1M7GA

Crystal structure of aps kinase from penicillium chrysogenum: ternary structure with adp and aps
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
208
structure length
208
Chain Sequence
STNITFHASALTRSERTELRNQRGLTIWLTGLSASGKSTLAVELEHQLVRDRRVHAYRLDGDNIRFGLNKDLGFSEADRNENIRRIAEVAKLFADSNSIAITSFISPYRKDRDTARQLHEVATPGEETGLPFVEVYVDVPVEVAEQRDPKGLYKKAREGVIKEFTGISAPYEAPANPEVHVKNYELPVQDAVKQIIDYLDTKGYLPAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Adenylylsulfate kinase
publication title Ligand-Induced Structural Changes in Adenosine 5'-Phosphosulfate Kinase from Penicillium chrysogenum.
pubmed doi rcsb
source organism Penicillium chrysogenum
molecule tags Transferase
total genus 79
structure length 208
sequence length 208
chains with identical sequence B, C, D
ec nomenclature ec 2.7.1.25: Adenylyl-sulfate kinase.
pdb deposition date 2002-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01583 APS_kinase Adenylylsulphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1m7gA00
1U0HC 3ASYA 2J0VA 3PEUA 3EPKA 3KJEA 2ZUBA 4PC1A 5FPHA 4ZCIA 2JCSA 3FFBA 4MKFA 3MFYA 4CEHB 5AK0A 5DHAA 2QE7A 4PPGA 3C8UA 3L82B 1AS3A 4IDNA 3Q85A 2XZLA 4KI0A 1W36C 1W36B 1W36D 2GZAA 3TVDA 4FCVA 3DKPA 4D0GA 4AY2A 4RZ2A 4JLMA 2HT1A 5EXSA 4DLRA 1RW4A 4ON9A 3U2QA 4JBXA 1O87A 2EFDB 2R62A 4I1UA 1XJCA 1DELA 3EIQA 4LBWA 4CZ2A 1YQTA 3QXSA 4GOJA 4NCHA 2O8DB 4CEIA 1GG2A 2ZRGA 3TUZC 1CJUC 2B7CA 4G01B 2A78A 2ZJAA 2OCAA 8OHMA 3W3ZB 4O3MA 2GXSA 1OV4A 4IXNA 4C30A 3UMSA 3CKLA 1KY2A 2DWPA 5FPTA 3BD9A 3PQCA 4WXPA 3H2YA 2C9YA 2QM8A 2OLKA 2R6GA 1QVRA 3AVYA 1CBUA 3C16C 1SHZA 1E2KA 2VSFA 4FWTA 1JI0A 5EE0A 4Q9IA 2QBYB 3UATA 5E95A 1P2VA 3B8HA 1TQDA 3EW9A 4HAXA 3K9GA 4JZKA 4BFZA 4B47A 2A5JA 3VHLB 3VTKA 4HSEA 4E07A 2NMVA 4EQ6B 1LVGA 5TARA 1TF2A 1II8B 3WP0A 4RKEA 2BDTA 2GTPA 3A4NA 5AUPB 5GVRA 821PA 3X1YA 2MSEB 3OEED 4FD2A 1K5GA 5HR5A 1GAJA 2AK3A 4JT2A 3LXXA 1PVOA 2C5LA 4TYWA 1IN4A 1VYUA 3B6EA 1TEVA 1OHHA 1P62B 2YJTD 4NCKA 4WOPA 4JSTA 4ESHA 2SHKA 3WBKA 1E2PA 1S8FA 1H8HD 4BPBA 1E0SA 2EYQA 1GTVA 1UEIA 3AVVA 2GJSA 2CE7A 3BBPA 4MDEA 1Z0IA 4XOIA 2KWIA 4L15A 1WQ1R 1GFIA 2GEDA 2BMEA 4UKDA 4PHFA 2ZE5A 2ZRDA 2VP9A 2IS2A 2IBMA 4M9SA 1FUUA 2F1RA 4FMDB 4MDFA 2RGBA 2GVZC 1FX0B 3B5JA 3W5JA 5GVSA 3BB1A 4IRUB 5K8TA 3P26A 3JVVA 2ZR7A 3OAAD 1E1QD 2O52A 1U81A 2FEMA 2BJWA 1NN0A 2BEKA 5CLQA 3ZIAA 4LI0A 1L8QA 2PCJA 3CRW1 1HE1C 3UXMA 4LHZA 1GDDA 2QPAA 1HE8B 1W4AA 2QTVB 2VP2A 5E7JA 4IXMA 1KMHB 1NKSA 3BXZA 2UZIR 2LCFA 4LYHA 5HE8A 2CK3A 3KB1A 4HAWA 3NHBA 4DLTA 5L3VA 1KJZA 1NRJB 4IOLA 3PEYA 2ZXUA 2G0NA 1Z22A 1E98A 1PUJA 3F3YA 4OJKA 4Q21A 1SKYB 1OKKA 2DFLA 3TR0A 4S2EA 1P73A 2C8VA 4C0SA 5EQTA 2JATA 1LS6A 2P65A 4MYCA 3VR5A 2Q3HA 3CH5A 1E9FA 1ELOA 3B7GA 1P61B 2EVWX 4B71A 5GADl 5FBWB 4WIAA 4DLVA 2YNMA 3AUXA 1AK2A 1V5WA 2D7CA 5JWHA 1EG7A 2O8FB 4OHXA 4X8OA 2V8OA 3MRSA 3SHFA 1NIJA 2G1JA 2HCBA 3A1WA 3MSXA 4U7DA 5DH9A 3IILA 4PANA 5J5CA 2JASA 3DZ8A 1KHTA 3E1SA 1N5LA 4PSKA 4XTCS 3R8CA 3VQTA 1IONA 1LV7A 2CDNA 3LDAA 4HATA 3GLHB 4M2LA 1E96A 4MRPA 4EFNA 1AN0A 3U7HB 1JBKA 4W5JA 3DM9B 3CF2A 2QPTA 2YWGA 4Q03A 1E99A 2QTHA 4Z1MA 3OEHD 1R0YA 1WMSA 2BBOA 1UBGA 2WWHA 5EE3A 1IXSB 2H8KA 1Z28A 1KY3A 2IXFA 3LD9A 1O3YA 4A2QA 2XTNA 4A8JA 2REBA 3EZ2A 4TYNA 2ZITA 2XJ9A 3M4YA 1WBDA 2YVUA 2ZRLA 3G82C 1ZCAA 4W7SA 2JGNA 5KDDA 2ZYUX 4PSVA 1ZNWA 2OAP1 3EASA 1KO7A 2H16A 5TY0A 2VEDA 1FL9A 4BZXA 1ZM2A 1A4RA 3CO5A 2GILA 3SS8A 5CIQA 1KDPA 3B1ZA 3CRMA 1NBMA 1LY1A 3SJAA 3RS2A 2LKCA 2P6UA 4GZMA 4UNPA 1ZU5A 4B3BA 3W6NA 4AIIA 4PZYA 4LJ5A 3LLMA 1OB5A 3U7EB 1SZPA 1ZW6A 3VU9B 2Y8EA 4QM7A 3QEJA 4HLUA 3GLIE 2XNSA 3FKSA 421PA 1KI6A 4HEJA 5F2EA 3IHLA 2BIFA 5KDOA 3EC1A 2IC5A 2NO9A 2ASEA 3E70C 3BORA 3I5YA 2IX3A 1S0UA 3ZVMA 4L4UA 2CL6X 3ZZ0A 3PG5A 2PCLA 3O47A 2E87A 4I1OA 3TR5A 4YMTA 4HB3A 1VCMA 5KSYA 2BHRA 4DDWA 1CF4A 2C04A 1YZUA 4W5WA 4G1UC 4V0OA 1KK0A 1JXOA 1NMXA 4RY2A 4NYIR 3TSZA 3X1DA 3RWMB 1F2UB 2BBTA 4MKGA 3M1IA 5EE1A 1EGAA 2B8TA 1KO4A 1GP2A 1US8A 1XMIA 1AM4D 2XTZA 1EFCA 3OF5A 4MRVA 1N6NA 1T6NA 2OAQ1 4TYPA 4IEEA 4LJ9A 3SDZA 4BLQA 3SYNA 2Z0MA 3H84A 1FNMA 1G5RA 1XU4A 4Q9HA 4NCNA 3B78A 3QKTA 1QRAA 1M7GA 1GKYA 2NO6A 2ZJBA 3PUZA 5ANRB 1D2EA 2LKDA 1E3MA 2WSMA 3A4LA 3P32A 3B1VA 1G8GA 2WJVA 1N5KA 1E1RD 4YXWD 3MLEA 2JLZA 1C9KA 4NTZA 3WNCA 2QTFA 1TADA 5HPYB 2O8BB 4B33A 4Q18A 5EXPA 4DSNA 3UK6A 1GITA 2D06A 3AQ4A 2V6JA 1CJTC 1OXUA 5KPDA 3QBTA 5FFMA 4YMVA 3R7WB 2GESA 5KPJA 3T1TA 5J4HA 2IUSA 3TSOA 2Q9CA 2WKPA 3THOA 1KJWA 1OJLA 1K6MA 3GLFA 2DFNA 4JBWA 2A5DA 1F2TB 2MSDB 3IIMA 4OI2A 4KFUA 5EXTA 3A1UA 3UG6A 1ZVQA 1QHHB 3AF4A 2BBSA 2VL7A 1G8FA 2OZEA 2FFAA 2WJYA 3PV0A 4LWZA 1E9SA 3P1JA 4M1MA 1NN5A 4PZZA 5FL3A 5CDFA 4LOAA 4QHTA 2I4IA 4JLAA 2IYUA 2GETA 4QJ3A 2FSHA 5B58C 3D8BA 1OW3B 1SVOA 1X8KA 4IFEA 2RKOA 3T15A 3ZD6A 1GUAA 3WRYC 4CIDA 4XWOA 2DFTA 1SXJA 2LWIA 3U7FB 3TJZA 4DLXA 1EXMA 4Q47A 1W0JA 2PZGA 3MJRA 3BRWD 3SOPA 2HCJB 2XSZA 1M7BA 3U4QB 1E9CA 2IHBA 2YWHA 3NG1A 5FUVA 3EZ6A 3KX2A 4ZIRB 4PHHA 4V0NA 4YONB 4OHZA 2PH1A 4DXAA 4CVNA 1VYTA 2XB2A 2BKEA 1IN6A 3VFDA 1ZUHA 2D3WA 1R8SA 2IUTA 2RGEA 2J0UA 2IW3A 1P9WA 1NSFA 2IS1A 1NJGA 2G77B 