA 2XUKA 2YZKA 2HK7A 3EGCA 5IFLA 2JLWA 2PBZA 1B0ZA 2ZSDA 4IQ0A 4IOJA 3DBHB 3CLSC 2P2CA 4F5ZA 3VI3B 3E8XA 4HRVA 1WEHA 1AJEA 2X2PA 5B37A 3ROKA 3TGLA 2VF2A 1VP3A 4PFSA 4BVFA 1N2XA 2GVDC 2R8YA 4G5GA 4G67A 4BMNA 5MGBA 3MOGA 1KTVA 4HFJA 5JDCA 1V3TA 3CUYA 1JG1A 1YJBA 5LYJA 1JR2A 2CVZA 5E1BA 2V7QD 1QQBA 3E48A 1CY8A 1UQTA 1EPUA 3A9RA 1CY0A 4JLNA 2NSHA 1Y6GA 2YFHA 3GRCA 2FEWB 4DCPA 2P65A 2ILTA 5CIYA 2OO5A 2Q5LA 3HB4X 1H1LB 1UF9A 2J6IA 1JWBB 2ZCVA 4HAIA 1D0IA 4K9NA 3PEYA 3OZUA 3ROGA 1NJ2A 1RTTA 4K6MA 3VH2A 4NYJR 2H7XA 5HCNA 3Q9SA 1YDFA 3A9VA 3I8OA 4XR4A 1L4HA 3KHSA 3ZXXA 4FXPA 3IAS1 3NHRA 1O0CA 3QLVC 4UNPA 3ZJVA 5JW6A 4HDNA 1SQ6A 3KE9A 1UBGA 5A9RA 1OXSC 2C95A 2VP0A 3EC7A 3G2NA 3N2KA 3HFGA 2GS9A 4JBWA 4OJNA 4RIGA 4EAQA 2WQ6A 2YVUA 5F3RA 2ARKA 2QSYA 2XBUA 4YQYA 4P0PB 1ZU4A 4MV7A 3A10A 1VRCA 2WU1A 2PX2A 4LYYA 4MDFA 1CNMA 1FMTA 1Y5RA 2WMOB 4KK4A 3GXBA 3BKXA 3HVRA 1E6CA 5CXSA 1NX9A 3TOVA 4FFDA 4E03A 1ELOA 4X92A 1ZI6A 4HGRA 2CLSA 2PGJA 3AM3A 4U0KA 3U9SA 1KYVA 3KUKA 2J5XA 4HDNB 4CTMA 1VFPA 1NMYA 5ERXA 3R7FA 1AKRA 3IVXA 4KH0A 2IXDA 3EH2A 3ZDZB 4F4HA 3CIFA 1Z6ZA 5FWYB 3DCIA 4Q6WA 2B98A 3D8BA 1E2BA 4DEVA 2XCRB 1EE9A 5LJLA 4P0TA 5GPBA 1PD1A 2R6FA 2ZJZA 3ORFA 2BW0A 2O3SA 1E5XA 1NVFA 4FJ0A 4G8CA 1IZYA 2IYYA 1BVYF 3QIAA 4AURA 4US2R 4WE3A 4Y98A 5CP8A 4CG2A 4C0JA 1QC5B 4XE5A 1WXWA 5AVUA 2FZ5A 1QH8A 4DLVA 3MMNA 3N8HA 3UAWA 4R8MA 4IFIA 5C8YB 2AOUB 3BGSA 4MW1A 5AVYA 3DDOA 5L7TA 3U7FB 3PDIB 2OYRA 2WUDA 4RZIA 2A5JA 2NV6A 2QT1A 3DBHA 2YZ2A 4K9SA 2YVAA 3FM9A 4WZAE 1WHSB 1E3QA 3ZHZA 4IDBA 3UKOA 2IU4A 3JQ8B 3PC7A 4DIMA 1O9BA 3HV0A 2OBYA 4Y1FA 1NJGA 4ZI3A 3EZFA 1WRBA 3NRJA 2Q7DA 5BOVA 1TJ5A 2ZCUA 2ZT5A 3NAMA 4DBZA 1C8BA 2B25A 3W06A 1GVNB 1KRHA 4MVJD 4S1NA 2GEBA 5T7BA 1URPA 4GE0A 2YHIA 4CF5A 4P3OA 3NIGB 5LIPA 4EUHA 1TEXA 4YJ2B 2P9CA 3MTBA 2HPVA 1JNYA 3BERA 4YMSA 3WL6A 3ZDDA 2QIOA 2VKTA 4Y9RA 4BC1A 2Q9BA 2AQ8A 5DCYA 1QF6A 3ONFA 3ENZA 5AH0A 5AW9A 4GI2A 1HTBA 2VEDA 2XXBA 2Q1YA 3X2SA 3T41A 1E4EA 2EGHA 4NCNA 2FEAA 5EIOA 2IOFA 5AJZA 2R6DA 4AF7A 1FY2A 3TINA 4B32A 4JT9A 4NMXB 4ZZ3A 1XUOA 2PH1A 2QLFA 5DBEX 1OI4A 3ESDA 4I6GA 2E87A 2EX0A 2P4HX 1U0BB 2NTVA 1JHDA 1VCMA 3B7WA 3WK4A 2GCEA 1TO2E 3LRTA 4YWJA 4C76A 1WSWA 2LNDA 1MQAA 4JL5A 3D81A 4N5LA 3K2BA 3NTOA 3OSUA 1L5KA 1WUJS 3WLRA 2POCA 4EFLA 