1M7GA

Crystal structure of aps kinase from penicillium chrysogenum: ternary structure with adp and aps
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
208
structure length
208
Chain Sequence
STNITFHASALTRSERTELRNQRGLTIWLTGLSASGKSTLAVELEHQLVRDRRVHAYRLDGDNIRFGLNKDLGFSEADRNENIRRIAEVAKLFADSNSIAITSFISPYRKDRDTARQLHEVATPGEETGLPFVEVYVDVPVEVAEQRDPKGLYKKAREGVIKEFTGISAPYEAPANPEVHVKNYELPVQDAVKQIIDYLDTKGYLPAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Adenylylsulfate kinase
publication title Ligand-Induced Structural Changes in Adenosine 5'-Phosphosulfate Kinase from Penicillium chrysogenum.
pubmed doi rcsb
source organism Penicillium chrysogenum
total genus 79
structure length 208
sequence length 208
chains with identical sequence B, C, D
ec nomenclature ec 2.7.1.25: Adenylyl-sulfate kinase.
pdb deposition date 2002-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01583 APS_kinase Adenylylsulphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1m7gA00
3QKRB 2VL7A 3REFA 1OFIA 4HUQA 2XTNA 1KDPA 4Q1BA 1ZM2A 1SXJE 1MO5A 1WMSA 4NPHA 4MA4A 3LO5A 2RHMA 4PHTA 1Z22A 2VP4A 3LAWA 3SYNA 5BWMA 1JAIA 1IONA 2Z6VA 4NCHA 3WNCA 3TNFA 4Z51A 3I3SR 1Q1EA 3R9XA 1Q1BA 3NWJA 2ANBA 3QE0A 1NVXQ 2QQ0A 3QF4A 4IEEA 4LC0A 2NZJA 1X3SA 3AV0B 1NG9A 2ORWA 1D2NA 4DHEA 1XEXB 4DLVA 1XMJA 4ZDWA 3ADKA 1CLUA 1R8QA 3E5HA 3IILA 4YMWA 1Z0KA 3KFVA 5AJVB 2NTYC 1Q21A 2V55B 1NIJA 3HWSA 2QP4A 4C0JA 4A9AA 4NYIR 1IXSB 3QXXA 3UPUA 1S3GA 2ZXUA 1A5TA 1S9DA 2OBLA 3QEJA 1W44A 2J5XA 4M1MA 2PH1A 3LA6A 3N70A 2YKGA 4HB0A 2A7QA 4D2IA 4D80A 1TU4A 2VLIA 1BIFA 4TL7A 3KJEA 4PO1A 2C9OA 2ZRBA 4EPTA 4HZIA 3QSYA 2YWHA 1ZYUA 2Z4RA 2QY9A 1P9RA 2YC2C 4LJ6A 4RD0A 1N5JA 1FP6A 4N3NA 4C4PA 3ASZA 4B2PA 3RYTC 3ECCA 1F2UB 3GJ6A 3SFVA 1E2JA 1FTSA 5EE3A 3ZGXA 4P4SB 3K53A 2EYQA 2ZSFA 3OAAD 3GLIB 4F92B 3VNUA 4B34A 5FOTA 2ODBA 4IVRA 4PC6A 4QJ4A 1P4SA 4JVSB 2G0TA 3SU8A 4PPFA 4ZDKA 2PLRA 4RSGA 2IYTA 4BFTA 4BFYA 4URYR 3O47A 3VKWA 3PIRA 4CYMA 5JRJA 2OSBA 3H86A 3PG5A 1SKYB 4LGMA 2QENA 2OILA 4Z54A 3K0FB 1N6LA 4BLRA 4TZ6A 3MWYW 1LF0A 2WPDA 1OIVA 1U90A 4JZKA 4UNNA 3RRYA 2H16A 4CEHB 4JBYA 3GLFB 1TF2A 1CTQA 4PXAA 2XOKA 1GL9B 1G5TA 3TSWA 1UFQA 3L8ZA 4IDNA 3AVUA 2O8CB 1KI4A 4OI1A 3THXA 1RIFA 5FL3A 2ZRJA 1G3RA 4MDFA 5J47A 1N0VC 4V0LA 2CLDX 1KY2A 1TQ6A 5FBWB 2DPXA 1AA9A 1AQYA 2CL7X 1XMIA 2ZE6A 3MLEA 2GXUA 3NKVA 1P9WA 3AKEA 3Q72A 5FH9A 3FFAA 4AKGA 4TT3D 3VHXA 4AC9A 1ZM9A 4NKRA 2J0SA 3ZLJA 1HE1C 1ONBA 3H84A 4DUGD 2FPLA 4JKIA 3EIHA 4NYMQ 3IIKA 4KLNA 4LPSA 3U4QB 5KYKA 4DSNA 1KIMA 1GRRA 2AKAB 1U8YA 2J59A 2MSEB 2NO6A 3GJXC 3H0KA 5G53C 4LYAA 3CPHA 4Q9LA 5AWFC 1E9SA 3KB1A 1VYTA 2W2XA 1DAFA 4JMPA 3HR7A 2A78A 4MKIA 4C9BA 4EDHA 3KKOA 4YDSA 1DAEA 4AKHA 2O8FB 1RRFA 3RRZA 4X8MA 2BEJA 3TLXA 1IQPA 5JSZB 2CK3D 5TY0A 5KNBA 4WAUA 2ERYA 2QMEA 3U6KA 4LYHA 3VAAA 4EFLA 5DNYB 1Q1ZA 3FHCB 4DWJA 4B76A 3BERA 1P60A 2YHSA 3BIFA 3T1QA 1X8LA 3SI7A 4BQSA 4DB2A 5E7JA 1QVAA 2BMJA 2GVDC 3MJRA 3PUXA 1OB2A 2PBRA 4A1FA 3CRW1 5FR2A 4LJ5A 4HLDA 2O8CA 1FMJA 1VIAA 2ZJZA 4ESHA 2V1XA 4AYTA 2JJ1D 1E1QA 1TPZA 4UNPA 5FTNA 2F55A 4JLMA 4URZR 1G64A 1UBCA 3FVQA 5L8VA 2CLCX 4JLKA 1BMFA 3B82A 4V03A 4R2IA 2OAP1 3ZVLA 1WRBA 4Q00A 4B71A 3LBHA 1W49A 3SOPA 1M7BA 2REBA 1E2GA 3NIBA 4KODA 3RS2A 2GAAA 1KI2A 3FHTA 2ECKA 4XWAA 5EP3A 1NVUQ 2UVQA 3B1YA 2H8KA 2ZS7A 2RH5A 3RSOA 4RCYA 4M4SA 4LHVA 1U98A 1HTWA 4LV6A 1X8JA 2FFBA 2RMKA 2WWWA 4P0TA 4TTQA 5KPJA 2F1RA 2FF7A 5AJXA 3ZIAA 4OJKA 2OFOA 4LY6A 3C15C 4NH0A 4NL4H 2O8FA 3V4RA 3EZ9A 2D2FA 1HH4A 2QM8A 1AGPA 2JEOA 2OESA 4HSEA 2BEKA 3AGQA 1E69A 3Q7QA 4OYHA 1SXJD 4FMBB 4IHQA 3AVVA 1W2HA 2KE5A 1G7RA 3L0OA 4O2RA 3A4MA 4DLSA 5FOUA 2IWRA 2WKPA 3GLGE 1J99A 3ICEA 1R5NA 2XZLA 3TIFA 1CJMA 4L9WA 3SYLA 2FOLA 5AUPB 4D26A 3VNVA 3B1ZA 2I4IA 1YZQA 3CONA 3FOZA 1VCIA 2XJ4A 1XP8A 1M2OB 1NMZA 1G7CA 2IYSA 2ZR0A 3CNLA 5P21A 1KO5A 2BDTA 2W6IA 3FKSA 4US0R 5DH9A 1E1RA 1RJ9A 3MAAC 2IEZA 4MYUA 3VR1A 2IX3A 1M34E 2YNMA 3P20A 4I1VA 1HEIA 2NPFA 1G7TA 3DHWC 5BYJA 3A1VA 3CUEF 1AQUA 2GEVA 1VHTA 2GILA 4ZCLA 5BW8A 3OFNA 4QM6A 2WWGA 1DELA 4KFUA 2W2TA 3H2YA 4C7OA 2GJKA 1W36D 3DMDA 4WW0A 2GBLC 1J2JA 2B7CA 2PX0A 2IWHA 3S1AB 4CEIB 4A0FA 4AIIA 2NPIA 2P6UA 2VF7A 3HYTA 3ZH9B 1EG7A 1JXMA 1XWIA 2AX4A 1N3BA 4LJAA 2B21A 4KO8A 3SC3A 4Q03A 4I1UA 2RGEA 4L9SA 2GESA 3KFXA 2OBMA 4D0GA 4TLAA 4GFDA 4P33A 4A8JC 3LDAA 2V3CC 1KSHA 3T1TA 4HAXA 4DIEA 4F93B 1Z0FA 4D4KA 1G17A 1NIPA 4PZYA 3HJNA 1B0UA 1JNYA 1ELOA 4B3GA 4DB4A 4IEIA 5G40A 3KJIA 5JS7A 1BH2A 4Q4HB 1KI6B 1LS1A 1GIAA 1IAQA 4NONA 3PQCA 1XF9A 4OBEA 4PSKA 1Z2CA 2JA1A 3NDPA 4M9XA 2R6CA 2O5VA 1JEDA 4YDHB 3QBTA 5TB5A 4BPBA 2J0QA 4N0EA 3VKHA 3D8BA 3VU9A 3ZQ6A 3CX7A 3EA5A 2VHCA 2IUUA 5LDDC 1TU3A 3NG1A 3AUXA 4IOMA 1TMKA 4DIDA 5C18A 4P31A 4B32A 1CR4A 2OEPA 3K9LA 2W6JA 5G41A 2XNDD 2ZJBA 4KV9A 2F43A 5FPTA 4CEJA 1A4RA 2P5TB 2C77A 4LHZA 3NH9A 5EE5B 4GMXA 2KBEA 1N0WA 3PUVA 3TK1A 4ZCIA 1AS2A 2CCKA 3P32A 1F2TA 4IVPA 1TL7C 4Q7JB 3BOSA 1GKUB 1KAGA 4Q48A 2QZ4A 4LJ8A 3X1ZA 4HAWA 1A7JA 2ZU0C 1LW7A 2ANCA 5FOXA 3T1OA 4A6PA 2JLYA 1G8HA 4GDFA 3CF2A 3R8CA 2JLQA 2EWWA 4CEIA 3QBVA 3KDSE 1ZBDA 1P2VA 3OE7A 3QVVA 3UG6A 