3I8SA 1Z0AA 3K0EA 4ABYA 2FZLA 4A15A 3FKQA 3I4LA 3LW8A 4R2IA 2FPMA 3NDBB 2CNWA 1A5TA 2IYQA 1VG9B 2CHQA 1XEFA 1XCMA 5BN4A 3UKDA 4ESVA 2CLDX 3B1WA 3Q9LA 4TMTA 3KQKA 4PPNA 4RD6A 3IO3A 1H65A 3NVAA 1MO5A 1T8TA 1Z2AA 4C7OB 4N0EA 3TKLA 4EAQA 1JJVA 1N0VC 4EDHA 1YZNA 2W0SA 1P4SA 4MUBA 3BWDD 1E79A 2ZQ5A 3OE7A 2DPXA 3HU3A 4DUGA 2YYZA 3IIJA 4LYAA 5J4YA 3UWKA 1HT2E 1M34E 2L0XA 4LJ4A 3MWYW 4B2IA 4ERNA 4HAYA 2IYVA 2J87A 4Y0VA 3RHFA 2ZI7A 2BC9A 3B13B 4Q4HA 4U5XA 3UIEA 3EG5A 1TUIA 1KYIA 4EPVA 3SFVA 2KI5A 1H8ED 1TF7A 4FWIB 4NYMR 2P3SA 1F60A 1KOFA 2XOKA 2QQEA 4D4KA 5KTYA 4NKRA 2Z4RA 2ZRMA 1LF0A 1R2QA 3QE0A 4TT3A 4WZ6A 4OKSA 2QI9C 2BCJQ 4P4SB 1OXVA 3KUDA 1M7HA 2QMUA 3CH4B 1P2UA 4TZ0A 3WMFA 1F5NA 2J41A 4OHYA 1YVDA 3SYLA 4LHXA 3X1XA 1NSTA 3CZQA 3QUSA 4FMCB 4QGHA 5EUMA 1AS0A 2W00A 3K8YA 2X19A 2P6RA 4B34A 1YR9A 5F9FA 3U3RA 4CDGA 5JRZA 2C96A 4LYJA 1XF9A 1RFLA 2DWQA 3BOSA 4BECA 4QXAA 4M9ZA 221PA 2CJWB 3NBZC 2QORA 4GOKA 2J46A 3QKRB 1WP9A 1OFTA 3MWLA 2GCNA 1X6VA 1MABB 3JVUA 2CE2X 4Q7MB 1U8AA 1DE0A 3FMIA 4HUQA 3NH6A 2W0MA 3K0FB 3LBNA 3GLIB 1N6LA 3AVOA 4V0KA 1HQYE 2ZI5A 5F3WB 4L9WA 1HYQA 3KXKA 1DAKA 1OH8A 1W7AA 1IJEA 1JR3A 1YHNA 2BM0A 2QAGC 2QAGB 3IBGA 4NYJQ 1E69A 2VLIA 1MH1A 4Q1CA 2R6AA 1E4YA 2N46A 3IUYA 1QHSA 2A7QA 1J8YF 2FMXA 4PPQA 1G8HA 1XNJA 1ZINA 3KQUA 4BZQA 2G3YA 4DVGA 1ZD8A 2B21A 2DY1A 3DOEA 3AF1A 1SVIA 2KSQA 3FHOA 3SI7A 4DSOA 3LQRA 2WWFA 5L3RA 4DT1B 4AI6A 2OLJA 4B32A 1OH6A 1FFHA 3SJCA 3SYKA 4DBLC 3GJ7A 1E0AA 2IL1A 4WZAE 2ZROA 4KITB 2YWEA 5G3YA 2E9SA 4QBIA 2ZS8A 3H4MA 1FTNA 4JBYA 5DYIA 1JJ7A 4DLZA 4CEJA 4NH0A 1AGRA 1OE0A 2V4ZA 3ZVNA 2ZI3A 2CL0X 5JHGB 1QG2A 5HZKA 1L7VC 3T34A 2E1RA 2ZS7A 1XXHA 2PT5A 2X77A 1MOZA 3KFXA 4TQAA 2WAYA 4LGMA 4BLTA 4LJ7A 4Q48A 5A0FA 5J47A 5DYGA 4IVPA 4MRNA 1YRBA 1XWIA 2GKSA 2NTYC 4ZKDA 2REOA 4M8NE 5DI3A 2Z4SA 1ESMA 1XTSA 3QSYA 1DPFA 3VKGA 3L0OA 3RVBA 2WTUA 1ONBA 3RS4A 5L3SA 1W4BA 2ECKA 2OFWA 4EPYA 2J7PA 5G41A 5DISB 3NC1C 5JECA 3JZAA 1NP6A 3KJHA 3GJ4A 3BB4A 1G16A 1G291 2RB4A 4PZLA 4HAZA 4QJ5A 3SU8A 5JJKA 4LBVA 5E4FA 2YINC 3PUWA 5SZHB 3WXMA 2YOGA 1AQUA 3FOZA 3W6PA 2W6JD 4NYIQ 3W8RA 4JS0A 1TUEA 3W90A 2GAOA 4WAUA 2XJ4A 3I1FA 1TAGA 4X8LA 3RANA 3EWSA 3ADKA 2ZUCA 3GLGE 1DARA 2OBMA 3ZDQA 1HQCA 4URUR 1DAMA 1IN7A 2GVDC 1Q21A 1Z0DA 2AFIE 1LS1A 4UNNA 1YZQA 5C18A 4TZ6A 2K5UA 3CM0A 4TYQA 1YR6A 1M8PA 1A82A 1E2QA 2H17A 2ZUDA 5JI2E 3AKDA 3PJRA 5L3QA 1JECA 2F1HA 4JLNA 3QOFA 1U0LA 1CR4A 2ZRFA 3KKOA 4UJ3A 3AP2A 3VHXA 5EJEA 5TMPA 3THYB 2VP5A 3DPUA 3FB4A 4A9AA 3U44B 1IJFA 5DN6D 3MJHA 1TPZA 3DO6A 4ASUA 4C0BA 3K0CC 1AJEA 1UDWA 3O8DA 3LXRA 1T9HA 2W83A 4V0ME 3HPRA 3K9HA 3HYTA 4E03A 2J3EA 3LQQA 3THXB 1VCNA 1SKYE 3EPLA 1WB9A 1OSNA 3UANA 4BFVA 621PA 2QRNA 1KSFX 2CLSA 4JLPA 3VX4A 1XRJA 4DCNA 4KV9A 4MITA 3T5DA 3WHLA 1RZ3A 1T5IA 3ICQB 2GJKA 1MKYA 1DG1G 2RAPA 2XX3A 3QVVA 5CK4A 2F1IA 2QMEA 4IOJA 1GL9B 3HR7A 3CONA 5CLLA 1DG3A 2HLDD 1BO6A 1DEKA 2KB0A 1BOFA 1KI4A 2PX3A 1TQ6A 4EFMA 2AXNA 1ZJ6A 2WSSA 3FHCB 2BCGY 4OQMA 1KAGA 3BH7A 5EZ5A 4BFWA 4YDSA 4K8OA 1II0A 3MAAC 2ZRJA 3GLHE 4Q00A 1SHKA 2FPKA 2GCOB 4BLSA 2IYXA 4LJYA 3TQFA 3SBEA 4ACBA 5J4VA 4D26A 4CEHA 4OQLA 1P9RA 1KGDA 2ZSBA 5E3HA 5H1YA 1VIYA 1R0ZA 4BEBA 4FCWA 3R8FA 2BMDA 4DKXA 4E22A 4H9GA 1DTSA 1W5TA 2QZ4A 4B48A 1R10A 1KDRA 4B2PA 4PAQA 5CIWA 1G9XA 4F7WA 3PVSA 3QENA 4BFSA 2IEYA 3GEEA 3KXLA 4A36A 4DHEA 2X2EA 3HDTA 1G3QA 1KSHA 3FMFA 2OE2A 3ND9A 2ZU6A 3BFXA 3BH6A 1R0WA 3K0AB 4TSFD 1S3GA 4TL8A 3ECCA 1C4OA 2FGKA 3RSLA 2FDCA 2O8DA 2IT1A 2JJ2A 2WJIA 3HPQA 4EJSC 4P3YA 1AS2A 4EJSB 2PT7A 3WHKA 4DRZA 2IUUA 1FZQA 3AF0A 4V0LA 1J2JA 3FFAA 3U6BA 2Z43A 1P2TA 1E32A 1KI1A 4TN1A 5EUQB 1EK0A 4CYMA 1TU3A 1NG9A 2JDID 2R6DA 4F91B 4IHQA 4AKIA 3VR6A 5KNBA 3L0SA 2QG6A 1SULA 2F43B 4FMBB 2FSGA 4NYMQ 1KSGA 2G83A 3DHWC 2B6HA 4PTLA 1UKZA 3RRMA 2YC4C 1SVSA 1KJYA 2AK2A 2ZE6A 4E5UA 4EQ6A 5JCZA 1YZLA 2TMKA 4OI4A 1II8A 4Z54A 1UBFA 2IHYA 3C14C 4BZPA 1A7JA 4TYYA 2PJZA 3D3QA 1XD2B 2WMOB 1SKQA 3AVWA 1OYWA 3G5UA 3NDPA 4OYHA 3PR1A 3IHWA 1A1VA 3J81k 3QQ5A 1W2GA 4LBZA 4QGGA 4FCTA 3IO5A 1G1MA 4R9UC 4ARZB 3TQCA 4DCVA 3EXAA 2XTMA 3ZD7A 4BQSA 5M04A 1RIFA 4Q4JB 2ZR0A 2WWIA 2C98A 1E94E 1QF9A 4GBMA 5ELXA 2C9CA 1OIWA 4LV6A 4DLSA 4G5OA 3VX3A 3IEUA 3VR1A 1YR7A 3DVLA 3FE2A 2XB4A 3B1XA 2JIZD 2REXB 4EIWA 1B23P 2PMKA 2XNDA 2JLRA 4QL3A 1CJMA 1FX0A 2DWOA 1TX4B 1XTIA 4KAXA 3WP1B 3AH8A 5C4GB 5GJVC 3OAAA 1E1QA 2ZJ8A 1U9IC 1KI9A 3QY0A 4B3XA 5JFGA 1QHYA 4FMDF 4MQBA 2KBFA 4A2PA 3CNNA 4KSBA 5JJIA 3ZGXA 3JZMA 4M1SA 2FJUA 2QQ0A 5HTKA 1OXTA 3HWSA 4LBYA 721PA 1QVAA 3ZJYA 1NJFA 4RD1A 1EFUA 1W44A 4B75A 5AJZA 2UZ3A 1GKIA 4D4MA 3EC2A 3D31A 4MRRA 2GZDA 5CM8B 5DIFA 3A1SA 2VYFA 4BE7B 1NL3A 5J4KA 4V03A 3GLGB 1GSIA 2WPDD 5JHHB 2GXQA 4PHGA 3BE4A 3U3OA 1N6PA 1RVDA 4PHTA 4XH9B 4YMSA 4Q9JA 1UF9A 2A3RA 2O8FA 4CEIB 4RKFA 1W46A 1XTQA 3L8YA 4URWR 2FWRA 3N2EA 4FN5A 2YKGA 3C5CA 1QZXA 2V55B 4NE2A 1DO2A 4QFMA 3GEIA 3TBKA 3VKWA 1RRCA 2IYTA 2B7BA 4B44A 1ZIPA 1G7RA 1G6OA 1LFDB 1E9EA 2J9RA 1BIFA 2Q9AA 2V1XA 1IAQA 1VTKA 2IYRA 1RRGA 2BOVA 1M6NA 4A0RA 3REFA 1IN5A 1PJRA 3A1TA 3VR2A 4US1R 3OEHA 3AKYA 5D3MA 4HUTA 2J7KA 4US0R 1J8MF 2Z6VA 3GFTA 2VHCA 5BYJA 5JSZB 5KOYA 3TNFA 