1M7GA

Crystal structure of aps kinase from penicillium chrysogenum: ternary structure with adp and aps
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
208
structure length
208
Chain Sequence
b'STNITFHASALTRSERTELRNQRGLTIWLTGLSASGKSTLAVELEHQLVRDRRVHAYRLDGDNIRFGLNKDLGFSEADRNENIRRIAEVAKLFADSNSIAITSFISPYRKDRDTARQLHEVATPGEETGLPFVEVYVDVPVEVAEQRDPKGLYKKAREGVIKEFTGISAPYEAPANPEVHVKNYELPVQDAVKQIIDYLDTKGYLPAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Adenylylsulfate kinase
publication title Ligand-Induced Structural Changes in Adenosine 5'-Phosphosulfate Kinase from Penicillium chrysogenum.
pubmed doi rcsb
source organism Penicillium chrysogenum
molecule tags Transferase
total genus 79
structure length 208
sequence length 208
chains with identical sequence B, C, D
ec nomenclature ec 2.7.1.25: Adenylyl-sulfate kinase.
pdb deposition date 2002-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01583 APS_kinase Adenylylsulphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1m7gA00
2AR7A 2X19A 2GXQA 4NYIR 2P6RA 3GP8A 3QQ5A 1NBMD 1HYQA 1VMAA 1F2UB 1AN0A 3WP0A 2R8RA 1E4YA 3R9WA 1KJYA 1N0UA 1KY3A 4IXNA 4UJ3A 2EFCB 1JB1A 3O8CA 2GDJA 2ZJ2A 3F0TA 2J0UA 1NSTA 3KUCA 5AUQA 3TMKA 2F6RA 4PHGA 2ZM5A 2PX0A 3A37A 1M6NA 4GMDA 1EWQA 4PFSA 1Q3HA 3IIKA 3TE6A 3U4QB 2GEDA 3GJ5A 2RGBA 2CK3D 3GLGB 4O0MA 4BRWA 4KBFA 1IOZA 2GNOA 3CF2A 5TDHA 3QIAA 1E4VA 2CHGA 3IBGA 4N0DA 3RDPA 5IF9A 4PZLA 2ZS8A 3D3QA 3M1IA 3ADKA 3I4LA 2J3EA 4D0LB 1W5TA 5FUXA 3CBQA 1VECA 1N6OA 2VSXA 1N6NA 1WMSA 2V8OA 3W3ZB 1NLFA 4G5GA 5CDFA 1XXHA 2V4ZA 1EWRA 2YOHA 2O8EB 3DPUA 1OIXA 3TUJC 2GJAA 2V9PA 2TMKA 5CB6A 1DVRA 1OSNA 1U0HC 1DS6A 1ZM7A 3K09A 2G6BA 5AR1A 4XOIA 4DXAA 1F60A 2PZEA 1T9HA 3PEVA 4DUGA 2H7VA 2R9VA 1OHHD 2QEQA 2KB0A 4TYWA 5TV2A 2AK2A 1P73A 1AKYA 2PMDA 1MO4A 3K0AA 4LHZA 3AF3A 3B1YA 1G9XA 2Q9BA 5EXSA 2ZU0C 2JJ1A 3C4JA 1M34E 1M8PA 4LV8B 2AFHE 5J4HA 4ZCIA 1KI7A 3PUZA 4HAUA 2HT1A 4XSGA 4Q02A 2RMKA 3NHBA 4MRNA 2JEOA 4RD1A 4C4PA 3ADDA 1FUUA 1M2OB 2E1RA 4JVSB 2GJKA 5KPJA 1LB1B 1W36B 4CEJA 1UJ2A 3BE4A 4Q48A 1ZCAA 4M9ZA 5DE3A 3H84A 4TMKA 4MGKR 2A5GA 1JEEA 2P6NA 2FF7A 2IHYA 2WWHA 1LNZA 1FTSA 3N2IA 4J0QA 4MYUA 1E6CA 3VNVA 4PHHA 2OG2A 5EUQB 2W83A 3CX8A 1XJCA 4Z8YA 2CDNA 3THYA 2WWIA 2G0TA 3R8FA 3LXXA 4RKFA 1AJEA 3CRQA 5H68A 2KSQA 4U00A 5JJLA 1KI8A 4Y0AA 2QA5A 3BD9A 1TAGA 2IXGA 1VDZA 2QAGA 2IK8A 1UAAA 1R0YA 1XTIA 2RGNC 1NMYA 3IBYA 1E9CA 1VG8A 1GRNA 3DHWC 4TMTA 3NH6A 1KZ7B 1AQYA 4Q1BA 2GILA 4A2PA 1X1SA 3B9PA 2YOFA 3K9NA 5IHPA 2FV8A 3AKEA 3QKTA 4KAXA 4URUR 2QTFA 3GJ6A 4EPRA 4Q9LA 2R65A 4ZDJA 1FQJA 4A2QA 4DJTA 4KVAA 2MMGA 4NE2A 2BKUA 3PUYA 3L0OA 2GRJA 4C2UA 1O3YA 5L3VA 4FN5A 1XJQA 1SKYB 1W4BA 2ZYUX 2JLVA 1DG1G 4BFXA 1JR6A 2WTUA 1IJFA 1VYVA 2BHRA 2D2FA 4IXMA 2AKYA 1E1QD 2CHQA 1W46A 4CT4B 2FG5A 3RRYA 1FPMA 1KI2A 1P9RA 3RWMB 4V0LA 4CGZA 2N42A 4BFZA 2GESA 2REBA 3BWDD 5B57C 4LBYA 5E95A 1G64A 2HJVA 4MUAA 1L4UA 4JSTA 2H57A 1DTSA 1TU4A 1Q57A 4NL4H 3L0IB 3WHLA 2RB4A 5E3HA 2Z43A 3KKOA 1U9IC 2R6AA 821PA 4D80A 3LX5A 3QKRA 3U3MA 3TAUA 4F38A 4YMVA 3EAQA 2C5LA 1F48A 3IGFA 4Q7KA 5FTLA 4IRUB 5DN6A 4QJ3A 5JI2E 4RD6A 2RGCA 3V4RA 4MRVA 2JLUA 2YWHA 5FI0B 3TBKA 2WKQA 2C9YA 2R44A 5AUOB 5DYIA 1XPUA 4U5XA 2B6HA 2O5VA 3DM9B 1OYYA 3MSXA 2JJ2D 2W2XA 1AZSC 3NDBB 2LKDA 1YZQA 1S3GA 1X8KA 2D2EA 2FSIA 3CR7A 2A30A 3QE0A 5JWHA 3QENA 3LXRA 1CR0A 5BYKA 1OFTA 1DADA 4GPTA 5DNYB 1FNNA 4V02A 2XGJA 2UZIR 4M21A 3LBHA 4TMXA 1SVMA 5HKKD 1TUEA 1RYHA 4CYMA 4BFVA 2PH1A 4N3NA 2G9NA 2PX3A 4XWOA 4DC9A 2BBTA 1N0VC 4B6EA 1R0WA 4GT1A 3T1VA 1D5CA 1OPXA 3A1TA 2OFWA 3AVUA 4LJ4A 3EIHA 4RJLA 4G5SA 4XH9B 1U8AA 4DUGD 2QENA 3ZYCA 2QY9A 4W5JA 1WQ1R 1J90A 1GWNA 3ZIAA 2C95A 4WW0A 5H1YA 5L3QB 1Q22A 3VAAA 2RGXA 4IW3B 1MOZA 5KDDA 5L3SA 2JJ1D 2IYLD 2F1HA 4LC1A 2Q3MA 4K81B 4A8JB 4F93B 1G3UA 3FWYA 3KFXA 3I1FA 3WMFA 1GNQA 1WE2A 4R2HA 3BH6A 5BWMA 4AI6A 2JIZA 4BGDA 3X1ZA 2ZXUA 1O87A 3CNLA 2FZ4A 4WZAE 3W34A 5HPYB 1SVWA 5C1BA 4Q9HA 1S3SA 2IYQA 5KPDA 2YC4C 1ZU4A 3CF0A 4I1SA 1E2NA 1XMIA 2XB2A 3KDSE 2QN6A 2QP4A 3B1XA 1N6PA 4FCVA 4PSAA 1G8HA 3TNFA 3N5CA 4AWXA 5FBLB 3VR3A 2V55B 3DEFA 3A4NA 2IF2A 4HAWA 4HAYA 4KV9A 5BYJA 2EWVA 4IFBA 5SZKB 3V9PA 3FGNA 1DBSA 4EJSB 2GZDA 3IEUA 2AXPA 1SXJD 1RRPA 3WBJA 1R2QA 4Q19A 4MGZR 3N2EA 4JVMA 3SJCA 3GMTA 1BYUA 4OHVA 2VHTA 4AYWA 5AUNB 5HR5A 1C1YA 3FHTA 4XIGS 1NLZA 2BIFA 3KKMA 4M1SA 4Z51A 721PA 4LZZA 1DOAA 3K9GA 4MKIA 2ANBA 3NBXX 3VX3A 3TUIC 1F6BA 1YKSA 2ZSAA 3EASA 4C0KA 4V0ME 1W5SA 5BN4A 3FDIA 5F9FA 5GADl 4JBYA 3PR1A 4BFYA 3CW2A 1II0A 1RJ9A 3CB4A 4BE7B 4PSKA 4JLVA 2BOVA 4K46A 5K8UA 1Z6AA 4FWIB 3PIRA 4IEEA 1TTTA 1JAHA 4Q03A 5FOUA 1G7SA 3EZ7A 3TKLA 5K8IA 2O8FB 3K0CC 3WMEA 4W5HA 4A6PA 2XITA 2NG1A 2W6IA 3A1SA 3H0KA 4TL7A 4L5BA 3BERA 3TR5A 2ZRPA 2GTPA 4RD3A 1Z5ZA 4DT1B 2XXAB 3ZLJA 3GLFE 3CWZA 1W2HA 4GP7A 2QT1A 3OZXA 1IY1A 3O8BA 3RWOA 4RCYA 4YQFA 1U90A 2FGKA 2G83A 4URYR 2XTNA 1KSFX 4IFEA 5KDOA 1P5ZB 3W8NA 4TZ6A 1E99A 3IHWA 3A1UA 1OIWA 3ICQB 3G5UA 2O8CB 3PFIA 4ZKDA 2OAP1 3K9HA 5DN6D 2PCJA 4TTRA 3VR1A 3EC2A 1KO5A 2L0XA 3U61B 4P4SB 3U3JA 2VP4A 3L43A 3K1JA 4QG7A 1YR8A 4MA4A 1IN8A 2HXYA 3OIUA 1XD8A 