1M7HA

Crystal structure of aps kinase from penicillium chrysogenum: structure with aps soaked out of one dimer
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
203
structure length
203
Chain Sequence
b'FHASALTRSERTELRNQRGLTIWLTGLSASGKSTLAVELEHQLVRDRRVHAYRLDGDNIRFGLNKDLGFSEADRNENIRRIAEVAKLFADSNSIAITSFISPYRKDRDTARQLHEVATPGEETGLPFVEVYVDVPVEVAEQRDPKGLYKKAREGVIKEFTGISAPYEAPANPEVHVKNYELPVQDAVKQIIDYLDTKGYLPAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Adenylylsulfate kinase
publication title Ligand-Induced Structural Changes in Adenosine 5'-Phosphosulfate Kinase from Penicillium chrysogenum.
pubmed doi rcsb
source organism Penicillium chrysogenum
molecule tags Transferase
total genus 76
structure length 203
sequence length 203
chains with identical sequence B, C, D
ec nomenclature ec 2.7.1.25: Adenylyl-sulfate kinase.
pdb deposition date 2002-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01583 APS_kinase Adenylylsulphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1m7hA00
3I5XA 3VR6A 4HLUA 3TVDA 4CYMA 2J7KA 1E79D 5FOXA 2GRJA 4M4SA 3UATA 5BN3A 3PUXA 2AK3A 4B35A 2OAP1 4B43A 2WV9A 5G3ZA 3TSZA 1G64A 3KTAB 1E0AA 4C0BA 4F91B 2HYIC 3ICQB 1IXZA 3K09A 4ABYA 3H4MA 1W49A 2P5TB 1OXXK 2QSZA 5B30A 4X8MA 3SYKA 3U7HB 3TIFA 1YR7A 4HLQB 5TARA 4G5QA 1XJQA 4D0NA 2ZRFA 1M74A 2QAGB 4EJSB 4DDWA 3U3RA 1MABA 1SQ5A 3RSLA 4LV8B 1FMJA 5JS7A 1ZD8A 3CRQA 2F3RA 3ZQJA 4ZKEA 3D7MA 1NMZA 3LNCA 3A6PC 4G3XA 2ZUCA 1E96A 2ZEJA 2GCOA 4FMBB 2ZE5A 1PJRA 2P6NA 2QZ4A 3R9XA 1E4VA 1RJ9B 3LWNA 5JWHA 2IX3A 3BH6A 1JALA 1Z5ZA 2FG5A 2QQ0A 4RCZA 4F4CA 3W8NA 3GLGE 1P73A 1C9KA 4M9SA 3PV0A 4AC9A 4E09A 4ZCMA 2PMDA 3DDCA 2Q3HA 4PQYA 4C0JA 2GVDC 1E2QA 2UZ3A 5ELXA 1NP6A 4Z8YA 1AQYA 3K0AA 1QHHB 5DYIA 1T5IA 2GNOA 1KDRA 1GG2A 5FTKA 1G4AE 1W0KD 2YC4C 4CGZA 1RRFA 2ZR9A 3ZGXA 1HQCA 4OQMA 1T0JB 1UKEA 3MLEA 2W2TA 4QG7A 2OCYC 3RWMB 3H84A 3QXXA 1D5CA 4DDVA 4BZQA 4AG5A 3I62A 1E6CA 5EXXA 5D3MA 1KMHB 5FPHA 1G3UA 2HDNB 4KFSA 4LC0A 4WW0A 2J0UB 3RRNA 2JJ2D 1C4OA 4BFTA 4JLMA 2NZ8A 3BFVA 2FU5C 2VBCA 4DLUA 2JLVA 4BGDA 1E94E 2HCBA 2SHKA 3EZFA 3UMRA 3I5YA 4Z1MA 2RMKA 4V0OA 1DG1G 4A4DA 2IUTA 1U9IA 5HKKD 4NYMR 1F2TA 4U00A 4IKEA 2QT1A 2NPIA 3OEED 2PMKA 4NH0A 4RZ3A 3NBZC 5TDHA 2QL6A 5EP2A 1Z29A 3W8RA 1KYIA 1KKMA 2EQBA 5AUNB 2P3SA 4JBWA 5CDFA 3EZ6A 2BVNA 3DZDA 4KFTA 3E1SA 1L4YA 1VYUA 4TYYA 3KFVA 2A9KA 1SZPA 2OFOA 1UBEA 3G5UA 1DG3A 1Q22A 4IDPA 4ERNA 1OJLA 2ZM5A 3OFND 3ZVNA 1A4RA 4Q9HA 2R6AA 2BKUA 1D2MA 5F98A 3OF5A 1XCPA 3KKOA 3NVAA 1W36D 3W90A 1KO8A 2FFHA 4DLTA 3GPLA 2P6RA 4XTRA 2V1UA 1N0WA 1NVXQ 4A6XA 2X8AA 4ZPXA 4P4SB 3VQTA 1DADA 1W0JD 3KJHA 2WPDA 4C2TA 4TYWA 1G8GA 2QTHA 2O0KA 2CLDX 4TTRA 1W7AA 1XTJA 5CM8B 4XWKA 5EQTA 4EAQA 3ADDA 1T91A 1Q1ZA 4OJKA 3Q85A 4DCVA 2O8DA 2J1LA 4DSTA 4R98A 2IS6A 1R0YA 4JLVA 4AYWA 2VF8A 3RANA 1E2JA 4V0ME 4F7WA 4D26A 4KHZA 1XPRA 3FWYA 2CVFA 3QPWA 3Q7PA 1QDEA 1T3SA 4L4UA 3ZQ6A 4MQBA 3VKGA 4RD3A 4DLYA 4B3CA 2IYXA 2GEUA 3CIOA 1IJEA 3ETLA 3NKVA 4DLVA 4AIIA 1VG1A 1J2JA 1GNRA 4WXPA 3RRZA 1U98A 2ZRKA 2ZRJA 1IY0A 3VKWA 3FKSD 3L8ZA 1P6XA 4TQUS 2MSEB 3X1ZA 4BLRA 4PO8A 4GFDA 3KTAA 2NZJA 3JVUA 2O0JA 4B2LA 2F1IA 4TYNA 5JSZB 3BAFA 3W3ZB 3UMFA 1E2IA 2IYSA 1YKSA 2W6IA 1WB9A 2FPLA 4Q4AB 4XD7D 5CB8A 2JIZD 2QAGA 4M1TA 4EJSA 1ZUNB 1JXMA 5FOTA 5JFGA 2I4IA 3BB1A 4L8GA 1W5TA 1YQTA 3PQCA 1GDDA 3R20A 3X1XA 1MKYA 1G4UR 3K0CC 4ASUA 2BMDA 3MRSA 4P4UA 4PQRA 5L3SA 4RJLA 2EYQA 2VRWA 4ZDIA 4JVLA 2WWGA 1ZM2A 2AHOA 2VLIA 2WOJA 3SN6A 5E7IA 2GK6A 3W5IA 3PXGA 2J9RA 3ADCA 1VCNA 4G5GA 3KQLA 2QUZA 3A4NA 2DFTA 2E1RA 3KJEA 2BM0A 1GL7A 5JBQA 2WSMA 2W6JA 3GCGA 1G5PA 4MKIA 3THWB 1S9HA 1X8LA 1QHHA 3RC8A 2O0HA 3K70C 3FMOB 5FL7D 1RVDA 4HSEA 3FMFA 721PA 5J4HA 1DARA 1E9AA 2QSYA 2A2ZA 1OH6A 1GP2A 5GJCA 4TLCA 4KLZA 1YZUA 3N70A 2XEXA 4CVNA 4DCNA 1XD9A 2ONKA 4IW3B 1ZNZA 3TUJC 1XMIA 5HE9A 4EPXA 1W4CA 1CP2A 3OZXA 3AVPA 2HLDA 2J0UA 4MYTA 3ZH9B 2N46A 4EFLA 1OXSC 4MDFA 2QA5A 2ERXA 4Q9LA 2DBYA 1KSFX 4TWZA 2RGGA 3NC0C 5IHPA 1BS1A 2IBMA 3LX5A 3V4RA 5FPTA 1DTSA 3EC2A 1KZ7B 2RGNA 3ZDQA 1NVWQ 1OF1A 4PAMA 