5LBIA 1UKVY 3FVQA 1K5DA 2FX3A 3U7GA 1IHUA 1EWQA 2IYZA 4G5GA 1DAIA 1E2IA 5IK2A 3D6TB 2VHUA 2J5XA 4HAUA 3BH0A 4POAA 1CEEA 1T5LA 5BQ5A 5HZHA 1AGPA 3CX6A 2F55A 1Y63A 1A2KC 3R9XA 1U94A 5CB8A 4F4JA 5LB4A 4NYJR 4MYTA 2HYDA 4RD3A 3VU9A 4C3ZA 2V1UA 3I32A 1EFHA 1XB2A 3CNOA 4HZUB 3LVRE 1G7CA 4DDUA 1D6JA 5GJBA 1P9NA 4TQUS 4I1VA 3M0EA 3P4YA 2VA8A 2GBLC 2NOAA 1R6BX 4XIGS 1CS4C 4PQYA 4WBSA 4Z8XA 2EQBA 1EFRA 2C99A 3QXJA 3UMFA 4URVR 2BWJA 3O8RA 1CR0A 4PO9A 3LVQE 1CLUA 5FI0B 2R6FA 5G40A 5FL7A 3RS3A 4ACAA 3S1AB 4AKEA 1DAFA 4V02A 4EUNA 2H92A 3BFVA 1F2UA 4NP6A 3U3JA 3QPVA 2OXCA 5TV2A 3FWYA 3CWQA 3NWJA 4ILEA 2F9MA 4Q1BA 2CMKA 5FBLB 5GJWC 2ZPTX 4DCSA 3OFND 3N5CA 4AG6A 5EP1A 4QGAA 2HEIA 3U5ZB 2ZRBA 4ZI3A 4LHVA 3AEZA 1YU9A 4WZBE 3L0PA 3CRRA 4ZI2A 4OK6A 3WRXC 3QEOA 3PUVA 4CGZA 4YXWA 3RNLA 4JVSB 5EP3A 1SVWA 4R98A 2FGJA 4D82A 1KDTA 1KDOA 2IYSA 3DOFA 1AIPA 2N1BA 4TTRA 5FBQB 1G3IA 1ZNZA 4FINA 4HB0A 5FBVB 3E5HA 3LO5A 5BXQC 3TGPA 3QVUA 2WJJA 4I81A 1KIMA 4M53A 1Q57A 4QJ4A 2AHOA 4GPTA 3R7WA 3SQWA 4G0NA 1P60A 4O0MA 2RHDA 3ZS8A 3F0TA 4AKGA 2KE5A 3TAHA 2ZU0C 2VF7A 2EFHB 1QHHA 1TTTA 4EFLA 5E7IA 2PX0A 1KZ7B 5KNCA 2MMGA 4C0LA 2CEAA 1YKSA 1Q1BA 4GMDA 3K9NA 4ZDKA 4TLBA 1XTKA 3ZZUA 4KODA 4C2UA 4KCGA 3GJ8A 4JLJA 5KNDA 1T3HA 2ZSEA 2HV8A 4ZDIA 5JMTA 4CF7A 4IDOA 4A6PA 1YJ5A 4GSYA 2EFCB 4NONA 4Q1AA 4TQ9A 5GJCA 4RCZA 5H70A 1JNYA 1GIAA 2QMHA 2ZANA 4BLRA 1OT3A 4LDJA 4CT4B 3LBHA 1E2NA 2QGNA 3OIWA 4XD7A 4XVUA 4B3CA 1CP2A 2ZJYA 1P7CA 4M1OA 4ZCLA 4QKQA 1JAIA 3BC1A 2ZRAA 3SJZA 2NQ2C 3BFKA 1W0KD 2W2XA 3W9YA 3THWA 1N6IA 1NG1A 3CF6R 5SZJA 1UPTA 5B2ZA 4HDOB 1NVWQ 3FKSD 3GPLA 2CL7X 1N0UA 4TMZA 2ONJA 2B92A 1XP8A 2DCUA 3T1QA 1FQKA 4LYFA 1HT1E 2FFHA 3Q3JB 1Z83A 4LPSA 1WDTA 4O2RA 4JKYA 2PLFA 5KO2A 4RZUA 1W4RA 4ZPXA 1XFAA 4MYHA 1QHIA 1I4TD 4FIDA 5AR1A 5A5GA 3P20A 3AKCA 4XTRA 2VBCA 2MMCA 4QNMA 2IEZA 4TWZA 4C7OA 4UJ5A 2QP4A 2O0KA 2I3BA 4AC9A 6Q21A 3L8ZA 3OZXA 3K1JA 2JLXA 2PEYA 1NN1A 3K0SA 3KJGA 4P31A 1P6XA 4PR0A 3EX7C 5K8LA 1ZNYA 2OFXA 3KUCA 3SBDA 1AKYA 4NU0A 4A6XA 2W2TA 4I4LA 1TNDA 2EW1A 2Q3FA 3KQHA 1BS1A 3TUIC 4XVQA 5LB2A 3QI2A 4NHOA 1H8EA 4KFRA 4LK2A 1S3SA 2WIBA 3GJ6A 2ZTSA 3QKSA 2UVQA 4CW7A 2VHJA 2P67A 4C0JA 1COWA 2RCNA 3IBYA 3EAQA 4CT5A 5JRJA 4JVNA 5K8IA 2O0HA 4TMKA 4HDQB 3OIVA 4NPHA 2HXYA 2XGJA 2JLUA 4JSYA 1KO5A 2JLYA 1D9ZA 1JEEA 2ZSAA 2JJ1D 3LW7A 3N70A 4AD8A 1XTRA 1RYFA 4FMCF 5AUNB 1JALA 1EFTA 2VRWA 3REGA 5IHPA 3EZFA 5TXGA 4G3XA 2H7VA 2WOOA 2ZJ2A 4S35A 2B8WA 3WMEA 1T3SA 2DR3A 3QKRA 2HT6A 4KVGA 1DAGA 1PV4A 2OV2A 1GRQA 3RDPA 3RLFA 2HF8A 1MABA 1G64A 1E9RA 1ZM7A 4D25A 2ATXA 3ONWA 4RJLA 1OXSC 3R9IA 4GDFA 1SXJC 2HDNB 1SXJB 4ZDJA 3GLIA 3K0FA 4N3NA 2FFQA 1KNXA 2YZ2A 2PZEA 1W0JD 3EIHA 4YQFA 1E9DA 2A5YB 4DEXA 4BEJA 3VMFA 1JQJC 1TEXA 5KUTA 5BN3A 2OXRA 1E2MA 2QEQA 4AYWA 3DMDA 1NLFA 3PENA 1XPUA 3BB3A 1TL7C 3P4XA 2ZJOA 1VG0B 3CLVA 4WA7A 2J0UB 1UJ2A 2FFBA 5DGXA 1I4DD 5BW8A 3K09C 4URZR 1T4GA 5FPSA 4ZCMA 2WJGA 4TL7A 1ETUA 4LC1A 2FNAA 1XEXB 3CR7A 1FTSA 3UMRA 1ZYUA 4LHWA 4D0LB 1Z0FA 4IDQA 3M6AA 1IOZA 3W8NA 4PFSA 3W34A 3WBJA 3QBVA 4A2WA 4KBFA 2X1VA 1BH2A 2J0SA 4A0FA 1N6OA 3CB4A 4BASA 1L4UA 2CCKA 4RSGA 4UNRA 5FTLA 1PLJA 3IPXA 1P72A 2V6IA 3GMTA 2O8EA 3KTAB 2ODEA 3U3MA 2ZYVX 3A1VA 2GCPA 5FH9A 4U00A 2IS6A 1G7SA 3OE7D 3GCGA 4MRSA 1WCV1 3WY9A 3W5IA 3RWOA 2VPPA 5C2JB 1R8QA 2V7QD 2ODWA 4D4JA 1Z6XA 2QM7A 2GZHA 4NDZA 3SC3A 2IYWA 1X86B 3ZH9B 3ZS9A 1XPOA 2VSOA 1ZC4A 3ETLA 3MWKA 4Q4HB 1V43A 2Q3MA 4N0DA 5IDVA 4EPWA 2GA8A 4Q01A 1X1SA 2WWGA 4D0NA 1NY6A 4OQNA 4OL0A 1BYUA 3LY5A 4LC0A 3Q5EA 4UNQA 5FOXA 3ASZA 1W4CA 4YLGA 1KSJA 4BLOA 1XMSA 3HYRA 3RC3A 1M1YE 5BN5A 1UFQA 4B3FX 3NC0C 3SQXA 2WWWA 4C0KA 3QG1A 1JPNA 1E0JA 4MGYR 4YC7A 1N25A 1GILA 1XJ0A 2J1LA 2WKQA 2Q0HA 2GJ9A 4A1FA 4DB2A 1N3BA 3T61A 3BS4A 1U99A 5DNYB 4KJZA 3DDCA 1CTQA 1JEDA 3OESA 5CJ2A 4HB2A 3SFZA 4QC2A 2OT3B 4LZZA 2CBZA 1UBEA 2ZRHA 4I1SA 4BUJA 2ZM5A 4B3DA 5FTNA 3GFPA 4O2LA 4KBGA 1CULC 2QSYA 3U44A 1CR1A 4WW0A 3C4JA 5DN6A 1MRNA 2CXXA 2C95A 4O25A 5C1BA 4KVAA 4RVCA 3A8TA 3K9LA 5FOUA 1E9BA 3BERA 3MG9A 1BMFD 3K0CA 2XITA 5JCPA 2CLCX 1RRFA 3TUJC 1JR3D 3IKJA 3ZZTA 4JLOA 1XBTA 4PAOA 1YE8A 2RGXA 4KHZA 3TLXA 3WMGA 4MKIA 3WYGA 2ANBA 3A4MA 4JKIA 5TVKA 3VR4A 4EKDA 2IXEA 3PEVA 3X1ZA 3WNBA 2ODNA 1VECA 1BYIA 4LHYA 3CZPA 4RD0A 3MGCA 1CR2A 1ZM3A 4ITRC 2G0TA 2R44A 3Q7PA 3VNVA 1DOAA 1E2JA 2RH5A 1AKEA 1KKMA 2W6ID 2HLDA 3AP3A 4JJKA 3RC8A 3SJBA 5C4MA 4CEJB 1TQ4A 2IF2A 2GF0A 2ZRKA 1U8YA 3H86A 4XWAA 4BFXA 1G5PA 4Z51A 4B2LA 2EFGA 1XXHB 3RAPR 2D4HA 1KI7A 5HCNA 3C41J 2GCOA 4FW9A 5FUYA 4TLAA 2Q21A 1KKLA 1BKDR 3AVTA 2C03A 4UNSA 4HLDA 2YV5A 1RJ9B 3T1VA 4X8HA 2P5SA 3CR8A 5DI3B 5DHFA 3IGFA 4LPKA 4R7ZA 2C78A 1S9DA 4RD4A 1XCGB 3CWZA 5J40A 2J7PD 2QMOA 1UKEA 3I5XA 3TIFA 4JYBA 2FA9A 2DFKB 1XZQA 3U3KA 2VSXA 4ZO4A 4AYXA 1CRQA 3FMOB 4GFDA 4TSFA 3K0AA 1SVLA 4PX9A 3IQXA 1ZRHA 2HUPA 2O0JA 4B74A 3RS0A 3KZ1E 3LAWA 3GJXC 2XXAB 4M1TA 4I99A 4EJSA 2O8CB 2WAXA 3PIRA 5EXXA 1G7TA 1Z63A 2XZOA 2GEVA 1D2MA 4JVMA 5EP4A 3SNHA 1Q1QA 1P3JA 2OCBA 2AN9A 2ZIAA 1HTWA 3EZ9A 2GEUA 2R2AA 4OI0A 4YMWA 5JZVA 3ZLJA 1I4LD 1Z29A 4M1WA 2JDIA 4D2IA 1JXMA 5JLJA 5FTKA 4AK9A 4PQFA 1F6BA 1Z6TA 3RYTC 