1M7BA

Crystal structure of rnd3/rhoe: functional implications
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
179
structure length
179
Chain Sequence
VKCKIVVVGDSQCGKTALLHVFAKDCFPENYVPTVFENYTASFEIDTQRIELSLWDTSGSPYYDNVRPLSYPDSDAVLICFDISRPETLDSVLKKWKGEIQEFCPNTKMLLVGCKSDLRTDVSTLVELSNHRQTPVSYDQGANMAKQIGAATYIECSALQSENSVRDIFHVATLACVNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Rnd3/RhoE: functional implications
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Rnd3/RhoE small GTP-binding protein
total genus 59
structure length 179
sequence length 179
ec nomenclature
pdb deposition date 2002-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1m7bA00
1DPFA 1YZTA 2J7KA 2R6AA 3GP8A 3QPWA 1V43A 3PITA 1H65A 4PSKA 3UWKA 1YZUA 3AVTA 2OBMA 2J46A 3HDTA 4XOIA 1GNRA 3KQUA 1XEFA 3Q3JB 4LJ9A 3CX7A 4Q7LA 1WE2A 2IYZA 5EE3A 3QVVA 4LJ5A 3JZMA 2HT6A 1Y3AA 2VSXA 4RFSA 3VMFA 4ACAA 1XPOA 2HYIC 1YZGA 1D2MA 3AVOA 3NC1C 3QJYA 4TT3D 2QE7A 1JXMA 3ZH9B 221PA 1GM5A 1LVGA 4PO1A 4AKIA 4DLYA 3ZVLA 1Z3IX 2EFEB 4HLCA 5AJWA 3M6AA 4L9SA 3ZVNA 2BBSA 1P7CA 3TLXA 2GTPA 2XOKD 4OI2A 1F5NA 1P73A 2QP9X 3PUVA 3KJGA 1DBSA 1UDXA 3TSOA 2ZYUX 4AIIA 1DAFA 1E79D 3PQCA 5TMPA 5P21A 1J90A 4KXFB 3PFIA 4QJ5A 5J4LA 4L16A 2D7DA 1GL7A 4JLPA 2VP9A 5SZIA 1PLKA 2OZEA 2XAUA 3SS8A 1XTKA 2CK3D 5TY0A 3ADKA 3TBKA 1CLUA 2CNWD 2HCJB 4DLVA 2W6IA 5A0FA 4A4DA 4PHFA 4HAZA 4OL0A 5IF9A 2P0EA 4BWYA 4M9QA 1Z6XA 1RFLA 1T5IA 5AR1A 4BLTA 2FMXA 4IHQA 1ZD8A 2RGBA 5L3RA 3LX8A 4KVAA 1R0ZA 1NMXA 1NL3A 4KFTA 3ZIAA 3NHBA 4QOSA 3EX7C 3AF4A 1W36C 3KJHA 1FFHA 3KUDA 4F4IA 1ZD1A 2B8TA 1W0KD 1NLFA 3U60B 2QRNA 1ZUHA 4UNNA 2XB4A 4BFYA 1XD9A 1GOTA 2CEAA 5FTMA 1KHTA 3U3JA 2D2EA 2CL0X 2PEZA 2PCLA 3K09A 4QC2A 2GESA 3R20A 4TMXA 4O2LA 1G7TA 3TR0A 1MO3A 3OEHA 2PJRA 3ECCA 4LHXA 3RS3A 5IK2A 5CM8B 1OKKA 1JJVA 5GJWC 2BCGY 3T1QA 1Z47A 4A6PA 2H92A 4IOJA 1U0LA 4A82A 1XJ0A 3U3OA 1JPNA 4IDQA 4OHWA 2DBYA 4LJAA 4N1AA 4HLUC 4PPGA 3BERA 1AGPA 4YMWA 4NCNA 1I4DD 2QUZA 3PJRA 1W0KA 1CRQA 2GEVA 3D31A 3GQBA 3QENA 4LBYA 4X8MA 3IQWA 4BQSA 4DVGA 1E2EA 1K8RA 2LWIA 4A9AA 2CDNA 1MRNA 2ZPTX 2ANCA 4P4SA 5JCZA 3MMPA 1GDDA 2Q9CA 3K9LA 4FMDB 1Z8FA 4OQMA 3EASA 3WMEA 3VTKA 1GFIA 1NSFA 3NDBB 2O0JA 3GFOA 2VSOA 2FFBA 1A2KC 2WWFA 3SJBA 2A5YB 2IYLD 1E2DA 2P6RA 3T5GA 4I99A 4WZAE 4V0KA 1I2DA 1X86B 2JIZD 4BEBA 1R4AA 4GZMA 2HLDA 1FP6A 1W49A 3KKOA 3SFZA 1T3LA 2FEOA 4RFVA 1AS2A 2H17A 1E0SA 3TSZA 4DB2A 1HT2E 3U7EB 4LCBA 3MD0A 5JRZA 1NP6A 3BC1A 3GCGA 1UFQA 2EU8A 4XWAA 1KDPA 2D7CA 1OXXK 1EK0A 3CB4A 3QF7A 3RS5A 2IF0A 2C96A 2YOFA 4JJZA 3W3ZB 1R5BA 2AWNA 2GCOB 5B2ZA 4CDGA 5KYKA 4BECA 2CBZA 1UEIA 4LZZA 2FPKA 3U6KA 2N46A 1XZPA 2YWFA 1Z6AA 2EVWX 1RKBA 4Q5IA 4Q47A 3EC1A 1CJMA 4EDHA 3T1VA 3SHFA 4AI6A 1S1MA 2F7SA 2FG5A 1JQJC 2KB0A 4PAMA 1IXRC 1D9ZA 3SYLA 3AUYA 4DC9A 5G41A 2CLCX 1ZUIA 3B85A 4JVNA 4Q66C 4Y0AA 1GWNA 5DI9A 2WPDA 3VU9A 1EFRA 4YLGA 4TTQA 2ZJBA 2OLJA 3BXZA 2WAXA 2EYQA 1XMSA 1Z07A 3AGQA 1R10A 1G8YA 2CJWB 4Z8YA 1QHYA 2GZDA 2VP4A 1VG0B 2FX3A 2Q3HA 3FYHA 2ATXA 2ZTSA 5GJCA 1DADA 4KVGA 1Z6YA 2D74A 2VF8A 4HLUA 2QAGB 2REBA 1E0JA 5FOVA 2ZVPX 1RW4A 4CEJA 5DH9A 3QY0A 2HEIA 3PVSA 1WDTA 4ZCIA 4Q1FA 1OKKD 3CX8A 3CW2A 4RD3A 4JZKA 1DOAA 5FUVA 1OE0A 3DZ8A 3BJIC 3MGCA 4LC1A 1G3UA 2FPLA 1G3QA 1KO4A 1YZKA 3NH9A 2AKAB 2ORWA 1RYHA 3KKMA 4DLSA 4DXAA 2BHRA 3B5JA 2FF7A 3QBTA 4FMCB 4MITA 2F3RA 3QE0A 4TLAA 1IN7A 4URYR 3DM5A 3TJZA 1OF1A 1Z0DA 4D4MA 1E9RA 2F1IA 2FSGA 4F38A 2NG1A 2FFAA 2J1LA 1QHNA 1LS1A 2QENA 3PXGA 5ELXA 2O8FB 1KI4A 3LY5A 3SZRA 2W6JD 4B2IA 2G77B 3GEEA 1NVWQ 2IF2A 1XPUA 2C95A 1GRRA 4GRAA 3GPLA 3DHWC 5UKDA 3CPEA 1Q3HA 2NZJA 4GZLA 3I73A 4OYHA 2ORIA 3W6OA 2WMNB 3RNLA 4DDWA 2ZRKA 4CT5A 3CX6A 4EKDA 2AWOA 1W2GA 1G18A 4DHEA 4MDFA 2K5UA 3FVQA 1I2MA 3CO5A 1QG2A 3VHXA 2ZI6A 4LJ8A 4M9ZA 4U02A 3QKTA 4WXRA 3BWDD 5TDHA 1KJYA 3I3SR 2VP2A 4B6EA 1WQ1R 5FL7D 1E2NA 1JBKA 2RMKA 4US1R 4DBLC 4OK5A 1KI1A 4IOMA 1J99A 2G1JA 4ABYA 5DE3A 5EUQB 2C99A 4U00A 4IW3B 3CM0A 4XSGA 5FPTA 5DHFA 4PSVA 3UKDA 2FPMA 2G0TA 4Q7KA 2QE7D 4TMKA 4PR0A 1KDOA 4PSAA 3B1WA 5BW8A 2J3EA 2OCBA 3UIEA 5KDDA 2QI9C 1S8FA 3LWNA 4Q7MB 2OO7A 3DL0A 5JZVA 2QY9A 1D6JA 4TL6A 3SOPA 2NO0A 1KSJA 1G7SA 2E9SA 2IYSA 2WSMA 2D4HA 3WP0A 3D3QA 4PFSA 3MWLA 1VCIA 2FNAA 4LJ7A 3U44A 3R9XA 2QEQA 3HYTA 4M1SA 4QL3A 5SZKB 2B6HA 3OFNA 3ZIAD 2A2ZA 3CNLA 4XJXA 2XNDA 4UQOA 2HJVA 2JA1A 4PQYA 4ZKDA 5DSZA 2NPFA 2G0NA 4H9GA 1QG4A 1E1RD 4DT1B 2ZQ5A 3L0IB 1ZCBA 5JCPA 3EWAA 3T06B 1F60A 1MRSA 1ZM7A 2W6ID 3CNNA 1E1QA 2VTKA 4ZIRB 1RVDA 2ZM5A 5TXGA 1T4GA 1ONBA 1KO1A 3W9YA 1G19A 4C0AC 4I4LA 3EPKA 1RJ9A 1OT3A 4LGMA 5GJVC 3SC3A 1NVVR 2ODBA 4LV8B 5L8VA 6Q21A 1FMJA 2NO9A 3K70D 2GJ8A 5FOUA 3DZDA 2RH5A 4UJ5A 1TNDA 5M04A 2WM9B 5JJIA 1YRBA 3U5ZB 1X8KA 3RS4A 5KPJA 2JLQA 1U98A 2ZIAA 4BUJA 1KK1A 1E96A 2YC4C 3G5UA 3VQTA 2ECKA 3NTUA 2HXYA 1IY0A 1CKEA 3ND9A 1ELOA 4ASUA 4D6PA 3THXB 3DVLA 1QZXA 3NDPA 3DKVA 2GF0A 3BH6A 5AUQA 1KI6B 3AM1A 2PZGA 4XWKA 3FWYA 4TYQA 4DCNA 4F93B 3A4LA 1HE8B 1VYUA 3GJXC 2WJVA 4GOJA 5FTJA 4IXNA 1E2LA 4ZKEA 2XZPA 2D2FA 4N0DA 2ZI9A 2XXAB 2NZ8A 3CF6R 4V02A 1AKYA 4FCWA 3N5CA 3TE6A 