1DS6A 2CNWA 2VHTA 2ZXUA 2ZAOA 2BCJQ 2CEAA 2P67A 2XOKD 1ZAKA 4B6EA 1MT0A 1FZQA 2W58A 2RHDA 3RABA 1DAFA 4U7DA 2J46A 2YWGA 2YJTD 5FBWB 1G6OA 3KJGA 4IHQA 2KBFA 4JT4A 5KUTA 4QBHA 2J41A 4C0AC 4JJKA 2X2EA 4KFUA 4QBGB 1ETUA 2QRNA 4B3FX 2XTNA 4BQSA 1G3MA 2XTZA 3PENA 1ZJ6A 5SZJA 2BBSA 5LDDC 3EZ7A 4I1OA 4BECA 1DELA 5EE1A 2JJ2A 2ZSEA 3VR2A 2IYQA 2EVWX 1OPXA 1AIPA 3ZS9A 2HV8A 1HT1E 3LLMA 5DE3A 2BCGY 3EX7C 1QG2A 4FCTA 4CZ2A 5HKKA 4MKFA 4TLEA 2D2FA 1Z06A 3C41J 2AD5A 2YYZA 4P4SA 2ZJ2A 2WJGA 3TBKA 5DYGA 2QU8A 3IIKA 2CE2X 3MWLA 3PFIA 2JLUA 4DSUA 2IYVA 1XXHE 1EFTA 1R0XA 5DO9A 2PJRA 1GZSA 5JI3E 2HT1A 2DPXA 3FVQA 3LRPA 1D2EA 1YR8A 5JMTA 3WBJA 1RRGA 4DEXA 3X1YA 121PA 2HF8A 2ZJAA 5HPYB 1KI7A 2O8CB 1DAMA 4JSYA 4LK2A 5SZIA 2B7BA 1KNQA 4LPSA 4A0GA 2OLKA 3A4MA 3DMNA 1KO7A 3VTKA 2DY1A 3FHCB 4HB0A 4A0HA 1OXVA 2J0QA 2G83A 5EZ5A 1NI3A 1Q1QA 3SBDA 3I4LA 3LAWA 4KLNA 4O2RA 1CBUA 1T5LA 2IYLD 2A5YB 4URXR 2IEYA 1NLYA 3AQ4A 3NBFA 4R9UC 3ZS8A 1U8YA 4C2UA 1DAGA 1NN3A 4QBFA 3SE0A 2NO6A 2Z5FA 3ZLJA 1ZCBA 2ZR0A 1KK2A 1DO0A 2WAYA 4M1SA 4QGAA 3QNUA 5KDLA 1W4RA 1NF3A 2NIPA 1MV5A 2BC9A 2O52A 4Q66C 5JSZA 2FJUA 2J45A 4S35A 3IHWA 5E7JA 1OH5A 2ZITA 4A2QA 4AWXA 3ZVMA 4PPFA 2GAOA 2OT3B 4C9BA 4CEHB 1SXJD 5F3WB 1IN6A 2EU8A 4V0LA 4B44A 2LWIA 1SVKA 2F1HA 4IOLA 5KTYA 2JA1A 4YQFA 2Q9CA 5JRJA 3DOFA 4P33A 2JDIA 3BH7A 1N5LA 3FMIA 4MKHA 1SVLA 1E2DA 2BDTA 4G5OA 2YOHA 3FFBA 5KDOA 2BOVA 4ZCIA 1XEFA 2IW3A 2XSZA 5CIWA 1ZIOA 4B3BA 3TGPA 2JLYA 4F93B 2ZAMA 4DIEA 4C0SA 1E9EA 3CRW1 3GEHA 3SFVA 5CITA 5JJLA 4LY6A 1AM4D 2VEDA 4XWAA 1F2UB 4LHWA 6Q21A 1JNYA 4HEJA 2ZRGA 2CL7X 2PBRA 4GDFA 1G16A 3THWA 4D82A 2RGAA 5G40A 5CYOA 3VMFA 4H9GA 4UNRA 1WA5A 1NJGA 1NN1A 2IYRA 2WZQA 3O47A 2GZAA 3GEIA 3ADBA 4NYJQ 2GVZC 4HZUB 4FWIB 4TL7A 1T9HA 5FUXA 5E7MA 2H17A 4IOMA 4AYTA 3T12A 3QXSA 1VECA 4D0LB 3P4XA 4O25A 2I1VB 3KX2A 1H8EA 1HE1C 3WRXC 3K0CA 4IOKA 1R6BX 4KODA 3KXIA 1G5RA 3MCAA 1P72A 1XJ0A 4JLNA 4KO8A 4YDHB 2W0SA 3P4YA 4L15A 4UQOA 1CLUA 3WMFA 4Q7JB 3C8UA 4BFZA 4IXNA 2QMOA 3ASYA 4RCYA 3RS3A 1EFCA 2W00A 5KOYA 3THXB 2FZ4A 1Z83A 3CW2A 4R2HA 4HATA 1X1RA 3Q3JB 1G291 4C7OB 3OIYA 1E9FA 1ZM3A 4AI6A 2WMOB 4OBEA 4PZLA 5JWRA 4AK9A 1OKKA 4K46A 2VSXA 2Z0MA 2IC5A 2MSDB 4TL9A 1NVVQ 3LX8A 3OEHA 4KJZA 4LRWA 4NZYA 4PHGA 3T1VA 2QI9C 1M1YE 1EFRD 1ONBA 3I8SA 1HUQA 2FV8A 2RGCA 1P2VA 3VR3A 1TUEA 3FB4A 2H5EA 3CM0A 4CEJA 4PC3A 2QNRA 1L8QA 1XTRA 3T06B 2WWIA 5FR1A 3TUZC 3ZYCA 5CK5A 1YZQA 4WAUA 4BRWA 4B3XA 1OW3B 2NQ2C 1XZQA 4GP7A 4URYR 3GLIE 2L0XA 4LHYA 4TMTA 5FOUA 5J40A 5F9HA 1Z8FA 2FMXA 1PLKA 1HY3A 3GJXC 4QC2A 4A36A 3EIEA 1XCMA 3DM5A 1DAHA 2ZRHA 1U0HC 3GEEA 1KSGA 5C46F 4C0KA 2CCJA 4Q5IA 4ZDKA 2IXFA 2W2VA 3G0HA 5AJXA 1G19A 4XIGS 3U7EB 4Q02A 1Q44A 3Q8XB 2HXSA 3IIJA 1RYFA 1HEIA 3TAHA 1E9CA 2OUKA 3WHLA 4GBMA 2GEDA 4A9AA 2OZEA 8OHMA 4FMDF 3TQCA 2NOAA 3KKMA 4UNQA 4Z1MD 1JPJA 1JEDA 4MYCA 4EQ6B 4FW9A 4M1KA 1KJWA 1Z0JA 2OBMA 1F5NA 5FI1B 3LBHA 4F4IA 3SZRA 1I4LD 3N2IA 1R8QA 4N0EA 2ZRLA 1KI2A 5KPJA 4MGIR 4QNRA 1KIMA 4DHEA 5C1BA 3EPLA 4P0TA 2IF0A 3BJIC 1UDXA 4LGMA 4CEIB 4B3DA 1ZP6A 2OE2A 1HURA 4FD2A 1FNNA 4CEHA 3CPEA 4QBIA 3I1FA 1G7RA 4IDOA 2VHQA 2KI5A 3U6BA 5BYJA 2IK8A 5B64A 5KSPA 3K9HA 2FPKA 5AK0A 2JCSA 4BLPA 4NYIQ 2EFCB 2UKDA 3L0IB 3AEZA 1N6KA 2ZSBA 3U44B 4O0MA 5H70A 2WKRA 4KXFB 5IT5A 4F4JA 3F5FA 1JJVA 4IJMA 4Q01A 5AUPB 4KVAA 5KNCA 5D3QA 3IIMA 1JB1A 3B7GA 1W47A 3REGA 2Z43A 1F2UA 2WPDD 1NIPA 3BC1A 2KE5A 4UXJA 1RC8A 1QBKC 2VHCA 4HAWA 4RZUA 2UVQA 4OL0A 2C9CA 3GFPA 2A5FA 3ZJYA 3AP2A 2VA8A 3RRYA 1IY1A 3RC3A 3SBEA 2PX0A 3T1OA 4HZUA 2GDJA 1DO2A 1TF2A 3LBIA 4BLSA 2KSQA 4LJ7A 2RAPA 3AKYA 4ZO4A 3GJ5A 4L5BA 2OEPA 4DLRA 5FH9A 4TMVA 4OQXA 4LYAA 4PAOA 4E07A 1ZNXA 2ZYTX 3SS8A 1K6MA 1R2QA 3T5GA 4D81A 1DAIA 4URWR 2JGNA 3Q5EA 2GK7A 3CX7A 2G0NA 1GKUB 1N0UA 4D6PA 2JEOA 2ERYA 1KAOA 3THXA 5K8IA 1BKDR 4GRAA 3I3SR 1Z6XA 1XCGB 5JI2E 3QXCA 1A2KC 3C7KA 2EWVA 3LFUA 1ZD1A 1GL6A 2JLXA 2ATVA 1KK0A 1YVDA 2W6ID 3KUCA 1TL7C 2AFHE 1W2GA 2GXUA 2ZU0C 3X1DA 3REFA 3S1AB 1E2FA 1KHTA 3QQ5A 3A58B 5TMPA 3R7WB 1M7HA 2ZI4A 3GJ0A 4TL6A 3GFTA 3IBYA 1XPOA 1QHNA 3LDAA 4ASUD 