5L3QB 3LFUA 1VCOA 1ZD9A 1RPZA 5EE9A 2D74A 1W47A 2EFEB 3UWOA 2JEOA 2P2LA 1P2SA 4D81A 1S1MA 1N2CE 2FV8A 3B9QA 1S4QA 5KSPA 3CNLA 2KBEA 2OM2A 2QAJA 4NMMA 1QDEA 5LPNA 5FBRB 1L4YA 4Q1FA 5AUOB 3EPHA 2UKDA 3G0HA 3HJNA 1XD2A 4ZDWA 4D80A 3QXHA 4TLDA 4OI1A 2X2FA 4P4TA 5DI9A 1HH4A 1KK2A 4PO8A 3BAFA 2ZRNA 4Q9KA 2RGNC 4U02A 3FTQA 1UM8A 3RSOA 4LJ8A 2N42A 4Q4AB 4Q4JA 1GM5A 2QL6A 1W1WA 5SZKB 2H57A 2V3CC 2NG1A 1Q1EA 1LF5A 3NHAA 1S2MA 2NPIA 3KKMA 2OBNA 2F3RA 2JIZA 5JEEA 3Q5DA 2QBYA 2FU5C 3EA0A 3ICEA 1G4UR 1JPJA 1S1CA 3RABA 4QBFA 1P75A 5H68A 5EE5B 4QNRA 1NI3A 3AVUA 2ZAOA 5SZIA 1OH7A 3LWNA 4P33A 1Z2CA 3W6OA 4QBHA 2NZ8A 4KFSA 4AWXA 1OFIA 4LCBA 3LLUA 3T5GA 4LUCA 4MUAA 2GDJA 5HKKD 3OEEA 1XEWX 3QKUA 1Q22A 4DWJA 3ZVLA 2NO7A 3WYFA 1Z8FA 4KLNA 4Q4LA 2H18A 4XWKA 1S96A 2ZVQX 4C9BA 1UKYA 1DBSA 4RFSB 1H8HA 3ZVRA 5CB6A 3ADDA 4GZLA 2GHIA 2AXPA 1LB1B 3AB3A 1ZAKA 1QHXA 2ZAMA 3TMKA 3GLGA 1QG4A 1W2HA 121PA 2FE4A 2WPDA 4R2HA 5JJLA 2AKYA 1CJKC 4L5BA 3QF4B 4F38A 1KMQA 3GJ0A 1MV5A 1E4VA 4A4DA 2JLVA 1R5OA 1NBME 1HURA 1MO3A 2JJ2D 4QHYA 4C4PA 4GOXA 3L0IB 3FGNA 2ZETA 2QT0A 4DEYA 3T06B 5HE9A 3GJ5A 2WOJA 1G8YA 4QG7A 2ORVA 4HLQB 2IF0A 4K81B 2GJ8A 1Q20A 1SVKA 2NO1A 2WHXA 4JYCA 1VIAA 2GXAA 3I92A 3ZQ6A 2W2VA 3WYAA 3Q8XB 1KMHA 1F48A 3AF3A 3AKEA 2QE7D 1IY2A 5H8WA 1XCPA 2FF7A 5DE3A 4B35A 3SR0A 3MWJA 1OYYA 3SEAA 4V0MA 1QBKC 3A36A 5BWMA 1QHGA 2GK6A 4KLZA 4DC9A 5JSZA 4NBSA 3UPUA 3I62A 3DEFA 3KB2A 1G8PA 2NGRA 3BIFA 1FW6A 2WIAA 5JWOA 1OPXA 4PSAA 4GL2A 2GWHA 3RRNA 5AJXA 1N5IA 1KO8A 1VHTA 2CCJA 3I73A 3C7KA 3NEJA 2EU8A 1Q1ZA 1U90A 1IY0A 2QN6A 4WVFA 1UAAA 1R4AA 4TLCA 2BKUA 4M1KA 5G3ZA 4WXRA 3B82A 4IEIA 1GNPA 2ZVPX 2F1JA 1KNQA 3FDIA 3LH5A 1N6RA 4GT1A 2IK8A 1GOTA 1NY5A 2H1LA 1J7KA 1WXQA 3F5FA 4HZUA 1XD9A 1A2BA 3GLHA 1X8LA 3DKVA 4IOKA 2IWRA 4DDTA 4JLDA 1T3LA 2GBLA 3HP1A 5F9HA 2XZPA 1HUQA 5KSZA 2P0EA 2XNDD 2VP6A 2C9OA 3SZRA 4N1AA 3CPJB 3B1YA 1UDXA 2IWHA 3S1AA 1GWNA 3DM5A 3GLFE 4MGKR 1FOEB 3QJYA 3CPEA 1AQYA 3I61A 1J90A 1E2EA 1IBRA 3AF2A 2Q9BA 4LJAA 4LY6A 3IDQA 3OIUA 5CDFE 1T0JB 1YRAA 2WMNB 2AWOA 3BJIC 3OFNA 2RGDA 4RZ3A 1MRSA 2OO7A 2MSCB 4P32A 2AWNA 3A37A 4BWYA 1OF1A 1OHHD 1NNEA 4Y0AA 1DS6A 4QRHA 3KQNA 3IQWA 3DMNA 4G5RA 2R65A 4DDVA 5LDDC 3U61B 1SXJE 4ZKEA 4OK3A 1XMJA 4HAVA 1NIPA 4IVQA 5CM9C 1K8RA 2QPOA 3KFVA 5KDLA 1D5CA 1GRNA 4A82A 3UG7A 1CJVC 3RRYA 5TB5A 3ADBA 2JJ8A 2RMKA 4C0AC 1WBBA 5B30A 1N6KA 2NZJA 5FR2A 3T35A 1DVRA 1VDZA 4TMVA 5FOVA 2DYKA 4RCYA 1Z06A 4B6FA 1UEJA 1NLZA 3EIEA 4HZIA 1E2DA 3FMPB 4JLVA 5FR1A 3ZIAD 5KYKA 5HCIA 2H5EA 1OFHA 2F9LA 2ZYWX 5KSOA 2BBWA 3CBQA 1WE2A 2ZRPA 2C2HA 3QPWA 4OJQA 4LSGA 4BLPA 2CHGA 2GF9A 3TVTA 4HDCA 1IXZA 1Z6AA 1D9XA 1G21E 1ZD1A 1LTQA 2CK3D 1VG8A 5AJWA 521PA 2RGAA 5D3MB 2WZQA 2ONKA 2JA1A 1YZTA 1QHNA 2PEZA 3EA5A 4OHVA 4DLWA 1OKKD 4M21A 1E1RA 4KYUA 1NN3A 1NMZA 2RGCA 2QP3A 5CJPA 5IRCD 2OCPA 2AKAB 1N0WA 2QSZA 1XMVA 3QXXA 2CCGA 5IK2D 2O8BA 3QF7A 1XPRA 4UXIA 2GK7A 3GJ3A 1HA3A 2ODBA 2ZREA 5FPYA 3RS5A 4Q5IA 2EYUA 2YOHA 1W0KA 3B9PA 2OG2A 2ZRIA 1FMLA 1G3MA 4C2TA 4FI3C 4DSTA 1G19A 1II9A 1F2TA 2DHRA 1PLKA 2PL3A 3AGPA 5CITA 1YZKA 3TRFA 4NL4H 1E2LA 1SQ5A 2QP9X 3IPYA 2VO1A 1EFRD 4DCTA 1IXRC 4URYR 3OIYA 3T1OA 4Z1MD 3AVQA 1G17A 2BV3A 4IW3B 1CRPA 3GD7A 2PMDA 3F8TA 1FPMA 4OBEA 2BVNA 5FL7D 1ZM4A 4A8JC 4L16A 4A8JB 3V4FA 1U98A 1WRBA 1Z5ZA 4PC2A 3C15C 2AD5A 3E2IA 4KO8A 5AJYA 3U4QA 1U0JA 5D3QA 2YC2C 4HYYA 5FTJA 4GI7A 2ANCA 2OFOA 2FG5A 2FSFA 4ZIRA 1NBMD 1RE0A 3K53A 1TF5A 2DBYA 3VR3A 2R9VA 4M0LA 4OQXA 2OCYC 4DZZA 3NTUA 1RKBA 2QA5A 4HLUC 4M4SA 1RYHA 2WBLC 4TTQA 1JQLB 2CVHA 5B57C 1KI6B 2FH5B 3PUYA 1KI2A 3FPAA 4XVRA 1ESNA 2ORWA 3X1WA 3A6PC 3AGQA 4KSCA 4GP6A 5EP2A 3V4RA 1JR3E 2QY9A 5FOTA 3HU1A 1NVVR 1X8JA 4W9MC 2YWFA 4RFVA 5P21A 1Q44A 3AV0B 3ADCA 4B3GA 1ODFA 4IDHA 1NVXQ 3RRZA 2OHFA 5K8UA 2ATVA 2GXUA 3B60A 1VG1A 3CRVA 1ZC3A 1KK3A 1ZP6A 2JJ1A 2WWXA 4IOMA 1E2HA 2J45A 3D7MA 4MGIR 4Q7JB 1US8B 1VCIA 3I8XA 1PUIA 3TK1A 3I3SR 1G18A 4K46A 3DZDA 1FQJA 3TAUA 3PUXA 3GEHA 4OHWA 1C1YA 2FN4A 3Q7QA 4UXHA 4C0QC 2QENA 1T91A 1G41A 2QUZA 5AUQA 3GQBA 1EX7A 5FI1B 4AKHA 3NEYA 4OQFA 1XXHE 1OXXK 4HLCA 3ZQJA 2FSIA 3X2SA 4TTPA 4G5SA 2ZE8A 1Z47A 4P0TA 1W5SA 3ND8A 3LRPA 2JLWA 3IEVA 1Q3HA 3MUFA 4P4SA 1XD8A 4XD7D 2J59A 1E2GA 1ZU4A 2CVFA 2ZJ5A 4M1YA 1OH5A 4LJ6A 4HB4A 4FXPA 4JIMA 4II7A 3THWB 3PCRB 1FNNA 4DLUA 4MA4A 2F6RA 2AD1A 2AX4A 3K09A 3N2IA 3GLFB 2D62A 1U8ZA 1UBCA 4DJTA 3AM1A 1J99A 1GNQA 4KFTA 1NKTA 2HJGA 3DL0A 1XEXA 1RC8A 4NZYA 2P5TB 3RS7A 4B43A 1KK1A 4LV8B 1B0UA 1GNRA 2OUKA 1MR3F 2GAAA 4J0QA 5UKDA 4MH0R 1R5BA 4BFUA 2CJWA 1HV8A 2DB3A 2RGGA 3P27A 4RZXA 4AG5A 2QU8A 3HU2A 1ZMXA 4JT4A 2V54A 1OFUX 3CX7A 2A2ZA 5FOSA 5AWFC 1UADA 4JL8A 4Q02A 4IFBA 4P4UA 1SXJD 4PAMA 3AUYA 3KTAA 4JL6A 1FUKA 2ZS9A 5CYOA 1U2RA 4Q7KA 3KXIA 4DCUA 4Q1DA 2ZEJA 2QT1A 3C5HA 2XSZD 3TSWA 2C77A 2IA5A 1FMJA 2V7QA 2QAGA 2QROA 1P5ZB 2G88A 4EPXA 5E7MA 3VKHA 2R6CA 1E2FA 5FTMA 5F98A 4AURA 3IIKA 2CHVA 2Z5FA 4GMXA 3GFOA 3SN6A 4JVLA 1XDBA 2GJAA 1LW7A 4XSHA 3QKSB 4DT1A 4Q9LA 1TMKA 2OEPA 3V9PA 3Q72A 4IJMA 3QNUA 2G1KA 2CNWD 4AYTA 1S9HA 4TL9A 1ZUNB 4JJZA 1COWD 1CU1A 2HXSA 2JAQA 1HY3A 1KO1A 3B85A 5JS7A 2A30A 2XAUA 1NF3A 5FOWA 