1UEJA 3M1IA 4ZI3A 1KSGA 3KKNA 2G9NA 4NYIR 4NHOA 3LFUA 4D2IA 4E07A 2XNSA 1WCV1 2PH1A 3K0AB 1KO8A 4NL4H 4EPRA 1OIVA 2O52A 4OI4A 2BVNA 4UXIA 4D4KA 2Q0HA 3CBQA 4DLZA 5KSYA 4POAA 1E1QD 5HCNA 1BKDR 2HXSA 2P5SA 5SZHB 5G40A 1UBCA 3KTAB 1DS6A 5IT5A 1KNXA 1U94A 1T8TA 1RE0A 2X77A 3W5IA 1VKJA 3FFBA 4B34A 3B1VA 2Y8EA 3RRNA 5JFGA 3KKPA 1SXJC 2MSDB 1II8B 1E2PA 1Q44A 1IHUA 3Q7QA 3X1ZA 4S2EA 3HJNA 3AVVA 4HAXA 1Z6TA 1LY1A 1ZCAA 2V7QA 2ZRHA 3X1XA 8OHMA 2V1XA 3PEYA 4TYWA 4I1UA 4LDJA 4KFUA 1T0JB 2IXGA 3GJ0A 4BGDA 3FKSA 1D8TA 4P0TA 1N3BA 1PLJA 5FI0B 1KK3A 4RD2A 2CL7X 3FMOB 4IFBA 1XD2A 4R2IA 5IK2D 3THYA 3I62A 2CLSA 3VR4A 2WOJA 1XCMA 1ESNA 5DYIA 4EJSA 3GLIA 1XWIA 5J4HA 3B9QA 4TWZA 4AKGA 3ADCA 3FGNA 1IJFA 4WBSA 4KLNA 5C46F 1LFDB 2WZQA 2JJ2A 4F7WA 4WVFA 1VHTA 4JSTA 4TMWA 4Q9HA 5C2JB 5FOSA 1OXUA 1VG1A 4CZ2A 4ZDJA 2O8EB 2W2VA 1EFHA 4PZLA 4PC3A 3T1OA 4DSOA 2AD5A 3PV0A 2FWRA 4HAWA 2GCNA 1L4YA 2C9OA 2H8KA 2OXRA 2XJ4A 4Q4HB 4C3ZA 4HI0E 1ESMA 1Z28A 3NVAA 5GVSA 3KQLA 4FCTA 3O8DA 4GMDA 5BWMA 4BFVA 3NHAA 5FR2A 4KO8A 4PC2A 4UNRA 4NPHA 1S3SA 1OB2A 3HR7A 4ZI2A 1MABA 1OHHD 2RHDA 3PUXA 3RRMA 4QBIA 1SULA 5JSZB 1VIAA 2VHJA 4DUGD 2O8BB 5FOWA 3EZ6A 1R0YA 2XEXA 4TMVA 3LH5A 5IDVA 4JLNA 4A2QA 3EPJA 4M53A 2PEYA 5LDDC 2AFHE 4UXHA 2WWYA 4KHZA 3MRSA 3RAPR 4AKHA 1OSNA 1ZBDA 1NF3A 4V0NA 1Z0FA 3GJ7A 2B21A 5CB6A 3PUYA 2VP6A 4B73A 2HLDD 2W0SA 1J8YF 2IHBA 5HZHA 1UADA 2ZJ2A 1P2SA 4ZDIA 3QIAA 3KTAA 4GSYA 4WW0A 2ZRJA 2OFOA 1KO7A 3MG9A 3GD7A 2C77A 3I1FA 5J4YA 2R44A 2WHXA 4MA4A 3CR7A 3G82C 4V0OA 5CYOA 1DAHA 3CRVA 5CJ2A 521PA 3TQCA 1ETUA 1G3IA 5JRJA 4NYJR 1IM2A 2QRZA 1E2IA 1XXHA 2IEYA 1B0UA 1G64A 1XF9A 2C5LA 4RSGA 3L0OA 2NPIA 4RZXA 3U4QA 1LNZA 3AH8A 2ASEA 2GHIA 1GUAA 4HB3A 3IHWA 2VA8A 2HUPA 1M7HA 1R8SA 2BEJA 2BMFA 2GRJA 4CEHA 1SVKA 2JIZA 3ZD6A 2GK6A 2F6RA 2WKQA 3HYRA 3Q8XB 4JLDA 2NIPA 2A78A 1OHHA 3QF4B 1M7BA 2CVHA 5KDOA 1VCOA 3TUJC 3HU3A 1T6NA 3IO5A 1HA3A 2WIBA 4A0RA 1W5SA 3WBKA 1P9NA 4B35A 4B75A 2GWHA 1G6OA 3F3YA 1RIFA 2ZE5A 5CK5A 4NTZA 1P60A 2HDNB 1CJVC 1M7GA 4ZV4A 1XTIA 1BH2A 2IBMA 4OHYA 4PC7A 1E2MA 4G01B 2ZYVX 2O8CA 2V9PA 2IYTA 2HYDA 2OCPA 3SU8A 1GITA 2VIIA 1PJRA 1GRNA 3K0FB 4LJ6A 4GOKA 4EQ6B 3ZS8A 1WMSA 3U3RA 5FPHA 4NCJA 1PUJA 2BCJQ 3OF5A 2NQ2C 2GXUA 3IIJA 3GLHA 2A5DA 3JVVA 1DG1G 5E3HA 5L3SA 4IRUB 4NCHA 4AD8A 4OJKA 4LYFA 1ZW6A 4GPTA 2IS6A 1WRBA 2JLRA 3UATA 3P27A 1JNYA 3KL4A 4TLDA 5KNCA 1SGWA 3BFXA 4PANA 3NXSA 4Q02A 4QGFA 4DJTA 1KMHB 1GL9B 3T5DA 1G16A 1VECA 1G17A 1VYVA 2OM2A 4JYCA 3WYAA 3FMIA 1ZC3A 3EA0A 3C15C 4RD4A 4JL6A 1JAHA 3CONA 2IUSA 1UKVY 4M1KA 2JDID 5JWHA 4S35A 4IVRA 2FV8A 2QPAA 1FL9A 1WBDA 3B6EA 4JMPA 4MYTA 4M1TA 1NKSA 1XTQA 5TB5A 4YMVA 1QHIA 5AUPB 2DPXA 1RZ3A 3N70A 2J0VA 1T5LA 4Z1MA 3OEEA 1E9EA 2RHMA 1HH4A 2B92A 4L15A 5JI3E 3SQXA 1Z06A 3NBXX 2CLDX 4NYJQ 4V03A 3K0EA 1OFHA 5L3QA 2V55B 2UVQA 3R9WA 3DPUA 2P67A 2L0XA 3GFTA 4GOXA 4PQFA 1IOZA 5EXTA 3GJ5A 4AYXA 4DDTA 2VQSA 4EFLA 3OHMA 1WXQA 1CU1A 2PCJA 4DSUA 3SFVA 4B76A 3ZD7A 1W44A 3B78A 1X3SA 3BH7A 4HAUA 3OFND 5EXSA 1E32A 4BLPA 3LVRE 3EZ7A 4OHZA 4BFWA 1W1WA 4IDNA 4P33A 2PZEA 1EGAA 2QMEA 3B8HA 1R2QA 1QHHA 5EQTA 1TUEA 1YE8A 2Q3MA 4KFSA 3EIHA 1NLZA 3RYTC 1Q3TA 3U3MA 4KYUA 4C0HA 4U5XA 1R6BX 1XFAA 2REXB 2YOGA 4PTLA 4LUCA 3GFPA 4Q4JA 4TL8A 5AUNB 1Z0JA 1W4RA 4WOPA 1QVRA 4JVMA 1H8HA 1MABB 4IOLA 4NYMR 4TZ0A 4I81A 2RGNC 3ICEA 4A0FA 1G20E 2KWIA 3OEED 1YVDA 4I1VA 4QFMA 4DSTA 4B33A 3P4YA 3TNFA 1BMFD 2NOAA 1GG2A 1JB1A 4EPYA 1EFUA 1KZ7B 2BMEA 5DN6A 4C7OA 1ZMXA 2X19A 1N0VC 3K53A 1E98A 2AXNA 4JL5A 3VR6A 2ZRMA 4MUAA 1XXHB 5AJZA 1JECA 4HUQA 5FI1B 1QHXA 3SYNA 5KOYA 4G5QA 1MO4A 3X1YA 2G83A 1E3MA 2ZJZA 3KQHA 2GZHA 4JS0A 5HE9A 2ZUDA 4TT3A 2ZI7A 1XTSA 5DO9A 1VG9B 3CRMA 1F2UB 2QSZA 3C5HA 2CHGA 3QXXA 4E22A 3GLIE 1GKUB 2C04A 5DHAA 2QM8A 1R8QA 1G4UR 3LBHA 2DWOA 2FA9A 2OV2A 2ZRIA 1L7VC 2HF9A 1PUIA 2W2TA 3RRYA 3R8FA 1X1SA 2QAGA 1VG8A 3RLFA 2B7CA 3ZDQA 4P4SB 5HR5A 1SQ5A 1XP8A 2GXSA 3K9GA 1S3GA 2AL7A 2F1JA 2GAOA 2TMKA 3CKLA 5EP2A 3ZVMA 1G8GA 4DB4A 5ANRB 3RSOA 1GP2A 2CJWA 3HPRA 3VKHA 1DARA 1W46A 2YNMA 1M2OB 3PENA 4L5BA 1AGRA 1KO5A 3NG1A 3LDAA 4KSCA 1F6BA 1WF3A 4IFEA 5DI3A 3AUXA 4JVSB 2WBLC 1COWD 4BFZA 2BJWA 1UPTA 3UXMA 2VHQA 5B57C 1E2GA 5B64A 1YZNA 4Q1BA 1RJ9B 1G5TA 2Z83A 4O3MA 5K8UA 2CVFA 4B3BA 2AKYA 3VX3A 1DE0A 4DCSA 1W5TA 3J81k 1N5JA 3ZYCA 4QKQA 1KY3A 5LPNA 2AK2A 4JBYA 2ZRNA 3I8XA 3KB1A 3LVQE 3NBZC 4PZZA 2J7PA 3KJIA 4LYJA 2QTHA 1GL6A 3C7KA 3Q7PA 4IEEA 2RAPA 1ZU5A 3OAAA 3HR8A 1SKQA 4AYWA 4CGZA 4V0MA 1XTJA 4AG5A 1Q1QA 3U6BA 1N6LA 2WAYA 1ANKA 3L8YA 4PAOA 1E9DA 4QNMA 4HB0A 4R2HA 2QTVB 1D2EA 3IUYA 1E0AA 4EIWA 4DLWA 1E2QA 1YQTA 3QKRB 1G5RA 3KDSE 2OBNA 3RSLA 2FSHA 2WWGA 2R6DA 4GMXA 4KLZA 4QHTA 1D5CA 4A36A 3LW8A 4V0LA 3E70C 4A0GA 2CL6X 2ZS7A 1E0KA 3CUEF 3FFAA 1JJ7A 5KNDA 3IPXA 4LBWA 4P4UA 5JHHB 1E9SA 1ZYUA 5HTKA 2QORA 4AYTA 4TZ6A 2OCYC 3T1TA 1QVAA 3BD9A 3V4FA 3CZPA 2JLWA 4KU4A 2GETA 4BZQA 2CMKA 1FMLA 3OZXA 1KAGA 2XSZD 2MMGA 4NP6A 4RKFA 2KBFA 4MGZR 1TQ4A 3ASYA 2FEMA 4HZIA 2H7VA 5FPSA 3TW8B 4EPWA 3I92A 4CIDA 5JEDA 1II9A 2WKPA 4HYYA 3I5YA 2YINC 4URWR 5JS8A 4DT1A 3PUWA 1E6CA 2F1RA 5E7IA 4EPXA 4B3FX 