4EPWA 3T34A 1GNRA 2GK6A 4QL3A 2GF9A 2YNMA 2ZETA 4LBZA 2YJTD 1OF1A 1E1RA 2C04A 2ZJ5A 1E69A 4LK2A 3T1QA 2WPDD 3KKPA 4PR0A 3C14C 1VCOA 1HE8B 1Z0KA 4I1UA 4KYUA 1KO7A 5F3WB 4PC2A 1QHXA 1H8HD 3BK7A 3K0EA 1EXMA 4HB4A 3TR0A 4P4UA 4JS0A 1P2SA 1SHKA 3K70B 2QE7D 1QHNA 3HU2A 2RGEA 1N3BA 1KDOA 1VCIA 3QXSA 4XTRA 4Y0VA 1G3RA 3IEVA 1KJZA 2FPKA 2SHKA 2ZYTX 2ZUCA 2CL7X 1A2KC 1CP2A 3A1VA 3AVPA 4LHWA 4E5UA 1Z0AA 5KSZA 3QY0A 4TMVA 3SYLA 4A9AA 2ZEJA 1Z06A 3A8TA 2IS1A 621PA 3GEHA 2W58A 5EE9A 4TL9A 3ZQ6A 4EPTA 2J5XA 1EX6A 1PUIA 2W00A 3PCRB 4QM7A 4PHFA 1LW7A 3WNCA 2ZE8A 3CRRA 4G5OA 2PEYA 3CWQA 1F2TB 4NCIA 3JZMA 4Q00A 3OAAA 1AZTA 4AIIA 4JJZA 2GXAA 3Q9LA 2QMOA 4K8OA 4TYPA 3U2QA 4M9SA 3GJ3A 4ZV4A 4PAMA 3CONA 3CX6A 1D9ZA 2WM9B 4M1MA 1T8UA 5EP2A 4I1OA 4X8LA 3IO5A 3ZD7A 1GFIA 1US8B 2BMDA 1R4AA 1OXUA 3AH8A 5CK4A 1MO5A 3M0EA 3OE7D 2P3SA 3Q3JB 1Z28A 4LYHA 1QF9A 4M22A 4PAQA 4ERNA 3ZVRA 4GRAA 1XXHB 3KXLA 2IS6A 1S1MA 4MGIR 1RPZA 2KWIA 1JI0A 4EIWA 1W49A 4L15A 3CIOA 3CH4B 2ZRIA 1NNEA 1HH4A 4B33A 4WXRA 2XAUA 4HUQB 4DCUA 1SXJC 3QXHA 3TVDA 3ADBA 2C98A 2GKSA 2NO6A 1ZC4A 3OIWA 1TQ2A 4QHTA 3B85A 2ZUBA 3T12A 1GAJA 2VSOA 4RZXA 1DEKA 1R5OA 1X6VA 1XMJA 1ZUHA 3U3OA 5KNBA 3AGQA 3SI7A 1F5NA 2CE7A 2QROA 5JS8A 5FUYA 1RRGA 4OQNA 4OI1A 4EFLA 1CR1A 3A6PC 4HDCA 1S0UA 1DPFA 4ZI2A 2R62A 5CJ2A 4F91B 2GA8A 2G3YA 4HI0E 4C30A 2B8TA 2OV2A 4I99A 4CEJB 4LJ5A 4LX0A 1P7CA 5HZKA 4ZDIA 1E9FA 5DSZA 2VEDA 1HQCA 1G4UR 1SKQA 1VG0B 1M74A 4DLZA 3R9XA 2B92A 4UXIA 2DYKA 1W47A 4I4LA 2VIIA 3HYRA 2A5DA 4EFMA 3VTKA 2LWIA 4D81A 4L8GA 3THYB 4CEHA 3CUEF 4C0SA 4V0MA 3ETLA 4CVNA 4M1YA 1G20E 5FI1B 1HE1C 2E9SA 4CT5A 5GJVC 1W48A 2QAGB 1NN5A 3I3SR 2QRZA 4QBHA 1FNMA 1G5PA 2BC9A 1JQJC 3HR7A 3KKQA 3V4FA 4NYJQ 1I4LD 1G8YA 3QNUA 1NMZA 4WVFA 2ZYVX 2RGDA 3I72A 4YDSA 3GPLA 3HU3A 4IDOA 3KB1A 4KU4A 4NBSA 1TF2A 1XD2A 1KZGB 4LV5B 3SBDA 4Q66C 221PA 1D9XA 2GBLC 2J1LA 3DVLA 4LC0A 3RC3A 3AVYA 2HLDD 5GVRA 5J5CA 4CDGA 5AK0A 3GLFA 3MMPA 4KFRA 4DSOA 1UF9A 1WBDA 5B64A 1C4OA 2IYWA 3SN6A 4DCNA 2H16A 1OXXK 4QBGB 3ZH9B 2WAXA 1B0UA 1SVOA 1Z8FA 4FI3C 3REFA 1J8YF 3DM5A 4A0GA 5IK2A 2V7QA 4A4DA 5B2ZA 1RFLA 3A4MA 2C78A 3T1TA 3TGPA 1E1RD 1KI1A 4I1VA 3EZ6A 3QJYA 3U7EB 4BZPA 3SU8A 1ETUA 2BBOA 4DWJA 4B2PA 1VHLA 4L4UA 4TYNA 1QHHB 2VHJA 3VX4A 5KHOC 1XPOA 1QHSA 1GDDA 5TB5A 1LVGA 4IVPA 2CLCX 2O8FA 5C4GB 1N5KA 1ZIPA 5DIFA 2WOJA 4ZI3A 3QKRB 1AQUA 4B71A 1TL7C 1N25A 3CPHA 3IKJA 1RZ3A 3EIEA 4HEJA 4H1VA 3X1XA 3C7KA 3H2YA 2XXAA 1JQLB 2QSYA 4NTZA 4RVCA 4PPGA 2WSSA 3W9YA 4Q4HA 3Q8XB 2Z83A 4LV6A 1K5DA 1OE0A 2VLIA 1BMFA 4HSEA 2ZSFA 3W6OA 4B2IA 2O0JA 3NG1A 5JJIA 1TEXA 2C99A 4BEJA 4JLAA 2BBWA 4KFTA 4GSYA 3FHOA 2QPAA 3RRNA 1OH6A 3LW7A 4H9GA 3RANA 1FMLA 1GP2A 1YZGA 2PZGA 1KDRA 1QG2A 2G1KA 3FE2A 4IOJA 2WJVA 3BAFA 3SR0A 1XEXA 2QU8A 3ECCA 2ZR0A 3VR2A 1E9AA 3RS4A 3UXMA 1Z63A 4AKHA 1E2IA 2I3BA 3NHAA 4LPKA 3NC0C 3NXSA 2FOLA 1HT2E 1KK2A 1L7VC 2R6DA 1U0LA 4Z8XA 3KXKA 4B48A 4O2LA 1DAIA 1IQPA 3HU1A 1WB9A 4WZ6A 1ZU5A 3PVSA 1IN7A 2BCGY 3IUYA 2YHSA 3OFND 3ND9A 4M1OA 1P6XA 1BYIA 2YVUA 3C8UA 5CITA 3X1YA 1XEWY 4B44A 4JL5A 3DKVA 1EFRD 2ZRBA 3FKSA 2G88A 1R6BX 2GZAA 2XTZA 4QGGA 4BWYA 4GOJA 2WVJA 3EZFA 1EESA 4D0NA 3AP2A 2W6JD 1RRFA 5ELXA 5L3SB 3G0HA 2Q21A 3LRPA 4TZ0A 2CMKA 1P62B 4IVQA 4KI0A 1CIPA 1P75A 4KLZA 5KSPA 1EFHA 2J45A 5KNDA 2QP9X 4YONB 1NRJB 4UNRA 4QGAA 2B7BA 2NPIA 2WJHA 1XTSA 4OHWA 4IDPA 4M9XA 1KDPA 2X8AA 2OBLA 3CR8A 2IL1A 3B5JA 4MKHA 5J4KA 3RS7A 1RVDA 1N6LA 4PHTA 1Z0DA 5LB4A 4KXFB 1F2TA 2BWJA 3PUWA 4HAXA 4NYJR 2O8DB 2ZREA 1OJLA 4URZR 2DY1A 4DLTA 4OJKA 2FX3A 3I5YA 1VIAA 2F3RA 3RABA 1PV4A 5JWOA 3P27A 4LYJA 4NP6A 2ZS7A 2Y8EA 1R7RA 1Q0UA 2OLJA 4TT3D 1T3SA 1US8A 2XSZA 1G19A 3N70A 3EWAA 2ZAOA 4XJXA 5M04A 1CRPA 1UFQA 1II8A 1G7RA 1T0HB 2AN9A 1XRJA 4ON9A 2C9OA 1Z83A 2EU8A 1D2NA 3C16C 3RLFA 2VP9A 1NVXQ 4HUQA 2OCYC 4OK3A 4B32A 3PEWA 1NLYA 2WKRA 2VSFA 4XVRA 4JZKA 1YR9A 1MV5A 3AUYA 1RJ9B 3P32A 4R7ZA 2WZQA 3ZVNA 3HP1A 4RKEA 2PZFA 2WWGA 5DYGA 4AKEA 4Q1DA 1G5RA 1S2MA 1XJ0A 2GCPA 4TLDA 1Z6TA 2FU5C 5E7JA 4KITB 2H17A 2WIBA 4B6FA 1W0KA 4MKGA 2PJZA 2XNSA 4TMWA 2GCOB 3KJGA 3ZS9A 3CRVA 1UBEA 5JCZA 1XCPA 3B9QA 4JKYA 3I8SA 4FCTA 2MSEB 4MYHA 4LWZA 3RS2A 2DB3A 3LBIA 3R9IA 2ZRGA 5A5GA 2RHDA 4B74A 1VCMA 3L0SA 1G8PA 4QRHA 4P4TA 4FMCB 2CHVA 3W90A 1P60A 4A1FA 2YINC 2DBYA 4BECA 5CYOA 4BUJA 3GEIA 5P21A 2ZR7A 4MYTA 2VYFA 1WA5A 3E70C 2GWHA 4LPSA 3ZD6A 3K0FA 3DDCA 2O0HA 5JJKA 4S35A 1ELOA 2IWHA 5JI3E 2GVZC 1XD9A 1VG9B 1GKIA 4B34A 1NJGA 4H1UA 1E0KA 2R2AA 2QORA 4Q7JB 1N5IA 1D2EA 4WZBE 2JDIA 4KBGA 4B2LA 1U2RA 4ITRC 1YRBA 2BV3A 1NIPA 3IO3A 1N0WA 4M2LA 2Z6VA 1FOEB 1X8JA 2IYXA 4LOAA 5AJYA 1S8FA 5FOVA 2DFNA 3OIYA 4D4KA 3K0SA 4A0RA 2JGNA 1GRQA 5FOSA 2CJWA 4HLUA 3ZJYA 2JASA 1JNYA 2IEZA 4QKQA 2J59A 4DLVA 4JSYA 5FOXA 1A7JA 4M4SA 1MO3A 3AF1A 2IS2A 4QM6A 4OYHA 1IHUA 5JSZA 3KL4A 1T5LA 4X8OA 3U3RA 1T5IA 1HT1E 2G0NA 5D3MA 3CZQA 3TRFA 3LDAA 2LCFA 3VR4A 3R8CA 1HQYE 2AL7A 4DLRA 2EFDB 4TSFD 2OE2A 1NIJA 1KK3A 4AKIA 1QHHA 4UJ5A 1HUQA 1LV7A 3QVVA 2D3WA 3K70D 1W2GA 3KUDA 4QHSA 3NEJA 1WCV1 1XZPA 4AC9A 3AF4A 4KYIB 1XTKA 2WWFA 4I81A 1KIMA 3MWJA 4D25A 2ANCA 5FPKA 3THWA 1FZQA 2CVHA 1JBKA 3ZS8A 1DE0A 