1JR6A 2Q6TA 2FZ4A 4QM6A 1T8UA 1VMAA 3O8CA 3CPHA 1XX6A 3L2OB 1G4AE 2NO0A 1G3RA 1XEWY 2BMJA 1R0XA 2EWVA 2OILA 4Q19A 2G9NA 3T12A 2NIPA 4BFYA 5JI3E 4RD2A 1E79D 4BGDA 1IN8A 1Q0UA 2RHMA 3NH9A 1ANKA 4DUGD 4GP7A 1SVMA 2ZRCA 2WICA 2NPFA 4M22A 4YMUA 2ZSDA 1D2NA 2HF9A 4A0GA 2VP4A 4PC7A 5EZ6B 2I1VB 3TW4A 4JMPA 1JB1A 1VKJA 2A9KA 1GZSA 2X8AA 4JL5A 4DB4A 3A58B 2J0QA 2HJVA 1D8TA 3PEWA 2O5VA 3KKQA 2XOKD 1OB2A 4QHSA 5CYPA 4LX0A 4HI0E 4D6PA 4TT3D 1BMFA 1KI8A 3MCAA 3GP8A 2W6JA 1WF3A 1XZPA 4YDHB 2OSBA 1GVNB 4IKEA 5DSZA 3EPJA 1GKUB 2QRZA 1YR8A 1CKEA 2VIIA 4Q1EA 4QGFA 4UXJA 1DO0A 3CW2A 1FP7A 1W48A 4MYUA 4E09A 2FEOA 1Q12A 2GRJA 1N5JA 4LRWA 4UQOA 3O8BA 2OESA 1ZIOA 5FPKA 3NBFA 4Z8YA 3AVPA 4OK5A 1VHLA 1PLLA 4PC6A 1XTJA 2IXGA 5FUXA 1AZSC 4QBGB 2ZYTX 3KQLA 2W6IA 3W3AA 5JEDA 1E6CA 1AA9A 1Z0JA 5TDHA 1LNZA 4IVRA 1MT0A 4M9XA 2D7DA 4Q66C 4F4CA 3THYA 4BRWA 2ZR9A 2WM9B 4HUQB 2IYLD 2WVJA 2WWYA 2HYIC 2O8EB 4JLKA 4ZV4A 1KZGB 2ZJZA 2R8RA 3K70C 3K70B 4GRAA 3K70D 3LX5A 2A5FA 4KXFB 2WJHA 5KHOC 3CX8A 3CRQA 1OIXA 1Z6GA 2EWWA 3HR8A 1Z08A 2VP0A 1RJ9A 5DLQC 1DADA 1VYVA 3THXA 4F92B 5IF9A 1M74A 1IQPA 4CRWB 2F7SA 4DIDA 3KDSE 5G53C 4XSGA 2PJRA 4L9SA 5KU1A 2KJQA 5DO9A 3WNDA 5JBQA 1M2OB 2ERXA 1ZNXA 3EWAA 4H1VA 3NKVA 4PC3A 4US2R 1DAEA 2QNRA 4Q7LA 2ZSFA 2PLRA 3MD0A 3U60B 3R9WA 3PITA 2I1QA 2XXAA 2IS4A 3FHTA 1Z07A 2JLSA 4IDPA 4NCIA 5JS8A 1NLYA 3CF0A 1IY1A 3TW8B 2O8CA 3QIAA 2D2FA 1G3UA 5CK5A 1EWRA 4TMWA 3V00A 2IYYA 4PO1A 3H1TA 2ZI6A 3CUEF 1X1RA 1CIPA 5IT5A 5JWRA 1F3OA 2PZFA 1E9AA 3FYHA 2VF8A 1VPLA 3KL4A 2XEXA 1MO4A 2ERYA 2ZE7A 4KU4A 1Z6YA 3SE0A 3LX8A 3LBIA 4EPRA 5B64A 5A4JA 5L3SB 4DSUA 3BGWA 3NBXX 4W5HA 1NVVQ 2A5GA 4H1UA 3EZ7A 1L2TA 3R20A 1SGWA 4B6EA 1CXZA 4L8GA 3I72A 1G5TA 1NMYA 4G5QA 4QOSA 1GL6A 1EX6A 1I2DA 3KKPA 2V9PA 2ZI4A 1WA5A 4LV5B 2W58A 4NCJA 2G6BA 2AFHE 2ORIA 4PPFA 4D4LA 4M9QA 1N6HA 2Z83A 1TU4A 5FUWA 2QGZA 2VHTA 4URXR 1NVUQ 2RGNA 2GNOA 3ZYCA 4Q4AA 2WKRA 4R71A 1T0HB 3EARA 4B76A 2BEJA 2AR7A 1KI3A 3TH5A 4MKHA 5LD2C 1G20E 2VH5R 3QXCA 5LD2B 3VNUA 3KKNA 1MO6A 1R7RA 1W49A 1ZCBA 5C46F 2ZI9A 3H0KA 4DIEA 3VAAA 1G6HA 1IM2A 5J4LA 4MGZR 2F43A 1AZTA 1I2MA 2FOLA 3NBYC 4EPTA 2D2EA 4B73A 1JAHA 1TQ2A 4A0HA 3KJIA 4F4IA 4TLEA 4BRUA 1RRPA 1Y3AA 2WV9A 3NIBA 3PXGA 2PBRA 1KAOA 3LA6A 4BFTA 1ZM9A 4F93B 5L8VA 2BJVA 2VHQA 4ASUD 5HKKA 1ZUIA 2YHSA 4PQRA 4TL6A 4X8MA 1Z3IX 2OBLA 1E0KA 3SHWA 2VQSA 3TE6A 3PFIA 5BYKA 3MMPA 3OHMA 3BK7A 2YOFA 5AJVB 3NXSA 3L43A 1PZNA 4GNKA 4RFSA 3U6KA 4ARZA 1Z0KA 3B2EA 4A92A 2FPLA 1ZBDA 3LNCA 4KYIB 1J70A 1EESA 3QG5A 4PXAA 1FP6A 2P6NA 1HEIA 1XJQA 2AL7A 1YZGA 1DAHA 4XJXA 1Q3TA 4C0HA 3QF4A 1GRRA 3AVXA 3CIOA 4DLYA 2JLQA 1KTVA 3QPUA 4TMXA 1OIVA 3LV8A 1OLOA 2BMFA 2BM1A 4JLBA 2F3TA 1X3SA 1GL7A 2VTKA 1R5NA 2WSSD 1U9IA 3AP1A
chains in the Genus database with same CATH superfamily
3N87A 4M98A 1G38A 4C2BA 4W8OA 1VL5A 3PXXA 5LN1A 3NHSA 3ZDCA 1LTKA 1F14A 1QGUB 3HNRA 2ZUBA 1GCGA 1JE0A 4KAAA 1V45E 3GFVA 4GBGA 4PC1A 4I4CA 3EISA 4DRXB 2DBRA 3FPEA 1L3CA 2IIPA 1PGQA 1RRKA 1XRNA 5L4NA 5KSWB 3T41A 2BFCA 1PFGA 4MQ6A 3DBLA 3FTPA 3C8UA 3LPMA 3SZMA 5EJMA 1U1CA 4LZLA 3K5WA 1Y5MA 2CB9A 2DR2A 4CU5A 1RKVA 3PQFA 1AHNA 3ZEIA 1U7PA 1POWA 5C31A 4FX2A 1P81A 1FDUA 2Y71A 3UGJA 1TIPA 4JASB 3ETGA 1FE8A 1UJ5A 1OMOA 3TRIA 3DDHA 4BVAA 4JBXA 3HBJA 4I1UA 1OLSA 1XJCA 2P3LA 1PW7A 1RWVA 4LBWA 5DSTA 4L4XA 3WKDA 1MXHA 5AVUA 5LFAA 1QCYA 3HB0A 1PR6A 4CEIA 3TUZC 3QM1A 2A78A 2ZB2A 4UTOA 3I45A 4YP1A 4YRMA 2QW8A 4X1YB 2FPXA 4G4IA 3KSMA 4UHDA 5CDUA 5JARA 1QIHA 1YJAA 4IXNA 1A9QA 4H35A 2OV3A 1L0BA 3DZJA 4KOAA 4YDRA 4EHIA 2AI3A 4WXPA 4P1ZA 5AK4A 2R6GA 4YRJA 2Q5EA 4HDNB 4F0JA 4HYEA 4B79A 3D3WA 3LVBA 3II6X 3UEOA 5ABPA 5JATA 4F21A 4FWTA 1T1GA 1EK6A 4B9EA 3WMRA 2VUTA 1PFQA 1Z75A 4G1MB 4NQRA 2QBYB 1NP7A 2NPOA 1R6UA 5E95A 3W4IA 4CM5A 2C5EA 4JP8A 4OA5A 4X84A 5CLFA 3FTNA 2JIBA 3EBLA 3K9GA 3U9TA 3PNMA 4B47A 2PAAA 1WXHA 3WSVA 3UHAA 4BMZA 5TARA 3VNBA 3DLIA 1S89A 1TF2A 4UUAA 2H8GA 3ORFA 4F9FA 3AERB 3LPCA 4RKEA 2GTPA 4IX9A 4FUTA 5GVRA 5AUPB 5KX5A 2W37A 3X1YA 1M2FA 2MSEB 3OEED 4AX8A 2GM4A 1OAOC 2GS9A 2Q5CA 2V5VA 3QX9A 1SBTA 1WB4A 4CCYB 2C5LA 4TYWA 1PVOA 5CX1B 3B6EA 4OAQA 3JTMA 1TEVA 3AB8A 3ONNA 4FEAA 4MA5A 1P62B 1JBEA 2YJTD 4JSTA 1H2BA 1MDBA 1E2PA 2VXCA 1X0VA 3T7AA 1E0SA 3OD5A 3TG8A 2GM9A 1B43A 3DFIA 4FC6A 4MDEA 3TZ6A 1T8PA 1K27A 2QX6A 4BB5A 1IRXA 1U7DA 2R1VB 3DE0X 4XOIA 3RHZA 3KXDA 4RMIA 3RFVA 2VP9A 4J90A 5AVQA 1BROA 1CUIA 1IZZA 4M9SA 2GGSA 3W1WA 3A9RA 1ZJWA 2HWWA 1PWHA 2C2ZA 2OY0A 1A8QA 1WQ4A 2RGBA 4HR7A 4J29A 1MVLA 4TYMA 3H04A 3BB1A 2EOAA 5DTJA 3FPSA 3JVVA 3OAAD 2WILA 1E1QD 5G0WA 5AQEA 1W76A 3ZWQA 4XQ9A 5HTOA 2ZBFA 1WV0A 5CLQA 3FNGA 1LU9A 1N92A 3MM4A 4GOOD 3WFJA 2CXTA 1KR5A 2PCJA 2ZTLA 3CRW1 3U56A 3ET5A 1HE8B 2XUZA 2QTVB 4IF4A 2NQ8A 3U9SA 4IXMA 3JQCA 2WWVD 1M5TA 3NBMA 3IP3A 4LYHA 1XDDA 2CK3A 5EIFA 4E5MA 3NHBA 1ZIDA 3PPIA 4AICA 1LNSA 2IUYA 3C6YA 2E82A 2I6TA 3PEYA 1JKXA 2AJCA 1Z22A 4Z1OA 3TR0A 5IG2A 4D42A 3I5AA 2JK0A 1WDKA 1DJPA 1SNYA 1SB8A 2C8VA 3AR3A 5EQTA 3RO7A 3SSOA 4C0SA 4OHKA 1CYDA 3LPNA 3INGA 9MHTA 4PLVA 2ZIGA 3B7GA 2EVWX 5FT9A 4UW9A 2ZUFA 5GADl 1RPNA 1YBHA 5FBWB 1U5AA 5G1NA 5FI5A 1AK2A 3ROKA 1V5WA 