5JJLA 4M9SA 1NRJB 4UNQA 2O8EA 4A92A 4EPVA 5BN4A 2YVUA 3NEJA 2JLSA 3G0HA 2R9VA 3K09C 4R9UC 2WWXA 3NWJA 1EESA 1U9IC 4NU0A 5EE9A 1A4RA 1A5TA 1XD8A 3QPUA 4JVLA 4QBHA 3RABA 4TTPA 5F9FA 3C16C 2PMDA 3H86A 4FIDA 4URUR 3C14C 3BFKA 3OE7D 2FN4A 4TQAA 1F48A 2HJGA 1N25A 2F3TA 2HV8A 1MO5A 3F0TA 1ZJ6A 2PBRA 2ZEJA 1G8HA 2O8DB 4F91B 4MYHA 2G88A 2QZ4A 3LO5A 3EPLA 5FR1A 2BOVA 3A1VA 3DOFA 4CEJB 3VNUA 5EP3A 3PEUA 4B3CA 4QBFA 4DCVA 4BFSA 2PT7A 1FX0A 1AS0A 5CB8A 3ZLJA 3K8YA 4D0LB 3L0SA 3TIFA 1JR3E 3AKYA 5E95A 1QHSA 5LB2A 2DWPA 3K70B 2RGNA 1G8FA 5D3QA 3EZ2A 5FUXA 2NMVA 4M1MA 2W83A 3BH0A 3FE2A 3FPAA 2P2LA 2FU5C 1EX6A 1XX6A 2AK3A 3BIFA 1L2TA 4OK6A 4NYIQ 4D25A 2BMJA 4KFRA 3KFXA 1AIPA 2O8BA 2XX3A 3TSWA 1E9FA 3CNOA 3K0AA 2EW1A 1ZVQA 1CP2A 3NH6A 2D62A 2GVZC 2C98A 2YWGA 3CH5A 4N3NA 4AWXA 1R5NA 4LHVA 1P2UA 2ZXUA 2JATA 2ONKA 4C2UA 1FTSA 2BC9A 4HLQB 4II7A 1GZSA 1ZRHA 1N5KA 4DCTA 1KK2A 2WV9A 4Q7JB 4GL2A 1M34E 1CIPA 1Z63A 4TL7A 1JR3D 5B58C 4KCGA 3ZZUA 2XB2A 2GJKA 3LW7A 4TMZA 1OLOA 1KDRA 4B6FA 2ZR9A 5EXPA 4M8NE 3UMFA 2BWJA 2I1QA 4IVQA 1G7CA 2IA5A 3SBEA 1GSIA 3MWJA 1OFIA 3FOZA 4W5WA 2DHRA 4C2TA 2QP3A 1XZQA 1NJFA 3A1SA 4EPTA 3DDCA 1P72A 3AVUA 1JAIA 3THYB 5FL7A 5DNYB 1ZM9A 2IS2A 1MO6A 5AJVB 4EUNA 1W2HA 1Y63A 1Z22A 1F2TA 4PQRA 2IYVA 4XIGS 4Q19A 2ZRDA 1FX0B 4IKEA 1XNJA 1UF9A 4E5UA 2DFTA 2YC2C 4TLBA 5H68A 1JXOA 1KI2A 3B82A 3N2IA 1ZD9A 4DDVA 1II8A 2FH5B 4Q03A 4TYNA 1XB2A 2EWWA 2QPTA 3QKUA 3GLFA 2QU8A 4BE7B 1HT1E 5BYJA 1FQKA 1H8HD 1H8ED 4BLOA 2IX3A 4JL8A 1COWA 3WHLA 4FCVA 4P4TA 5C1BA 2W6JA 1ZM3A 3AGPA 2NO6A 4YXWD 3T15A 1EFTA 1N0UA 2BDTA 3KQNA 1OFUX 2GBLA 5K8LA 3VR2A 4Q9LA 3RS2A 3GJ3A 3TGPA 2VP0A 2PMKA 2Z5FA 3RS0A 3PEVA 4RVCA 1CRPA 1J70A 3B9PA 4M1WA 1KTVA 3AVYA 1ZNXA 1W0JA 5KSZA 3GLHB 1L8QA 2IW3A 4FI3C 3TUZC 1I4LD 3KJEA 2ZSEA 4MDEA 4RZ2A 2GBLC 1N6HA 1U9IA 2NO7A 4OI1A 3PUZA 1E94E 4ACBA 2IS1A 2BKEA 1CULC 4QGGA 2CXXA 2VHUA 1OIXA 4Z1MD 1U0HC 2ZUBA 3O8BA 4MRVA 2DB3A 3MJRA 3OE7A 2NO1A 1LF0A 3BBPA 5DI3B 4W7SA 5H70A 4C0QC 1IN6A 1T91A 1XJQA 4ZPXA 2IT1A 2N42A 2V3CC 2CCGA 2JLXA 1JR6A 5CIWA 3FDIA 4JLMA 2RCNA 1AK2A 2WJJA 1T3SA 3VNVA 3MCAA 1XXHE 5K8TA 4GP6A 1NVXQ 1CTQA 4Q21A 1YU9A 4LJ4A 4DRZA 1S9DA 5HPYB 3TMKA 3AEZA 1KAOA 4C0KA 1DG3A 3ZJYA 2GDJA 3L0PA 2DY1A 2ZRFA 3H4MA 3WHKA 3I72A 1GILA 2B8WA 3QKRA 3EIQA 3TQFA 4CF7A 2JAQA 2P65A 4EJSC 2H5EA 2YHSA 3U4QB 1UKZA 1P6XA 2OHFA 3JZAA 1IN8A 3FHCB 2JDIA 1JI0A 2WKRA 3EXAA 2OXCA 4Q48A 3BRWD 2XNDD 1CR4A 4LHZA 4XWOA 2J5XA 4O25A 3MAAC 4HZUB 4Q1AA 3UANA 4TSFD 3VFDA 4DWJA 1BYUA 4WXPA 4A0HA 2JJ8A 1KIMA 3RVBA 2JCSA 2OEPA 3K1JA 5JHGB 2VO1A 2ZSBA 3VKGA 1XEWY 3EAQA 4BFTA 1KI3A 4NDZA 1Z5ZA 3MFYA 1BIFA 2ZS9A 2GZAA 5CM9C 4A1FA 1HEIA 1Q0UA 3ZQJA 1US8A 1E2HA 4L4UA 1Z6GA 4G5GA 4M22A 4RY2A 5KU1A 3I4LA 1JPJA 4M1YA 3L8ZA 3RS7A 1QRAA 5FTLA 3WMGA 1TF7A 1DELA 2JJ1D 1KOFA 2Z0MA 3DM9B 3EIEA 5HE8A 1Q21A 1ZC4A 2A9KA 3AVPA 2GEUA 4US2R 2NGRA 2C78A 3CRRA 2ZSDA 2A3RA 3ND8A 2ZAMA 4MYUA 5KUTA 4H1VA 5C4MA 4IDPA 1LF5A 2J0SA 1W4AA 1AA9A 5AK0A 4URXR 3B1XA 1RRFA 2BBOA 2F9LA 4KAXA 2IWHA 4URVR 4A6XA 4LK2A 5JSZA 2BEKA 2ZR7A 2GJAA 3FMFA 1TL7C 4KV9A 4M2LA 4NBSA 5EP1A 5G3ZA 2ZRBA 3UPUA 2XZLA 2ZU6A 5L3QB 3M4YA 4A2WA 4ZCLA 1YR8A 2IUUA 2IYUA 4QG7A 3DEFA 1J7KA 5AUOB 3HWSA 1AS3A 2G3YA 3BB3A 5G3YA 1P61B 3MLEA 5EE1A 2EYUA 5LD2C 4B2LA 5BN3A 2ZITA 3W8NA 5KHOC 3SR0A 4OQNA 1E1RA 3SBDA 2QM7A 5E7JA 5BYKA 1BS1A 1TQ6A 1DVRA 1W0JD 3U61B 1U8AA 2GK7A 3TR5A 2FDCA 1HUQA 3RC3A 2J87A 3B7GA 3WRYC 5AWFC 4M4SA 4PHTA 2DCUA 3M0EA 1OB5A 3LAWA 1XJCA 3QXJA 1D2NA 2GXAA 2J59A 4NCIA 4XVUA 3QBVA 5L3SB 2XXAA 1Q1ZA 2BV3A 3BGWA 2QG6A 5A5GA 1TQ2A 1P62B 1NJGA 5FPYA 2BKUA 2E1RA 4UKDA 5TARA 2ERXA 3QXSA 3W3AA 3Q5EA 4G5SA 1K5DA 1SHKA 2X2EA 4JLKA 4QXAA 1BO6A 4EQ6A 3CH4B 2F55A 3LBNA 1KMQA 4LBVA 1ODFA 5F9HA 1CXZA 2F9MA 4WA7A 3GLGA 4MRRA 1P9WA 1GKYA 1UM8A 1CJUC 1RRGA 2OSBA 3SN6A 4DZZA 3IIMA 3SE0A 4FXPA 4R7ZA 5D3MA 3V4RA 3MUFA 3NEYA 4A8JB 3OIYA 3SJAA 1XMJA 2VL7A 1TUIA 2RGGA 1E9CA 4HUTA 1VHLA 1SXJB 4I1OA 1CBUA 3KZ1E 4MH0R 2DR3A 4DIEA 1W4CA 4DEYA 2OAQ1 1YR9A 4BZXA 4MQBA 4YXWA 1T9HA 4G5OA 3HU1A 4Q18A 1FW6A 3REGA 1KI7A 2H18A 1F2UA 3L82B 2VF7A 1JEEA 1ZIOA 1DAMA 3AP2A 2GKSA 4R98A 3VR3A 4D82A 4QHYA 3IGFA 4X8LA 2WICA 4GNKA 4HUQB 1R0WA 2W00A 2ZYTX 4K81B 2PZFA 5DIFA 2JASA 5FL3A 4GFDA 1LTQA 1KZGB 1GNQA 1S1CA 4KODA 1G41A 2X2FA 3H0KA 1RC8A 4ZO4A 4FWIB 4BPBA 1Z29A 2N1BA 2W0MA 3AP3A 4Q9IA 1KMHA 3WMFA 3C41J 1KKLA 1G7RA 4LSGA 4NE2A 5EE5B 2D3WA 1Q57A 1NIPA 4TSFA 3NC0C 1SHZA 3P20A 2C9YA 3KUCA 2ZAOA 3AVWA 3GLFB 1UKYA 1DEKA 4C0SA 4C9BA 1YKSA 4Q4JB 3GJ8A 3BORA 1NSTA 4F4JA 1TU3A 2ZI4A 1KI9A 4TLCA 4AC9A 5AJYA 5FOXA 1OXSC 1BOFA 2QMUA 1R5OA 4LV6A 2REOA 2A5FA 1O3YA 3QI2A 2ZE8A 1YR7A 1ZNWA 3V00A 1GRQA 1IXSB 3AQ4A 2JLYA 2ZR0A 3QVUA 4PPQA 1S4QA 3A1TA 1CJKC 1ZUNB 3OIUA 2ERYA 4HAVA 3V9PA 4E09A 2JLVA 3IIKA 3OIWA 1G6HA 3A8TA 4LWZA 5KNBA 2QNRA 4A8JA 1KY2A 2PT5A 5D3MB 1CR2A 3W34A 2IHYA 2IUTA 3QF4A 2GA8A 1P2VA 1W4BA 1FUUA 2R8RA 4RKEA 1NG9A 4PHGA 2ZJAA 4B48A 3A36A 4LYHA 1AKEA 1W7AA 1N6KA 2F43B 1M74A 4Q9KA 3BB4A 4XTRA 5BQ5A 3SEAA 4PXAA 2GCOA 1K6MA 1KSHA 4W9MC 5JI2E 1AQYA 1OYWA 5FBWB 4W5JA 4OQXA 