1TQ6A 1E69A 1NNEA 1RRPA 4B2PA 1U81A 5KYKA 4G1UC 3AGQA 4CF7A 2VP2A 4B47A 4IDHA 1SVMA 3DEFA 1NLFA 1P75A 1VHTA 1GRRA 4W5JA 2J59A 3MG9A 3BD9A 1UADA 5A4JA 1ZM9A 2J87A 5EXPA 1SHKA 4I4LA 1W4AA 4WZ6A 2OILA 5DH9A 1SKQA 1JEEA 3B82A 1U94A 2ZI3A 4Q19A 1NJFA 1A5TA 1OLOA 1VPLA 2PZEA 1T8TA 1U0JA 1RIFA 2VYFA 1ODFA 1G7TA 2W6JD 3B1ZA 3EZ2A 3A37A 4LHZA 4LWZA 4CT5A 5H8WA 1BIFA 3SJBA 3B78A 3IQXA 1E32A 3EIHA 2QROA 4LJAA 4PR0A 3RS5A 1JAIA 1NBMA 3EXAA 4FCWA 1CULC 3IEUA 2X1VA 4M1WA 1DE0A 1EFRA 2F1RA 3Q5DA 3LVRE 1KAGA 5FBVB 1SXJE 3PEVA 3QJYA 3GLFE 1SKYE 4JSTA 1B23P 1S96A 2HLDD 3JZMA 4OJQA 3AF3A 4QJ4A 5BQ5A 4YMVA 1FUKA 2ZSAA 3AF1A 3HR7A 1G8FA 1IBRA 4DLZA 3RRMA 5DHFA 3SHFA 4PC2A 4KU4A 1KO4A 2ODWA 4EQ6A 3WNDA 4IEIA 2QMHA 2P0EA 4LJ8A 2QE7D 4OI0A 1IN8A 3BS4A 2AKAB 2CNWD 2VP4A 1M8PA 3WYAA 2CLSA 3FDIA 4OHWA 2O8FB 1FTNA 1A7JA 3GLHE 4CEIA 4V0KA 4L9SA 3A1WA 2FX3A 1MH1A 1OT3A 2O8EA 1IJFA 2CL0X 1Q57A 4IDQA 4WBSA 4QGHA 3B2EA 1D2NA 4R2IA 5B58C 3AP3A 1Z47A 4JLKA 4NCJA 1G5TA 4Q4HB 4BFVA 3K0EA 3TJZA 4BFYA 3U44A 1NSTA 1KMQA 4NONA 2QG6A 1G3IA 2ZYUX 3A1TA 1H8HD 1E1QA 1IM2A 2FFBA 4MGKR 3PEUA 3RNLA 2ZU6A 2YZ2A 3HP1A 4RZ2A 4TTPA 4FN5A 2PX3A 1UPTA 2ZRCA 2IYWA 1II8B 4Q1AA 4PQFA 4HAVA 2F55A 4AKGA 1Z6GA 3HPRA 2ORIA 4FIDA 1LB1B 1NMXA 3CZQA 2GA8A 4GOJA 5TB5A 1UKVY 1TU4A 4FI3C 3EPKA 2VO1A 3B1XA 4Y0AA 1E2NA 4AY2A 3A36A 3CF2A 2Y8EA 1YU9A 3KJIA 3M6AA 1Z0FA 1DAKA 2XZPA 2YOFA 2H92A 1GFIA 2IUUA 1LV7A 1NMYA 1LW7A 2QPOA 1NL3A 1E1RA 4LOAA 4PPQA 4ZV4A 4M22A 5F2EA 5E4FA 2HT6A 4I1VA 3J81k 2GZDA 5EP3A 1C1YA 2ZJ8A 4ZCLA 3CH5A 2DFKB 2KWIA 1Z08A 4M21A 1NY5A 3CNLA 4BFUA 3PR1A 1XBTA 1XRJA 1F3OA 1E2LA 3NWJA 4DVGA 5BN5A 3LW8A 4KAXA 4CIDA 2ZE6A 5IRCD 1MO5A 1W36C 5A0FA 3TR5A 4AD8A 3EPHA 4IVQA 2V6JA 1S3GA 5EE0A 1KJZA 3MFYA 1HTWA 1YZGA 5JECA 1AJEA 3WMEA 4BLOA 4LZZA 2PEZA 2OCBA 4PC7A 5DGXA 3AP1A 3LQRA 1GRQA 2AK2A 3GQBA 3H1TA 3S1AA 1QHXA 1V43A 1DOAA 1PLLA 2BM1A 2WSSA 3MJHA 3R7WA 2R8RA 4DBLC 4GL2A 4OK3A 1I2MA 2JDID 3CR7A 4Q9JA 1VTKA 4KI0A 1LS1A 2GBLC 1AQUA 4ON9A 4LHVA 3VR4A 1XTIA 1UFQA 1UBFA 1AS3A 1Q0UA 2EFDB 2ZE7A 2WJHA 3EA0A 3U3KA 2A5GA 4CW7A 4Z51A 3WYFA 2XSZD 3BBPA 1X3SA 1XTKA 5CB6A 1YZTA 2RGBA 5CIQA 1U8ZA 5L3VA 4PSAA 1EWQA 1UM8A 4H1UA 2REXB 3CNOA 2FFAA 5FUWA 4D0GA 5EUQB 1ZRHA 4B2IA 4RSGA 5BWMA 1JR6A 4FWTA 3PIRA 2G77B 2ZQ5A 3C14C 3KB1A 2IYZA 1GKIA 1JR3A 3ZIAA 4EIWA 1OH8A 3AF0A 4BFXA 2C98A 4PZYA 2J0VA 4HAUA 1VKJA 2A78A 2X77A 2J7PA 4TMZA 3EWSA 4LJ6A 5CDFE 2V54A 2Z4SA 4YDSA 1G17A 3C4JA 2ZI6A 2OG2A 4A92A 5GJWC 4RKFA 2V7QA 1G18A 4B3GA 4DLWA 2KJQA 4B32A 2EYUA 4MYUA 4BUJA 3K1JA 2JJ8A 4LPKA 1H8ED 3BB4A 1RJ9A 2QP9X 1X1SA 4PSVA 3A8TA 3MWYW 1KSJA 3LQQA 4G01B 1WBBA 3SI7A 3F8TA 2D7CA 2BEKA 3KQUA 3AF4A 2EFGA 1WE2A 1SGWA 1OIVA 2H1LA 5HCNA 4XOIA 1F60A 2QMUA 2ZSDA 1EK0A 1GRNA 2ORVA 4JJZA 5FPKA 1E2GA 3L2OB 1TQDA 4CRWB 5FOWA 4DRZA 1U99A 2WKQA 2F3TA 3O8DA 4GMXA 2O8FA 3Q9LA 2BEJA 4RZXA 1AZTA 3AM1A 2WICA 1OKKD 1KK3A 1LF0A 1II0A 2C99A 1E2EA 3P26A 3CX6A 4P4TA 1UBCA 1KMHA 2ECKA 2OXCA 3T1QA 3PUWA 3SNHA 2ZRNA 3OEHD 1IN7A 1D8TA 4WVFA 1Y3AA 2D3WA 3SU8A 1YE8A 3QKSB 4LJ4A 1Y63A 4JVSB 4S2EA 5C18A 4FMCB 2Z83A 5AJYA 4Q1EA 3JZAA 3LV8A 1SVIA 1AGRA 1FX0B 4LJ5A 2GJSA 2QE7A 2OXRA 1P9NA 4TMXA 4MRNA 4C0QC 3I8XA 2OFWA 2Q9AA 3P20A 3C5CA 1ZD9A 2VTKA 1MO4A 2XITA 2MMCA 4X8HA 4XJXA 1PLJA 2D4HA 2ZYVX 4BRUA 1II8A 1J70A 1XMSA 4WZBE 2CK3A 2D74A 2DFLA 3IDQA 1IONA 1KY2A 4MUAA 3P27A 1RFLA 2FH5B 4TSFA 3BFKA 1UBGA 4OKSA 1GM5A 3K70B 1CR4A 4A6PA 3SJZA 1FP7A 1W46A 4IFEA 1VYTA 4RFVA 4B48A 2DR3A 2F1JA 4LC1A 3PEYA 3AUXA 4JBXA 3B9PA 1MO3A 1CJVC 1JXOA 1MOZA 3R9IA 4ESHA 1M6NA 2IA5A 1IN4A 3B85A 5TY0A 1XMVA 3LH5A 2QMEA 5EJEA 3AVXA 2BKEA 2MSCB 4YLGA 4A0FA 3IHLA 3NC1C 2XX3A 4P3YA 1AS0A 1Q1EA 4Q4JB 2RGEA 1H8HA 2CVHA 2XNSA 1RYHA 3FKQA 1OYWA 2PEYA 5KSZA 2GHIA 4PAQA 1N0VC 5KPDA 1VYVA 1KO5A 1XEWX 3HYTA 2XNDA 1AS2A 1RKBA 1SVOA 4KSBA 1ZBDA 4BASA 4QJ3A 3OAAA 4TQ9A 2TMKA 5JLJA 4I1UA 5LB4A 4GP6A 2CDNA 1I2DA 4UXHA 2V6IA 2CE7A 1TEVA 1T0HB 4M2LA 4DIDA 1Z0AA 4OI4A 2ZROA 4JLOA 5LPNA 1JQJC 4HB2A 4OHZA 4LV5B 1G21E 4RY2A 3DKVA 5J5CA 3BWDD 4DWJA 4KV9A 3NBYC 5G53C 