3HO6A 5JWHA 1MU0A 2J9FB 3RYIB 5A2QA 4OHXA 4S1PA 3V8NA 2V8OA 3VJRA 1Z33A 3H42B 3TR6A 1SUSA 1NIJA 2EJBA 2G1JA 3O91A 5ENVA 1OROA 3UKJA 5BPHA 1PJZA 3D8RA 4B85A 2DP4E 1PVVA 1YIDA 3KEMA 4ADSG 4DA7A 5AP9A 3AR4A 3MAGA 1U28C 2I4OA 1KHTA 2NLOA 1IONA 1LV7A 1CFZA 1XZBA 4XB6B 2XI4A 2B8JA 1O08A 1CDZA 1OPRA 3GLHB 4EARA 4M2LA 1QE3A 2XBMA 3G1TA 2H48A 2HFKA 3DXXA 2Q2WA 1PT5A 1W4ZA 4MRPA 2FX2A 1AN0A 2PU5A 1JBKA 3PE6A 4FI3F 3ZGVA 1JRLA 3BYZA 4L5CA 4NZZA 4B6OA 1UP4A 2QYTA 1XA4A 1PNOA 1JU4A 1MAAA 3ZOKA 2RSLA 2IPAB 2YY6A 3IAXA 3ZWAA 2KLHA 4Z49A 1TUGA 1C5KA 2REBA 4JCCA 2ZITA 2ZZMA 4JGBA 3M4YA 1ZKMA 1WBDA 4HD8A 4DL9A 4DNXA 2ECPA 1PSDA 2P9JA 2YIDA 1LCIA 4EHNA 4YJ2A 3IR5A 5TY0A 4BZXA 1HQKA 4GKJB 1JDZA 3C3EA 1JXAA 1E1MA 2FP4B 4LXTA 1KZHA 4EX6A 1NBMA 1FRNA 4BLUA 4Y2QA 1VBNA 2P6UA 1BFUA 3LO8A 4GZMA 1ZU5A 2HQBA 3RS2A 3UVEA 4H4EA 4AIIA 1E5QA 4B3BA 3U7EB 1SZPA 2DFVA 1KFJB 1U4NA 4TV9B 3JRNA 1CQPA 1RMQA 3RF7A 1TCBA 3BFJA 3PE4A 4IIBA 1QB8A 421PA 5TMDA 2Z2KA 2ZTHA 3R7FA 2C9ZA 3JAMA 1CUBA 3SNKA 2VYCA 3BORA 3QEBZ 3OICA 1NR1A 3F4BA 2XDWA 3PG5A 2PCLA 3O47A 4O2AF 4S3MA 2E87A 4UU7A 4JHLA 1IC6A 4LGYA 1ADCA 4YMTA 5KSYA 2BHRA 4ARSA 1BCSA 4ISCA 2C04A 3QFHA 1CF2O 1YZUA 2YWBA 4W6QA 4G1UC 4V0OA 3DLHA 4KWEA 1KK0A 1CD5A 1N2GA 3ORSA 4OP3A 3WYCA 3SS9X 1J42A 2GT1A 2OWEA 5EN4A 3UK1A 4NYIR 1SUDA 1X38A 3NCHA 2BBTA 4X71A 3RWMB 1N9GB 1QV6A 1EGAA 3EA4A 3O1IC 4O33A 1P45A 2NXWA 3C3WA 1GP2A 1XMIA 3OF5A 3UQZA 2VK8A 4O8CA 2R751 3FHJA 4ZOEA 3H5WA 2TYSB 3P9YA 3VNRA 4MVCA 1EWVA 1F8XA 3IAFA 3P9XA 3QWBA 2Z0MA 4KGZA 4LSZA 3H84A 1FNMA 1SBZA 4JWTA 4TMFA 3V7YA 4E5UA 1HRKA 3KVYA 3OCZA 2WW8A 3L40A 5ANRB 4K7JA 4X41A 3IHKA 2DJ5A 3B51X 2V03A 1E3MA 3P32A 2P9CA 3BKWA 3CV3A 4F6LA 1B8PA 1G8GA 1XQ6A 3RS8A 1N5KA 5HDBB 1H1LA 2G36A 2JLZA 3MWDB 2H0AA 3N05A 2IP4A 3GMDA 4W63A 4M3NA 3TCNA 1KMCA 2HR1A 4M9CA 5BR4A 5DNCA 5JBNA 4LZWA 2QR3A 4JXKA 1RZUA 4AN1A 4Z7JA 5DOVA 4I3GA 1FRFS 1C9DB 5K3FA 1ZEMA 4WINA 3A70A 1KYWA 2ODQA 5AOVA 3SBXA 5EXPA 3G5LA 2D06A 2CC2A 1XCJA 5IFLA 4E31A 1CJTC 3I52A 1F4LA 1ZMBA 3I9LA 3M4JA 4I5DA 2PHZA 4XUEA 1GPLA 2YXEA 1P5HA 2X41A 1NBIA 2PSJA 2TRSB 3G2LA 2Q9CA 2BGNA 1CDDA 2C07A 2JA2A 1OJLA 3HXKA 3MJDA 4ALNA 1H2HA 3GLFA 4XD2A 1PAUA 1F2TB 2A5DA 4OI2A 5B58T 4ZICA 4QBTA 1G8FA 3OKCA 2G17A 5KNCD 3P1JA 2DUWA 5FL3A 1L4FA 2V3VA 2I4IA 3I83A 2IYUA 4GXNA 3VV2A 3EWNA 3LNTA 3Q6IA 2FMFA 3Q7SA 1TVMA 1OW3B 2PUTA 3OTHA 1X8KA 2A4KA 5EPUA 5G0SA 3SZGA 1HORA 4AZWA 5FJIA 3ZD6A 5JO0A 4O0LA 3WRYC 2DBQA 1EA7A 5ITZB 2LIPA 4H77A 4ND8A 1AT1A 5F73A 3H5RA 3MYYA 3U7FB 1SHJA 1W0JA 1XN4A 2NTJA 4AY6A 2H5LA 2YS6A 1FDSA 2AJTA 2V6BA 3AUTA 3MJRA 1M7BA 1U2DA 1E9CA 2YWHA 5FAXA 2B98A 3BE5A 2HX1A 5FUVA 4ZT4A 5KINB 2G9UA 4MJXA 4QQ8A 4YONB 5KAMA 4HEA6 4CVNA 3LLVA 4P86A 2XB2A 3WGTA 2JAOA 3A9WA 4GX5A 1XQYA 3RVJA 3GVCA 2I55A 4TTSA 2PJDA 4YT4A 5KWVA 1NYTA 1ZK2A 2WYVA 1NJGA 3F6PA 2JL1A 2G77B 4YRBA 3NOQA 1XAHA 1Z0AA 4MV1A 4DAOA 1KYVA 2ZW9A 2WU1A 1OI7A 4A15A 3I4LA 4K9MA 3NDBB 3VYTB 2CNWA 1UDAA 4RAQA 5DW3A 2FMIA 3ORYA 4UDXX 4RXMA 1XO1A 4F56A 1HDXA 1DUSA 5LOVF 5AXAA 4B6SA 2B5WA 3BA6A 4EG3A 5BN4A 3OQ6A 3Q9LA 4HYTA 4UCFA 4OV6B 4PPNA 1U2EA 3IO3A 5EMMA 4YACA 3GGSA 3LP8A 3KHSA 5IBQA 3VO2A 2X0DA 1B41A 2PSDA 4EAQA 4C7OB 1FFYA 1KMIY 2ZDGA 1F12A 1YZNA 2RK6A 3DYVA 2EL7A 4Q3DA 1AK1A 4ZN6A 5IKEA 2HW8A 3BEOA 1E79A 2ZQ5A 2DPXA 2DT8A 5LQUA 4IIEA 2WU8A 2YYZA 3EK2A 4LYAA 3BJEA 3S5JA 2L0XA 4LJ4A 2HA2A 5AKZA 5IDXA 4RESA 2AC4A 2ZT5A 4ERNA 2I7XA 2J87A 3LUFA 3O8OA 2ZI7A 1CP3A 1JFFA 4U5XA 3ASVA 2NACA 3RSSA 1ZGCA 1AF4A 1VLZA 1VPEA 4WESB 3W5UA 3HJAA 4EPVA 4MJ7A 4Y2YA 1ODIA 1NNUA 4ZPJA 1TYCA 4NYMR 4D4KA 2R3SA 1Z17A 4V24A 5IDWA 2XCLA 3EEYA 2GEKA 1Y4ZA 3F47A 3FTFA 1R2QA 1B16A 3E03A 4WZ6A 4OGLA 3B48A 4P4SB 5DT9A 2D2XA 3KUDA 4LXGA 2COEA 1R9NA 2B1RA 2AEJA 3V2HA 1M7HA 3CH4B 1AGNA 1P2UA 4GSLA 2WTMA 4WZZA 4JI8B 3FI0A 4LHXA 1NSTA 4R8KA 3ZHRA 1MA3A 1ODSA 4QDUA 4Y1RB 2W00A 5D8DA 5EHXA 5DT2A 1LLUA 2X8JB 4B80A 2R66A 1NJ6A 1TU0A 2P6RA 4W5NA 2YJ6A 3KD3A 3RSQA 2GRUA 5DZSA 3USCS 5CA0B 3OQ1A 1ZSYA 2H4XA 5DEIA 3KT6A 2I34A 4UBMA 3CE9A 2ORED 4QXAA 4OLHA 3L4JA 2PZMA 4WBNB 221PA 3RUAA 3EDRA 5LP6F 3NX4A 4H0FA 4MEAA 2GCNA 2BTQB 3JXEA 1UL1X 1E5LA 1X6VA 4WLVA 5TT1A 1Y8CA 5L40A 4W6ZA 1HNZB 1KH3A 3EFBA 1FS4A 4BB9A 3FCOA 4KP7A 1NOIA 3RIGA 2W0MA 1FJXA 2Z30A 3QITA 4ZK2A 2L69A 3ETJA 2OVBA 3TECE 3AVOA 4WKGA 4MGHA 3KWMA 2BI7A 1HQYE 4UUQA 3AY7A 4L9WA 5C8YF 1HYQA 1WSAA 3VYRB 4N48A 1BE0A 1OH8A 4QYMA 1P9OA 1JR3A 1XG5A 3ELWA 4BX0A 1W34A 7YASA 3IBGA 1W7AA 2LNDA 5KYXB 4G5FA 4XUCA 2R6AA 3IQIX 3ZX5A 2BM8A 5AVSA 1E66A 5T8KA 3UYLA 2H1HA 3FDZB 1EXWA 2D0OB 3R3SA 3KQUA 1ZD8A 2B21A 2DY1A 2YWRA 2OV4A 4NK4A 4CV3A 3A04A 1KR2A 1QS0A 4JCOA 2KSQA 4Q7EA 1VSQA 2VPWA 1NZJA 3OCJA 5L3RA 4ZOLB 2OLJA 2AG0A 3TQOA 1L9XA 1Q15A 5G2OA 4DJAA 3FG9A 1DKPA 4KN5A 2IL1A 3ENWA 2GPNA 4O59O 5BURA 2VEOA 2JH9A 4Q9AA 5GIOE 3FPBA 3DEKA 4XB2A 2JBWA 3ITNA 1VKOA 1YGPA 3H83A 5HG0A 2ACEA 4HFNA 2V4ZA 4NJOA 3J7TA 1NUAA 2ZI3A 3EXIA 3UTCA 3WLPA 1FW8A 1AQJA 4MMYB 3T34A 2E1RA 4C4TA 3U5TA 2KX7A 3KFXA 3PDIA 3MCZA 3GDWA 3O90A 1CUAA 1E9VA 4BDTA 1JHMA 1AKMA 1E5VA 4EY6A 4LF8B 2ZR8A 1RLOA 2P62A 4H7HA 2DQKA 1TZJA 3FD8A 5J47A 1KRXA 