4M9QA 4HAVA 2IEYA 3QSYA 3RAPR 3SQXA 2XZOA 5G53C 2NZ8A 1JR3E 4C0LA 1P9WA 1FTNA 4O2RA 4QHYA 1TMKA 3W5JA 4ACAA 1KY2A 2V1XA 3ZZTA 1VYUA 2D74A 3FFAA 3AVVA 3SYKA 2HUPA 2OCBA 4ILEA 2P2LA 4HYYA 4PC3A 2ORWA 1XU4A 4UQOA 4C9BA 2JLYA 1CF4A 3WNBA 3RS3A 2OCAA 1GSIA 4DKXA 2WWYA 2ZR9A 4A8JC 1XFAA 4HATA 3ASYA 5AJXA 1KSHA 2ODEA 2DFKB 2EWWA 3NDPA 1XPRA 2AX4A 4ZCLA 2OLKA 5KYKA 5JWRA 4AYXA 1UBCA 4B3XA 2ZANA 4LJ7A 1KHTA 4WAUA 2FFAA 2Q9AA 1AKEA 1NMXA 3NKVA 1GNPA 1X3SA 3L2OB 1Z22A 2F9MA 1ZCBA 3SYNA 3SQWA 1EG7A 4GMXA 4KODA 4Q9IA 3DMNA 3I61A 4BFWA 3LW8A 1MR3F 1QHIA 4GDFA 4EJSC 2OBMA 3B2EA 4E22A 2KI5A 5LDDC 1NKTA 1SVSA 2WV9A 4GNKA 3U7HB 4JL6A 2VBCA 2NGRA 2UVQA 4Q47A 4KSCA 4OQFA 2BM0A 2QP3A 3W8RA 1XB2A 1L2TA 3BB3A 1OFHA 4F4IA 5CK5A 4JT4A 4KJZA 4LHYA 1NI3A 2J46A 4CEHB 2QAJA 2ATVA 2O0KA 3WY9A 1VKJA 4IOLA 2OO7A 3EW9A 1S96A 3HPQA 4U02A 5HE9A 2ZSDA 2RH5A 3H86A 2E87A 1E2FA 3I32A 5KNCA 2JAQA 1OXSC 3RS0A 3EIQA 4L16A 3LX8A 2O8DA 2WMNB 2J41A 2R6CA 3Q7QA 1IXSB 2HF8A 2ZRDA 2QPOA 2IA5A 2I1QA 5FL7A 1V43A 1PLKA 2O8BA 1KI6A 2ZI9A 4HB2A 4URWR 1P3JA 1XD2B 3EA5A 4Q1CA 3RC8A 4EQ6A 4IDNA 2YC2C 2DR3A 1M7GA 1J2JA 2CLDX 3KQKA 3LFUA 4DVGA 3GLFB 2QI9C 2WKPA 4P33A 1P2UA 1P4SA 3BRWD 3KTAA 3FMFA 4JBXA 5K8TA 5A4JA 4JLOA 2RKOA 3MFYA 4IOKA 1TNDA 4JLKA 1WRBA 3AP1A 1GL7A 3A36A 4C0AC 2XZLA 2CNWA 1BKDR 3NEYA 1ZNZA 3SJZA 1RRCA 3BB4A 2IYSA 2H8KA 1PLLA 4DDVA 2J87A 2ZI7A 2F7SA 3CLVA 4WBSA 1SVLA 2CL0X 1KAOA 1N2CE 1ESMA 1Z6YA 2FFHA 4FMBB 2XOKA 4E09A 4JLBA 1G291 4YMSA 3LD9A 3SBEA 1RYFA 1XMSA 4C2TA 3C15C 2FE4A 2UKDA 1JXOA 3IQXA 3A1WA 1M1YE 4QNRA 3BGWA 4LJYA 3JVUA 2QRNA 5E7IA 4TQUS 5GJCA 3AF0A 2IUUA 1P2VA 2GCOA 2BJVA 3CNOA 4MDFA 4Z1MA 1GUAA 4MITA 4A6XA 4OBEA 5J4VA 3MGCA 4KVGA 1UM8A 2VHQA 3U5ZB 4Q4HB 5G41A 4DDTA 4OQXA 4A92A 5KSYA 2BBSA 3CPJB 1KDTA 2YKGA 4BLRA 1YQTA 2O52A 3D31A 4G0NA 4TLEA 5ANRB 4MRSA 1ZJ6A 4TTQA 2ZVPX 4EUNA 4Q4JB 2QTVB 1WXQA 5FR1A 3EXAA 2IYUA 2BMJA 4UNQA 1OH5A 1QRAA 3OEHA 5AWFC 2FPLA 1OH8A 4KHZA 3JZAA 3SFZA 2ZRHA 4Q7MB 1XEXB 2WOOA 1GZSA 4EFNA 5J4YA 3CX7A 1OIVA 3EC1A 4BFUA 3LBNA 5HCIA 1AGRA 1IN6A 2FMXA 1CXZA 2EYQA 1T4GA 2X1VA 5EP1A 2A78A 2F3TA 4DIEA 1SZPA 3AEZA 4DDUA 4Q9JA 2J7PA 1G7CA 1FL9A 1X86B 4XTCS 4QGFA 2C96A 3UG6A 1E98A 3BH0A 3X1WA 1KGDA 1JR3A 3SZRA 5CM9C 4BRUA 1RE0A 1I2DA 2HF9A 1E79A 2IW3A 4ASUA 2CVFA 2OBNA 5C2JB 1FUKA 2PT7A 2A3RA 4AG6A 4BASA 1ZNXA 3KQLA 3VHLB 2XJ9A 1AS3A 3F8TA 4TLCA 1KK0A 1Y63A 4JYCA 2QG6A 2WSMA 5L3RA 2NIPA 2XNDA 2FNAA 4GI7A 5CLLA 1HY3A 2QM8A 4DB2A 2ERYA 3K09C 1SVKA 3FFBA 3IQWA 3R7WB 4IOMA 4V0NA 4QGHA 2BVNA 4JYBA 5IDVA 3WXMA 4WOPA 4AD8A 5CM8B 1W0JA 3QPUA 4JL8A 3DMDA 3WMGA 3ZIAD 2JLZA 5FOWA 3QXCA 1TF7A 2QBYA 1E94E 2PT5A 2GJ8A 3K8YA 4C7OA 1JJVA 5GVSA 2D7DA 4PQRA 3EX7C 3AVXA 3BJIC 3B7GA 3OIVA 1OLOA 1BH2A 2RGNA 3QKSA 3ZDQA 3EARA 4AG5A 2VP6A 1XCGB 5HCNA 4JLNA 2JIZD 2V54A 3AUXA 4FD2A 1R0XA 1TPZA 1Z0FA 1DO2A 4BQSA 4TLAA 1XBTA 2ORIA 3BFXA 5JZVA 3FYHA 1K8RA 4XD7A 2RGAA 5AJWA 1KNXA 3TSWA 5A0FA 2ONKA 4FINA 1G1MA 1KKLA 1DG3A 1II8B 2Q0HA 5FUWA 2MSCB 121PA 1DAMA 3O8DA 4V0KA 4BZXA 1PUJA 1JXMA 1LTQA 3MG9A 2GF0A 1U0JA 2B7CA 2F43A 3GCGA 3T5DA 2VA8A 1UKZA 2QAGC 3TJZA 1OKKA 2JATA 2ZJYA 4FCWA 2FWRA 2XJ4A 4HLDA 4B3FX 3LQRA 4YMTA 3THXB 5B58C 5TMPA 1RW4A 5JEEA 3Q5EA 5DI9A 4ESHA 2DPXA 2ZRKA 5LPNA 1AM4D 1P2TA 1TEVA 4R9UC 2A5FA 4MDEA 2OSBA 4PC1A 2CNWD 1II9A 1OB2A 1CS4C 2C77A 3IHLA 1Q1EA 1CJUC 4Q4LA 3EZ9A 3B13B 2QSZA 5BN3A 2V3CC 1KMQA 2NO1A 4DCVA 1U9IA 1TF5A 1HA3A 3GQBA 1TQDA 4G5RA 3BOSA 2XOKD 3CRW1 1E9EA 1KMHA 2ZQ5A 2WJGA 3MWKA 3WYFA 3QG5A 3SS8A 1Q21A 2ZI6A 1H65A 4ABYA 4US2R 2QUZA 5DO9A 3QKUA 1G8GA 3LO5A 1W36D 4AKGA 1CR2A 2W6ID 5F98A 1Z3IX 3NBYC 5KSOA 3ZGXA 3K0FB 1GRRA 1G7TA 1E32A 1GILA 4JKIA 4Z1MD 2YYZA 3SE0A 4DZZA 1S1CA 3Q72A 4P3YA 3S1AB 2YV5A 4JT2A 1OB5A 2ZPTX 3BC1A 1J8MF 4PANA 3K53A 1G21E 3CPEA 3NH9A 2HCJB 1E3MA 1U98A 2FSFA 3D7MA 2ZE6A 1SULA 2ZU6A 4DSNA 5F9HA 1ZD9A 5BN5A 1NN0A 3GLHE 1TU3A 4RZ2A 2JJ8A 4PO8A 3CNNA 3SC3A 4F7WA 1IN5A 4OJQA 2NO0A 2VP0A 2XEXA 4JLPA 4EDHA 4G3XA 4Q4AA 3BFVA 1MKYA 1OXTA 1BIFA 3DOFA 2CJWB 2BCJQ 1KO8A 2CL6X 3M6AA 2C8VA 3B60A 2JLQA 3I73A 3AGPA 4GZMA 2V6JA 3GJXC 2Q9CA 4PO9A 4ACBA 1KI9A 3QBTA 5JSZB 4TQ9A 5DGXA 3HR8A 3V00A 5D3MB 3IIMA 4QOSA 1R5BA 2GXSA 1OHHA 3WNDA 3EPKA 2AFIE 2BM1A 3KKNA 3QVUA 4G5QA 4XVQA 5FPHA 1S9HA 1HTWA 1PLJA 4PQYA 4OL0A 2GETA 5EQTA 5IRCD 1YZLA 3Q85A 1E0JA 4HLQB 1YHNA 2KBFA 1F3OA 1NSFA 3CKLA 4M8NE 4PZYA 4E07A 1Z6GA 1EFTA 3THWB 5LD2B 2ZE7A 4NU0A 3WYGA 1E9SA 3HYTA 4PX9A 3X2SA 2FSGA 3RNLA 3EA0A 4JIMA 4IDHA 1KAGA 1SXJE 4PPQA 4RD0A 3MRSA 1CBUA 2ZJOA 3QPWA 2PEZA 5CJPA 5TXGA 4GFDA 4RZUA 4A15A 2AHOA 4EKDA 2ZIAA 3U60B 1G5TA 4B73A 1WDTA 2OILA 2ODNA 1Z0IA 4OK6A 4BFTA 1W0JD 3GLIE 4Q4JA 3OESA 4O25A 3OAAD 3BBPA 3P1JA 2KJQA 3MJRA 3BS4A 3GFTA 2VHCA 3LLUA 5EZ5A 1S9DA 1E2GA 1M7BA 2NZJA 2RAPA 1KTVA 4OQMA 5FBWB 4LJAA 1E9RA 1NVVQ 2P0EA 4D4LA 4L9WA 4C0JA 1UDWA 2Q6TA 4ESVA 4ARZA 3ICEA 2K5UA 1DAHA 1NL3A 4Q9KA 5JEDA 1COWA 4LJ8A 5JECA 2QNRA 2ZRAA 2BJWA 3PITA 4E03A 1HEIA 2OXCA 2MSDB 1R8SA 1E9BA 1TUIA 5UKDA 1QHYA 1N6KA 2HT6A 5BW8A 1KOFA 1ZW6A 6Q21A 1K6MA 4HB0A 1MRSA 2A5JA 3EPJA 3RRZA 1FW6A 4AY2A 3DOEA 4CEIA 5FPTA 2QMEA 5EJEA 2IYRA 