1G3QA 4OQNA 5JHHB 1VHLA 1TU3A 4Q1FA 1TQ2A 3SEAA 5UKDA 1N5IA 1OE0A 1W44A 4RKEA 1TF5A 1RW4A 2FFQA 2E87A 3AVUA 3L43A 1O3YA 4RD1A 1ZU5A 2CBZA 4AKIA 1FP6A 2WWFA 4NYJR 4Q47A 3V00A 4D25A 3HYRA 1ESNA 4HB3A 5FL3A 2UZIR 3Q72A 4TL8A 1ZVQA 2RGXA 2XAUA 4IVRA 4OK5A 2NO0A 4GMDA 4Q4AA 4M53A 3IGFA 3ZZTA 2PT7A 2ODEA 4P31A 4GOXA 2ZVQX 1NG1A 1VCMA 3KQKA 4HDQB 3GJ3A 1N6HA 1LNZA 1COWA 5K8LA 1IAQA 4HDOB 2XGJA 3TAUA 4LDJA 2XXAB 4M1YA 5AJZA 4YMWA 1SXJC 4M1MA 3SHWA 3BB3A 3C15C 1XZPA 4LUCA 4B71A 2FZLA 4Z54A 1KY3A 3EC1A 4JLPA 1EX7A 1Z22A 2B92A 2PCJA 3KKPA 4BFWA 3AVVA 1P62B 2PLFA 5GVRA 4DSOA 5HZHA 1KJYA 4Q4LA 1BYIA 4TZ0A 2YWFA 3MWKA 3T15A 1WQ1R 2IUSA 1NVVR 2ZS9A 1T6NA 3HU1A 2PCLA 5M04A 3QKRB 2QY9A 2ZJBA 1T3HA 2ATXA 4RD0A 4AKEA 2F6RA 3IO3A 4V03A 1IXRC 1R10A 1XJCA 4RD6A 3TNFA 1G8HA 1ESMA 2ZRAA 4B6FA 3TE6A 1JAHA 2OM2A 1TNDA 2DHRA 4DUGA 3EASA 1SHZA 3SR0A 4I1SA 4ITRC 3WXMA 3H2YA 4MA4A 2G0TA 1CXZA 1IQPA 1KDOA 3QKSA 2GXSA 4PO9A 2E9SA 4RD2A 5C4MA 3GD7A 3PUVA 1FX0A 1F48A 4PHHA 3T35A 1PVOA 2H57A 2AFIE 2YINC 4UJ3A 3SJCA 4BPBA 4HDCA 5G41A 1KZGB 2FOLA 2ZRMA 4GOKA 4AURA 2GCPA 4EPWA 3VAAA 2B8TA 4HLUC 3GLGB 1OB2A 1A82A 4W9MC 1GUAA 3GJ4A 1S3SA 4DCTA 2CHQA 2GILA 2V1XA 1BMFA 2EFHB 4LBWA 3CPJB 1VDZA 3TQFA 1PZNA 2ZPTX 3EWAA 4JL8A 2FNAA 1NBMD 5DNYB 3OIUA 1GNPA 2AWOA 3RHFA 3AKCA 1OFIA 2GZHA 2VL7A 2ZI5A 4MH0R 4MITA 4NKRA 3VHLB 4WXRA 3P32A 4TLBA 5FOSA 3KKNA 2D2EA 1EX6A 1FMLA 2IYTA 4TMWA 2FWRA 2CJWB 1OIWA 4KVGA 3AB3A 1HA3A 2REBA 2QPTA 2C95A 4US1R 1YZNA 1M34E 2WOOA 1IHUA 2HJGA 4TN1A 4NBSA 4A8JC 3W34A 4PZZA 4A0RA 5JZVA 5JHGB 4ESVA 5KO2A 1UKYA 3VR1A 4N3NA 2WKPA 4LJYA 2XZLA 2VH5R 2DWPA 2V9PA 3TRFA 1P2TA 1UEJA 3DVLA 1TADA 2A3RA 2GCNA 4NP6A 3NDPA 3NXSA 4NYIR 5FFMA 2O8CA 2KBEA 4NL4H 4YC7A 2EW1A 4QOSA 2FGKA 5FBLB 2W2XA 1VCIA 2OO7A 3BRWD 4JS0A 2V3CC 3CF0A 1F6BA 2FSGA 1VIAA 1CRQA 1WF3A 3WRYC 1NG9A 3U4QB 2ZJYA 4QXAA 1RE0A 2WAXA 4QFMA 3T1TA 1XPUA 1J8YF 3THYB 2JLRA 1A1VA 3IKJA 5BXQC 3QY0A 3KZ1E 1GWNA 2NO9A 4QGFA 2R6DA 3SQWA 1O87A 1SVSA 4QL3A 4Y0VA 5FBRB 1A2BA 1KTVA 5BW8A 3L0PA 2PLRA 1IXSB 1E1QD 4NHOA 4UNPA 1XWIA 1ZC3A 4HUQB 4GZLA 1U90A 3NTUA 1Q12A 4CT4B 3WYGA 2Q6TA 2G9NA 1WCV1 2YWHA 1QHSA 3NG1A 3ND9A 4Z8XA 5EUMA 4A8JB 1QRAA 5FTJA 4DEYA 3QEOA 4EPRA 3KL4A 4CEJB 1U9IC 2RGDA 1W1WA 1GNQA 1KKLA 2R6GA 1QHYA 4EDHA 1XTQA 4HLCA 1HYQA 4X8LA 2QTVB 4XVQA 1T8UA 4HI0E 3BORA 1JQLB 3HU3A 3NHBA 5J4KA 1E98A 3F3YA 3CNNA 2XXAA 5KNBA 1YHNA 1E1RD 3D3QA 1XU4A 2G6BA 1G7CA 2OFXA 2RB4A 3KQHA 4GT1A 1Z3IX 1R5BA 1GSIA 1WDTA 1D6JA 4M1OA 2FF7A 2A30A 2A5JA 2ZJ5A 3QSYA 1KI6B 4D80A 3K8YA 5A5GA 4DT1B 5LD2C 2OV2A 4K81B 5L3SB 4Q00A 4RFSB 1J90A 1AGPA 1X8JA 4PPNA 2GKSA 2QTFA 2ASEA 2BBWA 2XB4A 3OHMA 5HE8A 1L2TA 2FEOA 1P60A 1YR9A 3U6KA 5TXGA 1JECA 3OIWA 3QG1A 3QKRA 1XTSA 3ZZUA 2PT5A 4Q7MB 4A2PA 5J4LA 5J4YA 3ADKA 3GP8A 2VPPA 2ZRDA 2J0SA 4DC9A 3NDBB 3QKUA 2DB3A 1OHHD 3U61B 2N42A 4KSCA 4TYPA 2X19A 5DN6A 2QP4A 2QGNA 1XEXB 4C30A 2QQEA 1NKTA 2WSSD 3BIFA 2BIFA 3CO5A 4Q1BA 4U02A 3QEJA 5BYKA 1YJ5A 5B57C 1NLZA 3CRMA 1TF7A 3QUSA 2GJ8A 2FSFA 2YHSA 3EW9A 1NY6A 3M4YA 5EP4A 3CONA 5GVSA 1DAEA 2BMFA 2NG1A 1ZU4A 4HAYA 3I72A 4NCIA 5GJVC 1P61B 2DFNA 3BXZA 4NCNA 2MMGA 1S8FA 3GLGA 4C7OA 5EXTA 1XNJA 3TMKA 4KYIB 4R71A 3KDSE 3WNBA 5BN4A 421PA 1S9DA 1X8KA 2F43B 2W83A 4N0DA 2CXXA 5CJ2A 2WHXA 1KO1A 3WP1B 1XF9A 1UAAA 3QF7A 5HTKA 3HWSA 3U3OA 3UG7A 1JR3D 3C5HA 1R0WA 3ZIAD 2HEIA 2PZFA 4ACBA 1ZUHA 3LO5A 1KDTA 1L4UA 2J7PD 3O8CA 1G41A 3BE4A 1QHGA 2ANBA 3T34A 2WBLC 3A4LA 3EARA 5DHAA 2V7QD 2O5VA 2ZJZA 3HU2A 4JIMA 2VP0A 3L8YA 2WTUA 1OH7A 2QBYB 3ICEA 2QAGC 4EJSC 3DM9B 3FPAA 5FUYA 2I3BA 1HE8B 3BERA 3IPXA 2ODNA 4XTCS 4YONB 4Q1DA 1N5KA 2HYDA 2CJWA 2XZOA 2REOA 1FNMA 2VF7A 2QGZA 2R9VA 2ZE8A 4LSGA 5E3HA 2ZUBA 4TYQA 2HXYA 3TK1A 1B0UA 4JL5A 5DISB 1P9WA 2VHUA 1VG9B 3QI2A 4IDNA 3AH8A 2F9MA 3AUYA 1AK2A 2PJZA 3DO6A 4NDZA 5EP1A 1OXUA 3U3MA 2H8KA 4UJ5A 2YKGA 1N6PA 2ZUDA 4OI2A 3X1WA 3BK7A 3FTQA 2CL6X 1OFHA 3LXRA 4BEJA 2C96A 1Z63A 3M1IA 3QIAA 2WJIA 2RKOA 3A1UA 4POAA 3U4QA 2ZS7A 3THYA 1BYUA 4JLDA 1OB5A 4UXIA 1LY1A 1E9RA 4HZIA 5IK2A 4YXWA 3MWJA 3NH6A 4EUNA 1K5DA 