1AKVA 4PF1A 2N47A 3R5SA 1LQ2A 3SLRA 4MPDA 1RM4A 4QUBA 1C7FA 3SHVA 3UC9A 3VU0A 1G21A 3BILA 2ZBEA 1SZPA 1B0UA 3UPUA 4XWGA 1GUZA 4KP7A 4OQNA 1Y3AA 4X85A 3HJFA 2RC6A 3C5EA 1QZXA 1E3TA 1G4AE 1WP9A 2BGUA 4ENRA 4YEDA 2K87A 1LRKA 4IQ4A 2XNDA 4K88A 4W9MC 2EBHX 1XZLA 3FNGA 1WZEA 5E7IA 1KI7A 2DLDA 2KSQA 3CSSA 2Q0SA 5ENVA 3G49A 2XKKA 4LBWA 5BURA 4GZ5A 1Z18A 3O4FA 2DBYA 5HKLA 1GAJA 2I2CA 1P3DA 3W34A 4XB6B 1YOVA 3L3BA 4K28A 5AVZA 1LWNA 5E6UB 2O8NA 3WNCA 4LV5B 5BSHA 1VIVA 2O0JA 1R0ZA 3F90A 3OICA 4RDHA 2RCNA 4KO2S 3WRWA 4FQ8A 1UWCA 1HDRA 3UT5A 2X7XA 3ZE7A 3E9RA 2NADA 3NV7A 1QAMA 4PLGA 4X93A 3OUTA 5A3JA 4O2BF 5FF9A 2YNMC 2GM5A 1FJXA 2WNIA 2H0AA 3MBKA 1KEEB 2XVYA 1VSQA 4TMZA 3B1FA 2GZRA 5C1DA 3K7EA 1NP7A 2F3UA 3QVSA 4KAFA 2W37A 2WD9A 5T41A 2QX9A 2VLIA 2WOOA 1S3GA 4N12A 4YJ2F 1RQ2A 4IIJA 4JP1A 4YRCA 5TRTA 4UTVA 5KNBA 4GPIB 5EMMA 1OI2A 1AQNA 1EWQA 3ZCQA 2QJRA 1O9GA 2WYUA 3IALA 4LJLA 3N2EA 2C1EA 3F49S 3P9SA 2ZI7A 4EQ6B 4S35A 2WBLC 2F59A 3KQWA 3L0DA 3E5HA 2NU8A 2J9FB 1FFSA 1PSDA 2VEOA 4DCNA 3G6WA 1T5SA 2QRZA 1VZ3A 3C2QA 1HNXB 4HH1A 4L57A 4OMUA 3IQWA 1W5BA 1E9SA 1YONA 3FHJA 4KODA 4YNBA 1AT1A 3SOPA 5EJ8A 1FXWF 4GFDA 4LKRA 3N1UA 1VMEA 2ZXEA 3VVBA 2PTHA 1TK9A 4LJYA 5FEMA 2EVWX 4OXNA 4TQ9A 5U1PA 4QDJA 1OLSB 4YAJA 2HMAA 2VZEA 4HQ6A 4JBNA 5LQSA 4CVNA 4CZ2A 5BN1A 4RTMA 1SKBA 2VNKA 3IB6A 3L49A 1BW9B 5KOHB 2CEKA 2CMGA 1JAZA 4BQPA 4DUGA 4TXMA 4O29A 1YCGA 1GSIA 2H2HA 3DZGA 4L07A 3B3GA 3DTNA 3U3JA 1TOAA 1Q6ZA 1IJFA 3WGZA 2JLUA 1ZH4A 1YK0A 4B7AA 1C4OA 4KUHA 5G40A 4Z7JA 3I9NA 1G3QA 1HNZB 2OWDA 1YS1X 4LSWA 2E6UX 2V6MA 3KR1A 8ATCA 1QE0A 4MB6A 2E3JA 3RNLA 4FB4A 4FS8A 2V96A 4IGFA 3EF3A 3AT1A 2FN9A 3FYUA 2FWRA 3VO2A 3HXPA 5AWFC 3OAAD 1ZCJA 1OFVA 1J8YF 4ML3A 3IE2A 1GXSA 5EHXA 1V1MB 4KIGA 5LB4A 2IIQA 2XWPA 1TJYA 3L77A 4Z0NA 3A1CA 5JTTA 2QXYA 4M1KA 1FFXA 1OBVA 2PX3A 5DN6A 1MJGM 4PYNA 3SR0A 4ZFNA 3ZJTA 3LTEA 3M6IA 4N6OA 4RJTA 1CS0A 2RJ3A 3AESA 3P9PA 1P73A 3ITKA 2PLFA 2NMVA 4POOA 1P0FA 5LCXA 2HEGA 2IYNA 1QK3A 4GQIA 1P0IA 3TMYA 4ARZB 4R05A 4HAVA 3RSGA 2C4TA 5BYBA 3EMKA 3T9BA 1QOPB 2GMWA 4GEGA 4E7OA 4JI0B 1IBLB 2PVCA 2KM1A 3H86A 3KYCA 5EMJA 4ZIRA 5A4MS 5AM3A 3AGPA 4LIPD 2MSCB 3CJQA 1TYCA 4EGCB 1FBTA 1ZUD1 3MRXA 3OTQA 2LPMA 3K9FC 4C0QC 1M66A 4KTVE 2GPBA 3G9QA 1OKKD 1QCYA 1UAGA 1R0WA 1XRPA 3SFVA 