3DO6A 1P61B 3ZVLA 1AK2A 2VP5A 4LBVA 1ZYUA 4B35A 4Q1FA 1E2LA 1T3HA 5BXQC 3HJNA 5H8WA 3NIBA 2AD1A 1N6RA 1Q12A 3AQ4A 3K0CA 1J7KA 1IXZA 3IIJA 2PLRA 4PQFA 3KQHA 3TH5A 1IXRC 3ZZUA 2V1UA 4LHXA 3ZZ0A 2J0QA 2VF7A 3C5HA 3THOA 4DB4A 1Q44A 3R7WA 1JJ7A 4ZIRA 3RRMA 3VR5A 2ZI5A 2PL3A 5DHFA 2JLWA 4YDHB 3GFOA 4MKFA 3AP3A 4BLPA 2NMVA 4C0HA 1ZNWA 5EE1A 5HZHA 2JLSA 2J7KA 4FMDF 4AYTA 4M1KA 2IXFA 4TWZA 3U7FB 1D8TA 2ZYWX 1UKVY 4NONA 4DIDA 2O8BB 3GD7A 3RSLA 1KI6B 4TMZA 1CJVC 1XTRA 4LUCA 4F4JA 2FN4A 1D2MA 1W36C 2KE5A 5FOTA 4EQ6B 2VL7A 4US0R 1KI3A 4XSHA 1AIPA 2D06A 4PC6A 5DLQC 1RKBA 4CRWB 5EP3A 3TAHA 4FIDA 1DELA 3FB4A 1TQ6A 1ZUIA 2JJ2A 3FMOB 3ONWA 3FMIA 4WXPA 4NYMQ 1GM5A 2CBZA 1ZD1A 3X1DA 3KTAB 1GKUB 2VP2A 3TIFA 3WBKA 2HDNB 2Z4SA 4PZZA 2RGGA 3GJ8A 5CYPA 1CEEA 1PZNA 4HDOB 2HEIA 2OCPA 3U44B 2FZLA 1OFIA 3IPXA 2A7QA 1GITA 2CCKA 4TL6A 5EXXA 2OHFA 1FMJA 4M1TA 4LYAA 3TQFA 3ZQJA 5HKKA 5J47A 3PUVA 2W2TA 3THXA 2ECKA 4BLOA 2ZJZA 4B47A 4OHXA 5AJZA 1SVIA 2KBEA 4S2EA 3UMFA 4W5WA 1GTVA 4BFSA 2D7CA 3VFDA 4RFSA 1W7AA 2YWGA 5D3QA 5IK2D 4ZKEA 3GLHA 2V7QD 1IN4A 4A0HA 3PUXA 1Q20A 3TQCA 1Q3TA 4IDQA 1KNQA 3U6BA 2IHBA 2JCSA 1CRQA 2C9CA 3NC1C 5E4FA 2VQSA 3QEJA 4JLMA 3RS5A 2FH5B 1Z2AA 4B3BA 3CO5A 3KFVA 2ZS9A 3L8ZA 4II7A 2WWXA 5EE3A 3P26A 2FGJA 4LJ6A 4DSTA 2HYIC 1MO6A 2IYVA 2ZRFA 3TK1A 3GLGE 5LBIA 4AK9A 4NCHA 1KO1A 3REGA 1B23P 3GJ0A 3LVRE 2AK3A 1XWIA 2QQEA 4QXAA 4OQLA 1KI4A 3GJ4A 1KKMA 3S1AA 1YU9A 2WIAA 5FPYA 4ZCMA 2WSSD 4HDQB 4Q1AA 1T3LA 1NVVR 2VH5R 3UG7A 1YVDA 3CZPA 4JLDA 2HYDA 1BO6A 1T91A 4TYQA 4B43A 2DWOA 5K8LA 1BMFD 2ONJA 5CB8A 2ZROA 1OW3B 1FFHA 5B30A 1LS6A 2VHUA 1W4CA 2DHRA 3BFKA 3CRMA 1E2QA 5FBVB 2J0VA 2ZJBA 3RSOA 4HUTA 1SXJA 3DL0A 3NWJA 4Q01A 1I4TD 5BQ5A 4R71A 4DCTA 1G4AE 3BH7A 4NKRA 1ZC3A 3FOZA 3AM1A 2IXEA 2RCNA 3ADCA 1QDEA 3E2IA 3SHFA 4D4JA 2AWOA 3WRYC 3PG5A 2ZRJA 3GLIA 1QZXA 4FWTA 1COWD 2GHIA 2CEAA 1QVRA 4EAQA 5FL3A 3MUFA 1G8FA 3W3AA 3RVBA 2CLSA 4C3ZA 4RZ3A 1MH1A 1VIYA 2W2VA 2XZPA 3P4YA 4JMPA 3LH5A 4POAA 3ND8A 3FKSD 1GG2A 2EYUA 1AS0A 3PXGA 3WRXC 4LRWA 2EQBA 2AKAB 2F1IA 2BKEA 2G77B 2NQ2C 2XX3A 1CLUA 1ZRHA 2QBYB 3DZ8A 1IAQA 1NP6A 2OFXA 3UPUA 4URVR 4C7OB 4LHVA 1N6IA 2GAAA 3SDZA 4IJMA 1Q1QA 3QKSB 4A36A 5SZIA 1R8QA 2D62A 1T6NA 3QPVA 4X8HA 4CIDA 2G1JA 4RSGA 1PVOA 4QC2A 1MRNA 4NCJA 4QFMA 521PA 5JRZA 1G3QA 2IYTA 4NYMR 4AURA 4YXWA 1MT0A 1A1VA 3GJ7A 4TYYA 2GBLA 1A2BA 2CCJA 5C18A 2OESA 3U7GA 5FBRB 3I8XA 1PJRA 4RD2A 1G16A 5DISB 1LS1A 2WHXA 3B78A 2FA9A 1L8QA 1VTKA 2GCNA 3EPLA 2NTYC 1FX0B 3ASZA 1E2HA 4TLBA 3NVAA 2P5TB 2QL6A 4LSGA 4A2WA 1Z08A 2CXXA 2F43B 1D6JA 3KQUA 4DBLC 1SKYE 1E9DA 2X77A 2XSZD 4P32A 4V0OA 1EGAA 5FTJA 3VQTA 1T0JB 5JHHB 2ZVQX 1NJFA 2GEUA 1IJEA 4F92B 4D2IA 2EW1A 5GJWC 5EXPA 3GEEA 4Q18A 2ZE5A 2GJ9A 2Z5FA 4GBMA 5E7MA 3AVTA 2RHMA 2WPDA 3AKDA 3IDQA 3MLEA 3KJEA 4DEXA 1H8HA 3T35A 1Y3AA 5JS7A 3UANA 1IY0A 1U8ZA 2QE7A 3I92A 1G3MA 2FEOA 1DAEA 2OM2A 4GZLA 3D6TB 5KTYA 2Q3FA 2FJUA 1KMHB 1UBGA 5EE5B 1YR7A 4Q5IA 2OXRA 1X1RA 2WAYA 1E0AA 1XCMA 3VKHA 1VYTA 1QVAA 4KO8A 5KUTA 3UMSA 5EP4A 2EFHB 5FUVA 3DZDA 2QPTA 2VTKA 3VHXA 4O3MA 5EE0A 4C0BA 4UKDA 3TW8B 1W0KD 1OFUX 4LY6A 4DLWA 4UNSA 3AVOA 2A5YB 1KO4A 3QF4A 3L8YA 4B75A 4A0FA 4NZYA 1CJMA 3QG1A 3FVQA 2HXSA 2P65A 2WMOB 2I1VB 1G6OA 1DAGA 4MGYR 5CIQA 2YWEA 2I4IA 1WP9A 3QI2A 4A82A 1UDXA 5H70A 1YJ5A 1QBKC 2P6UA 1CKEA 2ZJAA 3PQCA 1Z0JA 1F2UA 2NPFA 4BPBA 2QGNA 4BLSA 4NDZA 3KX2A 2Q3HA 4EPVA 1U8YA 2IUSA 8OHMA 4JBWA 3PJRA 2ODBA 1K5GA 4RD4A 3OE7A 5EXTA 2JA1A 5GJBA 4B3CA 3OHMA 1IM2A 4W7SA 2W0SA 5C4MA 1UEJA 3HDTA 2QMHA 3VKWA 1EFCA 4Q4AB 3SOPA 4LCBA 1OYWA 3CM0A 1DO0A 2EFGA 3U4QA 4YMWA 1XP8A 3IILA 3KXIA 3PENA 3GLGA 3AVQA 3VNUA 2QT0A 1YZTA 2JDID 4DLXA 3U44A 2BEJA 4OI0A 1G3IA 1ZIOA 1NBME 2X2FA 4QBIA 1AA9A 2VRWA 1XX6A 4BLQA 4XWAA 5G3YA 3U6KA 2HCBA 1U81A 4QBFA 5SZHB 2C03A 1JECA 1ZP6A 2H18A 3FHCB 1JALA 3W6PA 4BZQA 3P20A 2O8EA 3W6NA 1ZUNB 2Z4RA 2J9RA 3A58B 2VO1A 3QXXA 4NPHA 1AS2A 4PTLA 4KFUA 3H4MA 4MUBA 3JVVA 4DLSA 2FPMA 1QG4A 3SNHA 1R0ZA 2B21A 2XTMA 4OHYA 2WWWA 3IPYA 4IKEA 1VHTA 3K70C 1U94A 3T1OA 3L0PA 3QXJA 3QF7A 4YMUA 1E2DA 1NG1A 4HZUB 5KO2A 2BMFA 3EZ2A 5DHAA 1N6HA 2A9KA 1UBFA 2FFBA 4G1UC 4R2IA 5FPSA 3I62A 5JLJA 3WP1B 1N5JA 4TQAA 1W44A 2PLFA 1XF9A 1ZD8A 3MWYW 3UWKA 1EX7A 1Z29A 1HURA 4BEBA 3LV8A 2ORVA 3CF6R 1T8TA 3VU9B 3LLMA 3PEYA 4NH0A 1A82A 4D0GA 2PCLA 4ARZB 1MABB 1UEIA 3K9LA 3QUSA 1W4RA 3UKDA 1H8EA 1KJWA 2ZSBA 4YXWD 3KB2A 1YZUA 2X2EA 4U7DA 1NY5A 1DARA 1CU1A 1XTQA 2HLDA 2ZRCA 2ATXA 1I2MA 1N5LA 1ONBA 3HPRA 3T61A 3UATA 2GJSA 3C41J 5DI3B 1XMVA 2F1RA 4FMCF 5G3ZA 3TSZA 4CEIB 3H1TA 3Q5DA 3J81k 3RYTC 3MJHA 4UNPA 5KDLA 4Q7LA 2DCUA 4D4MA 4B76A 5KU1A 4GP6A 3C5CA 2OAQ1 4N1AA 4DHEA 1LF0A 1DAFA 4CF7A 2NO7A 2F1JA 3BIFA 3QEOA 3SJBA 2AD5A 5CIWA 4FMDB 4DLUA 1E2EA 1CJKC 1YZKA 1KYIA 4M1WA 3I5XA 4ZIRB 1LF5A 3SFVA 5LB2A 2WBLC 2EFEB 2R6GA 1V5WA 2OEPA 1M7HA 3TVTA 2QMUA 3O47A 4RFVA 2WJIA 5DH9A 1JEDA 3UIEA 4B3GA 2AWNA 1JPJA 1U99A 2H1LA 3A4LA 3B1VA 2PMKA 3DKPA 4HAZA 4NCNA 5EZ6B 1OXVA 2LKCA 1E0SA 2VF8A 4RCZA 2ZI4A 1DAKA 1ZVQA 4GOKA 4XVUA 1GL6A 1ZAKA 2N46A 2FEMA 2H5EA 1ZBDA 1LFDB 4R98A 5C46F 2IT1A 2JLXA 4YC7A 3TW4A 1KSJA 4URXR 4MRPA 1GIAA 