1JJ7A 1N6OA 4HUQA 4EKDA 1R7RA 2BHRA 5JWOA 4F92B 3EIQA 4HUTA 1K5GA 3B6EA 2F9LA 2N1BA 3HR8A 2GJKA 3L0OA 4Q9KA 4A8JA 2QT0A 2CK3D 1KI3A 2HJVA 2OBNA 3QVVA 5IDVA 4DKXA 3SC3A 4I81A 2RGNC 1XXHB 4DDTA 3D8BA 5KU1A 4AKHA 3U5ZB 2ODBA 4TSFD 5H68A 3QOFA 3I61A 1GAJA 1ZC4A 3MUFA 4MYHA 1Z28A 1S2MA 2AXNA 2ORWA 2ZYWX 2WM9B 1DEKA 1EG7A 1EGAA 3IQWA 3ZZ0A 3TH5A 4TT3A 4OK6A 1FQKA 2QM7A 4M9XA 4W5WA 4V0MA 1FUUA 3AKDA 1E9DA 3QXJA 4MRRA 4DB4A 4MGZR 1KI4A 2P6UA 3D31A 4W5HA 2QM8A 1XD2B 4NE2A 2IHBA 4PSKA 4XVUA 1GKYA 1KI6A 5FUVA 4DXAA 3VKHA 3QBVA 2FA9A 3LD9A 1VG0B 1WMSA 4XSGA 1QF9A 2EWWA 2XNDD 5DLQC 1W4BA 2Q3FA 2VP9A 2K5UA 3LXXA 4RFSA 2RH5A 2R65A 5FI0B 3K9LA 3B13B 3OAAD 4D4KA 1Z0KA 4XVRA 1OYYA 3VHXA 3VFDA 2P5SA 4LYFA 3FYHA 5AJWA 4J0QA 5TVKA 1OFTA 1W48A 1Z6AA 5C2JB 1ZIPA 5JEEA 4ZI3A 2QP3A 3BFXA 1WP9A 3LLUA 2BBOA 3RYTC 3TW4A 1CJUC 1E0SA 3NH9A 3OIVA 1BOFA 1XEXA 1ZNWA 3U2QA 1IOZA 3GFOA 2WMNB 2ZETA 5GADl 1Z0IA 2X2FA 3RS2A 1NBME 1ZM7A 1JI0A 1I4TD 2IL1A 4TTQA 4C0LA 4HAXA 1Q21A 3IEVA 1I4DD 1PV4A 1W2HA 2GTPA 2Q21A 1OSNA 1GIAA 2JJ1A 2OCPA 4MGYR 3FMPB 1P2SA 4AYXA 1M7BA 1DBSA 4JKIA 3CKLA 2VP6A 4MRPA 2WWYA 2YOGA 1II9A 4IXMA 4FMCF 1E0KA 4Q18A 3W9YA 1N2CE 1T3LA 1R5NA 5DIFA 2F43A 1RPZA 3ASZA 5F9FA 3KFXA 1QZXA 1R4AA 1OHHA 1PUIA 4EPYA 4LBYA 1T4GA 3QXHA 3VX3A 1CJKC 3VU9B 4QHTA 2P65A 2D7DA 3EG5A 1RRCA 4MDEA 4JZKA 2JATA 4JLBA 1P9RA 3EPJA 2IWRA 2IYYA 2WJJA 3RS4A 1NSFA 1COWD 5TV2A 3LA6A 4LHXA 2QBYA 3ECCA 5AR1A 3I73A 1FW6A 3NEJA 3CB4A 4ZKDA 1IN5A 1UEIA 4NYMQ 4XH9B 3LY5A 4EFNA 2QEQA 1TQ4A 3WY9A 2IEZA 2YC2C 4ZDJA 1KI1A 2AWNA 821PA 5CYPA 1E4YA 4V0NA 5CLLA 2DYKA 4O2LA 1YZLA 3WP0A 4PPGA 3FOZA 3X2SA 1LF5A 3T61A 5KSOA 2GWHA 4JKYA 4ZIRB 2RCNA 3KXKA 3NIBA 1W36B 4LJ9A 1OXTA 3NEYA 2OSBA 2D06A 2NO1A 3DZ8A 2YV5A 5G3YA 4OHXA 2KB0A 3TLXA 2AR7A 2AN9A 4DCSA 1CF4A 1E9BA 4HLDA 4QKQA 1SVWA 4L9WA 2AX4A 1CR2A 2VSFA 4KBFA 3AVWA 3MJRA 4NCKA 3DPUA 3MSXA 1HQYE 2OAQ1 3HJNA 4KBGA 1NN0A 3E5HA 1OIXA 2IT1A 4DUGD 2IXEA 2O8BB 4D4JA 2ZIAA 1K8RA 4W7SA 1Z2CA 5LBIA 3BH0A 3ONWA 3CWZA 5K8UA 1CTQA 3QPUA 4LCBA 5L3QB 4DZZA 1IY2A 3AV0B 1EFHA 2H7VA 4I99A 4URZR 3AVYA 3DHWC 3CUEF 1N5JA 2Q3MA 1GTVA 4QGGA 4BLQA 2CCKA 4OYHA 3RWOA 1JBKA 1E99A 1E79A 1S1MA 1YRAA 2AXPA 2C5LA 3MMPA 3UWKA 5K8TA 1QVRA 5EE9A 4A82A 3QKTA 1XP8A 3GLIB 3FFAA 1BMFD 5JJIA 1XXHA 2GJAA 5HZKA 1P4SA 3QBTA 3CBQA 4B73A 1E2HA 3K70D 3ZVRA 1AN0A 2BWJA 1US8B 3EZ9A 3UXMA 3TUIC 3L82B 2C04A 4JVNA 5KSYA 3I92A 4PX9A 1KGDA 4JMPA 3KB2A 2WWWA 4A1FA 2JLQA 4QHSA 3CR8A 3QVUA 1G6HA 1XB2A 1E9SA 1N25A 4Q4HA 1M7GA 4GZMA 4HB4A 3U60B 5DI9A 3RAPR 2IXGA 2ZS8A 3PVSA 3M0EA 3A1SA 3FHTA 1OV4A 1VCOA 4G5RA 4WA7A 3WMGA 1J99A 3PUZA 2CCGA 1XD2A 1GITA 5FTNA 4URUR 1CJMA 1LFDB 4RD4A 1S4QA 1Z6TA 2WJYA 2FDCA 2G88A 2JLSA 1UDWA 3RS0A 3CRRA 4B34A 2AKYA 2XJ4A 4G5SA 4B33A 3OESA 3SQXA 3RDPA 2C2HA 2BJVA 2G1JA 4DLXA 4QJ5A 3N5CA 3F0TA 3CRVA 1J8MF 4B76A 2FN4A 4US0R 1VG8A 2QPAA 1J7KA 4F38A 1XDBA 2WIAA 1D9ZA 2FSIA 2WWHA 3PG5A 2NPFA 621PA 3U3JA 3UG6A 1JR3E 3WNCA 1GL9B 3B1YA 1S0UA 3UIEA 1QVAA 4D4MA 1GVNB 1NN5A 3QE0A 3K0SA 1W0KA 1TAGA 1CJTC 4GPTA 4HAZA 1HV8A 3W3AA 3K0FB 1W5SA 3C16C 2C77A 3PJRA 4DDUA 1MRSA 1AZSC 2QRZA 4KCGA 4M8NE 4Q1CA 4ZDWA 2V55B 2R6FA 3FGNA 1U0LA 4M9QA 3VX4A 5JJKA 2VSOA 2H16A 2Z6VA 2PH1A 1R8SA 5AWFC 2QN6A 4KYUA 2BMJA 4WZAE 4QM7A 1KOFA 1G8PA 4EFMA 2GJ9A 2FGJA 221PA 3UKDA 1CR1A 2ZI7A 3R8FA 2OESA 3IUYA 2DWQA 2C9YA 2ZANA 3AKEA 4GNKA 3OEEA 1CR0A 2C9OA 3VU9A 1G7SA 2LKDA 2ZSFA 5FPYA 2VQSA 3MD0A 1P2UA 4JVMA 1BH2A 3TKLA 2ANCA 3AVOA 2BJWA 1EFUA 4JLJA 4PHTA 4TZ6A 3B1VA 5KNDA 3N2EA 2FEMA 1MRNA 1WBDA 1CEEA 4DCUA 4UKDA 4MRSA 1E2MA 5AUQA 2J3EA 1ZYUA 2ZVPX 4C0HA 5HCIA 3U7GA 3IO5A 1ZUIA 5AJVB 3OFNA 4MKGA 4PTLA 3WBKA 1WRBA 1Q1BA 3B9QA 2G1KA 4P32A 4Q48A 1LVGA 1ZM4A 4ZIRA 1N3BA 2GF0A 1E0JA 4FINA 4IOJA 2GEVA 2C78A 4KFRA 2XB2A 2RHMA 4GSYA 5B2ZA 2B6HA 4UNSA 2I1QA 5SZKB 1W0JA 4NTZA 2VP5A 2A7QA 2CLCX 2B8WA 3D6TB 5FOVA 4R7ZA 1YRBA 2Z4RA 5DN6D 5CM9C 3KKQA 2Q9BA 3TVTA 3P1JA 4OQLA 2O8BA 3UK6A 4JL6A 4PHFA 4QRHA 2FPMA 2GBLA 3AVQA 3CWQA 4US2R 3LW7A 3RVBA 5FR2A 3K9NA 4LV6A 3NHAA 2CHVA 521PA 5EE3A 3ZVLA 