3UAYA 2IPXA 4WBSA 5BV2P 3L7CA 3HVHA 5C3UA 4K46A 4ZODA 3A1VA 1X70A 3ENVA 1WPGA 3VNBA 3PKIA 4LHZA 5A3RA 2AC2A 3MMXA 1FDRA 1DIRA 1K63A 2PAFA 4ZVMA 1UFOA 5K1ZA 3V4FA 1U98A 1WQ4A 1JFRA 3C3JA 4NV0A 2R2GA 2GM3A 3OLYA 4NBVA 2J6CA 5J2TF 1L7BA 2PJRA 1ZM4A 5BT8A 4JGBA 4HZIA 3UA3A 3OJ0A 4BLVA 1QGZA 4PNHA 3Q98A 4MVJM 4G4GA 1OBFO 2BZGA 3EWNA 1GDTA 4A36A 4DMGA 3KKEA 4QXOA 1BFDA 1P3Y1 4KMMA 2G7MC 4TM7A 2BGGA 1I32A 1GV0A 1QH1A 4LC1A 4RQBA 4BV8A 1D1QA 1P2DA 4DSNA 1P2FA 2WYOA 4KBGA 2FEOA 2X5XA 3L0CA 1W6UA 1Z0JA 2GZAA 3A06A 1KXJA 2M98A 2EZTA 2V3VA 3BA1A 3E3NA 1RPJA 4L3OA 5CLLA 5F33A 3ZW7A 2ATVA 2ZE6A 3N2YA 3GZ4A 2F1KA 3C6QA 4BEBA 4Z3OA 4OHKA 3B12A 1A7KA 3ZDRA 4A03A 3DZIA 3CVWA 4AZ0A 2PKQO 1PQWA 3SI7A 1P5RA 2CYAA 4X8MA 1D9ZA 1NBAA 3MYRA 4KYUA 5IN5A 2VPPA 4BIMA 5LD2C 5LA6A 1JKFA 4JSYA 4N0QA 2OGWA 1KFJB 4P3PA 1EVQA 2O8CA 1LJUA 3IVAA 3E35A 4GEKA 1Q0UA 2H57A 1ECJA 3SY8A 1AE1A 4LGYA 4KPUB 3WK7A 5DNWA 3E22B 4BX2A 4C3ZA 5EJ5A 1NAIA 1WUKS 1LFAA 4QRDA 1U94A 4DLZA 4DLSA 4ENTA 3SIPA 4HDMA 3MCUA 3C3WA 4RK5A 3I6ZA 4B80A 1YB6A 2NAPA 4R9RA 5DVZA 1F4LA 2CJFA 4NZYA 1O7JA 3SHFA 5LDDC 1F8XA 4F21A 5CCBA 1NURA 1PEAA 4M9UA 4LGMA 1WSDA 5IABA 2ZAYA 1IDOA 1NLYA 1P0QA 3HABA 3C6YA 3RYTC 3EXFB 4FUTA 4GLBA 4MW2A 3RIMA 4XWWA 1QUEA 1KEVA 4URUR 1KC1A 2Q1SA 3L43A 3ZU3A 3V2UA 1E5QA 2I1WA 5IH3A 5K8TA 5DKFA 1QBKC 3IURA 2JAPA 3BOSA 5FBKA 5LQMA 3KU1A 1E3LA 4Q3CA 1UJCA 4OIFA 3WYFA 2R6HA 4Y6LA 3UA4A 1GGJA 3WY9A 1CS4C 1IEXA 1YQ9A 3MELA 5EJ7A 2O4UX 2OBFA 3V7NA 2BWJA 4JYAB 2FPOA 2LDXA 3GLSA 4I5FA 4BU1A 4RANA 3WK9A 3CUUA 4TS4A 1FSSA 2IQ5A 3T7IA 2G8LA 5KMGA 2PX5A 4O4HF 4E07A 5ILOA 1HF3A 2DJ5A 3KAPA 3DONA 2VDOB 5K8CA 4JJ7A 1X80B 2P35A 4FINA 4JP2A 1N2HA 1O6BA 4FSDA 4IICA 4O33A 2R6R1 2DFKB 5D6OA 3V2GA 1Z0FA 3ZUPA 3KQUA 3DBRA 5BWBA 4U3JB 4LFAB 4E88A 2J0SA 4WCDA 4HN9A 3GLTA 3HCFA 1Y80A 3E18A 4R9NA 5CM9C 3FIJA 4D8YA 2ORVA 3ADBA 4GX0A 2EFHB 1TIKA 1H9CA 3AUYA 4HUQB 4OL0A 3SLGA 4YAGA 5K0GA 3MJ4A 3QELA 1HWYA 1M5UA 1S02A 1R88A 2WQZA 3H05A 1YKSA 3U6KA 4AP6A 1I4EB 3GLFB 1ZR2A 4F46A 1V25A 1VE7A 3A32A 1YZ3A 5BQ5A 3P2YA 1CJTC 3DM5A 5HJ7A 3ILXA 4HKTA 1MV5A 1DP4A 1QRSA 4HF7A 3KJHA 5EZ6B 2CKDA 3VZSA 1ZI8A 3U4MA 3OPNA 3KJGA 5CJJA 1ZHHA 1ZZGA 1ZM2A 3WHIA 1XQVA 3ZVRA 2HLNA 2B1RA 2JAHA 3DE5X 2H1VA 4Q4DA 4TKLA 2QEQA 3VYUB 1STOA 4K8RB 