3UMFA 3KXKA 1DPFA 2QE7A 1Z6YA 5B30A 2RHDA 4C0AC 4QJ5A 1QHSA 1KZGB 3CRQA 4AY2A 1HE8B 1HQYE 2HT1A 2Z0MA 4ZPXA 3FFBA 2F9LA 4LUCA 1PZNA 1KZ7B 1U0HC 2BMEA 4XTCS 2X19A 4WXPA 4TTRA 1KI6A 1KTVA 3C5HA 4Q9JA 1JBKA 1W0KA 3SYKA 2XITA 3TSZA 1P7CA 721PA 4BLOA 4IJMA 2REOA 2Q9AA 3MRSA 4PX9A 2MSDB 3T5DA 1O3YA 2BBOA 4JBWA 4QHSA 1E2DA 3H1TA 3JVVA 5DI9A 3WXMA 2OO7A 5HZKA 1LTQA 2G1KA 3TBKA 1OFHA 3L82B 4C30A 3AEZA 4LHXA 2OFWA 3A1WA 1Q57A 3DPUA 2G83A 3CF0A 4TSFA 2E1RA 1P62B 1SULA 2UZ3A 2HYDA 2YJTD 1OH5A 1L2TA 4IVQA 1P9NA 1XFAA 1JPNA 1X1RA 4F91B 5CM8B 1XX6A 3IUYA 2I1QA 3U2QA 3I92A 3ZVNA 1OHHA 4RD3A 1WF3A 5HCNA 4PHFA 5GADl 3RVBA 1NJFA 1KMHB 1XTIA 3ZZ0A 4ZDJA 1COWA 1E99A 1PLLA 3A1TA 3NHBA 1OKKA 2F9MA 4MRNA 2JIZD 4Q9IA 4HB2A 4URXR 2BOVA 1II9A 3MCAA 3GLIE 1VCOA 2CHQA 4NYJQ 4X8OA 2WKRA 1EGAA 1ZM4A 2WSSA 2GA8A 3ONWA 3RC3A 4RKFA 1GILA 4LHWA 2NMVA 2GNOA 1TX4B 4Q18A 3K09C 5E4FA 2AWOA 5JHGB 1T0JB 1E9RA 4JIMA 2VP6A 1RKBA 4DLYA 3QI2A 1XTJA 3U60B 1LB1B 3LXRA 5EQTA 2QMUA 1YQTA 2QBYB 1GUAA 1KJZA 3QOFA 2RGCA 2ZE8A 1NSFA 4M1SA 5JLJA 1K5DA 1H65A 2ZPTX 3MGCA 4EPXA 2HV8A 2Q3MA 4FCTA 3PUWA 2G1JA 4UJ3A 3QXCA 4JL8A 1IN7A 3GLFE 3AVTA 3RS3A 3C7KA 2Q3HA 2QROA 4OHZA 1Q22A 1ZMXA 4KBFA 2FWRA 2V7QA 1R0YA 3X1YA 2QMHA 3LLMA 4TQUS 1T9HA 4ACBA 5B57C 4BLQA 5J4YA 3SNHA 3FTQA 4OI4A 1X8KA 4PZLA 1AKYA 4QNRA 3MG9A 3IPXA 1HV8A 3CZQA 1KK1A 1KY3A 1U9IC 1YJ5A 1DADA 1NG1A 3R20A 1D2MA 4Q01A 2ZAOA 2EU8A 4DJTA 1SXJC 1DAMA 4G0NA 1NL3A 4ZI3A 3I8XA 3WP0A 2QUZA 3EZ2A 5AUNB 1V5WA 4GMDA 4KI0A 3TR5A 3PCRB 1D9ZA 2XSZA 3R7WA 4NYMR 3QVUA 5FL7A 2YYZA 2BBWA 1RPZA 3JZAA 2F1JA 2XXAA 4YMSA 1XMVA 1HA3A 4DEYA 5LPNA 2WZQA 2XZPA 4HZUB 1T4GA 3I1FA 3LH5A 1RYFA 1CR0A 4EJSC 2IF2A 2HUPA 5HTKA 2QI9C 1E32A 1C4OA 1DVRA 2QBYA 4HLUA 1QDEA 2IYLD 2IYZA 4ASUA 1VTKA 4KAXA 4P4UA 1SVKA 2GEDA 2QAGB 2QP3A 2GCPA 4ZDIA 4M8NE 1CKEA 1W36C 1UM8A 2PEZA 2OCAA 4DBLC 1NP6A 1XTKA 3U7EB 3QXHA 2ZEJA 2HXYA 1G6HA 1FQKA 521PA 5CITA 3E1SA 2JJ2A 4GZLA 5FUVA 2XEXA 1Q3HA 2GJ8A 2WMNB 2BCJQ 3HP1A 4YQFA 1S3SA 3NEYA 1R0XA 4BEBA 3RDPA 4TYYA 3M4YA 4QXAA 3KUDA 1G8GA 4KYUA 1KI1A 4P32A 2O0KA 4F38A 1HY3A 2ATVA 2QT0A 3QPVA 1W4BA 5EE0A 5C4GB 2MSCB 5CDFA 1M6NA 4C0HA 2IF0A 4KVAA 2GHIA 4TMWA 1RRCA 3DL0A 1S1CA 5GJWC 4XTRA 5L3SA 1E9DA 2ZU6A 1AGRA 2G88A 1CEEA 2OXCA 5FTMA 4A0RA 4AURA 3PEWA 1LV7A 2Q9CA 4PO9A 4RFVA 4Q19A 4HB4A 1OXXK 1ZCAA 2FU5C 2ZSDA 3H4MA 2G77B 1UBFA 2CNWD 3WMGA 2JDIA 3PR1A 5JI2E 2IS1A 1R5BA 3GJ7A 4Q4JA 1W48A 4BLPA 4HUQB 2AD1A 4M1KA 2IHBA 4NU0A 4WVFA 5FBLB 1W4AA 2C2HA 3BS4A 1OH6A 1SQ5A 1FL9A 3K9GA 2OCPA 4KBGA 5GJBA 3N5CA 5EXSA 4DLXA 2GJ9A 2QRZA 1FZQA 3HPQA 3LBIA 1KK3A 4A2QA 3P26A 2ZR9A 1S8FA 1J70A 1UADA 2C95A 3X1DA 4MRSA 2XTMA 3J81k 3QF4B 2IYXA 2PL3A 2QPOA 2VHTA 3L8YA 3WHLA 3LXXA 2RAPA 3IGFA 3F0TA 4L16A 4DC9A 5CB6A 2CL6X 3MSXA 421PA 3EWAA 2XNSA 2XOKD 2J46A 1ZUHA 4G01B 1PLKA 3FHOA 1WE2A 3OEED 2OFXA 2ZE5A 1D6JA 4NDZA 2ZR7A 4MGZR 4PPQA 4PQYA 3Q5DA 3I73A 4B74A 2ZI7A 3HU2A 5EE9A 3CBQA 1E4VA 3C4JA 2DHRA 1VG1A 3EPKA 4R98A 1Z47A 3K8YA 4ITRC 4WZBE 5AUQA 2HCBA 3CO5A 2YOHA 1CR1A 2FG5A 3X1WA 3THWA 2YZ2A 4ARZA 3F5FA 4V02A 1Z5ZA 3ZD7A 2IYRA 1GVNB 1DG3A 2VP5A 3AP1A 1DO2A 2BV3A 5EUMA 1E2QA 2EVWX 1G7SA 2GXAA 3MFYA 3AP3A 3TUJC 1E9AA 4B6FA 2VA8A 4FXPA 1AJEA 4PSVA 3CH4B 1MV5A 1G19A 2WV9A 1JECA 2FX3A 3KQKA 2D7CA 4M0LA 4TLCA 4CW7A 2OLKA 3AVOA 4U02A 3PXGA 3UATA 3FMPB 1N6RA 4K8OA 5K8UA 4EKDA 2AKYA 4Q21A 4X8LA 3W5JA 2RGNC 1Z6GA 3TQFA 1UKVY 1H8EA 2QQEA 2Q0HA 4MGYR 1KDOA 5H1YA 4QOSA 3KB2A 2NQ2C 4MYHA 4EQ6A 2OV2A 2ORVA 4MKGA 1QG2A 1G4UR 1YRBA 2G0NA 2WJHA 3HR8A 4LDJA 5G3YA 5KPDA 1Y63A 4XWOA 5JRZA 3AQ4A 4OK6A 5H70A 4RJLA 4B6EA 4EFMA 1SVIA 2LWIA 2AK2A 1W2GA 1E1QD 3THXB 3AVPA 3KKPA 3QIAA 4C3ZA 2WWFA 2AN9A 5KO2A 4E22A 4I81A 5EP4A 3B5JA 1RE0A 3P4YA 2ZRDA 2GF9A 1US8A 2IYWA 2BCGY 2DY1A 2FV8A 4OK5A 1NKSA 5JJIA 1E2LA 1HURA 1VG8A 3D3QA 1J90A 1JXOA 1T0HB 2E9SA 3GJ5A 3LVQE 1W0JA 3SN6A 2CJWA 1Z2AA 2XX3A 5CLQA 4URVR 2ZRPA 1E9FA 3HYRA 2REXB 2VHQA 1NBMA 3RWMB 3W6PA 3CWZA 4QRHA 2DYKA 2VHUA 4OQFA 1VYUA 1S96A 4BZPA 4L5BA 1TUEA 4TN1A 3UK6A 3NBFA 4JL5A 1A1VA 2VF8A 2D3WA 2GJAA 1ZD9A 2OCBA 2ZIAA 3IPYA 4QNMA 2GETA 2C78A 1NSTA 3O8DA 2OLJA 2ZRKA 1SZPA 3KTAB 2V1UA 2V6IA 3VX4A 121PA 2OM2A 3LY5A 1XPRA 2F3TA 2NO1A 2R6FA 2CE2X 1ETUA 1YZNA 5ANRB 2J87A 3SJCA 3W3ZB 5JFGA 4PPGA 2R9VA 4FD2A 1Z28A 1IN5A 1T3LA 4GSYA 5CYPA 5F3WB 2O8DA 1LNZA 3WBKA 1ZNWA 1KDRA 2J7PA 4W5JA 4EPVA 2GVZC 2A5GA 2GWHA 4MUBA 3NDBB 2FSIA 2VHJA 4RD6A 1CJTC 3QXJA 5DN6A 1HT1E 3AB3A 1ZNYA 4FN5A 1TUIA 3T15A 2JLRA 2WJJA 4OI2A 3WHKA 2HF9A 2HYIC 5LB4A 3GCGA 4I99A 1E2EA 1F6BA 4W5WA 4FCVA 1NY5A 3ZQJA 5IK2D 3L0PA 3LQQA 1YRAA 2YVUA 3DKVA 1C9KA 4NYJR 4YMVA 1OB5A 4LJ4A 2A5JA 4JVMA 4URUR 1M1YE 4HYYA 3OF5A 5TV2A 3GLHB 4MITA 4EIWA 5K8IA 2DWPA 1K6MA 3VR6A 4IDOA 4D4JA 1JALA 1EFRA 4JT2A 4A2WA 1IHUA 3AM1A 1VYVA 2ZUBA 4G5SA 3B9QA 5HZHA 4MRVA 4Q1CA 1GTVA 1TEXA 2J45A 5FTLA 3IBGA 1NRJB 4TMXA 3THYA 1ZD8A 4D6PA 3SJAA 3I5YA 5E95A 2O8BA 4OQXA 3KTAA 5E3HA 1Q3TA 3VTKA 2C5LA 4GOXA 2R6DA 4ILEA 3UMRA 1OYWA 2P65A 5IT5A 1VDZA 1FNMA 1Z6TA 4LBZA 2BC9A 2XJ9A 2YV5A 1XXHE 2AHOA 3IHWA 1GKYA 1N6PA 4TL8A 1TADA 1V43A 4PAOA 4FMDB 1UDXA 1YVDA 2IXEA 