1UKZA 5L3QA 1KI8A 4OI1A 4B75A 5EE5B 3TR0A 2OHFA 2LKCA 1UF9A 2XTMA 5CK4A 3KQNA 1FOEB 1N6LA 4OQFA 4YMUA 5ANRB 1P5ZB 5HR5A 3VNUA 1ZMXA 4E22A 3Q7QA 1Z07A 1LTQA 4Q9IA 4IVPA 3FKSA 1EESA 3EA5A 2NTYC 4QHYA 3GLIA 5KDDA 3PEWA 2ZRPA 2IF2A 4ZI2A 4LYHA 2C8VA 4AG6A 3B60A 4G0NA 3LBNA 2BV3A 3GJ8A 1US8A 2QENA 4JT2A 4LX0A 2WVJA 3PUYA 4M9ZA 2R44A 1ZCAA 4V02A 5EZ6B 5J47A 4DB2A 4BZXA 4C3ZA 4XD7A 3U7FB 2R6CA 1G20E 2JIZA 2Q0HA 4FCVA 4BEBA 1SXJB 3VR5A 2NO7A 3GLFB 4HYYA 4IFBA 1PUJA 1SKYB 2AL7A 3O8BA 3B1WA 3PCRB 4TLAA 5LB2A 3QG5A 5CJPA 2WWXA 3UMSA 4URVR 4PANA 4RVCA 1U8AA 3OE7D 3E70C 1H65A 3DL0A 3E2IA 1CKEA 5C4GB 4B74A 4WOPA 3NBXX 1RZ3A 4BFSA 4ARZB 2AD1A 4O3MA 1LS6A 2VIIA 2IS2A 2ZJOA 2ZI9A 3LVQE 1KI9A 2YWEA 1ZNYA 1AA9A 1GOTA 3K09C 4YMSA 3WHKA 1ELOA 1HH4A 3GLHB 3KXLA 5DI3B 4QM6A 1D9XA 1FTSA 2HF9A 5DSZA 3CX8A 3QF4B 2IYUA 3UPUA 3B5JA 1KDPA 3W6PA 2PL3A 5FL7A 3UWOA 1M2OB 4Q4JA 1E2KA 3GJ6A 3K0FA 2OLJA 3K53A 5CLQA 4OHYA 4PC6A 2ZRBA 4PC1A 4Q7KA 4A2WA 4TLDA 1HT2E 3UANA 3FE2A 3CH4B 3TW8B 1G9XA 4CDGA 1X86B 1G1MA 3CLVA 4YXWD 5IK2D 4NMMA 3L0SA 2IS1A 4NCHA 4GI7A 4JYBA 4M0LA 1TX4B 3SYNA 3TSWA 4N1AA 3RLFA 5FPSA 1CS4C 1CU1A 3G82C 3T5DA 2JLWA 1DPFA 2CMKA 4ACAA 3A1VA 1Q3HA 1TPZA 1UJ2A 2BMEA 3QPVA 1GILA 2GF9A 3IILA 3DOEA 4X8OA 4DLSA 2DCUA 5FTMA 2XOKA 2GXAA 3V4FA 2QAJA 2WJVA 5JS8A 1WXQA 3V9PA 4Q03A 1Q3TA 5L3RA 5P21A 4TT3D 4LI0A 1R5OA 4H1VA 5JEDA 1AKEA 2BBTA 1TEXA 1Q20A 2R62A 3O8RA 5EXSA 1MABB 4OHVA 1N6NA 1XEWY 2J5XA 3SOPA 1Z2AA 1XD8A 2H18A 4NPHA 3MGCA 4TMKA 2IWHA 1KK1A 1SULA 1NRJB 4LYJA 5FTLA 1G3RA 1KNXA 1NIJA 1Z0DA 4U5XA 1QHIA 1ZINA 2VHJA 1N6RA 3TSOA 5KHOC 1XX6A 2GCOB 5J4VA 4UNNA 5IF9A 2A5DA 4C4PA 3ND8A 3PITA 4L16A 2WIBA 1YR6A 3W6NA 3JVVA 4BE7B 2D62A 4KITB 5E95A 1VMAA 1JPNA 1NKSA 4DJTA 4FXPA 2DWOA 1FFHA 4LBZA 4E5UA 3AVTA 3K0AB 2ZRIA 3SJAA 5JRZA 3IBGA 4YMTA 4TQAA 1NVUQ 2CHGA 3VNVA 2GAAA 2V8OA 3SYLA 2O8EB 3ZD6A 5D3MB 4IEEA 2IHYA 2JJ1D 4Q7LA 3THOA 5L8VA 1R0ZA 5AUOB 1TTTA 2IS4A 1G8YA 2B7CA 3CZPA 3QENA 3ZD7A 2G3YA 1YZKA 3K9GA 1E2PA 3R9WA 1F2TB 1U2RA 1ZW6A 4XSHA 3BGWA 2R2AA 4BWYA 2YVUA 5JCPA 4A15A 2HCJB 4PXAA 1EXMA 2JAQA 1MR3F 4JYCA 2XJ9A 4NU0A 5H1YA 1QG4A 1SXJA 3GLFA 4MUBA 1N6IA 4DSNA 2P2LA 3MAAC 3DMDA 5FBQB 2EFEB 1FL9A 1XFAA 2ZR7A 4XWOA 1S1CA 2ONJA 3RSOA 1OFUX 1ANKA 1FQJA 4JLAA 4E03A 3HPQA 3B8HA 2JLZA 3FHOA 1KSHA 2W0MA 2NMVA 5SZHB 3EAQA 5GJBA 3W5JA 4II7A 4JBYA 4EPTA 3CF6R 5LD2B 1CIPA 1X6VA 4BLTA 2F7SA 2ZREA 2PZGA 1XMJA 4ARZA 4BZPA 5JCZA 3GMTA 4DT1A 2QORA 1P7CA 2LCFA 4D4LA 3GJ7A 3GLHA 2HUPA 3H86A 5DI3A 4QNMA 2GXQA 1E3MA 2OBLA 2V4ZA 3AGPA 3I32A 3QF4A 4PFSA 4D2IA 2GETA 1FPMA 3HDTA 1BO6A 4EPVA 3H0KA 1TMKA 3AF2A 4WIAA 2ZTSA 1VIYA 2B21A 3BOSA 2FSHA 1DVRA 4IRUB 1CRPA 2GESA 2NGRA 2O8DB 1AKYA 3RS7A 4LBVA 4K8OA 1MO6A 3DKPA 2C03A 3IPYA 4FMDB 3OE7A 2YNMA 3SFZA 1TUIA 4ILEA 3SDZA 1EWRA 3W6OA 1V5WA 3R8CA 4MRVA 2OCAA 1P3JA 2FE4A 4Q21A 1Z6YA 3KUDA 2JASA 1L7VC 4PO1A 3CPHA
chains in the Genus database with same CATH superfamily
3I5XA 3QMVA 3JARA 3OQ6A 5IM4A 2FQ1A 4CYMA 3T3DA 4M4SA 5BN3A 4RKRA 1MHTA 5B3KA 1C0IA 2HJRA 4DWVA 4IDFA 4QU0A 4BPRA 1N7GA 1CHNA 1PHPA 1PR4A 5HFAA 3H8SA 1G64A 4GS5A 1E0AA 3D0RA 3SCZA 2JIRA 3T0GA 4OHRA 2R3SA 4RFLA 3IT1A 3K09A 4MVJF 3H4MA 1W49A 4BVHA 2ZCVA 2XGMA 1C30B 5JAQA 3SF8A 3TIFA 3W6ZA 4A6EA 4BV2A 1TOAA 2BEVA 3RU2A 4BGUA 3IVRA 4RS4A 2FEKA 2QAGB 1T2AA 4LYYA 1W0CA 4NFHA 5KCMA 4DDWA 2WWRA 5D86A 3U3RA 1EPUA 2LRHA 4BNUA 3PHLA 1DIRA 4D6YA 1E5QA 1FMJA 2HJ9A 2HPVA 5JS7A 3B20A 4FYHA 3F71A 1G6KA 3CRQA 1GTMA 1M2NA 4BX3A 3LP8A 4KBYA 2F3RA 3D7MA 3KSRA 3ZI7A 4E94A 4B3TB 4G3XA 2DBVO 1F3LA 2DUJA 1L4BA 3R75A 3PHCA 1UANA 2AR9A 3IXLA 1NJ2A 5AOAA 3BD6A 2ZE5A 4H60A 1PF7E 4IS3A 1JXAA 4BNJA 4Y9TA 3NYQA 3VU3A 4N76A 3BH6A 1QMPA 1Z5ZA 4WNYA 3ZY2A 2H06A 4XM1A 4X71A 2RCYA 4FP9A 4CG3A 3OTHA 4EGJA 1P73A 1AURA 1C9KA 2Q5IA 3GHYA 3PDJA 3PV0A 4E09A 4ZHQF 4RKQA 2PH5A 1L5NA 4G37A 3DDCA 4PQYA 4C0JA 4RDXA 2CNBA 4CV1A 4IF4A 5JIBA 4ZCTA 3GU3A 3P5BA 1DRVA 4QOIA 1E4EB 3CXRA 5CP8A 1A9QA 2HO4A 5AVWA 1VA4A 3OD5A 1QHHB 2J6BA 4UARA 3SS9X 1G21B 2WJZB 1GG2A 1CUFA 1A1SA 2AUNA 2MYPA 1MC4A 5A2QA 