3TCKA 1E0AA 5ICGA 2EKPA 5ESXA 1LRLA 3W8RA 2F43A 2RI6A 2OCLA 2QVGA 2Z5FA 4BFCA 3D6FA 4OJQA 1P45A 3UFBA 2B5WA 2E4AA 1W88A 3GBVA 1PW7A 3CLSD 4Y2JA 4ND8A 3BK1A 3FOBA 3H2JA 4QEDA 4G56A 2OBBA 2QMHA 4ZWNA 1BFUA 3V7FA 3FWNA 5KSOA 1CRZA 1PS0A 2VYVA 1NG1A 2Q6KA 3R2JA 4KKXB 4PRYA 4Q02A 5BOSB 3DDWA 1W2HA 4K5QA 1M67A 3PNKA 4CV3A 1AK2A 3RK4A 1F9EA 4K9MA 4EJFA 1CQZA 4CQMA 5EJ2A 2FE1A 3VZDA 3G0GA 1CY2A 3H9BA 4IO1A 2I4IA 3KBBA 4OG2A 1IB6A 1Z9BA 2ZWVA 3RS2A 3F7TA 3K9NA 3HV2A 2ECFA 3G2OA 4TT3A 4TV9B 5M34A 2YJGA 4ZAGA 1MOPA 4QGFA 4YCLA 2GCIA 3JARA 3PHHA 1V8OA 2HCBA 2O3QA 3LX4A 2KB0A 4DREA 3MN1A 3KFLA 3O8QA 3O7MA 3P4UA 5DXJA 4YRRA 1Z7YA 3TUIC 3U44A 2FUG6 4ZDIA 4Q3KA 2REQA 4OUKX 1CK4A 1LY1A 3I9MA 1SFRA 1UIRA 4HLNA 2O2EA 1KEPA 1ZGZA 1JL3A 3INNA 3M3HA 4M38A 3ESRA 2LTAA 5FPTA 1ZFNA 1IL0A 2Q3EA 5KYUA 3UV3A 5CVTA 3EIUA 4JJAA 4KWHA 1BGWA 1T6XA 1XZKA 4GSYA 1N6HA 2EP5A 1E3EA 1FX1A 2PK3A 3IFSA 4OFBA 3KZCA 1IQPA 1NVVQ 3VNSA 5A4JA 9LDTA 3IDQA 2QN9A 2OFXA 4FQ5A 3Q10A 3DEAA 4GR9A 3EE6A 3F4KA 4WZAB 1DLIA 2MINB 3UCEA 2ZB7A 2E1PA 4UHCA 1V5GA 3TVDA 3ZQUA 4EKNB 3A58B 4PGHA 5KWVA 2NXNA 3O83A 1A9ZA 4GXRA 4TWIA 1HE8B 2ZIAA 4GKKB 4U2BA 3KQYA 5HP4A 1EFVB 4BNHA 3PGA1 4C01A 1AF7A 4ZVKA 2OV3A 1FTYA 1N5MA 5DRTA 3TNYA 1DQNA 1WXQA 3W8NA 4A0GA 5ALOA 4HQOA 4NG5A 3RARA 4RPCA 4IM7A 2C03A 4BNFA 2R11A 1CIJA 4E1VA 1NBHA 1KS9A 1PQ4A 4XCXA 2EFCB 4YRIA 1PK7A 2AVNA 4DLBA 2Q2OA 5DW3A 4UMDA 4UZFA 4B85A 4G07A 2H2GA 2X3FA 5TS3A 2PXAA 3AHIA 2H29A 3F47A 4DV4B 2VUTA 4D02A 5LMNB 1UMBA 3OIDA 2NPFA 2NO1A 4NV3A 4D99A 4TTSA 3BGIA 4L75A 2BL4A 4YRLA 4YWHA 1JQDA 1TJNA 2EBUA 4M9ZA 1EUZA 4EX7A 5CB0A 2O0HA 3N87A 2XSZA 1G6Q1 2WHXA 4FEYA 3W1VA 4E13A 1GSOA 2GRAA 4ZZ2A 5A5VA 2ZS8A 3W78A 3ZCUA 3UYKA 1SG6A 2CLCX 4NULA 3J7TA 3HK2A 2BMDA 3WFIA 1J20A 4D3FA 1NPDA 1QBGA 3TD6A 4YCAA 5AUNB 2C7OA 3GPBA 3M9WA 5JECA 2IXFA 2ZYDA 1S7CA 1TM3E 1Q6YA 4CR7A 1Z4KA 3IQGX 3TJMA 5KX5A 1C41A 3AJDA 5LZ5A 3WXBA 1UK8A 3OZGA 1OH7A 1BE1A 1V3VA 2Y1OA 1BOFA 3TL6A 1O5TA 2EX4A 1J42A 2W2LA 1QVAA 3V8EA 2O06A 3DLTA 4DZTA 1CJKC 3C3DA 3ENNA 1UT8A 3ES9A 4NCAA 1U5AA 4IIUA 1WZIA 2GF0A 4U2DA 1N3IA 3E7FA 5ISMA 3OLZA 3QOFA 1JEYA 3N7TA 1IQRA 4BU0A 1Z7GA 4J3NA 1N0HA 4BS9A 4QUKA 3L0SA 1MKYA 5LOVA 3OZCA 1YNSA 3GUZA 1B8PA 4MKGA 2B6HA 4ND6A 3JR7A 4QLAA 1EK0A 3RRMA 3SOZA 4B45A 