4OBEA 2PL3A 4C0BA 4P32A 5HKKA 2ORVA 4IJMA 1DO2A 2V6JA 2CE2X 5F2EA 3IO3A 2ZVQX 3A1UA 2ZRCA 3FHOA 3IDQA 3EW9A 2KE5A 4M0LA 3VKWA 5C4GB 1SXJE 1WP9A 4G1UC 3B1ZA 3CWQA 1NN5A 1C9KA 1TMKA 1LS6A 1HY3A 3TVTA 2EFHB 2A5GA 2C03A 3PR1A 3ZZTA 4EFMA 2RGAA 2FFQA 3F5FA 1EG7A 3FTQA 1TTTA 2O8CB 4ILEA 2FE4A 2CHVA 5EE0A 4Q4AB 3IQXA 3O8RA 1AM4D 2WSSD 3B60A 1UBEA 4OK3A 4LBZA 3DO6A 1KKMA 4UNPA 4LPKA 4LC0A 1S96A 4M9XA 3R7WB 1G5PA 3RC8A 4FN5A 4IXMA 2QA5A 4KI0A 5EXXA 3AF0A 1TF5A 3VR5A 4YONB 4B2PA 2YOHA 1J2JA 1LV7A 4HEJA 3D8BA 4XVRA 1BMFA 3UK6A 3UG6A 4HDCA 4HATA 5EJEA 1IN4A 3CF2A 2RGXA 2OESA 2QTFA 3KXIA 2LCFA 5DISB 3A4MA 1DAIA 3WRXC 4CEHB 4JJKA 1OH7A 1OXTA 1YR6A 3LX5A 1T0HB 2IK8A 3WNDA 1C4OA 5CYPA 1RYFA 4URZR 4TTRA 2WJGA 4MGIR 1NY5A 4BLQA 5KSOA 421PA 3O8CA 4XTCS 1E9BA 4P3YA 2BJVA 2AD1A 2R62A 1GAJA 5JEEA 2ZI3A 1YRAA 1XEWX 1NMZA 3CLVA 2I1VB 5F98A 2R65A 1FUKA 2ZSFA 3WY9A 4AKEA 2W2XA 3GJ4A 4PAQA 1U90A 4BRUA 4QJ3A 4MYCA 4U7DA 1FPMA 5FUYA 4DDUA 4DLRA 4HZUA 4B32A 1KJZA 3SDZA 3TVDA 1TQDA 3H1TA 2PX3A 2KSQA 2GAAA 3A4NA 3W90A 1ZU4A 4IDHA 2Q6TA 4ON9A 5JS7A 3A58B 3WP1B 5JWOA 4XVQA 1ZINA 5J4VA 2ZRGA 3IEVA 1UAAA 2QMOA 2ZROA 2RGCA 3AB3A 3AF1A 3AVXA 5CDFE 2JLUA 3VU9B 4B3DA 1G1MA 2J7PD 3E1SA 1W36D 2KJQA 2PX0A 5DGXA 2CHQA 1OYYA 5CDFA 5KTYA 4X8HA 3T61A 4XH9B 4QNRA 1HTWA 1XRJA 5IRCD 4MKFA 2WWWA 2Z4RA 2VYFA 4BEJA 2VP5A 1TU4A 5KDLA 1M1YE 3W6PA 1G8PA 2R2AA 4N0EA 5H1YA 1UBFA 1Z2AA 2YYZA 1D9XA 2J45A 4P31A 2H1LA 1TEXA 3L2OB 5TVKA 5K8IA 3A6PC 2X8AA 4KJZA 4BRWA 1SVLA 3FKSD 1FTNA 4DSNA 3VAAA 3RWMB 3C8UA 2GEDA 2EQBA 4FD2A 5J47A 3B13B 5FBLB 1SVOA 1NY6A 4YMUA 4TQUS 3UMSA 2ZJYA 1QHGA 2FFHA 3ADBA 4HDOB 3H84A 1E2KA 3AKCA 3GLHE 5FTKA 2YKGA 4AY2A 1PLLA 4HB2A 2WWIA 1HE1C 3EG5A 1XCPA 4XSHA 1W36B 5F3WB 1B23P 3C4JA 3BOSA 4Q1DA 1G291 5FBVB 2HT1A 3QUSA 4UNSA 4Z54A 4J0QA 4BLRA 4OQFA 4D81A 4Y0VA 5AJXA 2Z6VA 2ZRPA 3U7FB 1XD2B 1XMIA 3Q5DA 4BZPA 2V4ZA 4UXJA 1R7RA 3WYFA 2PLFA 3K0SA 1MR3F 2FSFA 2GILA 2Q21A 3O47A 2GF9A 5EZ5A 4OQLA 1Q12A 4BFXA 2MSCB 3NKVA 1UKEA 2O0KA 3S1AB 3FMPB 2QROA 5FFMA 1DAKA 3RDPA 3LV8A 1KI8A 3ZS9A 4KYIB 1KJWA 4YQFA 4BLSA 1NBME 4NONA 4QHSA 2HF8A 2VRWA 2Z4SA 3ONWA 1Q22A 1F3OA 1U8ZA 4TLEA 1KK0A 2O5VA 1P3JA 2VEDA 5CJPA 4DEXA 2OUKA 2AHOA 4IDOA 4LRWA 4RCZA 1XPRA 4DKXA 3ZZ0A 1Q1EA 2IYYA 2MMCA 4ESVA 1YHNA 1TAGA 2AR7A 1F2TB 4DUGA 1YZQA 5GJBA 4A8JC 2A7QA 2ZRLA 2OE2A 1SKYB 1H8EA 3TAHA 4HB4A 4ZIRA 2EWVA 3QNUA 1Z0KA 1VMAA 3PG5A 1UDWA 4UJ3A 1L4UA 5EP4A 3LLMA 1NN1A 2C2HA 1DO0A 2GJ9A 5J40A 4G0NA 1P4SA 2QQEA 1JR3A 4ESHA 3UWOA 2Z43A 3EA5A 3U44B 4OHXA 3FKQA 4B3GA 1Z0IA 1K5GA 1HV8A 4D0NA 4DLXA 5KPDA 3PIRA 2ZYWX 2Q3FA 5JWRA 1V5WA 1BYIA 1P5ZB 1X1RA 3CRW1 2JJ2D 1DAEA 3CIOA 2WVJA 1JQLB 2UZ3A 3IPYA 2AX4A 2ZREA 3N2EA 4HAYA 1ZM4A 1HQYE 3CF0A 1G9XA 1OIWA 3T34A 3EARA 1N5LA 4CVNA 3ADDA 4ARZA 3K9HA 1A2BA 2VHCA 3GEHA 4LHWA 1HURA 4CW7A 3EPHA 4CEIA 3W6NA 3LQQA 1OH6A 1PV4A 1P9RA 1GVNB 3U7GA 4B74A 4G5RA 1IAQA 1A1VA 3KB2A 2O0HA 4Q00A 2GCPA 5A4JA 4H1UA 4NMMA 4US0R 4OKSA 2FGKA 2A30A 1G21E 4QBGB 1WB9A 2J0UB 4IOKA 3X2SA 4WZBE 4NYMQ 4FMBB 3EZFA 3QXCA 2ZUCA 5LBIA 1VCMA 4EAQA 5SZJA 1W48A 1O87A 2WJHA 2ZSAA 3LA6A 3LD9A 4JIMA 4TQ9A 3TK1A 4RFSB 821PA 621PA 2QPOA 1QBKC 3LRPA 1YZLA 2ZJ8A 4MRPA 2DYKA 2QBYA 4PO8A 4RD0A 2O8DA 1S0UA 4JT4A 4JLOA 4FINA 4QM7A 3CWZA 5HCIA 1NNEA 3FHTA 1ZAKA 4D26A 3I61A 3BB1A 2BBTA 2YWHA 2J41A 4NKRA 3K9NA 4CYMA 1SVWA 5LD2B 1N0WA 1XMVA 5IHPA 5DYGA 1AJEA 2B7BA 3W5JA 2XTMA 1FOEB 2OBLA 3K0FA 2GNOA 4ERNA 2PLRA 3P1JA 2VSFA 121PA 4QJ4A 2EFDB 4B47A 1XEXA 3CPJB 3IBYA 3P26A 3EC2A 4D80A 2I3BA 4C4PA 3C5CA 3TUIC 2CK3A 1DAGA 3NBYC 2WIAA 3IEUA 1QF9A 1N6RA 3BFVA 2OCAA 4PO9A 3QQ5A 1MH1A 1SVSA 2RB4A 4BFUA 5KO2A 1ZNYA 2QN6A 2QQ0A 1AZTA 3HU2A 3ZQ6A 1ZIPA 2QMHA 1IQPA 3LQRA 4QM6A 4RJLA 2VHTA 3RWOA 1II0A 1TEVA 1N6OA 3TRFA 2P6NA 3CZQA 5JMTA 3Q85A 1UJ2A 5J4KA 1ZNZA 3KXLA 3K0CA 1RRPA 3MSXA 2IC5A 4R71A 4DLUA 2P6UA 3LBIA 3KQKA 3W8RA 1LW7A 4O0MA 1XTRA 1TX4B 2ODEA 1Q20A 2X1VA 3A37A 3PEWA 3GMTA 4CEIB 4RD1A 1C1YA 1S2MA 4LHYA 4Q1EA 3ETLA 4ZDWA 4GDFA 1UBGA 3LLUA 3QEOA 1X8JA 4OHVA 2C9CA 3DMDA 2A5JA 2ZI5A 1CS4C 2I4IA 1E2FA 3P4XA 1Q1BA 2XSZA 2YWEA 4PX9A 1P2TA 2D06A 4GT1A 3DKPA 1FQJA 5E4FA 1ZP6A 2BMDA 2FZ4A 1XU4A 3L43A 1SXJD 3I5XA 2WPDD 1CR1A 2ONJA 4XD7A 5HZKA 2RGDA 4L9WA 2QBYB 3B2EA 2XGJA 4GBMA 2GVDC 3UMRA 1FP7A 2WSSA 2WMOB 1U8YA 3AP1A 2DWQA 1OV4A 4M1OA 2R6GA 4RZUA 4C0JA 1VCNA 1KGDA 2JGNA 1E9AA 2G1KA 3DMNA 4F4CA 1OXVA 4LOAA 3RANA 3KX2A 5BXQC 4JBWA 4K8OA 3TKLA 1X8LA 2ZJOA 3QG5A 4I1SA 2JEOA 4IVPA 4DLTA 3CRQA 2F1HA 1NVVQ 2MSEB 5FBQB 3IHLA 4ZDKA 5FOTA 5C18A 3B1YA 4FWTA 1IJEA 4D4LA 3T12A 2QAJA 3QKSA 2UKDA 4NZYA 2ODWA 1T8UA 2IYRA 2ANBA 4BASA 4AK9A 1VIYA 1OJLA 4L8GA 3HP1A 4FW9A 3K70C 3EZ9A 3S1AA 1I4TD 5FH9A 4TYYA 1NBMA 4O2RA 3GLFE 3R7WA 1N6NA 4X8OA 2XJ9A 1SVIA 4G3XA 4KITB 1XDBA 1NIJA 3R8CA 2OILA 3QEJA 3U3KA 1ZM2A 5DLQC 4Q4AA 4JT2A 1EFCA 3U7HB 3QPVA 3VHLB 4V0ME 4KBGA 4B3XA 5B30A 2V8OA 2IYWA 2WJYA 3T35A 2QP4A 3OAAD 1NI3A 3SJCA 3BK7A 2C8VA 2IYQA 4RZ3A 1XCGB 4F92B 2V7QD 3CR8A 2FJUA 1E79A 2E87A 2ZRAA 3QXHA 1G3RA 1KDTA 1TF2A 3I8SA 3SNHA 2DFLA 4EJSB 5CITA 4MGYR 3GLIB 2JJ1A 2QT1A 