1HQCA 3FLBA 1UKEA 2Y1LA 5IHXA 3CLHA 1M8GA 1MIHA 1UJCA 1U2PA 2W2TA 3KPUA 3P9QA 4OMFG 2Y92A 5FT9A 3UMJA 3GJQA 4DCMA 1JLRA 2DR2A 4F3NA 3RYHB 1GVHA 2P79A 1E6CA 5EXXA 1ZNQO 5D3MA 1G3UA 3N2GA 5ADVA 4KFSA 1VPEA 1OU4A 2Z8YA 3TR6A 2J0UB 3RRNA 3M4ZA 5BSVA 4PGGA 2RIPA 4LY3A 2GPBA 3WGLA 4D9NA 4XCQA 1E94E 1YT5A 3SXJA 3UMRA 4MV4A 8ABPA 2WAAA 5HKOA 5JTUA 1U5BB 4Z4FA 1U9IA 5HKKD 1F2TA 2DT5A 4IKEA 1C80A 4U00A 4JQOA 1JAYA 1CPYA 3DB1A 2QQ5A 2AJBA 2YMPA 5TDHA 3IJPA 4HH4A 1QJCA 1Z29A 5KMGB 5DBIA 4UUQA 5EINA 3NHWA 4MAFA 4WKNA 4XIIA 5DNWA 3W9UA 3EZ6A 1GYRA 3HXLA 4CKXA 1F6WA 5KEIA 3P2MA 4IQ0A 1YQUA 3E1SA 1X7HA 1L4YA 1OY1A 3V1MA 1I3KA 1X3LA 4IL5A 3KFVA 4J4TA 3RHSA 5FORA 3EXIB 1W35A 1SG6A 4ND6A 4LDQA 2A9KA 3S28A 1UBEA 3CJQA 4PFKA 2F00A 4GX5A 1Z36A 5HIIA 3VYVA 3J7AC 4RHEA 4QVIA 1RKVA 2NO4A 2NNLD 2NZUG 3P9RA 4YRAA 2HHAA 3OFND 2GFIA 1TZCA 3FNIA 1R6XA 2AEJA 2DUNA 3HE3A 3GI1A 2OZKA 5F98A 1C7ZA 5ESDA 1W36D 3W90A 2EWMA 2FFHA 4DLTA 2WYVA 1A5BB 1PQWA 3GPLA 3IBFA 1Z5NA 5J43A 3ZU6A 4LMBA 3KL2A 4MW6A 1N0WA 4Z99A 2P75A 3LUFA 5EXEA 2X8AA 1YGYA 1XMXA 3NBMA 4HXEB 5HJEA 1W0JD 4MUXA 5K0BA 1I9GA 1O95C 2QV0A 3PDCA 4INOA 1JT9A 3EFHA 4C2TA 1YCHA 4OYYA 1QB7A 4JQYA 3CZ4A 2O0KA 1SXHA 3INTA 3M82A 1ZSNA 1W73A 1LPNA 2XT0A 3KZNA 2WJ3A 3ADDA 5D01A 3EDQA 2G8NA 2OZVA 1L7OA 5K51A 5TPWB 1DB3A 4H0NA 3Q85A 1OU0A 2XDYA 2J1LA 5BVGA 1UXIA 5K03A 2YYYA 4IUYA 2O8DA 3O7MA 2RG1A 2IS6A 3OZBA 3CKKA 2JANA 1GKLA 2UDPA 1JDVA 4MWBA 3EGDA 1E2JA 3RANA 4LRSB 4F7WA 1XPRA 2GN6A 4HX5A 1CRWG 3W06A 1ZWKA 3Q7PA 3QPWA 4KO1S 2X0EA 3V4VB 3ZD9A 1IMJA 2SKDA 1N2OA 5AKJA 4MQBA 1IIBA 3N39C 3WGVA 4DLYA 2IYXA 4IINA 5KYYA 4X66B 4GBGA 3NKVA 3WKDA 2WSLA 4AIIA 1XT6A 4OD0A 1SUDA 2G4LA 4YRRA 1UJBA 2F3QA 2VNSA 3RRZA 4XVCA 1BAPA 4D1YA 3PJEA 3ZU2A 3MOSA 1V6AA 1UMDA 2ZRJA 2D13A 1J22A 2H3HA 5KU7A 3L8ZA 4AWBA 4WZBA 3TO5A 2BGGA 2H4HA 2O4UX 3EF3A 1I4WA 1T0UA 4GFDA 1GQOA 1PR2A 2W8ZA 4Q9DA 2O0JA 5FWNA 1NXSA 2FWAA 2HCRA 4Q3EA 1QTRA 2ILVA 4HXFB 4MRMA 4XA8A 1MAVA 5TQ0A 3RYIB 4TYNA 1RXUA 4CMHA 1PIWA 3O1IC 1WHTB 3JZIA 2CXRA 1E2IA 1SG9A 4CMEC 4RZQA 2A1IA 4ALKA 4XD7D 2PTHA 1FU7A 5BRNA 1ZRSA 2JIZD 5DBOA 4CQLB 3F3KA 3DZCA 3VR5D 4UTPA 2VAMA 1R4MB 2Q2WA 5FOTA 2I4IA 4YPVA 3BB1A 4GP9A 1H69A 4BVBA 1C2YA 1SBTA 1UWVA 3LF1A 3JR3A 3PQCA 5TT1A 4ASUA 3KEMA 1M8JA 3QPCA 3HCPA 4ZCQA 1P0PA 2VRWA 3BMQA 4ZDIA 4K2AA 5AM3A 5F7JA 4DS3A 4Y18A 3SN6A 3RIGA 4DA0A 3L0YA 5E7IA 4DTCA 4WFKA 4YBRA 3PXGA 4KYVA 2A59A 4PO3X 1LBTA 4EEZA 5BSGA 3KQLA 4FVTA 3O4IA 4D8XA 2TMYA 3A4NA 2DFTA 2E1RA 4XYBA 1WVMA 2WD9A 2H11A 1ZUD1 3VU0A 4O4JF 1GPDG 5HVNA 2YFYA 1ORDA 3THWB 2ZT8A 1U7XA 2PPLA 1F17A 5JPIA 3K70C 1U9CA 2MWMA 2O2XA 2YJ3A 3FMOB 1RVDA 1ZMOA 4HSEA 2X3UA 4UM5A 1DARA 3AJAA 3V4OA 5J4HA 1OH6A 2EHJA 1GP2A 3QMMA 3H9QA 1YASA 3QVGB 1YZUA 2F2TA 3ZE2B 3DT8A 5IS2A 4AQDA 1WF6A 4DCNA 4BQFA 4F1WA 1Z2OX 2Q3EA 2Z98A 1PDWA 3D4BA 4YAEA 1L8AA 2BSQA 1VE5A 1W4CA 4EPXA 1FJHA 3OZXA 1N34B 1UZUA 4MYTA 1YB7A 2JG3A 4R7GA 4UDNA 2A35A 2XNJA 4PR3A 4TWZA 2PANA 4IKPA 2RGGA 3NC0C 3ESDA 2ZJ4A 1PR9A 5IHPA 2IBMA 3CC8A 4G56A 4IV8A 5FHRA 1MG0A 4LA4A 3CFYA 5LKRA 4NWIA 3ZDQA 1O0BA 1GZVA 1KVUA 2I4TA 2R1TA 3MZ0A 2QJFA 4I55F 4LTMA 4Z7OB 3QBEA 3LP6A 3WTBA 1QGAA 1V8PA 3UHJA 4EHJA 2K7FA 1EAYA 3LL7A 4C7VA 1G2IA 4CKWB 5J3JA 1FFDA 2DPGA 3R3JA 4AZ0B 5FBKA 1N8KA 2PKXA 2Q7OE 2GN8A 3RABA 3T9DA 3H11B 3TTTA 3VHQA 4U0KA 3PFFA 3KJGA 1YL5A 4RK1A 2G72A 2C4WA 4O33A 4RVSA 3N7UA 5DCLA 3WIBA 1YJBA 1T29A 1HDRA 4C0AC 2XRZA 1QF6A 4QBGB 1NASA 1ETUA 3HY6A 3GLVA 3L05A 3NR2A 3KQYA 3P9PA 2RE8A 3EVAA 5SZJA 4P9NA 3GWGA 4I1OA 3AX6A 1BE6A 1M2EA 2IYQA 2I03A 1OPXA 1AIPA 1GQFA 1ZN2A 4LXXA 3KHKA 5DE3A 3IBCA 3IUPA 5IJ9A 3K2BA 3O8OB 3ZG6A 1LPAB 1XLUA 3KD2A 4X7PA 3EX7C 1YB1A 4J0IA 5TF0A 4KMMA 4RE5A 2HNBA 4ED9A 5HKKA 1ZOPA 2ZDQA 3FJ1A 2YTZA 1DTEA 3KQSA 4TLEA 1U0TA 3RKUA 4WESA 2D2FA 3IRVA 1LW6E 3SX2A 2GO1A 1C3VA 1QLHA 3ER9A 4LJKA 4P4SA 3ZC3A 3PQ5A 1YHYA 1VYHA 4GQIA 4OATA 3JSXA 1M6WA 4P7GA 5DYGA 2QU8A 4MVWA 1VIVA 3TBKA 2CD7A 3QVOA 2JLUA 1BX3A 4TXLA 3TDNA 4ZREA 2GQ0A 2A0WA 5K3AA 1W7AA 3OFVA 4DVJA 1R0XA 2WJ6A 4AS2A 2BTOA 2PJRA 5KYXA 1TTPB 2C42A 