1R9GA 2AW3A 4XFJA 3LE8A 3F5SA 5DYNA 2G6TA 4BJ3A 1L8XA 2E3JA 2J9XB 1H94A 1DPFA 3AEQB 5EHNA 1ENOA 1OLXB 1V2GA 4RACA 2WTUA 3O4VA 2OFWA 1Z68A 3CUKA 4DV4B 1NVTA 2EKLA 1R00A 3PC8C 4X95A 5DKFA 3KTDA 3P0RA 4CDMA 4PZLA 4HAZA 1D6SA 4G0PA 4OQDA 1B6TA 4KDRA 2Y0PA 4DGSA 4BNIA 1QRDA 3ZR4B 2YOGA 1AQUA 1XNHA 2CXUA 2W6JD 3W6PA 5CEFA 3FOZA 3M9WA 2LCIA 5AW5A 1IVNA 5NLLA 2XMDA 3CHYA 3RT9A 3PGJA 1T43A 3WRWA 2Y76A 2XJ4A 3QLUC 3GXOA 4X8LA 2VAPA 4HJRA 3LZ6A 1ZHFA 3AJ9A 4RIEA 3WLRA 3N2GB 3UCFA 5K09A 1D1TA 4YQYA 2FEXA 2MCFA 1Q5PA 4MW0A 2ZUCA 1NF9A 4QA9A 2NUPB 4R7TA 5DLEA 3WLLA 3KKEA 1Q21A 1JFLA 1FFGA 1ISIA 4UNNA 5B3KA 5C18A 2IZZA 1ZD5A 5K6RA 4TZ6A 3Q40A 3H9CA 1DEAA 1SQFA 3EGXB 4KO3S 5KQMA 2R85A 2XCUA 1BVYF 3UGTA 1E60A 2XMZA 3F7OA 5BV0A 4PG7A 3VHXA 2VP5A 3DPUA 1J0XO 1JFTA 3W77A 4Q93A 1UZAA 3TEFA 3O75A 5DN6D 1MC4A 4Z0TA 3DG9A 3GJSA 3WGNA 2J32A 4E5NA 3RVDA 2ISCA 2K7FA 4IVNA 3WE7A 4C0BA 5KZMB 2Z6UA 5ALPA 3P5BA 2ZGVA 1IWPB 3LXRA 1BKSB 3H9QA 3FRIA 1CDOA 3HSKA 2HMSA 3NT4A 4KIUA 4YP5A 2AX3A 2W83A 1K8ZB 3K2QA 2KMLA 4UHBA 4V0ME 5LMZA 3K9HA 3UKOA 1Q0HA 1XU9A 1P18A 1R74A 3AIMA 2J3EA 2GLXA 3I9FA 2ZSHA 1SKYE 3LQQA 3LU1A 3MJ4A 3OT4A 5LL6P 1WB9A 3NAMA 2GB4A 3RBXA 1KEWA 5I8PA 1A27A 2CLSA 2QVCA 4JLPA 4MP8A 5I01A 1OBCA 2PMWB 3D0QA 3WHLA 4BO7A 1RZ3A 2JGEA 3AI7A 1J2EA 2V6MA 3MGAA 3MQ2A 2RHGB 4QEZA 4BMDA 4BX9A 2XX3A 3ETDA 2P2CA 3TEJA 3THSA 2AC7A 4Y8VA 3FVRA 3HUEA 4EGAA 1DG3A 2C2YA 1BO6A 1PD0A 2WSYB 4C6HA 3GVHA 3ZOZA 2BCGY 1SA0B 3DOHA 1TZ2A 3C1OA 4L51A 5EZ5A 1WNTA 3CQ9A 3VPSA 4AMGA 3ROQA 4U0KA 1II0A 3WIOA 4OD0A 5AKKA 5I5EA 3FAKA 2AE2A 2I3ZA 4LJYA 4WXHA 1A98A 1FMFA 5CDHA 4BYGA 5J4VA 5GZ6A 4MW5A 3TDMA 1Z4JA 4CWAA 4CEHA 3OHPA 2ZSBA 2P6MA 4KE7A 4PS0A 5JQWA 1ICEA 1VIYA 2P9TA 4V1CA 1Y1SA 4ARBA 2IFTA 2BMDA 3M33A 1EFPB 3PUJA 4H9GA 5LA6F 4EDFA 5JT1A 1PR0A 3UUEA 2QZ4A 3Q8MA 1RDFA 5C0OE 3KEGA 1SU4A 1LSOA 1PYDA 3NOOA 2NUTA 3ZCPA 4F7WA 1CZNA 1EGQA 3GEEA 3GZTB 3OH8A 3NMUF 4JU9A 1PJ2A 1KSHA 1RLMA 3ND9A 4MDYA 4CM8A 3BH6A 3K0AB 1E1YA 3WK6A 3ZHXA 1PDVA 2NZWA 3OPYB 1H5UA 1HG0A 4U2CA 4XIJA 2H2IA 2RJNA 2BGRA 2VDMB 1RBZA 2FGKA 2NSDA 3BWCA 4Q12A 2IT1A 3UV7A 1AA6A 4PLPA 2QSJA 2PT7A 2PZBA 3EEQA 2AF3C 1H1TA 5CXUA 2VJAA 3WYEA 3AHCA 3ANLA 2IUUA 3EPRA 4JA0A 4BN0A 3IE0A 5IVPA 3ZNQA 1P2TA 1E32A 1JLMA 4YUYA 3TS1A 1UQTA 1KWGA 1NG9A 3JTEA 3QYAA 4RVNA 3DNFA 4AKSA 3MHPA 4IHQA 4AUKA 4G2TA 3E1KA 4KXWA 3U1BA 3T1HB 3LRTA 4EBBA 1E4OA 1T0UA 1ONSA 2C31A 3HKDB 4CQLA 5KNBA 3TG2A 2C4UA 1LX6A 1U9CA 1U9YA 4R40A 1SULA 2F43B 3L1KA 3HN6A 3P9ZA 5ALQA 2FSGA 3UXEA 4EX7A 1QFJA 2F67A 2VCHA 3ST7A 4BQOA 3LMKA 4GWLA 3DHWC 1PHPA 1VSVA 2B0CA 4N18A 4DJ5X 1JH9A 3RRMA 1OUMA 1B6SA 2VK4A 2ERCA 2QDKA 3KE9A 3KNZA 3QBJA 4XLZA 5JCZA 4HNUA 1VI2A 4KE6A 1II8A 1K88A 4AJOA 1PK7A 2J09A 3E9MA 2EBWA 4TYYA 2GAJA 2V7BA 2ZB8A 1XD2B 1Z4MA 4CETA 1OYWA 4J7CA 4DLNA 1QJ4A 4WZAB 4OYHA 4E32A 3IKVA 3J81k 3SZ3A 4LBZA 4BIIA 3BK1A 1GHTA 4RADA 3MJVA 2A88A 5LMNB 4FCTA 1PTJA 4RV4A 4ZT3A 1G1MA 3HN7A 4W5QA 1SEVA 2QTRA 2QN3A 2XTMA 3I9V6 4BQSA 5M04A 3I6YA 3CVXA 4B5KA 4HN2A 4EVRA 2PUEA 4YLEA 1E94E 1QF9A 2KLBA 4O8ZA 3VX3A 4D8YA 1YR7A 3IOBA 2H4WA 2FZ5A 1I32A 3B1XA 1X70A 4QFCA 4PX5A 1EVYA 4H3SA 1Z7WA 3T8YA 2ID4A 1ZH0A 4DNFA 3RUHA 2C9MA 4NXNB 1CJMA 1FX0A 4KAXA 1XTIA 4BNWA 4CM4B 3KRTA 5C4GB 2PZ8A 1FVOA 1VHQA 4KPEC 2H1FA 4EHKA 2XUHA 2ZJ8A 5FAKA 3PQ3A 4BCDA 3G49A 4KPUA 1KI9A 4B3XA 4YRKA 5JFGA 3I09A 2XHZA 3DUFA 4OKIA 2ZBGA 2L17A 2W4QA 4ZVQA 5EIBC 2PKCA 1RHMA 5EIBD 2O4UX 1C8KA 3GA0A 3PTZA 5HTKA 1MAWA 4LBYA 2R47A 721PA 5BV7A 1GPYA 3AUJB 4K88A 2ALJA 5J23A 4G65A 3M5DA 1UT5A 2ILTA 4ZTUB 1BFDA 3A4YA 3GR6A 4IJWA 2YFYA 1UWKA 1N3YA 3CTMA 3QTTA 1UDBA 2YYAA 3DZBA 4P22A 4AZ3A 1Y48E 4E6EA 1EP9A 2PPVA 1T5DX 3GC6A 4HBGA 1GPH1 4MRRA 3RUPA 3SX0A 2GZDA 3EMBA 1FNCA 1GU7A 2PUWA 3HVIA 1L8LA 1OWNA 3IAM1 1NL3A 3LUDA 3QIVA 4LXHA 4M0CA 1AB5A 4KWTA 3RC2A 2WPDD 4C88A 4F46A 2GXQA 3HM2A 3BE4A 1VE9A 2AFIB 4UFPA 2C61A 4PHTA 2NAPA 3MF4A 1SC6A 3IP7A 3OIDA 5FF9A 3UJBA 1KIAA 5AJUA 5E1BA 1DZIA 4FYVA 3WB1A 3WG9A 4RKFA 4YV2A 4AW9A 2O1EA 3NHYA 3U62A 4F9TA 4YIKA 1R0RE 4QQKA 4NE7A 1E6LA 1RT9A 4ZFNA 1OYOA 2FWRA 4FN5A 2Q5QA 1SC9A 4IO1A 4WD3A 3VPBA 1QQTA 2DUMA 2A86A 2C1EA 2V55B 1X9IA 3LCUA 3PQ7A 2C7GA 4XDHA 1A9PA 4TKVB 3TBKA 4DMRA 3ONFA 4CUJA 3WLEA 4J1TA 3ZBUA 1BJKA 1G6OA 2OO3A 3BL8A 3NWEA 4WGFA 2W2OA 4AZ0A 3LCRA 2Q9AA 4YX9A 5FQOA 2V1XA 1BS2A 4MI6A 1RAGA 3NIDB 1NZDA 2A35A 4CL8A 1PEKE 1IN5A 1PJRA 3VR2A 1UXIA 5AKJA 4DAEA 5D3MA 3OEHA 1XVLA 3OEYA 4G24A 2C42A 2NM0A 3CS3A 3N58A 4DMHA 2GK3A 5ICGA 3O3NB 3PQ8A 2WIDA 3T3PB 4YDQA 1OBOA 3W2FA 4D97A 5A02A 3M4NA 3T7JA 3ILSA 4DMGA 4KXNA 3X2FA 3GCXA 1K5DA 1YA8A 2PXHA 5CVUA 2XBLA 5DCUA 3R0QA 4P2BA 1CE8A 5B1IA 1IHUA 1XDZA 2XT0A 5I7VA 3DZCA 2PMBA 3HYNA 3L7JA 1ZK0A 4G5GA 3IAS6 4LJKA 2JIRA 2JANA 3KEQA 3QV1A 3KHKA 2N0SA 3UJCA 1AHPA 4K87A 1ZH2A 1PV2A 4ECAA 4MCAA 4POAA 5DBOA 5K01A 3L6OO 4GLBA 2IIQA 1UANA 3IDSA 3I01M 4EG7A 4CF6A 1UBUS 4NS4A 1Y63A 1QH1A 1KQGA 4F4JA 1DRJA 5LB4A 2HYDA 1SG0A 2ZJ3A 3VU9A 1YOVB 4NG4A 1UQUA 3I32A 2IRWA 3OFSA 1ZJYA 3KJZA 3O9ZA 5DX8A 4Z9BA 2QTTA 5AM5A 4L50A 3HDVA 4DDUA 1D6JA 1YJBA 2RK4A 4J3FA 1P9NA 3WWCA 4I1VA 2VJPA 1O6CA 2EEPA 1Q7CA 