2W58A 1FNNA 2HCBA 5G53C 4AG6A 1FNMA 1VYTA 4FMDF 4PHHA 1MT0A 1OFTA 1QDEA 2FZLA 5FPKA 1MV5A 4C7OB 1JALA 2IS4A 1EWRA 1IONA 1NN0A 4LY6A 2P5TB 2RKOA 2F43A 2OAP1 4MKIA 2QL6A 1IN5A 4TYPA 5CIQA 1E99A 2P3SA 4M21A 4D0GA 721PA 3TW4A 2ZANA 5JLJA 4MRNA 3SI7A 4Q01A 1CJTC 5CK4A 3IILA 3THOA 1DTSA 3ICQB 4Z8XA 3QKSB 4RD6A 4GP7A 3VR1A 1QHHB 1AQUA 4YC7A 2J0UA 2G6BA 4CT4B 2FOLA 3WNBA 4LPSA 2CCKA 4D4JA 4HDQB 2ZETA 4KSBA 2YV5A 3PCRB 4WIAA 2BBWA 4PPFA 4W5HA 1KYIA 1IXZA 3AF2A 3SJZA 2J0QA 3H2YA 3SHWA 5LB4A 1IBRA 5EZ6B 1XBTA 2PJZA 2V6IA 3EWSA 3AF3A 1FZQA 3AV0B 4HLDA 4LI0A 1GIAA 4Q4LA 4DCUA 1OH5A 1CF4A 3IBGA 4LV5B 3NIBA 2ZE6A 1OPXA 1R0XA 3JVUA 3WYGA 1IY2A 2BM0A 2LKDA 3VX4A 5H8WA 2NTYC 1RPZA 3MWYW 3BS4A 3KKQA 4ASUD 4JKYA 1N6IA 1NLYA 2ZS8A 3HPQA 4JLAA 2OFXA 4XD7D 5FUWA 2JLZA 2R6FA 1GNPA 2XZOA 2SHKA 4A15A 2V1UA 1GTVA 1PZNA 3AKDA 3RRZA 4OI0A 3FB4A 1KNQA 1N2CE 3I32A 4JSYA 5DN6D 1AZSC 1IY1A 4IEIA 2GXQA 4WAUA 4K46A 1G3MA 2BIFA 4MUBA 4Q9JA 1KI6A 2IYXA 2QAGC 1VDZA 2LKCA 3QSYA 2RGEA 4MGKR 2WOOA 3E5HA 3THXA 4JLJA 1EX7A 1EXMA 4E03A 1Z83A 3LXRA 3R9IA 5JECA 5FBRB 3OEHD 1HQCA 2ZU0C 4A2PA 1SZPA 2QGZA 1N5IA 1S9HA 2YZ2A 3BE4A 3CPHA 1SVMA 2BM1A 4YDSA 1LB1B 1U2RA 2CCJA 3GEIA 3E2IA 1M6NA 2WJIA 3X1DA 5HKKD 3GLGE 1OH8A 3D7MA 4ZCMA 4YMSA 5FTNA 3ZVRA 3NBFA 1PVOA 1Z0AA 3K0CC 2OLKA 4RCYA 5GVRA 2XTZA 3KFVA 2WWHA 1KSFX 1MKYA 5JBQA 2KBEA 3KXKA 4JYBA 3Q72A 4TL9A 1G4AE 1CEEA 2R6CA 2CE7A 2IEZA 2WTUA 2QSYA 2VPPA 4YDHB 4ARZB 2FSIA 3ZGXA 3GLGB 4JKIA 1RRCA 1J8MF 4PC1A 3X1WA 2CNWA 3ASZA 2DFKB 3SQWA 4B44A 1SKYE 2VLIA 1U0JA 4LX0A 4Z51A 3LXXA 2ODNA 1EWQA 2J9RA 1A7JA 1M8PA 2GJSA 2QGNA 4PC6A 2YJTD 2VBCA 4JLBA 3UG7A 3SYKA 4QGAA 2Q9AA 4QGHA 3WXMA 5BN5A 1NVUQ 3Q9LA 4NCKA 4TMTA 1E2JA 1TADA 4TN1A 4AURA 4EFNA 2FGJA 2OFWA 4PZYA 4JLVA 2XITA 3QG1A 5GADl 1HYQA 2H16A 3THWA 2UZIR 1NN3A 2EFCB 3BAFA 3TH5A 1AN0A 2XTNA 3OIVA 2DFNA 4KBFA 1OW3B 3MWKA 4ITRC 5CLLA 4C30A 3WNCA 4NH0A 3D6TB 2AFIE 3F8TA 4LYAA 4QRHA 4FMCF 3TAUA 1NG1A 2IWRA 1X6VA 5CLQA 3A1WA 2ATVA 3U2QA 1MOZA 1SXJA 4WZ6A 2Q9BA 1GKIA 2ZJ5A 3AVQA 4YMTA 1W47A 1U81A 1EFRD 1TPZA 4PPNA 2XOKA 2AXPA 2VH5R 2IXEA 4OJQA 1NMYA 2OT3B 1WA5A 2QT0A 3IKJA 1XEXB 3P32A 4C0LA 1T3HA 3MJHA 3THWB 5E7MA 4MRSA 2IL1A 1VPLA 4B43A 2AN9A 2H57A 1E69A 1A82A 3QOFA 4DIDA 4HSEA 4JBXA 1NBMD 2OG2A 4CRWB 2O8FA 1JEDA 5JJKA 4Q1CA 3DOEA 4LJYA 2EFGA 1E4VA 3RHFA 4B71A 3LNCA 5L3VA 1US8B 2KI5A 5EUMA 3REFA 1VTKA 1N6PA 5TV2A 2V54A 3OESA 4MKHA 3GJ6A 5J5CA 5KSPA 1NKTA 3WBJA 1YJ5A 1CR0A 1E4YA 1Z08A 2ZE7A 4GI7A 1U99A 4MKGA 1WBBA 1P75A 3AKEA 4Q4HA 2IXFA 1Z2CA
chains in the Genus database with same CATH superfamily
5F76A 2PU5A 2J7KA 4QDKA 1V43A 3CT6A 3O4HA 1FYVA 1SWWA 1YZUA 4PSKA 4YA6A 2OBMA 3HDTA 5IJ9B 1KRWA 1XEFA 3GDOA 2IYZA 3BFPA 1MQAA 1CY4A 5EE3A 2HT6A 2FQ1A 1YT5A 4GBJA 1EM6A 4P4LA 5FNVA 1TC2A 1W6RA 2Y0PA 3NC1C 2XWQA 3QJYA 2QE7A 3V7YA 3JYHA 3LBFA 1LVGA 1GM5A 1L7PA 2R1UA 2IE0A 3NWPA 3VR4D 5LKRA 1Z3IX 4HLCA 4EW2A 1P1IA 1ISHA 2BFEB 2FP4B 3FPHA 1AXGA 5DEOA 2XOKD 1HEYA 4OI2A 1QH1B 1ZWKA 4L8YA 1MG5A 1P73A 3S4YA 2WWYA 1TEZA 4N7BA 5BRJA 5HJ2A 2OR3A 1K68A 2BTEA 3E48A 3DLIA 1O54A 1TCBA 4C1BA 2W4QA 4GX0A 1XU7A 2EX1A 4KXUA 5DGCA 3WMWA 5IPFA 1OGIA 3PFIA 1QQ6A 3HWX1 3JTEA 1A69A 3I0ZA 1W5BA 3LUGA 2VTBA 5P8WA 1E7QA 2VSQA 2XAUA 4B5LA 3EH1A 1K8ZB 3CZ4A 1XTKA 1YJAA 1DMSA 2CK3D 5TRTA 2H0QA 2CNWD 2YWDA 2NYVA 2C2GA 1W9MA 2W6IA 3BZUA 1DKOA 4HAZA 4OL0A 4PHFA 5CU7A 2ODAA 3V8EA 1A9XB 3LPLA 2NAPA 5B3KA 1GQRA 1Z6XA 1RFLA 3S29A 4ZK2A 2PUWA 5FV4A 1AA6A 5L3RA 4G1BA 4BMOB 1MIOB 1R0ZA 1E8DA 1NMXA 4KFTA 2ACEA 4QOSA 5FJIA 1M5RA 1KVRA 1UJ4A 3JWIA 1FFHA 1VLQA 3IVGA 3RFXA 5L6MB 1EFPA 2C3OA 2X1MA 5CXUA 3B3JA 1ZD1A 2B8TA 1W0KD 1NLFA 2A9FA 2GLUA 3QITA 4K1XA 4L3OA 1BDIA 1W6UA 1GTSA 1GDTA 4KKXB 3AG6A 3A6KA 3EZLA 5LA6F 3U13A 1K0FA 2QV0A 4R40A 2IITA 1EIZA 4LFCB 2H5LA 1HZZA 1KHTA 2IDJA 4BJ1A 5FLXA 4KE6A 2CL0X 4NV0A 5ITWA 5JUWA 3Q12A 3SZMA 4JITA 2PCLA 2HIGA 3PJEA 2ID8A 3I1YA 1PR5A 4QC2A 2GMWA 1G7TA 4L4SA 5T4HA 1R15A 3E61A 4ALMA 1RWNA 1RCFA 4H2DA 3AJAA 2ZB4A 3TOCA 4LHXA 1GPMA 4NF2A 4E5PA 2C2OA 3W5BA 4ND2A 5DBFA 5CLGA 1L7RA 2P2DA 5JQGF 3ZKAA 5IK2A 4EI9A 2DECA 2FZCA 5CM8B 5GJWC 1B26A 3IQEA 2HI0A 5DIZA 4EYEA 5HM8A 1KVUA 3SF0A 1HDIA 4GZ6A 5D6NA 3U3OA 3B52X 4X1OA 3GFGA 2HO5A 4JJ8A 4KPUB 2DBYA 5FULA 4N1AA 4PPGA 1KE1A 3BERA 1AGPA 4J49A 5B6IA 3PJRA 2QUZA 2GEVA 4DVGA 1DV1A 2YVQA 2H2FA 1C1HA 3NEPX 2UVPA 1XDUA 2HMSA 3LWZA 2Q9CA 1Z4IA 3K9LA 4GICA 1Z8FA 3WZLA 3WMEA 4JASB 3WJ7A 4RTJA 1JKMA 1GFIA 1S2DA 1PG0A 5EJMA 3RC7A 4WV3A 4WWHA 2PT6A 2PSFA 3GFOA 4YV0A 4QDUA 2XUDA 5HF9A 1A2KC 4MPPA 4MUXA 4HX9A 5A4IS 1PFYA 3ZDYB 1XMOB 2AT1A 2I6QA 4QNNA 1CW2B 1QYXA 3R3HA 3M4XA 2UUCB 4RFVA 1IOVA 4YRGA 4R1TA 3RYFB 1JEJA 1QP7A 2ZIWB 2Q6IA 1NBHA 1DUVG 4KNWA 2RDMA 1Q19A 2H52A 4NU6A 4OYYA 2DHDA 1LBHA 1RMYA 3OZDA 4BN5A 2EU8A 1U1GA 2AB0A 2D7CA 3ZDXB 1GL3A 2DSNA 4O4JF 4R7TA 2MWMA 1J21A 2C96A 1N2OA 1A8HA 2YOFA 3Q0EA 2AJTA 3A32A 3QPAA 4N40A 3W3ZB 1N9KA 2AWNA 2GCOB 3H8VA 4QREA 5B2ZA 3T7SA 1LJLA 1RI4A 4BECA 2CBZA 5DN9A 5BVHB 3OG9A 2EVWX 2ZYRA 4Q47A 4RVSA 4LF6B 3SJUA 3V1MA 1DKRA 1U1IA 2W2PA 2V98A 4DAOA 1TTPB 3T1VA 