4LGMA 5G40A 1NVWQ 4OK5A 2BMEA 3MWLA 4PPNA 3P4XA 1WF3A 3U3KA 1XTJA 2MMCA 2J0UB 1G41A 3OEEA 1E2PA 2DFLA 4EPXA 4UNNA 1TADA 1QHGA 2J0SA 1UKYA 3LAWA 5FL7D 1ZMXA 3LY5A 1E2MA 1FX0A 1FP7A 2V6IA 4D82A 5J4LA 1NVUQ 2VPPA 1YRAA 1Q1BA 4LBWA 1SHZA 1XNJA 5AJVB 1ZM3A 2GK7A 3F3YA 3FTQA 4XWKA 2DWPA 3GFPA 4PSVA 1FP6A 1Z47A 4NCKA 5FH9A 2IS4A 5FTKA 3T15A 4OI2A 1ZM9A 2YZ2A 1OH7A 4TL8A 3SHWA 3FMPB 3EPHA 1R10A 3MD0A 5HTKA 2BEKA 1S4QA 1YR6A 2A2ZA 2Z0MA 4HB3A 3OFNA 3KZ1E 1CTQA 5EUMA 5JFGA 1Q1ZA 1ZM2A 4RFSB 2WJJA 3GLHB 5FR2A 3FKQA 3R20A 1YE8A 4LDJA 4QJ4A 1EFRA 3UMRA 3PEUA 1XEWX 1W4AA 2OZEA 2ZI3A 2GEVA 1TX4B 4PXAA 1RIFA 3KJIA 3T06B 3KJHA 2ZTSA 2W6JA 2PBRA 3K0AB 4HLUC 4OHZA 3FPAA 3TSOA 4TTPA 3VKGA 2WICA 5JMTA 3AVWA 5TARA 4WIAA 1HV8A 1OV4A 4B3DA 1NBMA 5JRJA 2REXB 2ZRNA 1IY2A 3E1SA 1GVNB 2IYYA 1X8LA 2ZSEA 1SGWA 1RC8A 1KSGA 4QNMA 2AXNA 3SJAA 2CCGA 4M0LA 1BOFA 2QQ0A 4MYCA 1CR4A 4IEIA 3B1ZA 4DLYA 1A4RA 5L3QA 3BXZA 1G18A 3EWSA 3OF5A 5CDFE 3UK6A 1JAIA 1XXHE 1C9KA 5FTMA 2IUTA 2CK3A 2HV8A 2OUKA 3PV0A 1TQ4A 4QJ5A 4A8JA 1J70A 4DDWA 5KOYA 3F5FA 3AKYA 4RY2A 2GAOA 4P31A 4G01B 4EPYA 1LY1A 4NYIQ 2GVDC 1CJTC 5LD2C 4JJKA 1CULC 1NKSA 4KLNA 2CE2X 3Q7PA 1XEFA 4TT3A 5JCPA 3L82B 5FTNA 2ERXA 1SXJB 3NBZC 4UXHA 1GOTA 1UPTA 1ZINA 2HJGA 3OEHD 3WYAA 3QBVA 3AV0B 4MH0R 4UXJA 2N1BA 2W0MA 1G6HA 4LYFA 3G82C 3RHFA 3M4YA 4FW9A 4BLTA 1A5TA 2JLRA 1IONA 3GLIB 2DFTA 5TVKA 2QGZA 4TN1A 1H8ED 2J7PD 4OI4A 1UADA 4Q21A 4WA7A 1GL9B 2ZAMA 3KQNA 2FDCA 4GOXA 4EJSA 1JR3D 3B6EA 4DEYA 5JBQA 1SQ5A 5J40A 3TUZC 1E79D 3BORA 4KSBA 3VR6A 3D8BA 4ASUD 4Z54A 1FQKA 4HZIA 3SEAA 4FXPA 5L8VA 4GL2A 2OFOA 4OKSA 1KK1A 5SZJA 1E96A 1XZQA 4PPFA 3AF2A 4NHOA 2QM7A 4KFSA 4US1R 4N0EA 2OT3B 2BDTA 3NTUA 1Z07A 1YZNA 1IBRA 4IVRA 3B82A 1J99A 2ZRLA 2XNDD 2ZUDA 4CW7A 2WJYA 3HWSA 4JVNA 3CH5A 4IHQA 2DWQA 4F4CA 1E2JA 4LI0A 4P0TA 2NOAA 2B8WA 1P72A 1R5NA 5FFMA 1JPNA 3AB3A 4ZDKA 4HZUA 2REOA 3MAAC 1EK0A 3VMFA 2ODWA 1ANKA 4JVLA 5FBQB 1VPLA 2ZRMA 1EFUA 2F55A 1ODFA 3TLXA 1G17A 1L4YA 5JHGB 3EG5A 4DT1A 2D4HA 3E5HA 3UWOA 2FFQA 2QZ4A 1GKYA 4YLGA 3VU9A 4L9SA 4X8MA 5HE8A 5IT5A 4C0QC 2PJRA 1I4DD 2YOGA 1WBBA 3LA6A 1BS1A 1NY6A 1MABA 2P67A 2UZ3A 4DRZA 4HLCA 1NN3A 1NF3A 4KCGA 4W9MC 4V03A 4XD7D 2FSHA 2QTHA 3B1WA 4CZ2A 2IWRA 3OEED 2O8CA 2GXUA 1VG1A 1Z2CA 2IBMA 4DSUA 4D26A 1NG9A 4ZO4A 1P9NA 5DI3A 3LWNA 1XDBA 3MCAA 1W1WA 3T5GA 3ZVMA 4M53A 421PA 4P4SA 5F2EA 3AKCA 3BB1A 3LQQA 4ZDWA 2IF0A 4PO1A 3LVQE 4NMMA 1OT3A 1OKKD 2IC5A 1E1QA 4PC7A 4ZPXA 5TY0A 2R6FA 2IYZA 3QOFA 5AUPB 1UKEA 2P5SA 4MQBA 4TSFA 3W5IA 2ZITA 3B8HA 4Q1EA 4DCSA 2GZHA 3NBFA 2C2HA 2EVWX 2YWFA 2ASEA 4LJ9A 3O8RA 1VCNA 3LNCA 4MRRA 1Z6XA 2XB4A 1ZNYA 2H92A 1ZM4A 2ZJ8A 4PAOA 5CLQA 1ESNA 3QF4B 4D6PA 1E2KA 2F9LA 1AGPA 2IX3A 1NN1A 3WHKA 2NO9A 4JLJA
chains in the Genus database with same CATH superfamily
2AR7A 2X19A 2GXQA 4OB6A 1ZWLA 2P6RA 3GP8A 3L07A 3QQ5A 1NRIA 3HJAA 1HYQA 1VMAA 4QXOA 1F2UB 3ML1A 5LQSA 1YTLA 4DG8A 5EEHA 3QFRA 1XAHA 3T5MA 3WP0A 4BE9A 1E4YA 2IZOA 1H05A 1KJYA 3E18A 4CTJA 5BR7A 3OFKA 2X4DA 5DLEA 4PYKA 2HD4A 2SCUB 2M1XA 2XGOA 1Q0PA 1NBOA 1USUA 1LI7A 3F0TA 3TMKA 4PHGA 4AZTA 3S29A 2N1MA 2AFHB 3TE6A 1YJCA 3LOPA 5C8ZA 3U4QB 4ETNA 1GYPA 2RGBA 2AB0A 2CK3D 3FWPA 3MWEB 1LPMA 4JODA 1FVOA 3QELA 4MV9A 2ZTLA 3HI6A 2Q3CA 4KBFA 5FWXB 2QLBA 2RC6A 2AR0A 5TDHA 2AMVA 4HNGA 3Q3EA 5L4SA 3WLQA 4O1MA 5C8YA 3LBAA 9GPBA 4NNPA 4I50A 4Y2VA 5FUXA 3ZE0B 4UEOA 1N6OA 1CJCA 3OX2A 5JV5A 4CMEA 1WMSA 2V8OA 1G9SA 1ZMBA 2YASA 2VAPA 1RMTA 3BMCA 3OZWA 4B3IA 5LMNB 1THZA 4UUMA 4RJKA 2IUEA 3DPUA 4G85A 5IYZA 2BHNA 2V9PA 4FPXA 4RH3A 4LW8A 4TKZA 5JW6A 3CZ5A 1XQ6A 1DVRA 2X86A 4QDOA 3QTTA 2IY9A 4E5PA 3K09A 4MIKA 3BWXA 3OTWA 1F60A 4DXAA 2DSNA 3WLPA 2PSFA 2PTGA 1ZRNA 3MHPA 4IZ6A 2H7VA 1UC4B 2WQZA 2QEQA 3BMOA 1Q14A 4ZFNA 3U62A 5H4HA 4LYEA 4EABA 1P73A 4YDRA 4NE9A 1AKYA 3DLAA 1YQUA 2VQDA 1CY2A 3AF3A 4LHZA 2Q9BA 2YW9A 1KZ9A 4TUYA 4INZA 2BE9A 5LQMA 5J4HA 1P7YA 3H0EA 3PVCA 1K5HA 4ZCIA 1KI7A 2P2DA 3GLQA 3PUZA 5DNEA 4IR7A 5BNZA 3GUCA 4Q02A 2RMKA 4XSGA 4COKA 2BGWA 4MRNA 2F00A 4JU8A 4RD1A 3WLJA 5I8WA 4BKUA 1LPPA 4BZZA 1MJGA 2FI1A 5JD3A 1VI5A 1TQHA 4Q48A 1ZCAA 4JUFA 1HM5A 4M9ZA 4X5OA 4ZYYA 5JNUA 3TN7A 3OZBA 2I22A 4ZOLA 2P6NA 4EGFA 1KPIA 1WLYA 4KTVE 2WWHA 2VUIB 1C14A 1SELA 3VNVA 1E6CA 1SK9A 3CXUA 4PHHA 4IDEA 1MQ8B 1XJCA 3V4PB 3EEFA 4C4OA 1OWPA 2CDNA 1OXBB 4C5AA 2ZBEA 2HQBA 2C5SA 3C2QA 3KK0A 3COWA 2WLSA 5CAEA 5IVPA 3BJRA 1JILA 4ZYZA 4Y0AA 3PK0A 3ZHOA 1C3OA 3DAFA 1TAGA 2ZZKA 1YCFA 3DT6A 2FPPA 3LZ6A 3RU3A 3WK9A 2VJLA 1R0YA 3JWPA 4EGCB 1NMYA 4ND1A 1W73A 3AEYA 1C3LA 1EGVB 3EFHA 4KWIA 2G6TA 1G9TA 3UMGA 3RT9A 3AFNA 3ESYA 3QX7A 2BGJA 4WECA 2PK3A 1H5QA 2WWTA 3E2PA 1P5HA 5HM8A 3AFOA 3B9PA 4CM6A 5DTEA 1U2EA 3N8NA 1Z16A 3K9NA 5AP9A 2GR9A 4IMPA 2HHJA 2JZCA 1N78A 3TXAA 4GPIB 1T9BA 3NP9A 2O2XA 3KPJA 3FBTA 3OMLA 3T5PA 4Q9LA 1XYYA 4ZDJA 1FQJA 3GLTA 4DJTA 4NE2A 1WW3A 1CYDA 1K6XA 4C2UA 1O3YA 3BHNA 1W4LA 5G4KB 5JVDB 3AZPA 4FN5A 1DWQA 4FIZA 2JLVA 1DG1G 4D79A 3E9ZA 3UKOA 1J97A 4R8KA 1IJFA 2EFJA 3AUUA 4R41A 3OQNA 1FJGB 1YR3A 1T1RA 1YDWA 4QODA 4Y1FA 2C4MA 2CHQA 2HMYB 2HLHA 3PU6A 3VUFA 2PXCA 1KI2A 1P9RA 1H4SA 4GX1A 5LP6F 2N42A 2UYCA 2Q99A 