2VA8A 4Z8XA 5I8ZA 4R2KA 3D6FA 5ERYA 1BX3A 4DNOA 4CG3A 1RXUA 2IEIA 2B9EA 1CR0A 1BG6A 4YI5A 1JG3A 1NT2A 1V9SA 3BICA 2Z2XA 3F9CA 2J6HA 4AX4A 3LVQE 4E13A 4GWGA 1QX4A 2R6FA 5FI0B 5G40A 5M3BA 5DCLA 1KE1A 5FL7A 4ACAA 3HCOA 2XCIA 3S1AB 4AKEA 1X14A 3ZLBA 1IFXA 1OY1A 2RH8A 3BFVA 4BV8A 1Z2NX 3NKFA 3I12A 3G2OA 4GLJA 4WXYB 5TV2A 5SY6A 2CVOA 2VUHB 5ED0A 1TT7A 3FWYA 4G4SP 4DYHA 1HLDA 3T95A 2CZQA 3JQFA 2FJ0A 2F1OA 2HLHA 1L7EA 3DAGA 3T3IA 2AOWA 1DRVA 1EK1A 2DOKA 4DCSA 1WV1A 1G1AA 2H3EA 2J08A 4UPVA 5F3DA 1X19A 3QTBA 5E6SB 4QGAA 2HEIA 4I6JA 5EP1A 5EZYA 3VU1A 4TGLA 4ZI3A 2R86A 1ESZA 3TF5A 3IHTA 3WL6A 4DMLA 1NQAO 5ARCA 3JU3A 5ISMA 3WX0A 2GAFA 4UATA 1BGVA 3F8WA 1C0KA 4JVSB 3T9FA 3A0UA 3HZHA 2HK9A 1KDOA 3Q41A 3DOFA 1ADBA 3OE1A 1H2AS 2N1BA 4TTRA 4JB0A 2WA2A 5FBQB 5KOJB 4MULA 4FINA 4YWHA 3WJ2A 1DKRA 4BC1A 2V9CA 4NENB 5BXQC 1FFSA 2J9GA 1TCCA 3QVUA 4MZXA 5ALEA 1RJWA 1I14A 4FWBA 2R7AA 1RXSA 5A6VA 3H9UA 1Y1LA 3BD6A 4MICA 2AHOA 1PVDA 3NBAA 2OQRA 3Q10A 4L1KA 4IFIA 5TPWB 3UCXA 3AEKA 2JCVA 3GLKA 3T99A 1K3FA 1S8NA 3VMMA 3PYLA 1YTLA 4O0MA 3ZS8A 1F4PA 5KREA 2ZU0C 3D2CA 2VF7A 3M34A 1TTTA 1A5AB 2Y6UA 4N54A 5E7IA 1KZ7B 3ND5A 4DBLE 4CMEA 5EJ7A 2I0FA 3A3KA 3HJFA 4BZZA 2PSEA 3TBFA 2CEAA 1QIMA 4AMYA 2O2HA 2PKXA 4XVCA 4HN4B 5D84A 2YZKA 2ZWIA 1OI2A 3ZZUA 1RI1A 4MW6A 4F5EA 4KCGA 3BUSA 4N76A 3EQZA 4N7RA 4YRCA 1NYQA 1YRYE 3L7OA 1Q2XA 2YMMA 3HFSA 2P4SA 5EERA 2YQ4A 3G2PA 4CF7A 5JMTA 4IDOA 3PLAE 1EBBA 4A6PA 4F4FA 2CVPA 2EFCB 4GMHA 1DXHA 1GAWA 2HPVA 1GIAA 1RWQA 3O4RA 4J0IA 4QUIA 3DT9A 4GWKA 3VXKA 4ZI7B 1EINA 1QIFA 2QLFA 4N8DA 4HNGA 2YHIA 5GZ3A 1WNFA 5M2QA 4RVFA 4O5AA 4LK3A 4IIVA 3ZTYA 4BKUA 1P7CA 3S0JA 4QKQA 2ZRAA 1KAHA 2FQXA 1Y7LA 3A1CA 3THWA 1R6VA 1ZJJA 3RTEA 3CF6R 1LQTA 4NV0A 1Y34E 2I87A 3L6RA 1NVWQ 3FKSD 2GFHA 4BNDA 2CL7X 2G9VA 2JLAA 1F9EA 1XP8A 4N3AA 4IIUA 3L0BA 4UVHA 1YS6A 4QQFA 2IZ6A 4XQGA 2I66A 2C92A 5HQ3B 3UXHA 1JGTA 4U7WA 3ZJ5A 1Z83A 1N34B 3HFGA 4PVDA 3UJPA 1JJAA 4YGXB 1MX5A 1WDTA 1TM7E 3IULA 3FUUA 1XFAA 1GZ4A 3K0BA 3C6XA 3D4IA 1QHIA 2ACWA 3I58A 4PG6A 4XM0A 5AR1A 4EQZA 4OXYA 5A5GA 1LPOA 5FB3A 3AKCA 1JLKA 4X60A 4BL5A 1WM1A 2OZLB 1M5RA 2WHYA 1N0HA 3P2IA 2O0KA 4RXTA 4U3JA 5T57A 6Q21A 1MNQA 2OZKA 4Y7CA 3S8EA 2JLXA 2PEYA 4LQCA 3AIOA 4BMOB 9LDBA 1S5PA 1MT3A 1HYGA 3KJGA 3OFVA 3F3KA 3OP4A 4LOHA 1VLMA 3DZHA 4YH1A 1AZLA 2WUDA 3TLMA 1YUNA 4Z2YA 1ZNYA 4Q24A 2OFXA 3O8QA 3KUCA 5K3OA 1DDOA 3SBDA 5ERGB 4NU0A 3PIIA 1VA5A 4QELA 1ULSA 2OCKA 1NU6A 2Q3FA 4MYDA 3KQHA 3TUIC 4NBWA 4B84A 4JAVC 1ECPA 1QQ6A 3PFBA 4J8PA 4UVIA 3VDNB 4DA0A 4K6MA 4HUJA 1NUQA 2E7ZA 4CQMB 2VXYA 3GJ6A 2CFRA 2R7MA 3JALB 4CQMD 4DNQA 4MCHA 4W5RA 4CW7A 3LUHA 5AK3A 2ONZA 5A4KA 3STTA 1WD5A 2FE1A 1K06A 1SOAA 5GONB 1G2QA 5D00A 2RCNA 1I2CA 4H3KB 4JJFA 4H7IA 1QUEA 3LYAA 4CT5A 3QLVA 1B26A 4YHBA 5JRJA 3ZUGA 1SG6A 4AY4A 2PRIA 4NPHA 2HXYA 4FFRA 2XGJA 1P1JA 3K16A 2QI9F 5DCWA 1UJCA 1KO5A 4TUYB 4C4SA 4ED9A 1JEEA 3LW7A 5KJFA 3E6AA 1SZDA 1VKRA 1XTRA 2Q3JA 1CUZA 2IODA 3BSWA 3EDOA 4D98A 1RYFA 2NUAA 3UOAB 5TPZA 1CK4A 2WQ7A 2VRWA 1UBKS 1I5OA 3OE4A 5HMMA 3RF6A 3EZFA 4J0FA 3B6ZA 4S35A 2RFLA 4CG0A 1H69A 5FNVA 4JP1A 4JV5B 2DR3A 3TLAA 1Z7BA 2HT6A 4KVGA 1DC3A 1DAGA 2ABWA 4MW4A 2Q7OE 1YA6A 3CCBA 3CH6A 1GRQA 3OZBA 1DWPA 5FCDA 3UAGA 4OHBA 1FJGB 4D25A 1AQIA 3R9IA 2XMSA 4HTAA 3ZCRA 5JXJA 3NXKA 4HH4A 1IUOA 3DMTC 2CFCA 1AUXA 2YZ2A 4PLHA 4PCAA 4OU4A 2C9DA 4UHJA 5AM3A 3E82A 1PWEA 4R1SA 2A5YB 5JW6A 3LX4A 3ESAA 3VMFA 5CNJA 4DN6A 4EZEA 2VSNA 1G0NA 3EGDA 2UV8A 4PSUA 4R3UC 2ZBVA 1HDIA 3V7NA 2KM1A 2WE7A 4RF4A 4JDPA 5EKTA 1JLLB 3EJ6A 3TZCA 4N40A 1NDHA 3CLVA 1ISHA 3CMCO 1DC7A 3HBFA 4XOUA 3DT8A 1B8UA 2J0UB 2P9FA 3WWDA 1J1UA 3U81A 4OM7A 5BW8A 5K1ZA 3OSUA 1G6Q1 1DJNA 1PEYA 1XTZA 3DE7X 3L8EA 3C1AA 5BUQA 4LXYA 1XEXB 2R0QC 4H6VA 3UMRA 4LHWA 5IBRA 2MHCA 3M6AA 1IOZA 4OH1A 3W8NA 2Q3CA 1N8SA 4PFSA 2XUDA 1T1EA 4A2WA 4L0CA 3GDGA 2K2QB 3MOIA 4P7GA 3S29A 2N3ZA 3UW3A 2PQ0A 3YASA 3EF3A 4AVYA 4D8XA 2D0PB 2CCKA 2J4CA 5IVKA 5BW4A 3L6CA 1QOZA 2WP8J 2N75A 4I36A 2V6IA 2VTEA 1LTHR 3G9ZA 1RBYA 2F1KA 3GMTA 3O4IA 3PXAA 4N6OA 4PXSA 3ROPA 2ODEA 4IS3A 4AJ4A 1GNVA 1S8AA 5EYPA 3W8DA 2BKLA 5HSGA 2HJWA 2EDCA 1A88A 1EEHA 3OE7D 5DXFA 5LXTA 2XCTB 1JR2A 3KV1A 3RWOA 5EL0A 3IUJA 2I2DA 4PBSA 2QSUA 3CC8A 2VTBB 1K9VF 3AHHA 2IYWA 3D3EA 4LZJA 2GKGA 3ELDA 2BEUA 4MWGA 4AMUA 4I4IA 2CUKA 5ALFA 4JDUA 3QPAA 3UMBA 1PBTA 3DCIA 5IDVA 1Z6ZA 5AVXA 3FLBA 1X1SA 2E55A 1NY6A 2VC2B 1A2OA 1N7GA 2RAUA 3LCVB 4OQNA 4O4HF 2Q29A 1YU6A 2PGIA 2VRCA 4FBMA 1SUPA 1ZEJA 2BI4A 4A8TA 4CE6A 2F90A 3FZYA 3HKCB 1WUYA 2YHAA 4Y2VA 4Z7OB 3ONEA 1KSJA 1DCMA 2ZIEA 4IRMA 3E27A 2H7YA 2PKQP 3RC3A 2XNHA 5ADWA 1ULTA 1IXKA 3IH5A 4WLOA 3T4EA 1N2BA 1G66A 3IODA 2GZ2A 2MYPA 2Z9BA 3ZCUA 1KRHA 3GJTA 3U4DA 3UWSA 1CY7A 1PTKA 1RWMA 2WWWA 3AI1A 1PDWA 3GMSA 4KFCA 4C0KA 4YC7A 4LTMA 4M1EA 1TW3A 4YJDA 2D1SA 4XA8A 3JCZA 5HX7A 5BOSA 3ABZA 4IZHA 4GZ5A 3MLAA 1GILA 3AG5A 4WFKA 2X5XA 4CUKA 1QAQA 2Q0HA 4JSRA 4R8SA 4DSAA 3N1UA 4DCJA 1NHWA 4JXZA 3WISA 1IOVA 3PL1A 2VVTA 2ZYRA 3JWIA 1LQUA 3N74A 1F7UA 1OWMA 4K1XA 4LEIA 3EG9B 2OT3B 4LZZA 6ADHA 4WY8A 2GZRA 1MJHA 1PGPA 1M67A 2V4MA 4X7RA 4YJFB 4BUJA 3GROA 4CL2A 1U8CB 3OOHA 4FUQA 5KJCA