4EDHA 3FSGD 4K6HA 1R6AA 1SIWA 4RS3A 3T3NA 1S1MA 2WIDA 3U3XA 1JQJC 1ULBA 1MQ8B 3I4FA 2XT6A 3JX9A 1Q7GA 2WIFA 4MRMA 2JBAA 1SD2A 2HCFA 2A0WA 4HR7A 4UFPA 5IYZB 4JQCA 3UCXA 1KHHA 3LPMA 3ER6A 5DI9A 3U9TA 2WPDA 4AUEA 3VU9A 1QZTA 4E4YA 3K05A 4KXXA 1UM9B 2EYQA 2WAXA 3USCS 1E64A 1R10A 3DR3A 4Z8YA 3WK7A 2GZDA 5JDCC 2DLCX 1QQBA 3M5WA 3WC4A 4X90A 3QKIA 1AKUA 2TMYA 2FX3A 2NAFA 3LQ2A 3QEMA 3BKWA 1EJBA 1SD5A 1GXSA 2FPOA 2HB6A 5U1PA 3TGWA 2REBA 4MPDA 2Z8YM 1K8QA 1KVTA 4C4ZA 5KVVA 2H9YA 1TD1A 1W96A 2BGGA 1OKKD 3CJQA 3CW2A 4JZKA 3OM9A 4XYMA 5FUVA 2DQKA 1XQXA 8MHTA 2QV7A 5DGIA 3L8EA 3BJIC 2FPLA 3UK0A 3FM9A 4B7ZA 3LCMA 2VXBA 4XDZA 4OPMA 1RYHA 4QSMA 2BHRA 4NWIA 3B5JA 4FMCB 3L8DA 5TS2A 3ZGNA 1NP7A 3S2YA 4TLAA 1P33A 4ZVSA 2Y4NA 2HLNA 1R50A 3V42A 1GY8A 4M6WB 4O2BA 1T13A 4MVJI 4URYR 1ONSA 1SU7A 1UC5B 3DM5A 3RYHA 1B93A 3CVWA 3WJ1A 4EBBA 1VQ1A 2Q4DA 4EJ2A 2ALJA 3DMYA 1C9NA 5H3HA 1A3CA 1T8YA 4ROTA 4Y0NA 1A0OA 2FFAA 2J1LA 2ODQA 2QENA 3IP6A 3G6WA 4ND7A 4PZCA 3LY5A 4KWTA 2EBHX 4QYSA 4X1KB 4ALLA 4EF5A 4F86A 3V6MA 4LYGA 3FGPA 4DFDA 3HH8A 1FDIA 1YAJA 1Y5MA 2G07A 1HL3A 4I5GA 3ZQUA 4CHGA 1M2GA 2Q9UA 4BXOA 4P84A 5UKDA 3CPEA 1Q3HA 2NZJA 2VJOA 5CVVA 2DULA 4GZLA 3I73A 4ED9A 3H2JA 2CLEB 2WMNB 1EB9A 1Q5PA 1JA1A 5DGDA 4F2PA 1NUTA 3K0HA 4DM3A 1ADGA 4ISBA 1Q2UA 1QNLA 4J0JA 1G18A 1I14A 3H7IA 2PIAA 1SFRA 1I2MA 4R8SA 3WKCA 4F4FA 3ESRA 5FWYB 2I34A 3KHUA 1G8JA 3QKTA 3ZCTA 3FH0A 1L5YA 1QQAA 1N32B 4C0WA 3MWDB 3PLRA 1JBKA 2BI4A 2N3ZA 1ACLA 4MPJA 3OQBA 2PWAA 4G36A 2GVNA 4H27A 4KW7A 4PVCA 2JIDA 1KI1A 2VQ3A 4MUEA 1M1YB 2VDWB 4XR9A 3TSAA 3V8NA 5EJIA 1EJ0A 5JPDA 1KOJA 3OA0A 1JIJA 3Q1KA 3MINA 1RCTE 3PGVA 4PLVA 5EHIA 3O92A 1USVA 5CVTA 2EL7A 4JLUA 3ZV3A 2ONCA 2FPMA 4RWEA 2G0TA 2H2HA 2QE7D 4KWHA 3C3BA 1ZK2A 4J8PA 1DC8A 1KDOA 1UP6A 3RNOA 1NDUA 2B0JA 5KDDA 4CV1A 4LXTA 2FFRA 4YPOA 2WU4A 1VRVA 1D6JA 2BCEA 3PWTA 4WN3A 2NO0A 1KSJA 4OLAA 1G7SA 4I5EA 1CF9A 1NVFA 2QLBA 4HPWA 3WP0A 5HGXA 3D3QA 5CTJA 2GKGA 4I6GA 3NLLA 4PFSA 3EF3A 5IBQA 2FNAA 4IH9A 4P54A 3TCXB 3ISJA 2X5XA 2C29D 4D3SA 2C61A 4PBRA 2HA7A 3OFNA 3CNLA 4XJXA 1XNHA 1Y33E 3W2EA 1DJOA 3ZN2A 4Q3NA 4Q7EA 5KX5A 4I0WB 4ZKDA 2E5WA 1EZZA 5KYWA 2G0NA 5PGMA 1NZJA 5FBKA 4H9GA 1U0EA 2P11A 2XGSA 1ST2A 1OLXA 3PT9A 1V0JA 4MVJD 4YYZA 3L0IB 1ZCBA 2ATEA 4PU0A 5JCPA 4MIOA 2XADA 1E3WA 1VPEA 2C5GA 3KK0A 3NHJA 4QTUB 1AT1A 3ACBA 2P7HA 1WUTA 2EZ9A 4PX2A 2PO7A 4E2XA 1R37A 4I4LA 4KR3A 4BVKA 1J07A 1MB9A 1M2HA 5B1SA 3SC3A 5B6PA 4RYDA 1FX1A 2DC1A 5L8VA 4URHA 1PT8A 1WDWB 4MGHA 3DZDA 1L7MA 2RH5A 3I30X 4UJ5A 2BELA 5IAJA 3FI0A 1SQFA 4I5DA 2XRMA 3AEKB 5DX1A 1X8KA 1JKJA 4G63A 5H16A 3KJZA 4H3VA 2F2TA 3AEUA 3CZAA 3K1AA 4BUJA 3OJFA 1E96A 3G5UA 2ZB3A 3RU9A 3NGXA 1IY0A 3ED1A 4WLVA 3DD1A 3E7WA 4ASUA 3THXB 5I4BA 1L5WA 1QZXA 3NDPA 3GGDA 1KEEB 4E15A 4BB5A 5AUQA 4CIXA 5CDGA 1KI6B 2QUHA 4REQA 4KSYA 3I9KA 3DQPA 2X3YA 3FWYA 5B1DA 4H4DA 3JQEA 4TYQA 4OHPA 4YRMA 4PRLA 3H9CA 4FSHA 1L4MA 1VYUA 4YP1A 2C4HA 2WJVA 4GOJA 4NK4A 4ZKEA 3ZEIA 9GPBA 2XZPA 2D2FA 4I1YA 2IW1A 4N0DA 2P41A 1DWUA 3ZK8A 4C01A 5HTOA 2XXAB 1W30A 4IHJA 3RK1A 1EE9A 4N41A 5HQ3B 3SVLA 1EFVB 1N9GA 3M1IA 4LMRA 4ZI3A 3CE9A 3N3AC 4E6EA 1Q7EA 3V1NA 3KKNA 3FWNA 1CB7A 2G9NA 4NYIR 3LFUA 1GV0A 3U4HA 1CDDA 3WLKX 1WCV1 3R3UA 4JQSA 1EI9A 3OKAA 4E1AA 3O3CA 1C0LA 1KO8A 4YGYA 2QQFA 1U7XA 3PUHA 4NL4H 4KRFA 3KEMA 2DUNA 5IBRA 2C31A 2XWSA 2BTOA 1O97D 2CXSA 3UN1A 1I1NA 3ABQB 4RAOA 5E1MA 2X9LA 5KS2A 5KSYA 2ILVA 3CE6A 1TCCA 2V6MA 1E1QD 3L8HA 5HCNA 2RJOA 3B38A 5IAAA 2E3JA 1JWLA 4RK7A 4EHNA 4B3TB 3I5AA 3OFSA 1PFKA 2Z9CA 4LRUA 2XMCA 3HB9A 3KTAB 4PHCA 3LPAA 3TFOA 1UPFA 1X7HA 1U94A 2JH3A 1T8TA 1VJ0A 4ZEOA 3T3MB 2X77A 3BDVA 1KQNA 4B34A 2PUDA 4QM6A 5KMGB 1GN8A 4U63A 4ZGGA 2MSDB 4NNOA 4X60A 5E0KB 2OXFA 1E2PA 3FDXA 4MR9A 1U9YA 4UVDA 1WY5A 1Z37A 3PEYA 1Z6TA 3VV2A 2AYXA 1AGNA 4JGGA 4OXQA 2XA9A 3OZEA 4LDJA 1T0JB 4K9KA 3M70A 4TWRA 1SUDA 3ZE9A 3GJ0A 2GZ2A 1TM5E 3FKSA 4FTWA 4LZOA 1NF9A 1QB8A 2BI8A 4YVFA 5H9VA 1N3BA 3KQMA 5FI0B 4EB0A 3UK1A 5K01A 1RI2A 1GTZA 2CL7X 1VKOA 4R2IA 3THYA 3N7TA 3AQIA 4ZI5A 4ZJZA 1FVOA 3VR4A 3LHFA 3AR3A 1RYBA 3ZHQA 2HF7A 5MF6A 5IVHA 1PFUA 1TGVA 1Z25A 4HDMA 1SHTX 4AIRA 4UPDA 4M7RA 7REQA 2EKQA 3DE6X 3ADCA 4AKGA 4FBGA 4HX5A 5LUAA 3KWFA 1Y9JA 4KLNA 1QJCA 4F7WA 1VHTA 4ZRMA 4Q9HA 4FWBA 5C2JB 4I3GA 3DC7A 3BMNB 4F85A 1Y9DA 1OXUA 2YY7A 1XDDA 3KXPA 4IINA 5LYYA 1DKLA 2FWBA 3CV3A 1QK3A 2AD5A 4KQ6A 1ZK4A 3T1OA 1L5QA 4YJ3B 1C9YA 2C9OA 2H8KA 2GHQA 2ZWPA 4ESOA 3VHRA 1FYEA 4Q4HB 1TZBA 4HI0E 3D8SA 3VNSA 1O6CA 1H0RA 1CQZA 1PIWA 1ZISA 1ESMA 1GPDG 1Z28A 2P5UA 3BRWA 3KT3A 1T5TA 5B2FA 3O8DA 1QTIA 3QJ5A 2W11A 4ITUA 5BWMA 4XX1A 1Y3CE 5HF6A 2YXBA 3COZA 1QQ7A 3OLXA 3GG9A 5COBA 4YO8A 1P0PA 1ZGGA 1M34B 4NPHA 5FOQA 1WX1A 3TB4A 5DM60 1RR6A 3HR7A 3NW9A 5K20A 1C8KA 1A9RA 3PUXA 1TRHA 2WE8A 1BEEA 3HKDB 2X6QA 4YMIA 4BGVA 4ISCA 5DNAA 4YUXA 5JSZB 5KQLA 3EULA 5LFAA 2O8BB 4L4RA 2YVLA 3EZ6A 1B43A 1R0YA 3RS8A 1KAHA 1XRQA 3M5PA 3Q3GE 2HY7A 3HDQA 4FOSA 3O3NB 4IF6A 3KEOA 4M53A 2X2PA 4KQKA 2YHIA 2PEYA 5J59A 3RE1A 5LDDC 3V4PB 4I9GA 3WGTA 4KHZA 2NVWA 3JASB 3KC2A 5AKLA 3HI6A 3N6RA 5KAPA 4AKHA 3N39C 3QWIA 1OSNA 