2REBA 4O4HB 1SG0A 3BWDD 4KLAA 5B57C 4DGQA 2A0XA 5C32A 3L6DA 3I01A 4RENA 4MUAA 1L4UA 1XTPA 2G36A 5HEKA 2RBKA 3DXYA 1NA5A 2GYYA 3L0IB 4HN2A 2BTQA 4JJEA 5T67A 3CLHA 2O2HA 4BCBA 5B3KA 1C0KA 3KKOA 821PA 5CA0B 1SXHA 4PS0A 3V8PA 3LX5A 1CDOA 1DQZA 5D01A 3TAUA 1XPJA 3MTBA 4F38A 3EAQA 1CF2O 4BCDA 4YMVA 3PXUA 1V3TA 4M87A 1F48A 4Q7KA 5FTLA 2BCEA 1DJPA 4YX9A 2Q5EA 3DEHA 1T6YA 5HS4A 1SHTX 2JFOA 4YRSA 1TLFA 5CHYA 1UM9B 3IT2A 1V8OA 3S2YA 3WAJA 4PG4A 3B89A 3OQOA 1ZN2A 5FWDA 3DM9B 1BVHA 1E89A 4DMHA 1DQNA 1YA6A 1E3TA 3SMVA 3F7TA 3EB9A 4K9DA 3GFSA 4WNAA 4AF8A 1M54A 3CNBA 3AEXA 2CLOB 4WXEA 3KD3A 4ZHSA 1NKVA 5HK9A 2SICE 4L3WA 3RK0A 2I2BA 4ND7A 3WKDA 3MNFA 1IB0A 1RXCA 2HK8A 1H2EA 3H1PA 4UD6A 2A30A 1KYTA 3QE0A 5DXFA 3QENA 4D9EA 5EHXA 5AM1A 4I1PA 1Y7LA 1BRTA 1SC6A 4YRGA 4N9QA 5LWQA 2BGMA 3RQSA 6ABPA 4GPTA 4BNFA 4BQFA 2IIVA 2XGJA 1U2TA 1RAAA 2HPAA 2CDCA 5F1PA 3GA7A 1JEYA 2WE8A 5HKKD 2XUGA 1VIDA 1OD6A 1PEKE 2PH1A 1KIFA 3BTOA 3KQYA 2POCA 1ZR2A 3DQPA 1S2LA 4GT1A 3SM9A 5E4TA 1DXYA 3LUHA 3A1TA 1QOZA 3AVUA 1YVUA 4LJ4A 3NEAA 1P18A 2EL7A 4NU8X 3RGGA 1U0EA 3IKTA 3AM5A 2PA3A 4G5SA 3WGOA 3OMWA 4XH9B 4CMCA 1EFLA 1EWVA 1DBWA 5AIBA 4KIJA 5KYWA 2HF7A 2YCLA 3COSA 3H2GA 1DLJA 4QDJA 2EG5A 5DSTA 2QENA 3HA2A 4GC5A 4Z9XA 4S0ZA 4DUGD 1J0XO 4W5JA 4C4YA 3LFHA 1D09A 1C9EA 1HTBA 5EESA 5K6AC 3VAAA 3FRHA 4IIJA 5L3SA 5IF3A 1KJQA 4UATA 3H9UA 4AFNA 4FUQA 3OHPA 1JHPA 2A92A 2ZJFA 4J29A 1G3UA 4PYLA 1OFUA 1YMVA 4MWGA 4F93B 2FK7A 3QJGA 3A4VA 5B53A 3SIPA 4R2HA 4DJ5X 4DWOA 1NNLA 3ADDA 1Q6YA 1ZJYA 1NR7A 3CNLA 3D0KA 2FZVA 1GGVA 2UZ4A 5C1BA 4Q9HA 3DHEA 4RABA 4F4DA 4HY3A 1N92A 1T5TA 3UGJA 3Q1LA 1PHPA 3IEPA 2VPQA 1E2NA 3FZEA 5HQJA 3PNMA 4KFCA 2QP4A 1ZVJA 2C07A 1XN4A 4L5YA 4PSAA 4HDSA 2YR0A 1NQVA 2WI8A 3AEKB 4BFCA 5DM4A 3VR3A 5IJ0B 3GGGA 3KUUA 2O6HA 4HBGA 3UAZA 4CKCB 2HU5A 1EFVA 1WSBA 1CT9A 2BGRA 3V9PA 1RM3A 1SAYA 5J58A 5B1DA 1L5WA 1QDUA 2AXPA 1SXJD 2GZDA 3A3NA 1NFRA 3IEUA 3JW8A 4HRYA 4OX9B 2WIGA 4NZOA 4NEGA 4Q3OA 3W1WA 4J3FA 1ZSVA 4MGZR 2EBHX 2XQVA 3GJRA 2YHIB 3KEMA 1PT5A 3LUCA 1CZHA 3IOEA 3PNSA 5CT9A 2W2NA 5GOTA 1BYUA 5DM2A 3SJCA 1M6HA 2PUBA 2HMUA 3F7MA 1SBIA 2I33A 3DKIA 3KQPA 1TM7E 3G1UA 3L84A 2PO5A 5EIFA 4PINA 4QA9A 3ZHTA 4Z51A 1UFOA 3K9GA 2ANBA 4OA8A 1GG9A 1IWPB 2HPZA 2FR8A 4M37A 5KWEA 3G8CA 3EASA 3JARA 2AC2A 1QAOA 3UUEA 3ZK7A 4C4SA 4CETA 2QW8A 3LIPA 3OPMA 2B4AA 3AOEA 1RI2A 1PT9A 5HZGA 4BFYA 4DBLE 3A1EA 2YV1A 3W06A 3ZU2A 4DMUB 5IHXA 2BJHA 3CB4A 4BE7B 4D8VA 1C7JA 4FT4A 5KVSA 1BXZA 3HXQA 4JLVA 2PMCA 2BOVA 1FVXA 5LYYA 4K6CA 4WGFA 4JI1B 3RAGA 1TTTA 4Y1GA 4Q03A 5HVNA 3O94A 4MB0A 4F72A 3QVGB 1HFWA 1N2SA 1BGVA 4WK2B 4D56A 3FYUB 4YCBA 3WMEA 1OGYA 2XITA 2J0EA 2NG1A 4POOA 3RADC 3H0KA 4ZOEA 4TL7A 3BERA 3TR5A 3UV3A 2BP7B 2GTPA 5EFOA 3SXJA 1X7WB 3WMWA 2XXAB 4N3CA 5AJUA 2HJRA 4YWJA 5CVTA 2QT1A 1Y4DE 3RWOA 4RCYA 3TAXA 2HGZA 3KE9A 3F1LA 4YQFA 3FNRA 5CVDA 1DWOA 4CIAA 2IGBA 2FGKA 2Z2XA 4URYR 3WA7A 4WOJA 3LOUA 2A9RA 2AEJA 4IFEA 4N8SA 5ENZA 4C4RA 1M1UA 1T2DA 4YV0A 5D85A 5KDOA 5LNK6 1JLSA 4LQDA 1PG5A 3IHWA 1A27A 1OIWA 5CVVA 1YBAA 3E4CA 2EHJA 2VTVA 3WVNA 1H0SA 2WC1A 4YP5A 3UJPA 5EAIA 3DTVA 1RCTE 4UUBA 4HFJA 3VNAA 1KO5A 2OL4A 4IHJB 5H83A 3G49A 2PKRA 5E6SA 3QU4A 4P4SB 4D41A 1EINA 3HKCA 4BO6A 3C6MA 1GNVA 3V2GA 3ET5A 5K0JA 4GMGA 4LXIA 1JVBA 5KHLB 4HWRA 4QL3A 2GF9A 3GJTA 4AMBA 4B09A 1L4NA 4LBZA 1E2UA 1RPNA 2ILTA 2KPOA 3EVDA 1OF1A 2CW5A 5I7OA 4CQMA 3K1AA 1NUPA 1E69A 3OEYA 2WV7A 3UZUA 3IYLW 3KKPA 1Q7BA 3OX4A 1KO7A 1F0YA 2JAPA 3EVZA 3KKKA 4HDAA 5U4XA 3TIIA 2W48A 4ECAA 1GRCA 3BK7A 1EXMA 2B98A 4HB4A 2XXJA 1T34A 1N5RA 1SHKA 2LIVA 3TCKA 3TR0A 1CUHA 1OBVA 1M2KA 1QHNA 1JTEA 2I7VA 3TLZA 3B8EA 4YRZA 1VCIA 3RG8A 1XDZA 3ESZA 4GMKA 1FF9A 2MYNA 2V7GA 3QXSA 4ND8A 4XTRA 4D7AA 3NONA 3IEVA 1ZEMA 1QONA 3HJUA 2FPKA 2ZYTX 3FCOA 2WHQA 4TXMA 1N36B 3GLKA 3V1MA 4G0MA 4QYTA 4MLDA 3SYLA 2ZEJA 4GM0A 4J07A 2B83A 1PE0A 3H8JA 1ML4A 4HUJA 2IU3A 5EE9A 5KMGA 3MS4A 4PRLA 1ORVA 3EA4A 1JFTA 1ZY2A 1T4DA 2X76A 3BK2A 4YT4A 3QOWA 4EKIA 3SZGA 4MTCA 4B87A 2O3UA 2ZE8A 4YJGA 3OZCA 5BSMA 3CWQA 1C7RA 1ZICA 1F2TB 2PFSA 3E27A 4XM0A 1P17A 1K3FA 3C3BA 4IL5A 3QU2A 4LRXA 4MI3A 3MTDA 4AIIA 2ADMA 5JS6A 4ZAGA 3UBTA 3ESDA 3JAKA 4GVLA 3Q9LA 1T15A 3QELB 5CU7A 3JQAA 1AO3A 4TYPA 4RKRA 3T7JA 1L5FA 3N8HA 3U2QA 4DRYA 2BSQA 4PAMA 3NP7A 4CKZA 2VDKB 4L57A 5KI6A 1T8UA 5EP2A 4BMNA 5C8YB 3IO5A 5CK4A 1KVUA 3IE2A 1BCSA 4E7OA 4PYIA 3EF1A 3GVHA 4HDRB 2P3SA 4LYHA 3R7DA 1VRWA 4BO7A 3CFYA 3PP8A 1Z68A 3KXLA 1JEJA 1JKMA 1S1MA 3MF4A 4TM7A 5AKGA 4C4ZA 1KVTA 3ZCXA 5IYZB 1FXSA 5C8VA 3W9UA 4G23A 2X3UA 3CIOA 2A1UA 4Q05A 1QAMA 3O9MA 1Q1AA 1Y33E 3H87A 4GKBA 5EKUA 4J03A 3LGXA 3OPYI 5LOVB 2RHOA 1NNEA 1WCXA 4P4GA 2H4FA 3BXEA 4B33A 2PUTA 1O03A 2GJ4A 4MPRA 5DSXA 5IJ9B 1B6GA 3ZJUA 3IBCA 3TVDA 1QX3A 4I6JA 3PLNA 3HCDA 4RF4A 1M2EA 1ZC4A 2GBPA 3BMOB 4TSKA 3TZBA 2CV1A 5GPBA 1FS5A 3TOVA 4RZXA 3H2SA 4KXLA 1J2EA 3U3OA 2V8BA 4D97A 4TUYB 1F5NA 2RIPA 3HXOA 1E1MA 2G1UA 1SG6A 1Z0SA 1Z8DA 2PQ6A 2DQYA 3A1FA 3O2QB 2RGUA 4OQNA 4UTZA 3QHPA 1S0UA 4EFLA 2G28A 1UJ4A 3Q9NA 2YMLA 4F91B 3CSSA 4PE5B 1M8GA 4C30A 2B1IA 2IU6A 3D4BA 4P3NA 3H5RA 3I23A 3RAJA 5HZKA 1F0NA 1P7CA 1ZN7A 2DHQA 2QD2A 