4BN0A 4RULA 2XCSB 1MC8A 5JSKA 3I73A 4F6LA 1JH9A 2LKDA 4OP2A 2EATA 1XKQA 2XYPA 1YMVA 1O6ZA 2RSLA 2G17A 2YDXA 3I1YA 4L8LA 5EHGA 3QSGA 4Z4CA 3GCZA 4ZMSA 4OH1A 2F3RA 1YZUA 4KQEA 1CV2A 1ULZA 2SHKA 3LWNA 3PNQA 4WNYA 2ADFA 3TQIA 4X54A 3K70D 1CEEA 3ANMA 2R1ZA 3CUKA 2DPMA 3MQ4A 4JCCA 5BNIA 3JQGA 1A7JA 3HCCA 3NIDB 4YJFB 5TT0A 4BKPA 4BVKA 1S8FA 3IAAA 5IDXA 3RC3A 2CWDA 3IILA 3OKFA 4NMHA 4I9UA 3V4SA 4DKXA 3WWCA 1E58A 1YL6A 2F3SA 2ORED 4KQKA 1X42A 1WKBA 1OV4A 3CRMA 4P36A 4V1CI 1VL1A 2G70A 4MMXB 3IQZA 4NONA 1BMTA 3CZQA 5E8JA 3CRRA 2PSHA 4OK3A 5CFZA 1G8JA 4QHYA 1G2PA 4TZ6A 3PJFA 5EGSA 1V5FA 1GUDA 3CLRC 2HJ9A 1TM4E 1WXDA 3VR5A 2PZLA 5K7SA 2OZKA 2VF8A 3RVBA 2G9VA 1Y89A 3PXGA 4NYJQ 4OFZA 3ZI0A 5BYJA 2HHJA 3MPUA 3WLFA 3DWGA 4Z4FA 4YMWA 3IKTA 2HLPA 3QLTA 1I4LD 4DPKA 3H04A 1S9HA 2AOVA 4R2KA 3K71B 5T4EA 1VJRA 4H6WA 1E96A 1R0SA 2ZE7A 4JLSA 4XFDA 4CM7A 2WD7B 4HTAA 1JT2A 3Q3GE 1GGNA 2IZ7A 4ERXA 3WB0A 1C9DB 1PTKA 1OFTA 3CG4A 1EQ2A 1NF2A 3FMGA 3GHHA 2XGJA 1UDAA 3SQLA 3D5EA 2JEYA 2IPLA 3QUTA 6ABPA 3PGVA 1CJMA 3JZMA 3JATB 3HJBA 3JQPA 1YQEA 3MSCA 2EG5A 3RBAA 3EAQA 4ZPJA 2I91A 3IHKA 1SIOA 4XX0A 1NBWB 5BWNA 1LBHA 1NWHA 2ZR8A 3HADA 2JCBA 4TV9A 4NJMB 1B8UA 1NFQA 4EPXA 4EYSA 8MHTA 1JF8A 1GGHA 1XMPA 1G5IA 4MUAA 1P2BA 4P2BA 4POAA 4EJMA 1MAUA 4RSMA 4MJ3A 2AFHA 2HUNA 2RGWA 1H5NA 3MJVA 2QN8A 3UK0A 4EUKA 2AN9A 1PJ3A 3W2EA 3KOZA 1VCNA 1G20A 3RU2A 2D2IA 2CVHA 1UPCA 1VYHA 1M2KA 2B92A 2OAEA 3PNBA 5E1OA 4KQXA 2OZVA 2O48X 2JPDA 1FFCA 5JSQA 1SC9A 2ECPA 3BAZA 1DO2A 1BH6A 1TI7A 2YWDA 2ZUDA 3CLTC 3LYLA 4IKPA 4MS3A 4DR2B 4JP8A 3CZAA 2XMGA 4BCBA 2XW6A 4ARZA 1KVTA 1CLEA 1NOIA 1V2GA 4H3VA 4F4FA 2O2GA 3U7EB 3DNMA 3MTJA 1IEWA 4HZGA 4XIIA 2RGUA 3CRNA 2FEKA 3O6VA 2JL1A 3GUUA 4K3VA 5GONF 4D8XA 1A1VA 3I76A 3H8SA 1XHFA 3RVLA 4L2IB 4FNMA 1SRQA 5DO9A 4JSTA 3RV4A 4A5OA 1KPIA 1JEJA 2VDUE 4CBVA 4YXFA 4LRTB 4YP6A 3AYZB 2YYYA 2ZM5A 1Q0RA 2IHVA 2IWHA 1VIAA 3L02A 3Q11A 1JFSA 2A0KA 3BE5A 4EVIA 1E5LA 2Y4NA 1YA6A 2R1TA 3U19A 4O0LA 1T24A 4ZCPA 3VAAA 3TZQA 4AVYA 5JQGF 4LZOA 4EMSA 2C96A 4DA0A 2HJWA 1NUTA 4C4RA 1OFUA 1FMLA 3F0TA 3ZHRA 1ONNA 2FRDA 1CZNA 3Q5GA 1TTPB 1EX7A 2JBAA 4RVDA 5K8LA 1K3UB 1R4MB 2H18A 2XNDD 2XVXA 1L4KA 3PI6A 4HNGA 3NVMB 4LJ4A 4PCVA 4U4AA 5DTQA 2FQXA 2WP8J 2UVPA 1Z2CA 3L1VA 3H2SA 3VKUA 3I52A 4H16A 4OUDB 