3PITA 5ELXA 4NTZA 4B33A 2W0MA 4MDEA 3KX2A 2J0UA 3T34A 4A0HA 2V8OA 2EYUA 1NMXA 4TYWA 3TMKA 1Z83A 3A58B 4YLGA 4C0BA 3OEHA 3SHFA 1E94E 2WAXA 3SQWA 4M1YA 4RD2A 1R6BX 3EC2A 1FPMA 1M7HA 3FYHA 1RJ9B 1GL6A 1E79D 2PZEA 3AP2A 2GCOB 3CLVA 3BH0A 4KHZA 5EP1A 2O8EA 3X1XA 2V6JA 5EE1A 4OHVA 2BJWA 2GBLA 1JI0A 3BWDD 3I4LA 2DB3A 3KJHA 3K9HA 4BZXA 1N25A 2X2EA 2B8TA 4LBVA 4C7OB 1SHKA 2L0XA 1F5NA 2PX3A 2ZYUX 2KSQA 4FMCB 4A8JA 1KJWA 2XB2A 2QSYA 3GLHA 1OXUA 4BUJA 2WIAA 4DCNA 3MWKA 5BN5A 4LBWA 4UJ5A 3GP8A 4QBHA 2QRNA 3B9PA 3B60A 4D81A 3OIWA 4LZZA 3EAQA 4G5OA 5A5GA 5KUTA 3AKCA 2PCLA 4GOKA 1KI8A 2FNAA 5J40A 1NN0A 4FCWA 3SZRA 2ZUDA 5EXPA 4B3CA 4EPYA 1XEWY 1VHLA 1MABA 1W0KD 3OAAA 5G3ZA 4XVQA 1YU9A 2ZS8A 1GP2A 1ZD1A 5GJCA 3QY0A 2FZLA 4G1UC 4Q1AA 4AYWA 4BFVA 1NVVQ 4NHOA 2BBTA 3EWSA 2WVJA 3B13B 1ANKA 3IO5A 1X6VA 2I3BA 3OHMA 3VU9B 4OQLA 1E98A 1OT3A 1NN5A 4PHGA 2DCUA 4GRAA 1P2TA 3OIVA 2IT1A 3TQCA 3FE2A 4V0MA 4A0GA 4Z8YA 1SVOA 1P61B 2QEQA 4XVUA 1RC8A 1FFHA 2PZGA 2OUKA 2GCOA 4CDGA 2F43B 4CEJB 1H8HD 2ZRLA 5AUOB 2O0HA 4BRWA 4F7WA 3A1SA 1KGDA 2ODEA 2UZIR 4JLBA 4YXWA 3GFTA 4Q7KA 1FQJA 1E2NA 4BLTA 1F2TB 4U5XA 4XSHA 5HE9A 3HDTA 1OKKD 3JZMA 3TH5A 3BXZA 1HQCA 1BO6A 2CHVA 3QPUA 4MQBA 2AFIE 2IBMA 4DKXA 3DZDA 2B7BA 1VMAA 1A82A 4HATA 4JLAA 3RWOA 2ORIA 4URWR 4QHYA 3B2EA 5UKDA 1OXSC 2IK8A 5CJPA 1TF7A 3NBXX 4AK9A 4P3YA 1JQJC 3T35A 3KZ1E 1T5IA 5KSYA 1X1SA 4TT3A 4RCZA 4US2R 5KOYA 3A1UA 1L4UA 4PAMA 1KOFA 4TQAA 1FOEB 2ZSAA 4H1VA 3A6PC 2VEDA 4DUGA 4B3FX 1S0UA 1VCMA 3QG5A 4OHXA 4A82A 4JT4A 1OXTA 1I4TD 2ZANA 1E0AA 1II0A 3QKSA 3KXLA 4JBXA 1CBUA 4ZI2A 1QZXA 4PSAA 4D4MA 5D3QA 4DDWA 2VSXA 2HLDD 4S35A 1IY1A 1SKQA 3QENA 2WJYA 3ADCA 1CJUC 2G6BA 5A0FA 1XPOA 1EWRA 5GVRA 1GG2A 1T6NA 3AF4A 3KKMA 3SS8A 4TMTA 2ZI3A 4I4LA 3D7MA 3DM5A 1JR3D 3NVAA 1MT0A 4MH0R 2CK3A 2ODNA 1CXZA 2RGBA 4MKFA 4NCKA 2VH5R 2PJRA 1OJLA 1XB2A 1VECA 4E07A 2EWVA 1WBBA 2BVNA 3SR0A 2X2FA 2VRWA 4WA7A 1CRQA 2OBNA 4LRWA 3VR5A 3EPLA 1MO3A 2NIPA 3FMOB 2FSFA 5KSOA 2CVHA 5A4JA 1CU1A 2VP9A 4M1OA 5C1BA 3ZYCA 2JLUA 2JJ1A 2PEYA 3K09A 2TMKA 1UKEA 2WKQA 4JSTA 4BFZA 3O8RA 3P4XA 2QP9X 3CNOA 1IY2A 4PC3A 4KFTA 4ZCMA 4TLDA 4Z1MD 1N0UA 1OH7A 4QGHA 4XD7D 5F9HA 1IJFA 2F7SA 4MRPA 5CK4A 3UXMA 3CZPA 3LQRA 2FN4A 3AVWA 1VPLA 3GFPA 1PUIA 2ZRAA 5EZ5A 5GVSA 2YC4C 1II8A 3RNLA 1R4AA 4RZ2A 3K70B 3AF0A 3D6TB 2IS4A 2DBYA 2QG6A 3VR3A 2WAYA 5BQ5A 5SZKB 3B1WA 5FI1B 2IYVA 3B85A 5SZJA 2RGAA 4Q1EA 4Q66C 2Q21A 2ZRCA 1U9IA 4R71A 1KKMA 1KAOA 4TYQA 5K8TA 1NN1A 2H17A 3IDQA 3NTUA 2BM1A 5SZHB 1ZIPA 2IS2A 3EG5A 4MGKR 1XBTA 4BFXA 3FMIA 4JLPA 1SXJA 4MKHA 5J4LA 5KSPA 4DDVA 4KVGA 3LD9A 2D2EA 4IDHA 4KFRA 1YZLA 3K0CC 5FFMA 1ZAKA 4IOKA 1ZINA 1W5TA 3PV0A 2H18A 3QNUA 4HLQB 4MRRA 1L7VC 4HEJA 3DDCA 3TVDA 2GRJA 3BH6A 3CPEA 4NCNA 2G9NA 2MMGA 3U3MA 4CIDA 1ZRHA 4JVNA 3U3JA 2QGNA 3B78A 2QGZA 5FBVB 2BIFA 2H92A 4G3XA 3R7WB 1KK0A 4GZMA 2R6GA 4EJSA 1XTRA 2IW3A 2WJVA 2XXAB 5J4HA 1JQLB 2D74A 2EW1A 1ZNXA 2IYUA 2ZREA 1KKLA 3GFOA 1P73A 2QPAA 4LYFA 3W9YA 2PZFA 2BJVA 2JDID 3ZDQA 4E09A 1XD2A 3LW7A 1N5LA 3I32A 1SKYE 3CNNA 3MWJA 4XH9B 2CL0X 1D8TA 5K8LA 4ABYA 1EFHA 1FMLA 4JVLA 2A5YB 3RRMA 3ADBA 8OHMA 3V4FA 3CH5A 5KDLA 5LD2B 4OL0A 3KL4A 3RS7A 3L0SA 4POAA 2ZRHA 5CM9C 2QNRA 1S2MA 3EZFA 1MKYA 4PFSA 4LBYA 5C4MA 5L3VA 1FTNA 3RC8A 4KJZA 3ZZUA 3TAUA 5FUYA 4Q9HA 5TVKA 2V4ZA 4JLJA 5D3MA 2LCFA 2A9KA 1QHXA 1AZSC 3I72A 4O0MA 4AWXA 1LVGA 1Z6AA 3M1IA 3QXSA 2N46A 2WWHA 4LSGA 5FBRB 3QUSA 3SBDA 4CT4B 1W7AA 3UIEA 3AVXA 1GOTA 3U44A 3EW9A 5DO9A 3BB1A 4EPRA 1EESA 4PC2A 4TTPA 1F3OA 1EX7A 5JI3E 4F4JA 3EA0A 4U00A 4MYCA 1XJQA 5L3SB 2PT5A 2P5SA 3NEJA 4M21A 2ZM5A 4A36A 2PCJA 2IYYA 3MJHA 2W83A 4G5QA 1Q0UA 1R8SA 4O3MA 1IOZA 1U94A 2PJZA 3BFVA 3W8NA 2G3YA 1ZUNB 1E96A 4BWYA 3OIUA 2OG2A 4LOAA 3CWQA 3RLFA 3VR4A 3NC0C 4XVRA 2C9YA 2NOAA 3U6BA 1IJEA 4QGAA 3SDZA 1KNXA 1F60A 1N6OA 4Q4JB 1OLOA 3CPJB 4FMDF 1OIXA 5DYGA 2J1LA 3LLUA 4YC7A 2QT1A 1YR7A 4RVCA 3NHAA 1VCNA 5DIFA 3NBYC 5JWRA 1U0LA 1BYIA 1Q12A 1XD9A 3KKNA 2WSMA 3F3YA 1OH8A 4W5HA 2CLSA 4GI7A 2GEUA 3QQ5A 1E0JA 4UXHA 3FWYA 2CEAA 2VSOA 2X8AA 1FW6A 4ERNA 2CMKA 1PUJA 3FPAA 4TL6A 3TW8B 3BAFA 4AKEA 2EFGA 3X2SA 1NKTA 1DARA 2AL7A 1OFTA 1IN6A 2ERXA 4DLZA 4UNSA 4B48A 2VO1A 5DHFA 4FMCF 2J3EA 5CIWA 5JS8A 4PANA 2C8VA 2YOGA 1NN3A 4TWZA 3CRVA 3WYAA 5IRCD 1N6IA 2C04A 3HPRA 2JASA 1MO6A 1P75A 2OCYC 2BMDA 2OE2A 1XXHA 4DDTA 4EFNA 1WBDA 1Z8FA 4BASA 2JAQA 4QL3A 5EP2A 3P1JA 2ZUCA 3THWB 3LNCA 4FIDA 4ARZB 3GJ8A 5HKKA 5CJ2A 1ESNA 2A5FA 1IBRA 1W0JD 4EAQA 3DZ8A 4PC1A 4D0LB 1AZTA 3B1VA 1DAHA 1A2BA 1QHHA 2JIZA 2R8RA 5KDOA 2LKCA 1QHIA 2H7VA 2GK6A 5CYOA 3OESA 1G291 3CM0A 4NMMA 2YWFA 3BRWD 2RGNA 1KYIA 1NLFA 1T8UA 4M9SA 3G5UA 2MMCA 1E9BA 2H57A 4GP6A 2FSHA 3C14C 4GT1A 2ZI9A 1JJVA 1E9EA 3RHFA 2Q9BA 2NO9A 3A4NA 1G4AE 1NVVR 2WWXA 3SEAA 3ZS8A 1JR6A 1J8MF 3VR2A 1LS6A 2WPDD 2FEMA 1Z3IX 3QG1A 5FTKA 4PO8A 2Q6TA 4TL9A 3AVQA 4JLDA 3DVLA 4Q1FA 3LV8A 1GRQA 4M1WA 4UQOA 4EQ6B 2I1VB 2IXGA 3W5IA 3IKJA 2HT6A 5KHOC 4JSYA 3M6AA 1BS1A 1G6OA 1QHYA 2J7KA 4DSOA 2RGXA 2BMFA 2ZJYA 1IY0A 1AN0A 4HLCA 1W4RA 2P0EA 2ZE7A 4RFSA 4C0LA 3DKPA 5TDHA 2IS6A 1KMQA 4JJKA 1YZUA 621PA 3DEFA 1RRGA 4OK3A 4A4DA 3SJBA 4QJ3A 