3QYAA 5KEIA 1HK7A 5ESDA 3TPZA 4U6NA 3L9WA 4XWYA 1I13A 4ZOLB 1HQCA 2VK4A 4NXNB 3NHKA 1UWLA 2B92A 1PNVA 1BTOA 4UXIA 4NHEA 3UJ3X 1SEPA 1NVBA 3IULA 5CXXA 3M3HA 4Z4HA 3K2EA 4LEIA 1MPXA 4A23A 3G02A 2LWIA 3A7EA 4JXJA 1XZJA 4GRDA 3BMQA 1A9PA 5AHWA 2CF6A 5CAEB 4JOSA 3VPXA 3ETLA 5HS6A 1YOBA 2K2QB 3HVHA 1XE3A 3OZTA 2QL7A 5A9TA 2XADA 5FI1B 3WX0A 1H5UA 3F2VA 5GJVC 3PQ6A 5DX8A 5HFAA 2FPPB 4MQLA 1U7PA 4QBHA 2BC9A 1EDEA 2I3GA 1L7QA 1JQJC 1UQTA 2XODA 3HR7A 4AUKA 3FPHA 4D9CA 1I4LD 3QEMA 4HNRA 1XRPA 3QVLA 4O2AF 1WY5A 4P34A 3PNPA 4YDSA 5DBGA 4IDOA 4YA6A 2YY5A 3MERA 4KI7A 4PG7A 4KU4A 1FIUA 5AT1A 1SB8A 4D3YA 1XD2A 2B94A 4LV5B 1FFEA 4GWGA 1XCLA 4QDKA 4IHKA 2ZBFA 4O2BA 2O3SA 3LUGA 5BPHA 1PR9A 5THKA 1ZOIA 4J0IA 4UHHA 3UHOA 3F97A 2C29D 5J5CA 2OPBA 5KU7A 2YJ6A 4MULA 1X9HA 1P31A 5FHRA 1UF9A 4HNTA 2IYWA 3R6WA 4YREA 4DV7B 2VNIA 3L0DA 3SN6A 2FZ5A 4DCNA 2H16A 3O03A 4D9KA 3Q0TA 3ZH9B 4W9NA 3UENA 1YI1A 3JQBC 1HO3A 2HRDA 3K7EA 4MUXA 5B5SA 5FI3A 4ZHQA 1GEGA 4FI3C 3ZCTA 3ETGA 4A0GA 5IK2A 4JB0A 4A4DA 2Q07A 1RFLA 1L8OA 3A4MA 3MEQA 2J9YB 2C78A 2P2GA 3R0XA 4PTZA 2CLIB 3NB0A 3T1TA 3TGPA 1E1RD 1KI1A 3O4VA 3PKIA 1BFDA 1HRKA 3R3ZA 2BW0A 3QJYA 2CY0A 2XAAA 4BZPA 1C5KA 1MGOA 1Z6ZA 2NWQA 3K4HA 1VHLA 5H5JA 4L4UA 5I9IA 4IIXA 4YUXA 4NJEA 3I5AA 4UUQA 1QHHB 2VHJA 4YYZA 3UAXA 4K9NA 4EO7A 4ZI7F 1EFKA 4HRAA 5TB5A 4YAIA 1ES9A 1UBLS 4IBOA 2WTXA 4BTEA 3MM4A 4R2JA 2CLCX 1Y5LA 1MVLA 3WZ2A 2PM8A 2O8FA 5DIFA 4AO6A 3W77A 5CD1A 3BD7A 2LV8A 5A62A 4B71A 1LPNA 1X92A 3L6UA 3VPAA 4YUYA 1TL7C 4OQZA 5EHNA 3CPHA 3IKJA 4XR9A 2I7CA 4GE3A 4ZQCB 3NCHA 2XUJA 2YWRA 1CUUA 3B38A 5ALQA 4YT2A 1CC1S 2XB6A 1C0LA 2NX2A 4DR3B 3GGSA 4PPGA 4Q4HA 3FTNA 2BSAA 4QEKA 1V95A 3Q8XB 4OXNA 3FUCA 4DLBA 2Z83A 1A9TA 1JDJA 5IEBA 2EQAA 1BN6A 2XVZA 5A5FA 4LRQA 3NG1A 3TXXA 5CYFA 1Z4JA 3VC2A 1ORDA 4MGEA 3IUQA 3RJTA 1EBFA 3EUWA 4GYYA 4GSYA 4N5DA 5CXQA 5JDCC 3O4JA 5C1DA 1FMLA 1GP2A 1R3DA 1W5FA 3PJDA 4B6QA 3LDFA 2WJVA 3QH4A 2YFHA 1EI9A 1XEXA 2JKZA 2QU8A 2ZR0A 1E9AA 3DE5X 3ECCA 3HL0A 3UK0A 3VGJA 5JNWA 4AKHA 1DX6A 2VUUA 1O9GA 1RVV1 4KX5A 2Q46A 4ZQEA 1CUXA 3NXSA 1H4VB 3MJTA 1JEYB 1VE7A 2VBGA 3QEAZ 1HT2E 1L7VC 2JBHA 2QRVB 1UXKA 5C5EA 1GN9A 1W75A 5AKIA 1OUMA 4TZTA 4MW9A 1IQPA 1J24A 5K0SA 2XCQA 4WESA 4RY0A 4WZ6A 5K03A 4LOLA 1EXWA 4N7RA 1WEHA 3L6EA 4CGYA 1DX9A 1DTWA 3ND9A 1BYIA 3S2IA 4DPKA 5C7IO 3KUKA 5CGZA 1XEWY 1U02A 3LSYA 1TCCA 4B44A 1EFRD 5KYWB 2FYTA 1DPGA 4DYDA 1JG2A 1BH6A 5EERA 1X80B 2PH5A 1VGVA 4QGGA 4BWYA 4V0SA 5HKOA 3IP6A 2RDMA 3K2IA 4CLHA 1IEQA 3EZFA 2ZWOA 3F6YA 3KZCA 1EESA 1ESDA 1OBOA 1RRFA 4IIJB 5KNBD 5L3SB 2FR1A 3ZGLA 4ETWA 1OI7A 2XT6A 2VQ6A 2VTEA 3LRPA 4TZ0A 2CMKA 3OU7A 5MFZA 2J3JA 1JDNA 2E6KA 3ACDA 1CIPA 3MELA 1P75A 3U3ZA 5T4HA 2YXDA 1MW8X 1Y81A 2QN3A 1F0PA 5BWOA 3ZXSA 5CFRA 1ENOA 1BMDA 2IDKA 5DBIA 2RBEA 1KXZA 2X8AA 4GX2A 1IPEA 3WS7A 2VOEA 3WO1A 4MKHA 5I7SA 1ONNA 4KDEA 4YJ3A 5AXBA 2OCDA 4MVJH 5LDGA 5KOIA 2BGUA 4M8IA 3KE8A 5B3LA 2RHRA 1LTKA 1OJLA 3L5OA 3ZCUA 4RJJA 5IAEA 2UV8A 2CB0A 4DLTA 3A6DA 1Z15A 1YCGA 2PKYX 4HDSB 3CZCA 1RHJA 4OJKA 3KAQA 2AJ8A 3ZHBA 2EJTA 2R4QA 1UKBA 1PV4A 2PGDA 3P27A 1VFPA 4DIBA 4OJYA 5CEEA 4NP6A 4ZP1A 2ZYDA 1TRHA 3A9TA 2ZS7A 1R7RA 1EFVB 1Q0UA 2OLJA 4TT3D 1A4UA 3FJOA 3K9BA 1TYCA 3GAMA 4MARA 4DLAA 3BREA 3VJRA 3N70A 4PN7A 5DBEX 5AVYA 1KZHA 2YXBA 1FXUA 1EVZA 1R64A 4NLLA 1GCAA 4XJXA 3SS7X 4CTKA 1DL5A 2YIJA 4UM5A 5JSKA 3CUUA 4XUCA 3WISA 4X61A 1XRJA 4L28A 1IRXA 2ZVJA 3RLFA 4D8XA 5FNVA 4UOEA 2VP9A 5CFNA 2WEKA 1QORA 1RQ7A 4JQOA 5LMUB 1RM4A 5ITWA 4G0VA 2XEDA 1DO8A 4P5PA 5JD4A 3N0VA 4G67A 1ZD5A 2O07A 2ASVA 2VSFA 4XVRA 5A4FS 3D0OA 4R7ZA 2NPOA 1X0VA 3G5TA 3ZVNA 2EX4A 2FLKA 3VR6D 4HH0A 2PZFA 3UAGA 4F3KA 1IBLB 1RABA 1R0RE 5ED4A 1PK7A 2J3HA 3N75A 2CFTA 4L50A 2ZT8A 2JIDA 5I7VA 4LVUA 4G37A 1DIHA 4EGSA 4E88A 4LWPA 2YWBA 3AI7A 5EGNA 2ZP1A 4YRKA 4DR7B 1LBEA 5COBA 4MV4A 5T6MA 4I50F 4RVOA 4OYRA 1U0GA 4MKGA 5AI6A 3ZS9A 4MSUA 4KC0A 4WOCA 1JTVA 3NETA 5JCZA 1YFJA 4OFBA 1IZ0A 3RS2A 1U9YA 2FP4A 3UIEA 2E18A 2XT9A 3R9IA 4NOJA 4RF2A 2RHDA 4B74A 1CZNA 1SCBA 1G8PA 4X84A 1LCIA 2R66A 1CDEA 4FMCB 4P4TA 4PYMA 4QRHA 5KAPA 4TS4A 2VYVA 4FHDA 2DBYA 4N5HX 1FTGA 2M2IA 5DEOA 3MMXA 1JKXA 1GN8A 2ZR7A 3JD0A 1D1PA 1F7UA 3KFLA 4OBBA 4CIVA 4S35A 2IWHA 5JJKA 1JZQA 2GVZC 4Y98A 2BFMA 3BKXA 1W96A 2PPLA 5JXWA 4NG4A 3WIEA 3ZWNA 4XCXA 2PH7A 3M6IA 5E6SB 1PJQA 5U1PA 3TGWA 5JAUA 4IGEA 2OORC 3PA6A 4FZ3A 4IKOA 4P92A 4Q7JB 3BQ9A 5CRIA 4CUKA 1O5IA 5JU6A 1D2EA 4YP9A 4RDIA 2H3EA 4EHAA 2A0FA 1ZIYA 1U2RA 4H2DA 1IC6A 4ITRC 3O21A 4O6VA 2ETVA 2VK1A 3ITNA 1YRBA 5B36A 4CQMB 1NIPA 3ONFA 1N0WA 3OO1A 2XWPA 2IHTA 1D4OA 1D2RA 1KEPA 2C0QA 4HEA6 4QWMA 1T1SA 5IJWA 5CFLA 1GPH1 3G6WA 2DFNA 4HR7A 1DIRA 4I3HA 3K0SA 2IIBA 4A0RA 2VXOA 3ZJYA 3A1DA 3ZDZB 1QCCA 4CV3A 2J59A 4QKQA 4JSYA 1SBYA 5FOXA 1DFHA 1C1DB 1XT6A 3N05A 4RA9B 4CL2A 1NVAA 1VL5A 1IHUA 4TV8F 5J2TF 5T3UA 4MW4A 4X8OA 1S2OA 5T57A 2I7TA 4ND8B 3U3RA 3ZW9A 5D3MA 3PIDA 2FW7A 3NKFA 3EY4A 3TRFA 2AFVA 1NFFA 4F7DA 1M67A 1SUBA 2X0IA 3VR4A 2D1FA 2C3UA 3B7PA 2Z2YA 2POQX 4IJQA 1QIDA 1KK3A 4ZO9A 2JH3A 1HUQA 1T1GA 1BX1A 3M5DA 2IXAA 3CZAA 3FF1A 2XUFA 4FYJA 3K70D 2GUWA 5KMGB 1WCV1 4R2XA 1EUDA 4MR9B 4O59O 4P7JA 