1SU4A 3NYWA 1FDWA 2XKAA 1HY3A 1NV9A 2BDUA 2IEDA 3FSRA 4U9IS 5HILA 5MDHA 3DCYA 3IMEA 2VT3A 4A1FA 5C8YA 3ZNPA 4PZCA 1MJHA 1W94A 2XRYA 3R4VA 1CUHA 1JDPA 1WCV1 3BQNB 1KI8A 3CBQA 4HYQA 1KK2A 2ZBFA 5BN4B 1Z5WA 3LC0A 1TVEA 1F8UA 4XDHA 2P2NA 1FYEA 1XI2A 1UKCA 2CBZA 1I5OA 1Z8DA 3GD7A 1KZ6A 3MJSA 3N07A 1DAKA 1K9VF 2LR0A 2J46A 3ZLJA 2BDTA 2JBHA 2QJWA 3ZE8A 2QZ9A 3AYXB 3EN0A 1QHGA 4LRUA 5L3VA 1JDZA 4ZPXA 1WW2A 1QO7A 5C34B 1EI9A 1W0KD 2QZPA 3MYYA 4YRMA 2P6OA 4PLYA 5ALKA 1U9YA 3GRKA 4D2IA 3DM9B 1HC7A 4H27A 4UUNA 5KNBD 1T8YA 3KVVA 1DBWA 2G04A 3ISVA 3TX2A 1VKZA 2QW0X 4M9XA 4LVNA 3G2LA 2HNBA 3WR5A 1ECLA 2QSUA 3SZLA 2ZROA 3K8ZA 1GGVA 1TPYA 4A3SA 2HYIC 1XNRB 1SWVA 4C4ZA 3VYTB 3F7MA 4HYYA 1UT5A 1M1UA 2CE2X 2NZXA 4MPRA 4OSPA 3ELYA 4Q5IA 1R8XA 2V9ZA 3C6XA 4HR7A 4RXUA 4ZJPA 3T7DA 2G40A 1J7JA 2ZT7A 3T4EA 4F85A 3DQPA 2GSDA 5C2JB 2WSIA 3CHYA 5JAOA 3PA6A 1ZR4A 2PCJA 1XMIA 4HBZA 3L0OA 2VCHA 1EXMA 1NMXA 4AKHA 2DU8A 2BJVA 3KSRA 3LO8A 5F3DA 5AM2A 5ESDA 2CDBA 4DXDA 4F97A 3RSZA 3F74A 4QEZA 4RO0A 1J8MF 1VLQA 3W9BA 4WOBA 4BRSA 2D7DA 1FFDA 2BC9A 5K9ZA 2QNRA 4DUGD 2CFOA 3AF5A 2Y9MB 1G55A 2C77A 2OV6A 3BORA 1NMZA 3IJPA 3KHTA 5FIUA 2XRMA 4UBLA 2GZ3A 5FBRB 1FQWA 3QOXA 5EXSA 1YAJA 2QTVA 1N7GA 5E4JA 3T3MB 2VTBA 1BMDA 1P5FA 1K7FB 4OHXA 5J2UA 1W4RA 2GESA 4FSXA 4R1QA 3PJGA 4XWYA 2OILA 2D8AA 2FSVC 4PO9A 3VX3A 1VSUA 3AX6A 3EFOA 4LTDA 1K8XB 4ZT6A 3PCTA 3OAAA 4RKQA 5G1PA 1VKOA 2RK3A 4G0MA 4OV6B 3LL7A 4Y2UA 4R41A 2ANCA 5IMSA 1FRZA 3IXQA 4B3TB 1K5HA 2NU7A 2OOKA 4IIDA 4UAGA 3VJRA 1SQSA 1XVTA 3IERA 3HRIA 5DYIA 4RCYA 3WYDA 4Q3BA 1NW8A 2KE5A 3H13A 5HFAA 4A8HA 5MGNA 3HKCA 5C1BA 4JL8A 1KSFX 3ZV3A 3PRYA 2ZSHA 3BFKA 4HFRA 3VPHA 4WCFA 5B1HA 1IHXA 3F6CA 3FNEA 4K05A 2ZRHA 2WT4A 5A0FA 4YJKA 1TQHA 1KAMA 2HK8A 3GLVA 2PGLA 2YY6A 4ZGGA 3VM6A 5BUCA 5HIAA 2E4VA 1RKVA 1SXJE 3MVEA 1M0EA 3K72B 3C48A 3IQEA 5GOZA 1U9IA 4RMNA 5FA8A 7REQB 4W6QA 2JIZD 3M6XA 2ZE8A 5UKDA 2R5NA 4GKVA 3FGZA 2FEMA 1T9ZA 2X2OA 2IYWA 3PUIA 2TMDA 4A2PA 5FUXA 3NVAA 4BMDA 3F4LA 1C8VB 2VYCA 4BVLA 1YFKA 5CFLA 4I1SA 4INOA 2BEUB 1DBRA 4DG8A 1QYWA 1OKKA 1TT5B 3MB5A 5LA6F 1PGOA 1H2EA 2RHJA 3U16A 4WCFB 2QRHA 4NI5A 4P7GA 1N5OX 3LECA 3K4HA 5L4LA 4WK2B 2BM8A 2O5EA 1E1RD 4HNTA 621PA 3MJHA 1OA0A 4YR9A 1E6UA 2WSMA 4JX9A 4LEIA 4X66B 2B9EA 4C4PA 1WX1A 2BFCA 