5KU1A 1US8B 1GKIA 2IYQA 3Q3JB 3BB3A 1XPUA 3EPHA 4A92A 5HCIA 4F4CA 1G20E 1E0KA 4DSTA 3GLGA 5B64A 5JCPA 3ZJYA 4BFUA 2EFEB 4JJZA 4ZIRB 2WHXA 1RZ3A 5DGXA 4C0QC 2EQBA 1RFLA 2CJWB 3LRPA 4G5GA 1VKJA 3DO6A 2VSFA 5DI3A 2XAUA 1CF4A 3Q8XB 3EX7C 1M8PA 1ODFA 2R2AA 3C41J 3RS4A 5AR1A 2CXXA 2IEYA 2ZYWX 3TR0A 4OHWA 4LHYA 4XIGS 4RZUA 5LBIA 2UKDA 5TARA 3KQUA 5FR1A 4LPKA 3V00A 3TGPA 1W4CA 3GQBA 4H1UA 3U3KA 2F1IA 1G21E 3R9IA 4V0OA 1E2KA 5L3QA 1N6HA 1XJ0A 1Z6XA 3Q7PA 2R44A 1QBKC 4I1OA 1TQDA 4N0DA 3DOFA 3WYGA 5JZVA 2WMOB 4FWTA 4B47A 2H1LA 3ND9A 1GNRA 1UEIA 5JEDA 4PAQA 2O8DB 2YINC 1AS0A 3OEHD 5EJEA 4TYPA 3JVUA 3UKDA 1XTSA 1ZU5A 2VPPA 4BRUA 4M1TA 4LJ9A 1BMFD 2P67A 2GXSA 1U99A 2QAGC 2QA5A 1GM5A 5JWHA 5DSZA 2ZI4A 3N2IA 3VHLB 4ESVA 1NNEA 4H9GA 4A2PA 1GITA 4MUAA 2BKEA 3AF2A 3D31A 3IO3A 3IIMA 3AKDA 1G3UA 2ASEA 4OKSA 1KO8A 1AIPA 2F3RA 1EXMA 1E2IA 2AD5A 2Z83A 4KSBA 3MUFA 4CZ2A 2XB4A 3K9NA 2NZ8A 4ZIRA 4QHTA 1E6CA 3KKQA 2WTUA 1P6XA 1T91A 2N42A 3PEVA 4TYNA 2JLSA 2CCJA 3W8RA 5FPYA 1KK2A 3WMEA 1N5KA 1T3SA 4BEJA 4W9MC 1XNJA 3ZIAD 3FGNA 2YOFA 2D4HA 2C03A 2JATA 4C0KA 3EIQA 2O52A 3TE6A 3TVTA 1I4LD 4BE7B 4OI0A 2CCGA 4IW3B 1LY1A 3LX5A 4IOLA 2ZRGA 2ZVPX 4QKQA 3THYB 2QMOA 5AJYA 5H68A 2O8BB 4DT1A 1YR6A 2CNWA 1G16A 2WIBA 5FPKA 3R9WA 3QKRA 1LFDB 3EIEA 1JR3E 3VFDA 4JYBA 5SZIA 3TUIC 1UEJA 4IFEA 5J4VA 3B8HA 1XU4A 3F8TA 1U81A 3PUYA 1DEKA 1HYQA 4FW9A 5HR5A 5AJZA 2X1VA 3U3OA 2FPKA 4K81B 2QORA 1JPJA 4AYXA 2J0UB 2VIIA 2EFHB 4ON9A 2FMXA 3L2OB 1DOAA 1ZU4A 3A36A 5H8WA 2ZYVX 1NY6A 1KSJA 2DFTA 2W6ID 3FKSD 1GFIA 1ZUIA 1E1RD 1O87A 4Q47A 3TAHA 3KJGA 2ZS9A 5FTJA 1DE0A 2DR3A 2JGNA 4QBFA 2O8EB 1IXRC 4D25A 4Q7MB 5FI0B 4YXWD 3OFND 1XEXA 5TXGA 5EXXA 4JLVA 2ZJ5A 4RD1A 4WBSA 3CX6A 1NMYA 1WXQA 4NCJA 3L43A 4M22A 5LB2A 1QG4A 2HXSA 3B6EA 3ADDA 2ZRMA 2WOJA 2GTPA 2X77A 1XZPA 2ZSBA 4NE2A 3OEEA 1X86B 4A8JB 2P6RA 1SVWA 4LV8B 4DCUA 1D2EA 1Z0IA 2VYFA 4L4UA 2KI5A 2NO7A 1G8PA 2J41A 4DCSA 2A30A 4KITB 1CR2A 1AM4D 1KDTA 2ZJ8A 4HAUA 3V9PA 1J7KA 1L4YA 3DMNA 1G8YA 1T3HA 2GXQA 2QTHA 4QGGA 5FPSA 3FKQA 4BFSA 1Z07A 5FPHA 3ZD6A 1F2UA 3K0AB 4OQNA 1UDWA 4D0NA 4P4SA 2ZTSA 1Q44A 3GEIA 1MABB 3GLIA 4IDPA 3RANA 3PJRA 4HB3A 1KI7A 3G82C 4EPWA 1E4YA 1GRNA 2HJVA 4UKDA 3W90A 4W7SA 2V54A 4OJQA 3EC1A 4IFBA 1G18A 3TW4A 4B3DA 1E2PA 1OYYA 1NLZA 4E5UA 5CDFE 5M04A 4U7DA 5E7MA 2QPTA 1DAKA 2W6JD 3BORA 4CGZA 2P2LA 2AXNA 3EZ6A 3T12A 3K0FA 1UJ2A 1XCMA 2ZI6A 4NP6A 2FJUA 2QM7A 1XMSA 5BN3A 2C98A 5FUWA 4DCTA 4CEHA 1Y3AA 2QSZA 3WRXC 1OXVA 3GLFA 1TTTA 3A37A 5JJLA 3GEEA 2W0SA 4PC7A 1TAGA 4B35A 1CP2A 2JJ8A 2FZ4A 3R8FA 4GNKA 5DLQC 4HAYA 4OQMA 1W46A 3TKLA 1BKDR 2ODWA 3KXIA 2C99A 2WBLC 2CHGA 2QTVB 2Z43A 2ZJAA 3OE7D 2HDNB 1E3MA 3ICQB 2RCNA 4DLRA 2QE7D 5EUQB 2ZETA 3O8BA 2D62A 3AVYA 2ZSEA 2A5DA 2GAOA 3BC1A 5JHHB 1NLYA 2EFCB 1UAAA 2Q3FA 3FMFA 1ZVQA 1MH1A 1ZCBA 3K0EA 1YR9A 5JBQA 3WP1B 3K0AA 4UXIA 3BE4A 4GPTA 3T06B 3U4QA 1DS6A 1W5SA 2DWQA 4A6XA 3I61A 3K1JA 3QKSB 4TMVA 3ZVRA 3OZXA 4R9UC 4LJ7A 4B75A 2HCJB 2Y8EA 1P5ZB 1OW3B 1RRPA 3CW2A 4FINA 4AG5A 1XRJA 3WNDA 2AK3A 2CBZA 2OAQ1 1XJCA 1Z63A 2ZI5A 2B8WA 2R6AA 3T5GA 4KLZA 2CE7A 5JSZA 3PFIA 1NI3A 3CR7A 4O2LA 1XEWX 4LK2A 4TSFD 3LW8A 1L8QA 2F6RA 2Z5FA 2XTZA 2YWGA 3ASYA 3BBPA 4Q4AB 4LWZA 1OSNA 3WMFA 2D7DA 3BJIC 3QF7A 1Z0JA 1DTSA 1OHHD 3LFUA 4HDQB 2IXFA 3VQTA 3ND8A 2KBFA 2GZHA 1COWD 4BLSA 3HU3A 1KSGA 3AH8A 1UKYA 2J0VA 2SHKA 3G0HA 1J8YF 3BFKA 2Z4SA 3E2IA 4B2LA 2NGRA 4Q4LA 2E87A 4JL6A 4US1R 1E2FA 2PMDA 1YZTA 1XEFA 3CF6R 1G5RA 1ZP6A 2WSSD 5J4KA 2QTFA 1KI3A 1R0WA 1R0ZA 2JCSA 2ZJ2A 4NZYA 2R62A 3NC1C 2CDNA 4TMKA 1S4QA 2DFNA 3DM9B 1PV4A 5B58C 1AKEA 1BYUA 2BM0A 2WICA 5IK2A 3W6OA 2J9RA 4FWIB 4TZ0A 1W1WA 3Q5EA 4B73A 1UKZA 2B6HA 5L3RA 1CJKC 2FDCA 3MWLA 1YHNA 1MOZA 5BYKA 1EFTA 3AGPA 1II8B 2O0JA 1IN8A 3K70D 3GJ4A 4TLBA 3IBYA 4J0QA 3NBZC 2IL1A 1G41A 1NVWQ 3VKGA 2ZAMA 5HE8A 2V7QD 5F2EA 1WP9A 3EARA 3T61A 1IXZA 2WM9B 1YZKA 2GZAA 2VQSA 3M0EA 3Q85A 3K0CA 4II7A 5GJVC 6Q21A 1GAJA 4HAZA 4QBIA 1P2SA 5KTYA 4B44A 4Q4AA 4M9ZA 1SXJB 3UWKA 1GL7A 2ZVQX 1I2DA 4CVNA 1ZC3A 1G3MA 1NF3A 1NJGA 4X8HA 1MRNA 1WCV1 2OHFA 1UBEA 1KHTA 3SBEA 4TMZA 5BXQC 2XZOA 3W3AA 3RRNA 4DDUA 3RS5A 2WJIA 4GBMA 4LX0A 1SHZA 3PEYA 4BZQA 3AF3A 2EFDB 2ATXA 1ZM7A 2XSZD 3QKTA 4OHYA 1VG9B 5FL7D 3OIYA 1AS3A 1NBME 1PJRA 4NYIQ 1E79A 4DVGA 1WDTA 4TLEA 4EJSB 2VBCA 1DBSA 1SVSA 4PTLA 3RABA 2DWOA 2FEOA 2PLFA 1KO4A 4BGDA 1M74A 4KU4A 4PR0A 1XD2B 2FPMA 2RB4A 1GNPA 2FE4A 4A15A 1YE8A 2VP2A 4IDQA 5DYIA 3I5XA 5TMPA 4NCIA 2RGGA 1TQ4A 2WOOA 4ZKDA 3K0SA 4AD8A 1W36B 3B1XA 2QU8A 4ASUD 5FOWA 3S1AA 1JB1A 1U0JA 2JLVA 3U3RA 3IEVA 4K46A 2XGJA 3CKLA 5JJKA 1XCGB 2OT3B 2NG1A 1G8FA 4IRUB 221PA 4KYIB 1P3JA 4C2UA 3PVSA 4IXNA 4DXAA 1GDDA 3NH6A 3MD0A 3Q9LA 3RAPR 1FNNA 3TUZC 2VP0A 4XOIA 1A2KC 4LI0A 2JJ2D 1XCPA 2GJSA 3QPWA 5EZ6B 3DOEA 3CR8A 2AXPA 3SE0A 1AK2A 3RS0A 2W00A 5D3MB 3UANA 3QKUA 4JLNA 4Q4HA 4PPNA 2KB0A 3E70C 5JECA 4PHHA 5KDDA 5KNDA 5F9FA 2V9PA 3IQWA 2QL6A 4EUNA 1GZSA 3U44B 1JAHA 4R2HA 5JWOA 1N5IA 4DSUA 1MRSA 4XJXA 2QAJA 1KI9A 3TSOA 3UMSA 3U61B 1JJ7A 1XDBA 1YR8A 4HAVA 4P4TA 4PQRA 3VX3A 3LX8A 1P2UA 3EXAA 1R7RA 1OIWA 5DHAA 1U2RA 2F1HA 2IHYA 2KJQA 4JS0A 4E03A 1G5PA 