4AC9A 1FNDA 1MT3A 1O1YA 1PX2A 1XTKA 3KELA 4KYIB 5EMKA 1NBIA 1S6YA 3MWJA 1FVHA 5TIIA 4YJGB 1PG2A 3IP9A 1JBKA 3ZS8A 3TBHA 1P1HA 3ZHRA 2JI7A 5B2EA 2CNLA 4L3VA 2DWUA 4Y8VA 4R8SA 4HAVA 1VJCA 3RAPR 4MW7A 3L6CA 3SQXA 3JAKB 2EZ9A 2NZ8A 4AJNA 3JQAB 3GGJA 4ACAA 4QHYA 3V97A 5AXDA 3VR2A 1W9HA 5ED0A 3CPSA 3AVVA 3OH8A 4F1KA 1YJAA 3OQJA 3BD6A 4ZVRA 3BTUA 3PC3A 4G86A 4J0HA 4NJMA 4U6QA 2ORWA 4MWZA 3HH8A 2PRKA 3UWSA 4IPTA 1OBHA 2VTBB 4G5FA 4K26A 1X38A 2JLYA 3F5DA 1CF4A 1RS0A 5LZ8A 5BVGA 3G2PA 4HVAA 2ODEA 5J23A 1U6KA 1R16A 4I9HA 2A1UB 2AX4A 2FVYA 2Q8QA 2OLKA 3ADOA 5EQFA 5KYKA 1RACA 5JWRA 1V7PC 4AYXA 1TK2A 3EVGA 2AJDA 1KMMA 4WAUA 2JAUA 4EJ6A 1ZISA 2HRRA 4GPEA 4H1TA 1J5EB 3ZGZA 1H2YA 2XNJA 3NKVA 1NMXA 3OJFA 4ATNA 1Q3KA 16PKA 1NX6A 3PYLA 3U5TA 3SYNA 4DLLA 3SQWA 1YIAA 3ZWVA 1L5ZA 4IIVA 1Q15A 3EQ9A 4KODA 1C3EA 3B51X 4Q9IA 4X3OA 3EZNA 3WIOA 1UK8A 3I61A 2CD7A 2V74B 4G2TA 3UYLA 3LW8A 4RYLA 1QHIA 5CM2Z 2COUA 1J42A 1SOWA 1K63A 4IGFA 2KI5A 4B9EA 2AZXA 1NKTA 4GNKA 2WV9A 4ZAYA 5BN3B 2FOXA 4QNNA 4EUHA 4JL6A 2VBCA 3QVSA 1FXWA 4FGUA 4FOPA 2IPXA 4R8MA 2QP3A 4CQJA 3I6YA 4FE4A 5TMDA 1D6NA 1WB5A 2GLUA 3W8RA 4KPEC 3NI2A 4GKVA 6REQA 3LVFO 4LHYA 2J46A 3BMQB 4UTNA 2FQQA 2P2ZA 1QE3A 2QAJA 2AFRA 3O2SB 3EW9A 1S96A 5F5LA 2KYRA 3ZBUA 3ZKWA 2ZSDA 3ORQA 1SCQA 2D59A 1E2FA 1NW8A 2BGTA 3GNTA 3PQFA 5KNCA 1M73E 1I6MA 1NUTA 3O1LA 4JT9A 4WJZA 2AKEA 2O8DA 4RTMA 1GDTA 1FNCA 2XMZA 2J41A 4TV9F 1NMEA 3OCUA 3TOZA 4E13A 3HDYA 3CEMA 2Q5CA 5H7XA 3CQ9A 1IXKA 3N2GA 2P1RA 3P9RA 4UAVA 1KI6A 3UMJA 3WGTA 2K87A 1XD2B 3FYUC 4EG7A 1FLDA 3RC8A 4U2EA 2A58A 2PS0A 4LI3X 4O2BB 4IDNA 3S28A 3T7TA 1DG9A 1MIHA 4DR5B 1J2JA 2Z3VA 3IQIX 4HJXA 3QWIA 4PZ0A 3U39A 3LHKA 1H2ZA 2V0GA 2H85A 4K9OA 3F9CA 1P4GA 2C4TA 3KU4A 3IUEA 4JJGA 4C7BA 2UZAA 3BRWD 4OYLA 2IBTA 5HF5A 2FPGB 3FMFA 2D8AA 4L75A 4F46A 1VE3A 1ZH8A 3FGPA 1B73A 5F1KA 2PKCA 2V7VA 4ZHQB 1WRBA 2G9ZA 4FGJA 3R6GA 3O4RA 4C0AC 1X42A 2X58A 1BKDR 4N6OA 3KS9A 4P4NA 1TD9A 4EY3A 2RGRA 1YMQA 2I4MA 4X45A 4DDVA 3T9AA 2VT7A 3NLLA 4DANA 3JQGB 2GBIA 3CISA 1SVLA 2FETA 3UAWA 3VR4H 4O8CA 2XDYA 3R3HA 2H0QA 3KCNA 3IT0A 2FFHA 4IS2A 4E09A 3IUPA 1LZLA 4NJEB 4ZAVA 1OQAA 1RYFA 4OHOA 4U7TB 3W9SA 1A95A 1ZH0A 3T4XA 4RA6A 2HSWA 4LJYA 3TFQA 3OQ1A 5E7IA 4YI3A 4G09A 3COJA 2G5GX 2V6FA 2IUUA 3DMGA 1CY8A 3PFGA 4JWKA 4C3OB 4EJ0A 2TMYA 1UJ5A 1ZGHA 1KQOA 3GT7A 1N3LA 3NWBA 1OGIA 4OSPA 3EYAA 1J8VA 3E9MA 5J4VA 1MV8A 1XDWA 3GVPA 3HY4A 1ZMRA 5K99A 2DX7A 3U5ZB 4Q4HB 4B79A 2JHGA 4OQXA 4A92A 5L40A 2BBSA 3IJ5A 5M34A 3W5CA 2H1CA 1KDTA 4XIIA 3GA0A 5AKXA 1WUHS 2O52A 1STOA 3HZZA 2FEXA 2QMYA 4TLEA 4ZVLA 2O4UX 4MRSA 4TTQA 2H2AA 4Q4JB 1U2DA 3MMSA 3SYTA 2FRVA 1DAOA 3IAAA 2OZLA 3V3KA 4J2HA 2IYUA 2BMJA 2I62A 4PBRA 2QRLA 3X2FA 1OASA 4AMUA 3TM5A 4C6TB 4GOMD 4AU1A 3USCS 3H4TA 4Y6QA 4Q7MB 3ZNOA 1KWGA 1XEXB 1GZSA 3FNBA 3CX7A 1JHAA 2C5FA 1AGRA 1IN6A 1AUOA 1ZJ4A 1PFUA 2X6QA 1CXZA 1B43A 1T4GA 3ABIA 3OT5A 5EP1A 1I4EB 4B4WA 1AU9A 1SZPA 3SZMA 1A77A 4ER7A 4A3SA 3U7FB 4Q9JA 3GJSA 1HG0A 3QUCA 2IHZA 4QGFA 3UG6A 1E98A 1MORA 4G1MB 3QFTA 5A9RA 4R3UC 1QP8A 2DPLA 2ZSKA 4P83A 3ZY5A 2Y71A 2NUPA 2O7QA 7GPBA 5EIBC 2JHAA 1M1XB 4Y6PA 1DTWB 4XEUA 2I91A 2HF9A 2WM8A 1E79A 5G0VA 3S1LA 1D7AA 5IW8A 2CVFA 1EFAA 3K1YA 3PNQA 3ICOA 3TFOA 5T3YA 2ACVA 3IAHA 1FS6A 4L3OA 3C1OA 3KQLA 2V0NA 1AS3A 3F8TA 3VPHA 1AKQA 4TLCA 4CMEC 4BV8A 1XL0A 4JYCA 5DTJA 2X7XA 5BQ3A 2Q0XA 4GL4A 3TBFA 3IOCA 2QG6A 3AMVA 1EPUA 3DVQX 1YZ3A 2XNDA 3JD3A 4BP1A 5KOHA 2FNAA 4Z4EA 4GI7A 5CLLA 2OB1A 1DBPA 1N2ZA 5TEWA 5IDYA 2ERYA 3VV3A 1MAUA 3R5JA 4C1NA 3K09C 3R7WB 3HYSA 4XJSA 2OTCA 3G0IA 3DMRA 4IOMA 4QGHA 4AJIA 1WZEA 4QD3A 3QNMA 3EG9A 4S1NA 5G0WA 5IDVA 3M5CA 4WOPA 3DXXA 3DV0A 2WA2A 3COZA 2F8SA 3EXIA 2WYOA 3QPUA 4HQLA 1Q0RA 2HDHA 4DARA 2AYYA 4TKVA 4CIBA 5IC5A 4B8ZA 1TF7A 2QBYA 3S8MA 4HG2A 4YFYA 4C7OA 3FHJA 5BORA 1JJVA 9ATCA 1UJBA 5TPWA 4PQRA 4UBMA 1EWKA 3B6JA 5AESA 3EX7C 2IFTA 1WXFA 3QKSA 4BVEA 3AM4A 3EARA 2G7MC 2VP6A 3OY7A 3K31A 1EXNA 2JIZD 2V54A 4JLNA 4FD2A 1E8DA 3CEAA 1R0XA 1NXSA 4EAAA 5JYBA 1LLCA 2B4QA 3NV7A 1WF6A 1XBTA 4TLAA 4KPYA 1B8OA 1K8RA 3FVWA 4XD7A 1FRVA 1JI3A 2RGAA 1V37A 1I3KA 3CNEA 3K35A 4K28A 5A0FA 4A73A 2MSKA 5F7XA 4F97A 1G1MA 1GG5A 3CH6A 3WAGA 1DG3A 3TEFA 3PFWO 1D4AA 3ENWA 121PA 2GX6A 1PKXA 1D2CA 4BZXA 1PUJA 1LTQA 5I9LA 5TS3A 2GF0A 3HYLA 4F9TA 2O5EA 4RCVA 3GCGA 3HEBA 2VA8A 3KIPA 4ZV7A 5AVWA 5GINE 1UKZA 3P97A 3NVDA 1ODSA 3M4ZA 2OHVA 3DE3X 2FWRA 5FUBA 1TM2A 2X5XA 1C8VB 2MYPA 3OF3A 2IY7A 4F6LA 1DIBA 3U16A 4NK5A 5CPBA 5FLEX 4U0JA 4ESHA 2ZRKA 4OQQA 2FEAA 2W4MA 4Z86A 1B6RA 3DAYA 1CCWA 1TEVA 2A5FA 4R9UC 3ELDA 3RFXA 3BCUA 3UYKA 3D3JA 4MDEA 1NU8A 1XJ5A 4LQ4A 5AQEA 3WLKX 1MJGM 2PLAA 4WMLA 4O63O 1CS4C 2C77A 3PGVA 4Q9NA 1NC3A 4Q4LA 5E3IA 3EZ9A 3V4ZA 3B13B 4KW7A 2R87A 4CG0A 3KPYA 3RH0A 5DOVA 3N0WA 3GQBA 1B93A 3OFSA 3HUFA 2FP4B 3GFBA 4WLNA 1F14A 2XOKD 2AHRA 3OOWA 1ZJZA 2ZATA 4RVDA 4BDTA 1EE1A 4OAQA 1K86A 3ZIDA 3WYFA 2G04A 1Z88A 1WXIA 2G4VA 1OFVA 4ENWA 1RWOA 4UHJA 5DO9A 5IXYA 5FAXA 3FTPA 2W6PA 4OG2A 3ZXUB 3NTVA 2J8ZA 1W36D 2NQ8A 3AJRA 3UHFA 3DZHA 1AVTA 1Z3IX 2FKNA 2PVPA 4P5DA 4R51A 4HPWA 5KSOA 3C6KA 1E32A 4MCIA 1BNCA 1A96A 2VWQA 2XHEA 5AVKA 4Z1MD