3MLEA 4L73A 5FLEX 3QQPA 4IRXA 3GFTA 4B7ZA 521PA 5IM4F 2DLCX 2I7XA 3GVCA 5BVGB 3CPEA 2I2AA 1RAAA 2EZ4A 4BQRA 1E66A 2WUGA 4DGSA 3RJTA 2YWXA 4MH0R 2CJWA 2BZ0A 1KETA 2PU5A 4FFMA 1DV2A 1TQ8A 2GO1A 2HMUA 4Y7CA 1IG3A 1SXGA 2GWRA 3WKEA 4Q37A 1TT7A 3IA2A 1JG3A 1XCMA 1G2IA 1XZAA 3S2IA 4D4HA 3NTUA 1XTJA 2BTEA 2GZ1A 3E3LA 3LUDA 2DQKA 2O07A 4NJEB 4BYMA 1EGVB 3FZYA 1PZNA 1RKUA 1RYHA 2ICAA 1GQYA 2QYTA 1B0PA 4R2MA 3FDZA 2M6LA 2RKWA 5KYUB 1L4MA 4PPFA 1THZA 2B9VA 4OB6A 4INJA 3HM9A 5TDHA 3WGQA 3UBTA 3AB3A 3ZD7A 5C80A 2VSYA 2AJDA 4FGKA 3T3PB 2GAJA 4R8VA 2QT9A 1GL7A 8OHMA 4R1OA 1PU2A 3IS3A 3QVXA 4Q9JA 1XQ6A 2AIRA 3VFDA 2XUJA 3M3DA 3ED5A 2AXPA 3HMKA 2AQIA 4Z4GA 2GPTA 2QP9X 2NU8B 1BGVA 1FOEB 3Q3EA 5BRNA 1KGDA 4B3XA 1E9VA 1YVEI 2P77A 3C6ZA 1YAHA 4RKFA 1GGMA 1R8SA 1U2DC 2HADA 2QWXA 4OX9Y 4JVNA 4TMFA 3BEDA 1M72A 1T4BA 3GNQA 3CO5A 1KAHA 2CHQA 1U9JA 1RKBA 1YBMA 4GGPA 4D9CA 2AKEA 2IJGX 2FSIA 2I4LA 3BGDA 3UK6A 4CIXA 3PUVA 4CMIB 4ND8B 2DOKA 3I37X 1YJAA 3ZWNA 1RDFA 4O08A 3VOTA 3EPPA 1DRKA 3KSMA 3D59A 3WGOA 1A9RA 4TRNA 2A0FA 1UP7A 3HCWA 1LW6E 1XQYA 4YO8A 3MBIA 5JS1A 4REOA 4X97A 1EWYA 2CT8A 1T0IA 3AFNA 3OEWA 5IWAB 3SSOA 4NE2A 4MS4B 1W75A 5J47A 1XMSA 1R5NA 3KYDB 2OCBA 3E9ZA 2YC4C 4RL4A 3OMWA 3TQQA 3R1IA 3O8NA 4N7BA 5AK6A 5FO1A 2Y71A 4QGHA 2IYAA 5IC6A 4BZZA 2BSXA 1ZN7A 3RIEA 3T7JA 4XLLA 3QU9A 5GOTA 3BGOS 2Q7OE 4HHEA 1EVLA 3STXA 1RI1A 4F4JA 5HUJA 4EG5A 2ZYUX 3NDPA 4TQUS 1JAYA 1NIJA 4WN3A 2CW5A 4J90A 3TPFA 3KT6A 2B4KA 4G5YA 5JADA 2Z2ZA 2G36A 4WFJA 1B3BA 1QFJA 2R66A 5U4XA 4AK9A 4W5WA 1S3IA 2QU7A 4RVHA 1FSPA 1YNOA 1XKXA 3DO6A 1BVHA 4CIAA 1A97A 3LYHA 3M9LA 4GMKA 1VCHA 2CL7X 4ISCA 1LLFA 3NWPA 1XN4A 3RRZA 4LOIA 2PD6A 3PJDA 5E2IA 3GBPA 1ZGGA 3CCCA 1RBYA 1MPXA 4LXGA 3VZQA 3KR0A 4Y18A 3OPQA 2QUIA 1EJ2A 1P7CA 1WF3A 4ENPA 4S1PA 1FUIA 2OBLA 5LZ7A 3NOOA 5D85A 3WWYA 5HUQA 2YV1A 1AUQA 3IPAA 1JH8A 2FUCA 3OQVA 3IR5A 4NQRA 1C5KA 3AR5A 3ABQB 4WJZA 2J32A 4PC6A 2LD4A 2WJJA 1HMYA 4JWKA 2VQDA 2YWCA 4OMFG 2J33A 4N5NA 4CODB 3TZEA 5IKMA 1JBKA 2QMEA 2APJA 2YMMA 4L8FA 5IAGA 1CT9A 4P9NA 4XIYA 2BJWA 3JQEA 1LNZA 1ZD4A 2HA4A 4Q7KA 4C2TA 4GI5A 2QRGA 2UZIR 3GHYA 1AV7A 4NCJA 1FMCA 1BH2A 1SBZA 4DCTA 5EJFA 2W7TA 2GJ9A 5KTNA 1U0JA 1C9EA 4GC9A 3TOSA 1XZCA 3QW4B 2VPWA 2ZPUA 4KZKA 2QM7A 2VYVD 1PNRA 1J1UA 1DTWA 1RM5A 1OPXA 