3VMFA 3BH7A 3WYFA 1H8HA 4QG7A 3IIJA 4NBSA 2FFAA 1XD8A 1FUUA 1EK0A 5HKKD 3IEUA 4B2IA 2BWJA 1FUKA 1EX6A 1GWNA 1Z08A 1I2MA 3FB4A 1I4DD 2PMKA 2P6NA 3LBNA 1DAGA 2AWNA 3C5CA 4XWKA 3RSLA 1CJVC 3C8UA 1R2QA 1BOFA 3BGWA 4LYJA 2KWIA 4MYTA 4YONB 4RZXA 4DCVA 3GPLA 1W47A 1DO0A 2HF8A 1F48A 3ZVMA 4XSGA 4DLWA 3GMTA 4GOJA 2ZJOA 5IF9A 2P3SA 1VIYA 2GF0A 4L15A 2ZQ5A 3CRMA 1OF1A 2DFLA 3CX8A 2FFQA 2JLXA 3LWNA 1TNDA 1YZGA 2GZDA 4WXRA 2ONKA 3T1VA 5FOSA 3IQXA 1E9CA 4Q7LA 1G9XA 2B92A 4Y0VA 2H5EA 3WY9A 2RKOA 1Z06A 2GCNA 2FA9A 5JMTA 2GKSA 1B23P 4C0SA 4LC1A 2BBSA 4Q9KA 5JCZA 4QGFA 1OFUX 3QEOA 3KQLA 1Q1QA 1ZM3A 1SVMA 2HLDA 2C96A 3GJ3A 1N6KA 1QVRA 2BHRA 4WZAE 4B3XA 4LJYA 4LV5B 5CB8A 3SHWA 1PVOA 1EFCA 1MR3F 4CF7A 1XZQA 1JR3A 3GLHE 3ETLA 1XXHB 3EASA 4UNRA 3EZ7A 4JYCA 4AG6A 2XNDA 2W58A 4F4IA 1Z29A 1KNQA 1G1MA 1KO7A 1KO1A 3FDIA 4B3BA 2QN6A 3CIOA 1KSFX 1KMHA 1GNQA 3A4LA 5JEEA 5AK0A 2D06A 4WIAA 2OZEA 1QHHB 4HI0E 2ZYTX 1QF9A 3CRRA 4CRWB 4YMUA 5C46F 4KCGA 1ESMA 1D5CA 4R7ZA 2NO0A 2FH5B 4WOPA 3N2EA 1TEVA 4Q1DA 1WA5A 2IUSA 1D9XA 1T5LA 5HPYB 4M53A 1N6NA 2LKDA 2RGDA 4Z1MA 1R10A 1P72A 3I8SA 4N1AA 4Q02A 1RVDA 3P27A 4XD7A 1CS4C 1GSIA 1H8ED 4S2EA 4V0ME 4KSCA 2K5UA 1U8AA 2YWEA 4I1SA 2DFKB 4QBGB 2WWYA 3GEHA 4KFSA 1ZIOA 2JLWA 4ZO4A 1CULC 4O25A 2ZRNA 5KNCA 4AKIA 4WZ6A 4UNQA 1RW4A 1G3QA 1ZC4A 2AFHE 1N2CE 3L0IB 3TJZA 5EXTA 3UG7A 2HJGA 4RKEA 4RFSB 5E7IA 5J5CA 5CLLA 2ZRFA 4D82A 4JLOA 1LF5A 2A2ZA 4PQFA 1WB9A 1C1YA 1JEEA 3K70C 1UPTA 3PEUA 5FUXA 4Q5IA 1E0SA 3ZS9A 2FGKA 4M9QA 4RZ3A 4YMTA 3KUCA 1CRPA 4L8GA 1XTQA 1QHNA 3EPJA 2OXRA 2A3RA 3GLGB 5B2ZA 1U8ZA 1YKSA 3BD9A 4CT5A 1FP7A 1DAIA 5BN4A 1UBGA 4D4LA 4G5RA 1EFUA 1WQ1R 3U7FB 1QRAA 3O8CA 4KXFB 1NBMD 1OE0A 1FX0B 1Z0AA 1ZNZA 2VTKA 5DI3B 4BECA 2ONJA 4V0KA 4IOJA 4V0NA 4QC2A 4DEXA 3ZZTA 1RYHA 2ZROA 4GL2A 4HDCA 1HT2E 3BK7A 4UXJA 1M7GA 1CIPA 3PENA 3LVRE 3MMPA 4HUTA 4TQ9A 3A8TA 3BFXA 3BB4A 4ZKEA 1UF9A 1PLJA 3W6NA 4HZUA 1Z0DA 5DE3A 5CK5A 3GJ0A 5L3QB 3U7HB 1DG1G 3SJZA 5C2JB 3SQXA 5AJWA 3UWOA 3THOA 3WRYC 2BKUA 3QJYA 2QAGA 2JLZA 1ZJ6A 2CVFA 4MGIR 2N1BA 1OPXA 2J7PD 5IHPA 1S1MA 4HLUC 4AI6A 3NXSA 2IC5A 1K8RA 2GDJA 4M2LA 4DLTA 3U7GA 5DN6D 4Y0AA 2FSGA 2IUTA 1EWQA 5LD2C 2WWIA 2IA5A 3KQNA 3PUZA 1VG0B 3GD7A 3W34A 4C2TA 1R5OA 4QM7A 1G3IA 1KJYA 2R65A 1OV4A 3SFZA 4DLUA 1S9HA 2ZITA 4GP7A 2W2VA 2GK7A 4FI3C 4IKEA 5DISB 3TRFA 4Z8XA 3CB4A 4HDOB 1HUQA 4RD4A 1QHGA 3REGA 2FGJA 3IHLA 4RY2A 4ZV4A 2HEIA 1E2MA 5FBQB 4DRZA 4BFWA 4B43A 5F98A 2AR7A 4QFMA 2C9CA 1IN4A 1Q20A 2WJGA 1TQ2A 3WNBA 1EFRD 1FX0A 3C16C 4PZZA 5IDVA 3I62A 3AF1A 821PA 1K5GA 1T8TA 4JKYA 5KSZA 4IXMA 3AKYA 3AUYA 3B7GA 4DZZA 4LCBA 1SVLA 3WBJA 1E2HA 2FFHA 1ZW6A 1MO4A 5FOVA 4ACAA 3HU1A 2PT7A 4DT1B 1SGWA 5CIQA 2ZRIA 3U5ZB 1IM2A 3KQHA 1TF5A
chains in the Genus database with same CATH superfamily
5EKXA 3WK9A 2E4WA 2VPQA 1DKOA 1XRSB 3JQDA 2H63A 4R9VA 3QUBA 1GPBA 5SYMA 4JB2A 1ZM2A 1SXJE 1MO5A 2HTEA 2P2ZA 1OR8A 1JEQA 1WMSA 3A1CA 4NPHA 3RAEC 4MA4A 4WINA 4KQ1A 4LYDA 3HGMA 1RBYA 2GTIA 2RHMA 3ADPA 3TD9A 1I14A 1OI3A 3H1PA 4FHFA 1N2EA 3W7AA 4F56A 1EX9A 3ULKA 3UW3A 3O92A 3QKIA 1SY7A 3L77A 3SQMA 1OLSB 3TNFA 3A7DA 1Q1EA 4GXNA 1J49A 3WX0A 3R9XA 3JQGB 4FR0A 3NWJA 1N2ZA 2QQ0A 3QF4A 5LQAA 2J5BA 2NZJA 3KSMA 3SVTA 4JOCA 3B70A 4O4JF 4ZEXA 1D2NA 4IV0A 1WP4A 3ZX4A 1XMJA 4DLVA 2K4MA 4ZDWA 5A04A 3WL6A 2IUYA 5JH7B 2YMQA 1H9BA 4E5MA 5AJVB 1G8SA 2NTYC 3EDRA 3TZKA 1OZFA 1FP4A 1NW4A 3IRVA 3MPUA 3V4SA 4NYIR 1IXSB 4BQEA 3S7ZA 4KGZA 2MTBA 1A5TA 2NUBA 2ZXUA 4EHNA 4KREA 1X42A 2NM0A 4H16A 1W1UA 5JR3A 2PH1A 4ETIA 4R0NA 3N70A 5DHQA 3S68A 1PBNA 2FN9A 3H05A 2RHCA 1TU4A 2GNPA 5CJJA 4YT8A 5JH7F 3JQFC 4QDUA 4FFPA 3QSYA 3ZIUA 1SOMA 1ZYUA 2QY9A 1V4VA 3AJ8A 4LJ6A 4YJDA 1N5JA 5F7ZA 1MOSA 4N3NA 5B37A 5LZ8A 4JEUA 2VBFA 3OT5A 1XL1A 2FWJA 5F51A 2W6ZA 1E2JA 3KQTA 5EE3A 3NPMA 5DF1A 1JSRA 1WOMA 3ZGXA 3OAAD 3ZJ5A 2DMRA 2CVOA 3CO0S 3QOYA 1LPOA 1AO3A 4I9FA 3UAGA 3VNUA 1BW9A 1QZZA 2C2OA 3AR8A 4PC6A 1WB6A 3KHSA 1EP3B 2HCRA 4F5EA 2H7XA 5TQ0B 5B7QA 1GT6A 4OV6B 1WV1A 4RJIA 4YV0A 1L3BA 1AV7A 2PLRA 2F8LA 3EY4A 4RSGA 2IYTA 1JMVA 4IMJB 3LKDA 3O47A 1CG6A 2IE8A 4CYMA 3RK1A 4J8PA 4MVJH 1DKNA 2Q6LA 2FWNA 2QYHA 4G23A 2ZCJA 3E9ZA 3HLKA 2B8EA 4M0CA 1X92A 4UATA 5T67A 3X3HA 3K0FB 1A71A 4WUVA 4Z54A 1N6LA 5CNMA 3DR5A 3N0TA 2O2EA 2GZ3A 1U0OC 2RJ3A 3KR0A 4UCWA 2H16A 3HLTA 1OX6A 2PWBA 4HGRA 2FETA 4PCUA 1NX6A 2WJAA 4OP2A 2QUBA 1H4QA 2VHWA 4GMFA 4X7PA 4BC1A 3IE1A 1G5TA 2C2MA 3Q2IA 3TSWA 4IDNA 1FVFA 1KETA 3IE2A 3WAJA 3AVUA 1H22A 3R3XA 3RVDA 1C7QA 4OI1A 2OUIA 2H1VA 1GPYA 1RIFA 2ZRJA 3CGWA 1G3RA 7ADHA 1J25A 1XZFA 4V0LA 3TR6A 3H6GA 4EL5A 1TQ6A 1YE3A 1ZD5A 2HMWA 4IJ6A 4PVDA 5JVDA 2D8AA 2OMEA 1AA9A 3RYHA 1EM8A 2CL7X 3RRFA 3SS9X 2RHTA 3AKEA 3Q72A 1QQ5A 2Q3EA 4JJIA 4GR4A 4KUEA 3VHXA 2Q3BA 1IMJA 1AX9A 4G4GA 4LISA 4NKRA 4DPKA 1E1DA 3OF2A 3WWEA 2HCTA 1KIAA 3ZLJA 4KGXA 3QX7A 4WXEA 2VNAA 1YVUA 5HQJA 3WYBA 4JKIA 1GFZA 3P96A 4X9XA 3TLJA 3ZN2A 4LPSA 4XM2A 2VATA 5EYPB 3U4QB 1DIBA 1JQEA 4O4HA 2CVPA 4HNUA 1SOVA 1U1CA 3VI3B 4DMUB 1KIMA 1YJXA 3GBPA 1FRQA 4ZU1X 1WPXA 2J59A 3ZDEA 3H0KA 2UUOA 1H0KA 3F73A 3H9JA 4DDKA 1U8XX 2DEUA 2OHOA 2HU2A 4ZVNA 2QZJA 1Z7YA 4CKYA 3G2PA 2XDWA 