3ZDFA 1ZBDA 3IEXA 2OQ2A 3JSAA 4LDAA 3N05A 1UXIA 4V0NA 5H0IA 2BKLA 2HU7A 4MWTA 2JEYA 2I8CA 3FYDA 1AUOA 4CV2A 4NXNB 5K3EA 1ACJA 3T3IA 4XWWA 4BNYA 3FTDA 3P2YA 4YCJA 3UVEA 1YGYA 5TQ2A 2IUEA 1JQ3A 2W0SA 1CNFA 2CNNA 2IHBA 4PYOA 1MO2A 1UADA 2ZJ2A 3DCJA 4JXKA 4P86A 1C50A 1ZHFA 2QVGA 4GSYA 4X3OA 2ZRJA 1HE2A 3D7KA 1XPJA 1J5EB 5IDXA 1KO7A 3A3NA 3MG9A 3QVLA 4PFJA 3DFKA 1VL0A 2C77A 2Z1DA 4WKOA 2R44A 4MA4A 3CR7A 4JLWA 4CODB 2P6OA 5CYOA 3S2UA 1K7SN 3CRVA 4FYMA 3NXKA 5CJ2A 2YH2A 4YQZA 4KN9S 1B3BA 2V8BA 1T36A 4QLBA 1KMMA 1E2IA 1HE5A 4TWAA 1T43A 4I6EA 2HRDA 4JGBA 1E3LA 1OZ0A 1B0UA 4WSOA 1K92A 4X6LA 3W7VA 3J7AC 1RPAA 4YK7A 3P2OA 2JGRA 3JQPA 4N4AA 4KPYA 1B8PA 2QJTA 2PIDA 1BU8A 3U4QA 2R751 1EVKA 1LNZA 4G5YA 1EFVA 1O8CA 4FGKA 3HJCA 1GUAA 2GZ1A 1O0BA 4B46A 2VA8A 2HUPA 4I4CA 3VM6A 1ZWLA 2WMYA 2XMRA 3PC2A 1RZRA 3CXRA 3Q8XB 1UFOA 2F6RA 2V4MA 4V39A 4Q3CA 1ZK1A 2NIPA 4JXZA 1OHHA 2RBKA 4ENTA 1X38A 3Q3IA 4PG5A 4RKQA 3D6MA 2O19A 5FHRA 3TUJC 1H9CA 3IO5A 1DDGA 2DKOA 2WIBA 4K9RA 2W6NA 4A0RA 1W5SA 5LP6A 2FMUA 4OP1A 2O23A 2CV1A 2Y27A 4B35A 3QW2A 1X13A 2C4KA 3EEYA 2OO3A 3F3YA 3ZE1B 3KUXA 4AKTA 7MDHA 1GR1A 2ZE5A 3RHTA 1EXNA 3Q0TA 1IOLA 1P60A 1RHUA 4OMFG 4FFDA 2FJPA 3ZNNA 1KGSA 1SC1A 2HDNB 1QM5A 4CM9A 3MTGA 4E2YA 3BZWA 3DB1A 3S28A 3WLTA 3SFTA 4FHFA 4FM9A 2IBMA 1SN7A 4P7GA 3NC4A 1DJNA 4PC7A 4YB8A 2D2XA 5M34A 1UPCA 3JYOA 3RW9A 3ZV5A 3H9GA 3KWJA 4HWRA 2F67A 4JBLA 4Y18A 4B7AA 2V9PA 2IYTA 4U2EA 3G89A 1SBCA 2NVUB 2E4WA 2HYDA 1GTJ1 1GNSA 1AHIA 1X1AA 2Y67A 3OSZA 1J8QA 2OMKA 3DLAA 4R2WA 3E9QA 2BE9A 4L5YA 2FZ5A 5D1HA 3ZS8A 4EQ6B 4BCBA 4YCSA 2BKVA 1WLYA 4UBIA 2FX2A 2EEPA 4X95A 3TLJA 2C4WA 3HDHA 1DTWA 1HNNA 5IT9A 1V5FA 1NRWA 1QRRA 1JG6A 3OJXA 4GX2A 4S24A 5C1OA 2GXUA 3IIJA 2FN3A 3JVVA 3JSXA 3RYCB 5E3HA 5L3SA 3IMFA 3SZOA 1A97A 1YONA 4IRUB 4JEIA 1KYVA 5FDFA 2HMTA 5B7QA 2DEUA 3QV1A 2V5AA 5JH7B 1SVNA 2QTMA 2A7XA 5TX7A 5KNCA 4LA4A 2WHQA 4B80A 4R41A 4DF3A 1UJ6A 1GL9B 3AOGA 4HX2A 3RC1A 3GPIA 2OM2A 4JYCA 1G63A 4IIXA 3FMIA 1XQWA 4NDAA 4RD4A 4DBLE 1M2EA 4JL6A 1HMYA 2CFTA 3HJRA 3P9SA 5K0ZA 1UKVY 2E6UX 2HJHA 5JWHA 4HMOA 3WBFA 3B6EA 2R87A 3A9WA 4BMNA 4M1TA 1DJMA 4B7UA 1XTQA 5F23A 3RARA 5CDHA 5E6UA 3I05A 5AUPB 1F4VA 1RZ3A 3JALB 4S0XA 2G80A 4Z1MA 4PS1A 5CVUA 2QIOA 5AHRA 4CQMB 1HH4A 2B92A 1EQUA 2J3JA 3AR5A 4V03A 1W19A 1K98A 1K27A 2V55B 3ADOA 3R9WA 3AHHA 3KQPA 1YQEA 1BHQ1 1BXRB 2M6KA 1T15A 3GFTA 2P69A 3I64A 4Z4CA 1JTFA 3FRIA 3U4GA 1U4SA 3OHMA 4WNCA 2WD8A 1WZIA 1GPWB 2X4LA 3CZRA 5HKBA 4B76A 5AHOA 3ZD7A 1W44A 2I2CA 3W5SA 3KE9A 3I2IA 1PZGA 5EXSA 4B6JA 3ER9A 3P9KA 1QIGA 4OHZA 5IH7A 5JNLA 4IDNA 4C4XA 4Q3EA 3PDIA 2YHIB 1GUBA 1QHHA 1TUEA 2Q3MA 2Q3DA 1S89A 2O2IA 3IIEA 4H35A 4U5XA 1XFAA 2CC2A 2YOGA 2PZAA 3CLTD 2CXNA 4JHLA 4LUCA 3TM4A 1Z3CA 3PI7A 2YICA 1CQJB 2J07A 3O8QB 3V8BA 3C3XA 5IBPA 3H13A 5CT5A 5I7HA 3BIJA 4P7JA 4H08A 1YVDA 4PNHA 5GGYA 5KHLB 4KQJA 4QFMA 5EEHA 4FDAA 4QEKA 4WKBA 1JIXA 3TNFA 3FTFA 1BMFD 2BFBB 2EIHA 4E11A 1JB1A 1U5CA 1LK5A 4EPYA 3DYVA 4XPIA 2BMEA 2CSUA 1T6YA 4N39A 4C7OA 2X19A 3BIXA 3F4KA 1CT9A 3K53A 4IAOA 1U0BB 3PEFA 3ICCA 4YWJA 4FBLA 3T0IA 5KYXA 1F51E 1NQWA 1XXHB 2NU7A 1C0EA 1T9GR 1CEYA 1H5QA 2B8NA 1P7ZA 4HL6A 4J9VA 3RGGA 1XAHA 4G4SO 4GMKA 4HWKA 3BXHA 1QU2A 1Y1PA 4RTNA 1IM5A 2EGHA 3KQHA 1P4JA 4ARBA 4IIUA 4W82A 1ZH4A 5HE9A 4ANFA 4IXTA 3KHKA 5DO9A 2JHAA 5C5DA 3RBXA 3CRMA 1F2UB 2IPAB 3A6LA 4MEAA 2I3ZA 2DSTA 3GGOA 3QXXA 5IHXA 2EBFX 1F0PA 1ZIYA 3LBHA 4DCJA 1B8OA 1ZRSA 2PTHA 4B0PA 1EINA 1U3WA 2RFLA 4I55F 2Q3BA 3RU3A 5K0GA 1KIAA 2R6JA 2W2TA 3EBPA 3HKBB 3R0VA 4CN8A 3LCCA 2B7CA 4WZBA 3KVRA 1RLJA 1ZMRA 4D8UA 5HR5A 2V4UA 3SPXA 5EP2A 3ZBUA 4D43A 5JY1A 6NULA 2WABA 4UFNA 3WXBA 3NVKI 4RY8A 4FZ5A 3ZUPA 5ANRB 3RSOA 5IZ4A 4DB4A 1PVVA 3BUSA 3HPRA 4HDNB 4ZAVA 3PDIB 4JCCA 2YNMA 3KPVA 3PENA 4L5BA 2OUIA 1KQ3A 2HHAA 3SS7X 5CDTA 1BX0A 1DBIA 4XM0A 3M89A 4YAGA 3LDAA 5ESDA 4BZWA 1C3OB 5GWXA 5C1IA 2OYSA 3LTEA 4KUHA 2H1VA 2WBLC 3P9XA 5IYZA 1Y6FA 5GMOA 5TJHA 4OKNA 2J9FB 1G1AA 4EATA 1VBFA 3OTQA 3GLQA 4FYHA 4MICA 4TRRA 4U7GA 5B57C 3JQAA 3VZPA 4QVIA 2VZLA 1I9CA 4NDZA 4TUYB 1PEDA 5CX1A 3W9BA 1EFDN 2NLOA 1CFJA 5JSKA 7YASA 1ND6A 1G5TA 2Z83A 3LPDA 3DHVA 1PT5A 3JAWB 3K9QO 1L7EA 4C87A 2CVFA 3BDIA 4BVJA 3M5CA 3MXOA 4B3BA 2AKYA 1L5HB 1P81A 1YA4A 3E1KA 4YLEA 1Z33A 5I9TA 4B82A 1KR2A 3HEMA 4J4BA 4EUFA 4RF2A 1L4EA 1KY3A 2P4QA 3LXMA 4HQLA 4WNAA 4QATA 3EDMA 1X39A 1NLUA 4KFCA 3NBZC 3NHFA 3KJIA 4W8OA 1GGMA 4TV9B 4WNAB 4D79A 3JZFA 3EEBA 3EGWA 1HEUA 2CMHA 3D1VA 3NBUA 5BWBA 2C57A 4AG5A 3SLRA 3U6BA 4PAOA 2A0UA 1E9DA 4IDDA 5HM6A 3E9DA 3ONNA 4E1BA 2QTVB 1XA4A 3GBSA 1JH8A 2QF7A 3BA6A 4MQ4A 3WO0A 1IUPA 1L5VA 1JKIA 1LDNA 1O95D 1P6QA 2GI4A 2V7WA 3G8AA 3L0CA 4QELA 3ETJA 4BO6A 2PGXA 4TUYA 5IBCA 3DZGA 1G5RA 3PKZA 4B6GA 2UZ1A 5CCEA 2NO5A 3ROQA 1EQAA 1ODSA 4BVEA 5HIAA 3GGCA 3OWHA 4QHTA 1D5CA 5F52A 3MJEA 1AKMA 3E70C 3KS9A 1E0KA 4CCYA 1G8MA 3DSRA 3ROEA 4GQIA 4HS4A 1WVMA 4KQFA 4OFWA 4P4UA 1ZYUA 4AYTA 5CHEA 4IVNA 2O48X 1K8YB 2A9VA 4WCFB 2ZWAA 1QVAA 2DM6A 4HH1A 3SQLA 3V4FA 2VXOA 3TRJA 4BJHB 5ITZB 4KU4A 3OZCA 1EWTA 2GETA 4UM9B 3VJKA 4LZJA 1EK1A 1YFKA 2QZZA 4G2TA 3RJMA 5TNXA 