2PSDA 4BJHB 1ZHOA 3GGJA 1IB0A 3R5JA 3CVUA 2QPOA 3BB4A 3R6TA 4E2XA 2GLUA 2W58A 3VHRA 2XBMA 4TT3D 3W7VA 4RK6A 3OJFA 2I76A 3LA8A 3ETHA 1PHPA 5B58T 5IJ0B 2HHLA 5AYVA 2VI5A 2VH5R 3ZHXA 5JNLA 3K1ZA 4WXPA 1SUFA 1AOXA 2AL7A 4L4RA 4BNUA 1YR7A 4EHJA 1GGFA 3ZQJA 5I4BA 4M22A 3JD2A 3ZGVA 1B6GA 3A1WA 4LZJA 2GPNA 2W6IA 4FXOA 1U8EA 5J2TA 4DNOA 1I6WA 2P1RA 1W1UA 4ESVA 3AGQA 3WRXA 2IY7A 1Q7RA 4GZLA 2WJIA 4AU1A 2WYIA 3X1XA 3KZMA 4YI3A 2Y1GA 1JDTA 3LZCA 1DBPA 1HE1C 4LWZA 1NJFA 5L4NA 1AN9A 4O4LA 2ZW9A 4YO7A 1AM4D 4BYGA 5B3JA 1AK9A 3DR3A 4BTEA 7ADHA 1V39A 1JI3A 5JU6A 4WKBA 3V3KA 3VU1A 2HF7A 1NVXQ 1SBCA 2ZR9A 3QU5A 3X1ZA 4LRSB 4TLDA 1FS6A 1QV9A 3N9IA 1QLJA 1A9OA 1USGA 2O1WA 2QPTA 3QFFA 4XOIA 5CYPA 2HFJA 2HSWA 4R2LA 3VTZA 3DKIA 5KX5F 1DUIA 1E62A 2CNKA 1EP2B 3RHZA 4B8ZA 4IH1A 1T3ZA 1XMXA 4E2YA 2FRXA 1ID1A 3PEFA 2ASEA 3E27A 4DF3A 4MWZA 1XBTA 3FCOA 2PSJA 3GR6A 4FYXA 4IL5A 4MUKA 4EY5A 2YIDA 1RPNA 2QBYA 4CKEA 1CR0A 1Y9JA 3I9LA 2IPOA 4LQCA 3JVUA 1DO0A 5KWSA 3AKZA 3VU3A 4B3SB 5B4VA 5KVCA 3ROQA 3S2GA 2LP4Y 1S2GA 2D5IA 2DB3A 4WBNF 2OXIA 4L0DA 1MXHA 3DPIA 3FVTA 1RLIA 1PG0A 3B1WA 1T15A 1F14A 1PWHA 4KXLA 2WUFA 4X3OA 2VJKA 1UM9B 4U2CA 5IYZF 5K3FA 4J4HA 3NH9A 1OF1A 4NMLA 4RZ2A 5F7JA 2BDEA 5B1EA 5KTPA 5AMXA 3GG2A 5DSTA 4AY2A 3LU1A 1DAFA 4BBJA 1EVZA 3IKLA 4UVIA 2DP4E 4U1RA 3W79A 3PRHA 1J2JA 2EF0A 4OQFA 3VOAA 1WB4A 2ID7A 1ODSA 2P91A 3AOEA 2OL4A 5DYTA 4EEZA 2XYQA 1M9NA 1C3EA 2NSJA 3GZNB 3IRUA 5EZSA 3OCCA 4Q1VA 2G9NA 4M1YA 4EGQA 3AVTA 3MTGA 5FH9A 2A30A 3F7NA 5EGNA 2ZRPA 2ZXFA 1G8FA 4WCFC 3JASA 4R8LA 1QAOA 4B40A 4HQNA 2W2LD 3LYUA 4KDCA 5JHGB 3JSXA 1UMDB 3V4RA 5LDHA 4U2EA 4G9EA 2LUOA 2CFRA 2DGDA 5CNIA 5E6SB 3W5DA 3IP9A 3IEXA 5JQGA 1AIPA 2VHCA 1VJTA 4FLEA 1ATIA 2PGAA 1F2UA 3KEQA 3WISA 4UM9B 2PBFA 4E5PA 1GLNA 1IVYA 1T43A 1DX9A 1FW8A 1QGED 1O94C 2BGTA 3E9MA 3K73O 3NAZA 1E2HA 3VBEA 5JEDA 1PT7A 1UODA 4PIVA 4CM4A 3PEUA 4KX3A 4LDAA 3GVHA 2QL9A 2VYND 3AP3A 1L5MA 2WIJA 4E3WA 4G0NA 1YZYA 2DWOA 4MIOA 3TAHA 5ICCA 1WB6A 4QARA 3PUXA 1WXIA 2ANBA 4LDRA 1U2TA 3BN3A 2PUEA 4QFBA 2FSHA 4Z2YA 4IDCA 3NMUF 1AA9A 3UUGA 3LP6A 2VLBA 1GVHA 4GNRA 2WIFA 1X15A 4N01A 1T2EA 1SZCA 4CG0A 3AVUA 1VIMA 3ZZMA 4RPHA 1EHYA 1GUBA 1I10A 3RC9A 1B6SA 1JSXA 1GU0A 5DSXA 2GYWA 3H9GA 3T5PA 2PRYA 3IRVA 4GH5A 3BWYA 1TW2A 5IN4A 1DT5A 1S6YA