3M70A 2O7VA 3HR7A 1DAEA 4E94A 1MDBA 2QJTA 1JQBA 1CQJB 2AQHA 2BH9A 2NN3C 3HCDA 4IO1A 4UOEA 2XKBA 2XRZA 3QMMA 1IK4A 1BXRB 1C9DB 5TY0A 3HCEA 1UAGA 1PV1A 3FUTA 4RV5A 3TXYA 3AETA 1Z2EA 1OA1A 4MTCA 4CCSA 5BPHA 2YJ5A 3N2GB 3MINB 4RADA 4XGRA 1P60A 2Z3WA 3FNFA 5CR9A 3UKOA 1YL7A 1GQRA 2AOTA 2C84A 3P9QA 3ZHXA 5I3ZA 1T43A 3AR5A 5FLXA 3AXTA 3F97A 3PUXA 2QTZA 3TZQA 2PBRA 5B12A 3AUTA 2HJRA 1GQSA 2Y1OA 3CRW1 1L5LA 3H75A 4CLRB 1VLQA 3PTZA 4BVFA 1FMJA 2E2WA 3REQB 1OROA 1CE8A 4R8SA 2V1XA 5F73A 2FQXA 3HB0A 4QARA 3S2SA 2KMLA 3DLAA 4JLMA 3VVBA 5L8VA 3WGYA 4JLKA 5EJMA 2IEGA 4M60A 5TGDA 4CL2A 3ASVA 2XTJA 1J24A 4KTVE 4M46A 4MR7B 3U5TA 2HWWA 2F8TA 1SAYA 3UTDA 3N28A 4KKVA 5J5VA 1NQWA 4KODA 3CUSA 4YDRA 4BNGA 5E38A 1CLEA 1MEJA 1S7CA 2EZ4A 3EGDB 2Y0PA 1K2VN 5AOAA 3AR4A 5EP3A 3EQ7A 5KAPA 5THKA 1Q7RA 2E21A 4DABA 1JQ3A 2WF8A 3N7UA 3BJZA 4N3CA 5EL0A 3CW8X 4JI5B 1TEZA 3Q4GA 2HIAA 4IH9A 1KWGA 1HTWA 1DCMA 1QM5A 1YD7A 1GN9A 3G0GA 2FFBA 4O2BB 1Z7GA 1V7CA 2B36A 2YMLA 4WJKB 4UMEA 1GQFA 4P0TA 4QE3A 3EHDA 3H1GA 4G0MA 5AJXA 4CQMD 3EXFB 4UZFA 4BO4A 3N6XA 2FUKA 1SHJA 3MTBA 3HNOA 3V8RA 3NJRA 3W4KA 2J67A 1X0XA 1KEZA 4FQ5A 3M6IA 5K6AA 2BGRA 2D2FA 2DUJA 2QM8A 1AGPA 3KVVA 4HSEA 2ZIXA 1E69A 4PBRA 4RA6A 2ZVDA 3Q7QA 3MOSA 4ND8A 2GD2A 3BGSA 5B7NA 5GOZA 2FFJA 2YIMA 2X41A 4FMBB 1JPVA 2BMVA 2GRAA 4P2BA 5A05A 3AVVA 1W2HA 3TVYA 3OP1A 4TKUB 4O4LF 1L7NA 1I6MA 2O50A 4E11A 3V1UA 4KZPA 2IYNA 3ED5A 4P5PA 1ILWA 5F9MA 5FOUA 2FPRA 4ZYXA 5LJLA 1TA4A 3SEZA 1N2SA 3ICEA 2XZLA 1U0RA 3SYLA 1BQEA 4LYEA 5AUPB 2NXJA 3WIBA 4GH5A 4BKMA 3JATB 1YBFA 1QANA 4PVCA 1RQ7A 1YB2A 2GFQA 4NBKA 4FT4A 5CFZA 2IYSA 4PHCA 5ALIA 4N0MA 1Y5NA 4PSUA 1V5FA 2BDTA 2D54A 3FKSA 4QQNA 5AT1A 2NU8B 2CMDA 2Z2IA 2D2XA 3MAAC 5AI0A 2ZIUB 3FCXA 3P20A 5FOQA 4RNDB 4S04A 2NPFA 1HEIA 5IF3A 1BGVA 3K4HA 5FWYB 1ECJA 2OFPA 1O95A 3OFNA 4QM6A 2D2IA 2UYHA 4H4DA 4KFUA 4NLLA 2W2TA 3GP5A 5AW0A 3H2YA 4AUNA 3HYLA 2G5TA 1Z4PX 3GT4A 1JEYB 4C7OA 1J07A 5DP1A 3GYBA 2ZP1A 2AQIA 3DMDA 3U4IA 1L3CA 2B7CA 5C4IA 5DKFA 4QOHA 4BTEA 4KQIA 4XE5A 3AKZA 3CLUC 2E0IA 2I1LA 2P6UA 1FJ2A 1VSVA 2XWBF 3ZH9B 4OXKA 1JXMA 1U5CA 4LJAA 4BJ3A 4Q03A 2RGEA 4L9SA 4PG6A 2JJQA 3PYLA 4G26A 4DADA 4IAOA 2CF5A 3LQ2A 5I9TA 1QPGA 1T10A 1KSHA 1BU8A 2PY6A 3VO9A 4DIEA 1QF6A 3WGVA 1BS2A 4RESA 1G17A 4HN2A 4PZYA 1UBHS 1ISSA 3C3BA 4FFSA 1B0UA 4LCEA 1UFKA 5TPWA 1ELOA 3W1WA 4GVXA 4WADA 4EVRA 1BH2A 4A5OA 1UINA 5JNUA 3ILHA 3UOAB 5FUQA 1J1UA 4NONA 2BT4A 3D3EA 1U4NA 1YNOA 4FNAA 1SUCA 4M76B 2RC5A 3MVEA 4FW8A 2R6CA 4DPLA 4YDHB 1V6AA 1G1AA 3KUKA 4RF5A 5ETJA 2D5LA 3VU0A 1RCTE 4N0EA 4L0MA 3EJWA 3CX7A 3T3NA 3DEHA 3ZDZB 4ZVPA 2ZBGA 1S89A 2CFRA 2G17A 2W42A 4WNCA 1WCIB 2FY8A 3F2VA 3Q3GE 4ZRDA 4MGEA 4F4FA 1NXVA 5DGTA 4P31A 5GM1A 2IVZA 2OEPA 3K9LA 3P2JA 4XPZA 2BFBA 3AY0A 4UW9A 2WM8A 2ZJBA 5FPTA 2XB6A 5CPBA 5L45A 3AL3A 1O9GA 1RAAA 4IP0A 2X3UA 2F8MA 3OQOA 5LFAA 2LZ0A 3MPOA 2ADMA 2KBEA 4GMXA 3TK1A 4ZCIA 1AS2A 1F2TA 1UBTS 4K9LA 1SHUX 4S0XA 4WNAB 1TL7C 3UJBA 1J00A 4MVJF 2ANCA 1CUBA 1WDWB 2JLQA 2ZUSA 2EWWA 2GM3A 5FFNA 3C6BA 4UVGA 4DG5A 2HLHA 3LDGA 2C29D 2ODPA 1XRNA 2P9QA 3QH4A 3RIYA 5I7SA 3OE7A 3E3LA 2NXEA 4HRAA 3PUKA 4RHCA 2RGWA 3HO6A 2QE7A 3NV9A 3DJFA 1V7QA 2RHDA 5HF9A 5B30A 4QJ5A 1QHSA 3B5IA 2ESRA 2GOYA 2N75A 2Q1XA 1J23A 5BUCA 2JVJA 3H5NA 1HG1A 2YXLA 5E2AA 3AR9A 3SMVA 1Z4OA 5AVUA 1U0HC 1JBEA 4IIJB 2R7MA 4ARUA 4WXPA 2VVTA 2W6PA 3O93A 1J06A 1KI6A 1KTVA 3A2MA 3C5HA 3AL2A 4Q9JA 1JBKA 2O1WA 2WVAA 4LWPA 721PA 1E1MA 2FW1A 3B3FA 4B7XA 4BLOA 3MRSA 3W8DA 1KEKA 1MB2A 1A8QA 1UZMA 2HV9A 1QU2A 3UJAA 2BBOA 4JBWA 2VH2A 4OGLA 1JDSA 3A7EA 2HAEA 3WKEA 1E2DA 5DCLA 1QV6A 3EAFA 3IV7A 1U1EA 1C0PA 1GR1A 1K8YB 3C8MA 4F3RA 4NULA 5CLHA 4J3NA 1P91A 1G21A 3L82B 3HKCA 4LHXA 4L07A 2OFWA 3A1WA 2XNHA 4JQSA 3O2SB 3SZLA 4WX2B 1P62B 5FWNA 2E3JA 2YJTD 2P9TA 3WSVA 1L2TA 3GUZA 4X24A 3ESBA 3TL6A 2BFEB 1VLVA 1N9ZA 2WR8A 3H9EO 4DDMA 4IYRA 4J1QA 3VAYA 2QYOA 3U9TA 2Y1XA 1JHPA 1OHHA 2Y76A 3EDOA 4RD3A 3EVAA 2C7VA 4HEA6 4PHFA 3RVBA 4P84A 2UZ0A 3CF4G 3DCNA 4ZDJA 1COWA 1PLLA 1E1CB 2Q5EA 4OGFA 4Q9IA 3ZWBA 2AH5A 3W5UA 1U3FA 2BOVA 2RH9B 5KYWB 3UJ9A 1II9A 1NBOA 3ENKA 5FJIA 1VCOA 1EKXA 4F3KA 4TXNA 3HJBA 3UJ6A 4NYJQ 4X8OA 3L4JA 1QUEA 1PU2A 2II6A 4KGDA 4UM8B 1Q91A 1EU1A 3H9BA 2GA8A 5P8WA 1NYTA 7YASA 1SU8A 1PJCA 2BKLA 2JCVA 1GGHA 2WYOA 2GNOA 3QVKA 4BO2A 1IUKA 5E4FA 3K09C 3QVWA 4DA4A 1WTCA 2Q3LA 1OQAA 1OXKB 3DF7A 1DCKA 4JIMA 3P9SA 4JY7A 1BEUB 1DXHA 3V1KA 1UK7A 3ZUPA 2QMUA 1YQTA 2QBYB 1TK3A 2RGCA 2ZE8A 4CMKA 2PGIA 1JFLA 2L19A 4M1SA 5JLJA 4EBBA 1V5GA 1V8OA 1WXIA 2I9PA 2Q3MA 1PJLA 3OH8A 3PUWA 1RXWA 1YDGA 6NULA 3HZHA 1VMDA 1NW8A 2ECQA 2PBZA 4JL8A 1IN7A 1CQIB 1JPUA 3TD2A 1MVNA 5KWEA 3RS3A 5G1NA 3ZH2A 3KB6A 4P54A 4E5SA 1Z5WA 5PGMA 1X1EA 4X95A 3I52A 2OV3A 3DKKA 1DMSA 5KYYB 2BPOA 3UO8B 5AD1A 1JFFB 1XA0A 4IY1A 4BHTA 1IUOA 5K0FA 3PDUA 3H2KA 4R1TA 4OI4A 4MW6A 4EF6A 4QNRA 1Z6QA 5FCDA 1GPMA 1BGWA 3A4TA 1KY3A 1U9IC 1XN1A 4C1NA 3LY8A 1C0KA 5AI9A 3L41A 4BO8A 4GYKA 4WE3A 3DBLB 3E7PA 2ZAOA 4L95C 3BMOB 3IDZA 4HS4A 4NMXB 4KQFA 4Q15A 4WKPA 5AVVA 1LQTA 4G0NA 2OCKA 2QKYA 4B6OA 4EMUA 2AZ4A 1V5IA 4K9OA 4QOGA 4GXRA 1UMDA 1WL8A 4E3ZA 2WW8A 2NZVG 1CEXA 