1CX9B 4AZ3B 1QRTA 5EFZA 4NPAA 4MR8B 5TQ0A 1LLCA 3ASYA 2WM2A 3R74A 6AT1A 3I92A 5JEDA 5JCXA 5EJGA 3ZE7A 4CMCA 5AOBA 1S8OA 2A1TR 3PYLA 3KR1A 1H1LA 2PVSA 2Q6KA 4IXWA 3T9BA 3DF9A 3OE5A 4I14A 4QQRA 3FPLA 3C1OA 1J5XA 1ZVKA 4DY4A 1PF7E 5ULLA 1MCZA 2JIPA 5E7IA 5BR8B 1JHOA 3L7MA 3A0RB 3ZDRA 3KR9A 1DQRA 2A92A 4M9SA 4R9RA 3NM5A 4Y2QA 3JQFC 1CQXA 2GN9A 2C2KA 3ANXA 1JQ5A 1GNTA 1PD0A 2XZDA 2O7RA 4LVCA 3SSNA 4ZYLA 4GI2A 2C00A 5EINA 2JW5A 5EJ9A 4A03A 3K09C 4D3XA 3LTNC 2WWXA 3NWJA 1EESA 5EE9A 4QBHA 4HDMB 1DBQA 3QZUA 4BV2A 1SEPA 3CBGA 3C16C 1QYCA 1RWQA 4GXNA 2C7BA 3CKKA 3NIDB 4I55A 2LUOA 3BFKA 1FFWA 4Y2UA 2JKZA 3RBAA 4TQAA 3ESBA 2RBGA 4L7VA 4XEHA 2HV8A 1J5PA 1L9KA 4YAKA 2YX1A 4YTEA 1VKRA 4YAWA 1MO5A 3IMCA 5A62A 3F0TA 3O8NA 5BWLA 2O8DB 4TVOA 2FUG6 1F4PA 1A77A 3G9UA 5D2CA 2G88A 3LO5A 4YCNA 1PRYA 3HBFA 2I0FA 1DNPA 2XQIA 3DEAA 3KKZA 2BOVA 1JHPA 3A1VA 4LE0A 2JGJA 4PGAA 4PX3A 2XNKA 5EP3A 3VNUA 5BP7A 2GD6A 1N8SA 4B3CA 3TLZA 4EHFA 1Y9EA 1KVQA 2O14A 3AR6A 3O6VA 3ENQA 3GUZA 2O2GA 3CW9A 5CB8A 3K8YA 4ZO6A 2HA6A 5EWJB 3B1KA 3BE8A 3P2EA 2J33A 3JAKB 1P44A 2P9JA 3QFCA 3VNBA 1QHSA 3PJDA 4Z4HA 1Y8RA 1X1EA 2MYPA 2YFHA 3D2LA 2ZLBA 3PFFA 3ZV4A 2NMVA 3ZD8A 1I2ZA 2GOYA 2W83A 3BH0A 3FPAA 4TM8A 1MHPA 3E15A 2FU5C 4AUKA 1EX6A 5HNKA 2YYAA 1AF4A 1JAYA 3RIMA 4RLHA 1YQQA 2WPNA 5JANA 2D8MA 4KFRA 3DZKA 1ISPA 1MB4A 1AIPA 1T6BY 5FNVB 3LLVA 1Q92A 2XX3A 1Z0ZA 2HGSA 3HVKA 3E18A 2EW1A 3TQRA 1ZVQA 3HL4A 3OX2A 2E6KA 4L28A 5ALLA 1JILA 1ZGZA 2C9MA 3FSJX 3NH6A 4XJVA 5EJAA 4KOEC 2D62A 1HDGO 2GVZC 3AESB 4UTRA 1C3XA 3L8CA 3OZTA 3RV3A 4F06A 3CH5A 1R5NA 2JZOA 3FJYA 1ENYA 1P2UA 1MB0A 2VEOA 2CFOA 2W2LA 4HGPA 2G7ZA 1P4GA 4DXDA 5I9IA 1N2IA 1E0AA 1N5KA 3M81A 2H1SA 4DCTA 5ALWA 2KX7A 2WV9A 4Q7JB 4GL2A 1HO3A 1PWZA 1VE5A 4BO4A 2Q5LA 3E7XA 1Z63A 1CLEA 2NP7A 3DNPA 5B58C 2ZJ0A 3ZZUA 3AFIA 1CUGA 1NUPA 4H6WA 3DD5A 4TMZA 1ONOA 2BHTA 5C8ZA 2EKLA 2ZR9A 1N2HA 3IOMA 2AOXA 3SXJA 4BBPA 3NJRA 3UMFA 1C29B 4U8HA 3RBVA 2CLMB 2H1HA 3MCWA 2XMSA 3HBLA 3WFJA 10MHA 1XA3A 5ALHA 4ZO8A 1RABA 1YS4A 4W5WA 1E62A 2DHRA 1TA4A 2IY7A 4UE2A 1ZJJA 3TLMA 1NJFA 3UPDA 4C2TA 2JGIA 5B36A 4DV6B 3DDCA 4WESA 2A3NA 3QSGA 2LIPA 5T6MA 4DV0B 4Z86A 3QEMB 4NXMB 3HCCA 1ZM9A 4UNIA 1KDYA 3HFGA 1F2TA 2CXHA 2X7HA 1UIMA 4XIGS 5AI5A 3VH4A 2EW8A 1FX0B 2F9FA 4IKEA 1XNJA 3OQJA 3REOA 1Q1GA 5A02A 4E5UA 2DFTA 2O05A 1CFZA 2RK4A 2YC2C 1XRPA 5J2TB 3UOWA 4I3FA 4N8DA 5I5EA 1RBZA 1BA2A 2CXTA 1QGED 1KI2A 1GPKA 1VPWA 2WFAA 3A4VA 3B82A 3OZAA 4KXVA 1GZUA 1BQ4A 1EEHA 1G8SA 1VLJA 3GDWA 1IG0A 1II8A 1PL6A 2FH5B 2QX9A 3O8OB 1SQ6A 3FCCA 3GLTA 1U8XX 1NA5A 4IHKA 5AM2A 5AP9A 3AR8A 4E94A 2ZUEA 5DHSA 2G40A 4FDTA 5ARBA 1TLLA 1H8HD 2QRPA 2JA2A 3GWGA 3OMLA 4GIBA 3T52A 1M8GA 4P4TA 5B4VA 2C3MA 2FW6A 4QDXA 4NCXA 2IKQA 1A7UA 1H3FA 1N0UA 2ADFA 2BDTA 2PH7A 5GONA 1OFUX 2GBLA 1N4AA 1VKHA 3VNAA 5EQFA 3KQNA 3TGPA 4RQAA 4CT0A 2VP0A 2PMKA 1RYMA 2REQB 4IG9A 5LBTA 3RS0A 3MQ4A 3R4CA 3IDSA 3B9PA 3PHGA 2OPHA 1RRVA 5ICCA 1K1EA 1N78A 2BONA 2GQ0A 3E22B 4GKVA 1ZNXA 3C6BA 5LZ8A 3W2GA 5KSZA 3GLHB 2OBYA 4BJ5A 3B3FA 3KNZA 1B1AA 5BQOA 2NXWA 3IJRA 3M4JA 2ZUSA 3KJEA 3RF6A 5A5DA 1W59A 4Z4QA 1U9IA 2NO7A 2E55A 4ZO9A 1O94D 2P62A 2HN9A 5EY5B 4CL0A 6YASA 4MARA 1QP4A 2I6XA 2CFRA 1NX6A 1CULC 2BKEA 3FTNA 3LQFA 3DONA 2CXXA 5CX1B 4J16C 1SK8A 4ZQHA 1MQSA 2FWNA 1AUVA 3WLQA 3ESZA 4AUNA 4PV7A 3COSA 4ZVUA 2NO1A 1X1BA 1O89A 2X8BA 1PEAA 1YI1A 5DI3B 3R5JA 5GIPE 4C0QC 1IN6A 1K4KA 3DBLB 3NFYA 4K6CA 4N3GA 4P3PA 1XMXA 1REQB 4NJEA 2PD6A 3VO1A 1YIAA 1JR6A 4L8FA 5CT4A 4JLMA 5ENVA 1T3SA 4B45A 1CS0B 2MYUA 2P9EA 3BJZA 2Y77A 3VNVA 4YJFA 1QOQB 3PRYA 1XXHE 1NVXQ 1CTQA 2V0CA 3A14A 1GG8A 5FV7A 3SEQA 4FGWA 4LJ4A 3ACDA 5E1DA 3AEZA 1WPQA 1DG3A 4GW3A 3IMGA 4ZARA 3ZJYA 3QWFA 4V2UA 5EJ5A 2FRDC 2ZRFA 1NYLA 2VSNA 1SU8A 4NI5A 2C42A 5E2IA 1M0SA 4CE6A 4CUJA 3TQFA 3W04A 4KIJA 5B5SA 1K06A 2F3PA 1LKZA 2JAQA 3GEDA 4EJSC 4CF7A 1SR8A 1M34A 2NQTA 4KO3S 5M5BA 1UKZA 4FLEA 4K7JA 1GKLA 1RKVA 3EXAA 1JI0A 3KL2A 3H5VA 4FFVA 4OH1A 1MH9A 2WSLA 4II3A 4LHZA 2P8JA 2WF7A 4K3VA 4HZUB 4RHCA 4GUDA 3NBQA 1H94A 5IJXA 2WLSA 4DWJA 1P2FA 4RAQA 1CHDA 2JVJA 2YXPX 4U8GA 5JHGB 2E4UA 3LGXA 4CM8A 3VKGA 3LF1A 4OUKX 4MR7A 5CA1A 1OAOA 3EAQA 2A1TS 4PAWA 2LP4Y 1UXOA 2VDMB 3HJGA 3GA7A 1I3KA 2ZS9A 1Z0UA 2WW8A 3I04M 1E3IA 2EBUA 2GZAA 3ZCRA 1HNXB 1NNSA 1Q0UA 2AEFA 1CUUA 2A0YA 3DZCA 3FRJA 3D5EA 4XUEA 5EIOA 4UAUA 3ZQJA 4KGZA 3RFFA 4DC1A 1RI1A 2V6FA 1JPJA 2P2YA 3BF7A 3I4LA 4M1YA 5KQGA 3RS7A 1QRAA 5HS4A 4EH1A 4ZEMA 1F0NA 2V7VA 3WMGA 1DELA 2JJ1D 2Z0MA 3SSAA 2XF2A 3JQDA 4B84A 1IZ0A 2A9KA 4R8VA 4MEJA 4US2R 1UM9A 3PQ6A 3CRRA 1RZUA 2CZCA 2ZAMA 3HDGA 3ZDCA 4K9OA 4YIHA 5C4MA 1G8KA 2PNFA 2X0RA 4IJKA 2IWHA 1RRFA 3SAJA 5AI0A 4QU5A 2NUAB 4CMIA 5BOSA 5JAMA 4LK2A 3MWDA 2BEKA 2ZR7A 2FP4A 2GJAA 3R5XA 4KV9A 4NBSA 3W78A 4CV3A 1NVAA 3P0IA 2OXIA 1YRWA 3UPUA 4RJJA 1JP7A 4E51A 3C5WP 2WVGA 3AFGA 4A2WA 4OYLA 1YR8A 1TT5A 1R4ZA 3VOSA 1KERA 3DEFA 3K1ZA 2XKAA 3HWSA 1T1SA 3TFWA 1O4VA 4I08A 3MLEA 5G3YA 5EE1A 2PFKA 2XMDA 2H2DA 4GLOA 2LDXA 4RU1A 4CDMA 1AVTA 1X3LA 2ZITA 3LP8A 1I5EA 1VMIA 3SR0A 4R0VA 5E7JA 5BYKA 2EQ5A 4BMYA 3B6JA 3U61B 4MO9A 2X8LA 1XA0A