2FK8A 3PCRB 4N48A 4NYMR 5FL7A 1KS2A 3SE7A 1PT5A 1LZKA 3JZAA 3BGIA 3LC1O 4I9NA 5DU2A 1THZA 1MN6A 1L5NA 1E66A 1S2LA 1F6DA 4YMSA 4WA8A 3TCKA 4DEYA 5LPNA 1ESZA 3HVKA 2CB9A 3I0NA 1Y80A 4HRYA 4B3IA 1T25A 1K86A 3MUOA 4PTYA 4X62B 1CR0A 3IAFA 1ODCA 1QRUA 4DOMA 3LX4A 4ZYTA 2IF2A 3KD2A 5I9IA 1XNQB 1E32A 3I09A 4RJTA 3JQBC 4RK6A 3FOFC 1CZKA 4EB6A 1E4EA 1DAPA 3GRPA 5INTA 4PQGA 3IA2A 4NCBA 4LNAA 4ASUA 3AEXA 2I71A 1QV9A 1SVKA 2AJDA 2QRLA 3R7LA 4YX9A 5LBUA 3IAM6 4ZC1A 5IVKA 3WA6A 4OB6A 1W88B 4ZVMA 3KFLA 1VJ0A 4RK7A 3OUZA 1V25A 4KLRA 3ZC3A 3VTZA 5CFNA 2HXYA 3D8SA 4Y3UA 1G6HA 1JKFA 1FQKA 1GFSA 2OVFA 1GTMA 4RBNA 1CDOA 2R2GA 2GFIA 3HP1A 1D09A 3UWMA 1V0JA 2JA2A 3NEYA 2C3UA 3KPUA 4BEBA 4TYYA 4A73A 4QXAA 5F7OA 4EUFA 5AVTA 3CE9A 4LC9A 3IMKA 1WTAA 1X7GA 1NVGA 4YT5A 3COPA 4EB0A 3SX0A 3DXZA 4EYKA 2JI6A 2P9JA 1T2FA 1K4YA 5JG7A 5C4GB 3RC2A 1CVRA 4GLJA 4O2BF 4C0HA 1LC0A 1YVEI 2QJFA 2O9JA 3ON5A 5EZYA 5FYQA 2B3DA 4KOEC 5K0TA 4LF7B 2H2DA 2GI4A 3I04M 3WLOA 1E9DA 2ZU6A 1JZSA 1RAGA 3BA1A 5DBFA 1AGRA 1TW3A 3BWCA 3KNZA 1SG9A 1T1RA 1GTG1 2R5NA 5KJFA 3ML1A 3TFWA 3EEBA 1FXWA 1YCDA 2BM9A 2QZSA 1Y48E 2K2WA 3SYMA 4B9AA 3ESXA 4M0MA 4PO9A 4CL8A 3T4EA 1B3BA 4I1PA 1ZOSA 1OXXK 1ZCAA 1PJBA 1C50A 2HO5A 2RI0A 3F78A 2VOJA 2QMQA 3H4MA 5IAJA 2H3EA 1UBFA 2JDIA 5JI2E 3BZUA 2I34A 2VJYA 1UT8A 3B1KA 3GJ7A 4L28A 2XR1A 4KWCA 3JVIA 4BLPA 5LQUA 1ISMA 1X7WB 2IHBA 4MVJD 4WVFA 3HDJA 4U6QA 1X15A 5JNTA 1U0BB 1TGYA 1W4AA 1VBKA 1W9MA 3PGKA 4BRSA 2PWPA 1SQ5A 3AHDA 3O83A 1UOEA 2GM5A 1FL9A 2QX6A 3JARA 4MVXA 2BUBA 3GU3A 5C9ZA 3VYWA 3T7TA 5HX7A 2IITA 3ZE2B 2GLTA 7REQB 4D9GA 2C07A 2QRZA 3ZY6A 1HMYA 5J9FA 4YASA 3UZUA 5KCMA 4O33A 2C95A 4GYJA 1V47A 2VYNA 3N2KA 4A8TA 4F7DA 2PL3A 1UPUA 2QPOA 1N9GA 4RCVA 3L8YA 5AOBA 1GT91 2QRUA 4OFZA 1ZK3A 1XT6A 4LY3A 1KMCA 1GLGA 3TW8A 4XIYA 5B6JA 5BNTA 5CB6A 1HDGO 2D1QA 3BULA 2M1XA 3IUEA 2ETVA 4MKRA 5U1PA 2PVPA 4NV0A 421PA 4CG3A 4DE5A 1Y4DE 5IKEA 3L02A 1VE5A 3I9JA 3KJXA 3ZV5A 5AVQA 4FB4A 3AEYA 2I91A 1WE2A 3OEED 2VTBB 4RTKA 1RRVA 4L5CA 3VVLA 2IY9A 4ECAA 1D6JA 1SBHA 2HA3A 3K2BA 3A6FA 1KTIA 2PE5A 2QN2A 2Y9MB 3I73A 3Q5DA 1XP5A 4F3NA 1IEVA 4MKZA 5DRYA 4H6VA 3C4JA 1VG1A 5IX8A 3EPKA 3D7SA 1IL0A 4HL6A 3C4QA 4OP1A 4PYRA 3WFJA 2F3PA 1DIHA 4WZBE 3N75A 1ZKMA 4M1ZA 2AN3A 4IGFA 1QKKA 4IFTA 2YZ2A 4B4DA 1RCUA 3THWA 3ECSA 3H3FA 1NI4A 1XMOB 1JIXA 4R9RA 1T4CB 2IPXA 2YR0A 2Q1SA 2ZQZA 2FW7A 2PS0A 4OFWA 3RUAA 3S1LA 4Z4IA 3L1IA 2IYRA 1M2JA 2X3FA 3AR3A 4GWLA 1DG3A 2VP5A 3AP1A 5DTRA 5FADA 4XX1A 4OOEA 3Q2KA 1G63A 3I05A 2DFDA 4WUTA 2BGIA 3U13A 5I9NA 2GXAA 1M2VA 1VIVA 5AJUA 4D5EA 4HMPA 1HFEL 3SZOA 4TN5A 1E9AA 1AQIA 2HJWA 4DA7A 2DR0A 2JI4A 4HNVA 4E0BA 1EDBA 1SD5A 1IAVA 1XG5A 2WV9A 4L8VA 5E9JA 2E4AA 5GONA 4IIUA 5B1YA 5JD6A 4BL5A 4M0LA 1A8IA 4CW7A 4FEGA 2OLKA 1SC9A 3AVOA 3M5CA 4NJMB 1T15A 5TT0A 1N6RA 3PXGA 5ICEA 2FF5A 3VPCA 4EKDA 5K8UA 4Q21A 4RVUA 1JAYA 2ZYAA 4I1YA 1L6RA 2AC2A 2RGNC 2BR3A 5FIUA 3ZU2A 3WE7A 2Q0HA 3AEQB 1KDOA 2PJDA 3RU3A 1A27A 4G0PA 2HDHA 3DGFC 2I4TA 4MYHA 3HADA 4AY5A 3JU3A 1Z8NA 2G9ZA 4LDJA 4EI9A 4YAIA 1Y63A 3HZOA 2JFPA 3O5AA 3ZGNA 2Q2VA 4XWOA 4S05A 2LWIA 2ORYA 2Z2YA 1YS9A 3A26A 3R6WA 1X7ZB 4BJ6A 3THXB 4P3PA 5IAOA 3RSZA 3D5EA 2QB5A 2ZT5A 2ZTUA 3RJMA 2FMFA 3WLAA 3T3MB 1TUGA 1E77A 1YB5A 1YC2A 2QVBA 1EP9A 2XAAA 4I81A 4OA8A 4B6PA 2G1AA 5CFQA 1YZVA 2QPLA 4HMOA 1E2UA 4JXKA 1USGA 5EUBA 3QW2A 2HLPA 3GHHA 3DDZX 1US8A 1OAAA 3KAKA 2WNIA 2WQZA 4OJMX 3WYDA 1TQ8A 2H2GA 2HBZA 4YWJA 3GG9A 3MZ0A 4CPDA 1T5OA 3R5TA 5K99A 2HRDA 4M0FA 4IIJF 1J33A 5A6VA 1XRRA 1Y4ZA 3PI6A 4IF6A 1E3SA 1GU0A 2QJOA 1J90A 1M1ZA 2CNBA 1H23A 1T0HB 3GBSA 1PWEA 4MIOA 4DV3B 2MR5A 2D2VA 2CJWA 4OYYA 1OC2A 3T7SA 5KX5F 1BXKA 4IL5A 2O3RA 4XA8A 3B48A 2JGEA 3UA3A 4QRHA 4AJNA 1EINA 2VHUA 4HBGA 5C8ZA 1Z3CA 3ZJUA 2PX2A 1CY4A 1S96A 1VYUA 4HQ0A 1LGYA 1TUEA 2QD2A 4L5BA 1Q0HA 4HGOA 4TN1A 2DPGA 2D3WA 1UJNA 2GJAA 1ZD9A 2VF8A 2XQGA 3GV0A 2X13A 3IPYA 4QNMA 1NSTA 2VRBA 2X9VA 1J8FA 4CEIB 3R44A 3FZYA 2QTCA 1E6EA 1NMQA 1V7PC 1Z74A 1IEWA 3L0ZA 1B2RA 2HHAA 4FR5A 2WUVA 4ISCA 5H02A 3NVMB 2NO1A 4DA8A 3R75A 3SIXA 1PW7A 1RAHA 3JWGA 2FG6C 4RY8A 4JYAB 4C76A 4G36A 2A9QA 2DJ5A 1O2DA 4MI1A 3WDLA 4EY5A 5JFGA 1O0SA 2B37A 5K8CA 4PPGA 2BF4A 2W2KA 5K9ZA 5JCOC 1JV2B 1VA4A 1GG8A 1VE1A 2FRDA 2GPTA 3A28A 3HWRA 1E7WA 1LNZA 5CYPA 1R4NA 5F1YA 1E6KA 1YRWA 2BELA 4OAQA 4W5JA 4W8GA 2PMFA 2GVZC 3AERA 4X93A 3AJDA 1ZMRA 3R0JA 4INZA 2VHJA 3BZBA 5TIIA 3D4NA 3TKYA 3BMNB 4WFKA 5EMLA 1CJTC 1HT1E 2O8NA 1XTZA 1FA9A 1HTBA 2A0FA 3DXFA 3GEDA 1OC4A 3ZHRA 1AU9A 1XZMA 4OI2A 5T3UA 2NT4A 3WHKA 5J2TB 4OQYA 4EMBA 1NHGA 2QN3A 2QLBA 1Z8HA 2NSJA 1E2EA 2EG9A 2HK8A 2A92A 3E84A 3QU7A 4M8LA 3F9IA 2HSJA 4GLLA 3L0PA 1RM5A 3OTQA 4UU8A 2YJ3A 4RK0A 4CNBA 2JFVA 3QLUA 4GKBA 4X1OA 4F6LA 4Z7NB 5C8DA 2EF1A 2VUSA 4PG4A 2XUFA 4R2WA 4LRSB 3V7YA 3ZTTA 2R1TA 4AX4A 4BNIA 3U0BA 3OF5A 4BNNA 4EYEA 4EY7A 4BBZA 4F4HA 4MYSA 2GCEA 3DZGA 4JC0A 4MITA 4PYOA 4EIWA 2RSLA 5LZ2A 3QWFA 2O5CA 1K98A 4HEQA 4D4JA 1RBMA 1SKMA 4BX9A 4JT2A 4RDXA 2R6R1 4FNMA 4X90A 4DJJA 1OX4B 5HZHA 2JHAA 1OTXA 1HLFA 3UICA 1NRJB 4F5DA 4QXMA 4TMXA 3THYA 1ZD8A 4MP6A 3AIMA 3I5YA 5E95A 1B93A 2O8BA 1D07A 4OQXA 2EATA 4OO3A 3SF8B 1BJTA 5KYGA 5AKLA 3RLIA 2ZTHA 1KZHA 2C5LA 1OYWA 3EQ9A 5FKJA 1Z6TA 5IT5A 4TM8A 3OUUA 3DOIA 2XJ9A 2YV5A 1XXHE 2YS7A 2NVUB 4NZZA 4G07A 3VM6A 1U11A 4R7TA 4FMDB 1UDXA 1TZJA 2IXEA 1ST3A 3GDHA 3PITA 4NTZA 5E0OA 4BPRA 4ENTA 3T34A 3L7KA 2H52A 3F46A 5EJGA 2C58A 2V8OA 1NMXA 2CXRA 3TMKA 2XUQA 5BUZA 4TYWA 1AK9A 3A58B 1J6UA 2EP7A 2FE1A 2I8CA 2QUAA 3K92A 5HOEA 3DOUA 2FZEA 1W8IA 3TLYA 1LDMA 3W06A 3FYHA 1RJ9B 4BU1A 4KQCA 3TB4A 3AP2A 3D6HA 4QU9A 2OXFA 1CB7A 3ANYB 1WZUA 3O26A 2YYYA 3IIEA 2GBLA 4ND6A 1ISFA 4BECA 3O1IC 3I4LA 3T94A 2DB3A 3EW7A 5I9MA 1DXOA 1RJFA 2XVZA 4G1FA 4UEWA 1N25A 3D8HA 3R7DA 2HWXA 2XE6A 2Q2WA 2BI7A 2QSJA 3F67A 1O57A 1M3SA 1SZCA 3M4JA 2H31A 1PR5A 4PLFA 2ZYUX 4CM9D 1M8KA 4K26A 4EEZA 2PLNA 1XYYA 3IUSA 4PE5B 2WIAA 1XZLA 2C31A 3N8KA 1GCOA 1UXKA 2EFYA 3G68A 4UJ5A 5JROA 3LCRA 1GUZA 2QRNA 5FP0A 1SCUA 3B60A 1QNFA 3OIWA 1NJ6A 3T7RA 3JRWA 5A5GA 4RIEA 3SZUA 1BMTA 4BBPA 4B80A 1XRPA 5JSFA 2ZK7A 4FFMA 4AL4A 4PINA 4S1PA 4BP8A 3AFOA 3MWDB 2FP4A 4B3CA 2ZUDA 2O8VA 3TO5A 3CURA 3G59A 4CUJA 1VHLA 3PPVA 1KS9A 3QW4B 1SC3A 1W0KD 3A4VA 5G3ZA 4XVQA 4O2AA 3RREA 3K4QA 1GP2A 2OVBA 5GJCA 3SHOA 3DMHA 5C7OO 2RD2A 3VC7A 4YJFB 4L78A 1NVVQ 1EVIA 2P4SA 4NHOA 4W6QA 2IV2X 5IG2A 3JQ7A 2WVJA 3OJEA 3B13B 2Z1MA 1X6VA 3OLWA 2LPMA 5LL6P 1MIHA 3CC8A 4Q3NA 3LPMA 1ZPDA 5T8KA 1EXNA 2AXEA 3TW0A 5BXYA 1P2TA 3AM4A 3OIVA 3RPEA 1UPCA 3FE2A 4N8SA 4DZTA 1GGVA 4H1TA 1SVOA 2QHXA 1P61B 4OIMA 3B2NA 4HDNA 2ZULA 3QU9A 3RUDA 3SMQA 3SQDA 2PZGA 2OUKA 4H7FA 4BTLA 4LOIA 4OQPA 4DCCA 4ENWA 5E2IA 2PGJA 3R3UA 1T0IA 3EB9A 3KPYA 1KQGA 4F7WA 3DE0X 4LZLA 4X85A 4IIYA 1E6LA 2UZIR 3LIIA 4JLBA 4YXWA 1U8CB 2AFHA 2OXIA 3TOXA 5C80A 1FQJA 3M5WA 1E2NA 2FEWB 4GF5A 4BLTA 1RI2A 3VH1A 1ECBA 4XSHA 3CH7A 2OC4A 1U3GA 4AO6A 2FPPA 1QVZA 1N2XA 2WHPA 2E4ZA 3QPUA 2AFIE 3KZMA 1DKUA 3F4BA 4QFCA 3OJCA 4HATA 3CHYA 4QHYA 1K7SN 1UL1X 1OFGA 1B3RA 1CFJA 4QRDA 3ZV6A 5UKDA 4C5CA 1U2TA 1IHYA 1U7ZA 3RKRA 4CG2A 1WEHA 3LOPA 3T35A 1T5DX 4ZEWA 3E23A 5EG5A 1XFDA 2QK4A 3A9CA 1L4UA 1KOFA 3MIIA 4LZJA 4U4AA 3A6PC 1WO8A 1QP8A 2VEDA 2OOKA 3KXDA 1MENA 5I8ZA 4B3FX 3U31A 3FRIA 4A82A 1ZN9A 5I4CA 3SSNA 4JT4A 2ZANA 3DB2A 5BNIA 1QIKA 4ZMBA 1DIRA 4IGAA 4R16A 5BR1A 1OASA 4DWWA 2FLWA 2VSXA 5B3AA 5IFLA 2BI8A 2JKZA 3D0OA 4I4NA 5CA0B 1CJUC 1YZYA 1MJGA 3G9UA 1CZNA 1G2IA 3G2JA 1V7ZA 2DTDA 3PFFA 1VB5A 3KVOA 1RWOA 1GG2A 1T6NA 3GVCA 1FTYA 5B2FA 4TMTA 4BS9A 3RFFA 1OFUA 1K66A 2LE0A 3NVAA 2BKXA 3MTAA 3JWJA 2CK3A 2RGBA 1CXZA 2ZUWA 4ALIA 2FN8A 2FXIA 1YK1A 1OJLA 5K6AC 5B2EA 2KHZA 3BTVA 2VNIA 3FNQA 2X2FA 3EGXA 4DWVA 2OBNA 2XYRA 3I9MA 4LRWA 4X7MA 3VR5A 4AJIA 1NBWB 4EMSA 3WSWA 2YFHA 1FLAA 3EPLA 4BFCA 3UGTA 3FMOB 2FSFA 3EVCA 3SLKA 3TCNA 5EVJA 3LMKA 3WLNA 1CU1A 2V3WA 1DQNA 4KIGA 3ZYCA 3EF3A 2JLUA 4RTLA 2C97A 1OBFO 2H59A 2Y0CA 3AJ9A 4HRXA 4KXWA 2Q5FA 3VPAA 2X7JA 1UKEA 1U2EA 1HZJA 2QGFA 2C4WA 1ZFNA 4B9EA 4D4IA 1W25A 1IY2A 4KFTA 4L8FA 2VP3A 5EMNA 4AZVA 3V6MA 1OOEA 2P27A 5ICGA 4PZ0A 4FZ5A 1BVRA 3VU3A 5ITZA 4TOIA 2ZSIA 3UHJA 2WZDA 2CLKB 5DCUA 3C6QA 2Z2KA 3SIRA 2IH5A 2G7MC 4L50A 3QPDA 3C6MA 3U1BA 2VYVA 2ZRAA 1GCUA 2VPYA 3EXIB 4GZ5A 4K9MA 3ZLVA 2FPGB 4ER5A 2QQGA 1SM4A 3LOUA 2HMSA 1U7OA 2NQ8A 1CETA 4MQUA 2QG6A 3VR3A 5BQ5A 1O97C 3SZMA 3B85A 4OQDA 1TM2A 1U5BA 2J5QA 2ZRCA 4Z9FA 5L4NA 1KKMA 1KAOA 1T0UA 3ZGOA 4BWFB 1NN1A 3C2QA 3L49A 3RVQA 3ZE7A 5K8TA 2BM1A 5BO5A 1S2DA 3L5OA 4F85A 3D8UA 1ZOOA 1PR2A 1XBTA 1KYVA 3R1IA 4WERA 3FMIA 3E9DA 4EKGA 4DDVA 2C2ZA 3HKBA 3RG8A 4TX1A 3BKXA 1A5BB 2E4VA 2F3UA 2XQKA 3FDFA 1L5MA 2XCLA 3ZHVA 2J3JA 5D2CA 1C3OB 4MRRA 1L7VC 2V4UA 1AGXA 3DDCA 2VHYA 3KDPA 2I4LA 3IX7A 1FMFA 1A9YA 1EJ0A 1ODKA 4JVNA 3NANA 2HXGA 5DOZA 5IARA 3IEMA 1NUPA 4D9JA 4LQDA 1APBA 2XUPA 3UYKA 1XTRA 3WIEA 2PTGA 4N41A 4WJZA 4RE6A 3N8IA 1FNCA 3YASA 4N5NA 5JRDS 2LP4Y 2QPAA 2CWDA 2XWJI 3MOIA 3UMVA 1OWOA 4QTXA 4E09A 2ZYIA 3D7NA 3OHPA 5IJAA 4IGIA 1I24A 2JJMA 2IQ5A 4G1EB 3SKYA 1PL8A 2CB0A 3K4PA 3PE3A 1NW7A 4ZO6A 2H1CA 4XH9B 4AZWA 5ALSA 2EKZA 3AIOA 3BFJA 4ABYA 1FMLA 1DPGA 3ADBA 2HU8A 3IT3A 2V7EA 4D8UA 5AO9A 2C88A 1VJ5A 1R4ZA 3L0YA 1EVEA 4N7RA 4W7IA 2V0GA 4MW7A 2FPOA 5K0JA 5K6RA 2CNNA 4OL0A 4Y6LA 1Z8DA 4EGJA 4XFDA 5I7UA 3O21A 3EVZA 3ITEA 4I6JA 5MGBA 1C1DB 1MKYA 4BTVA 5L3VA 4FZ3A 1FTNA 1ISGA 2QTLA 2X5XA 1FNSA 3RC8A 2R6HA 5J2TF 3AO0B 4MS4A 4PZCA 5FUYA 3TAUA 4Q9HA 1I7SB 4ZQCB 1FDUA 1PD0A 3SOZA 1JLHA 1LFAA 4IUBS 4LF8B 1EJ6A 1DRKA 1QHXA 4YFYA 2YFKA 4UUQA 1EFKA 1NLUA 4Y2TA 1AO0A 3SD7A 1LVGA 3M1IA 4LSGA 1S2OA 2N46A 3K5HA 3QXSA 1DHTA 2FW8A 1U7WA 1AURA 2VAVA 2XYGA 3P0EA 3UT5A 2AE1A 1GOTA 5DHRA 1XDSA 4CDNA 4EPRA 5E1BA 4EOGA 3K6KA 4TTPA 4GPD1 3OTOB 4FWBA 4F4JA 4QZVA 4G8JA 1JBQA 1FDSA 2VH1A 3EA0A 5K8JB 4TS3A 2ECPA 5L3SB 1GV0A 3OMLA 3WGNA 4E2FA 5FV4A 2PUAA 3M33A 1L7AA 4K6MA 6ADHA 1YJAA 2W83A 4G5QA 3SYTA 1HOTA 1IOZA 3J7TA 3ZWMA 3D4OA 1BE0A 4EG0A 2Q62A 1ZUNB 1WB5A 1E0DA 2QUJA 4XYMA 2C82A 2FAXA 4E13A 3VR4A 3TIVA 2C9YA 2D1FA 2NOAA 5AW7A 1IJEA 1ZNQO 3FLMA 4OX9Y 2P30A 5LJIA 1KNXA 1F60A 3HY6A 1N6OA 4Q4JB 4JUIA 3CNQS 5IAGA 2I03A 4Y98A 2AGVA 3CPJB 4FMDF 4C2AA 2WQ6A 1N2HA 3LLUA 4C06A 2F2TA 3WR5A 2X9GA 4E6EA 5KYYA 3DV9A 1YR7A 1T1IA 5COBA 2BFOA 3HBAA 5DIFA 1YKGA 3HXOA 5ALEA 2ZT8A