2QR3A 2ISQA 3AYXB 3LRPA 1D2EA 4FE3A 4KUHA 4ZANA 5JMTA 1NVBA 2PX6A 3WBJA 4TV9F 4Q1VA 2W8BA 2C9BA 3TAXA 2IPXA 3N6VA 3GD5A 4A0GA 2CXSA 2OLKA 3A4MA 1WKVA 3G7NA 4NFSA 4WQMA 3P0HA 5EZ5A 3LGXA 4N5HX 3SBDA 4TPKA 4J7UA 3LAWA 1CRLA 4KLNA 4PG6A 1EEHA 2I22A 3FPKA 1PKXA 1TCUA 1GU7A 1NLYA 1GPH1 3AQ4A 1L5HB 1OT5A 1QORA 4I50A 1NXPA 1RABA 2E3JA 4HVAA 3HJUA 3OBBA 4QBFA 1P17A 1M2GA 3SE0A 1IEWA 1T9BA 3R23A 1DO0A 5JYCA 4M1SA 3AB7A 3WLTA 5KDLA 1L5SA 3GA0A 1W4RA 3T0IA 4WT7A 1MV5A 2BC9A 4TQGA 2P9EA 3TGWA 1ZHHA 5JSZA 1O95A 3SQNA 2VNHA 4Y6GB 2J45A 1B00A 5E7JA 1Y33E 2ZITA 3QELB 1OH5A 2QLBA 4M8IA 2GAOA 2Q62A 3UZUA 2EX0A 4E3WA 3L7BA 4B44A 2F1HA 4IOLA 2V65A 5AQEA 3DPIA 3HV2A 3G1UA 3HUDA 2OKCA 1L5YA 2LV8A 1U8EA 2FEAA 3EWIA 3HL0A 3IT2A 2XWPA 4K6FA 2FN7A 1N5LA 3FHJA 1IEQA 3R0ZA 1HX7A 1UK8A 4MKHA 5FX2A 2R4TA 4URVR 5KOHA 4ZV9A 1M34A 5IZ4A 1AGXA 4ZAVA 2BOVA 2OPHA 3IDOA 3UAXA 4NIMA 4AMVA 2BMVA 2IW3A 5CIWA 3TGPA 4B3BA 1Z4NA 4JQSA 2JLYA 1PS8A 4HH0A 4DIEA 1L9KA 1QFSA 2WSIA 3E4DA 3SFVA 4MJ3A 2H1FA 4X92A 3RFUA 4B31A 2YMLA 5KYNA 1F2UB 4L57A 4AUMA 3D4LA 1P4JA 2ZRGA 4HEJA 4DA6A 1PEDA 4D5EA 1GUBA 3HADA 1IE3A 4UHCA 4TUYB 3PC4A 2PBRA 1ULBA 1WZCA 2YX1A 4GDFA 1TJ3A 3PQ2A 5JQGB 4D82A 2RGAA 5G40A 2QMYA 2R1VB 4ROSA 4JI7B 5B4UA 3UXHA 1RYEA 1ZJ4A 1NQTA 1S8AA 2IYRA 3ADBA 2GZAA 3D8TA 3GEIA 1THZA 3I23A 3V8NA 3AHHA 3HRKA 1NV9A 4HZUB 5JU6A 2Q4BA 1DBWA 5AIAA 1JEOA 1FXWF 2R5FA 1DRKA 3H2SA 3JYLA 3MRTA 2BKVA 1A72A 5DK4A 5E7MA 2H17A 3VRHA 4DCGA 3E84A 1QJ4A 3QXSA 1W5AA 3P4XA 4NSNA 1CZOA 1TM3E 5IUKC 4D0LB 3H8VA 4HV4A 5E4YA 3GH3A 3O92A 4HTFB 3DVRX 1E1NA 5B1YA 1T3GA 1L7EA 2RSLA 3AW8A 2XZDA 3K1TA 4KODA 1YU6A 1G5RA 1GPBA 2Q29A 3CINA 4HEQA 2DF8A 4KO8A 2OUIA 2W0SA 3P4YA 4NJEA 3LQFA 3OSUA 1E6KA 3ZOKA 5CB4F 4NHEA 1PJBA 2ECFA 2J6IA 2AXEA 3L8MA 4IV0A 3WISA 5HZGA 4G1FA 4BFZA 5KI6A 1JX6A 1GZ5A 1SG0A 3PWTA 3RS3A 1UBMS 5A4IS 3FYCA 5KOYA 5LM3A 3THXB 1D0SA 2YMQA 1O96A 4U2DA 3BMCA 2EG5A 4R2HA 1B1CA 3O21A 5HQJA 1ODTC 3CA8A 1NI4B 1E9FA 1ZM3A 2JI9A 4BZQA 3HI4A 4AI6A 5A9SB 5ILQA 1BCRB 2WUVA 1NW5A 2JS7A 2ZQZA 1BDJA 4JH0A 4K46A 3KDPA 3Q3EA 4MW4A 4DBLE 3BPSA 3BICA 1QIJA 4TL9A 1NVVQ 1EMDA 4LY9A 1HOTA 4LF7B 3JTEA 3T3NA 4LRWA 1H85A 1LRJA 1XRNA 3T1VA 3BE5A 1M1YE 1EFRD 3QOYA 4YCBA 2R4QA 4HY3A 2RGCA 5T8KA 3AI1A 3VR3A 4OB8A 1HQKA 1T5SA 3DP9A 2QX7A 2OAEA 4PC3A 4Z3OA 3LTNC 3CEPB 5CNIA 3KG2A 4IGAA 2ATEA 4XGKA 5IXJA 2WWIA 4ZCRA 1P6UA 1KBQA 2BLNA 3C70A 3LT0A 5FR1A 3UKOA 1DBIA 3ROKA 2TRSB 5E4TA 5FLKA 3ROPA 1ABBA 2P9BA 4BRWA 5EERA 1XA4A 4X9XA 5IXSA 3O4VA 3R6DA 3PX3A 5J40A 4D9KA 2FMXA 1HY3A 4IIGA 2JNWA 4Y2RA 1FRVA 1BXGA 4MA0A 4P4GA 1A2QA 4LZNA 3FNBA 4QC2A 5KTKA 5EI5A 4KN6A 3SDSA 4A36A 3IUJA 3EIEA 3LFTA 1UAGA 3UOGA 2VJYA 2QYSA 3DM5A 2IHJA 1H2WA 1V39A 1L7DA 1KSGA 2C84A 5C46F 3T3PB 4Y9RA 5I3ZA 3K2QA 1T34A 3C48A 3GGJA 2IXFA 2W2VA 3L01A 3G0HA 5JG7A 3LJKA 2ALJA 3BHIA 2PZAA 4KTVE 4RQTA 5I4IA 2FUG6 4F8JA 2HXSA 5I5GA 5DASA 4BMZA 4ZT7A 1PD0A 1GGNA 4OX9Y 1WDLA 3GARA 1EDOA 3PP8A 1TCAA 2HA5A 5AOCA 2OZEA 3N74A 4ENSA 1IOLA 3DTTA 4RIIA 3WLKX 2JVIA 3BCSA 3GBPA 3KKMA 3ESZA 3AO0B 5I9NA 3OJCA 3LKZA 4I6EA 1WULS 1JHDA 1N2CB 1XZLA 2X5OA 4FSXA 4EENA 1Y8RB 1CUJA 1KJWA 2PAFA 2OBMA 3FPGA 3ZWYA 4OF4A 2PZJA 1NF2A 4BNDB 5FI1B 4F4IA 3R5XA 4S1OA 4GR4A 2P4EA 3MBOA 3NWBA 4QNRA 5C1BA 3EPLA 3A9VA 2IF0A 1BHJA 3ZCPA 1HNZB 1UDXA 3L5KA 3HHPA 4LGMA 4CEIB 4UUNA 3ORFA 3SEFA 3QOWA 4Q15A 4FD2A 4CEHA 4QBIA 4Y67A 1I7DA 4MO2A 2DSTA 3I1FA 1G7RA 4IDOA 2XT9A 3X43A 4BIMA 5LYYA 3VOAA 1JDUA 3B8EA 4BBAA 1DBRA 5LMUB 3TG2A 4ZXPA 1MX3A 3L4BA 3QLVA 5AK0A 1T2VA 1TFRA 4DW8A 5BT9A 4YJFB 4Y7DA 2FOXA 3ZEIA 3E3MA 3HABA 5FADA 4X6LA 3U44B 4G5FA 5EZYB 3V8EA 1JEQB 8MHTA 4KXFB 4LJRA 3AYZB 1JJVA 3AHIA 2GDZA 1SUFA 2GTIA 4M46A 5KNCA 4CLDA 5CRIA 1RDFA 4MWTA 2IU4A 2DH5A 4HD8A 4IH4A 4TVKA 3REGA 4WJKB 1ORRA 4KRGA 1TK2A 4RO0A 4QPNA 4XR4A 1SVUA 4PRKA 2B78A 3UMVA 4EHLA 2XYRA 2COKA 2BZ1A 2B2CA 2G7ZA 3B9RA 1CQJB 3NONA 4NS4A 4M9UA 2AQHA 4KAJA 2GBIA 3GFPA 1XRPA 1WR8A 2YWBA 3INRA 3P97A 1KFBB 4KW7A 4BX2A 3PLAE 4IZHA 1CUDA 3CKYA 2PX0A 3WL6A 3F6RA 1DO2A 2QF7A 3D5TA 3OPXA 1RJWA 2VDQB 3LBIA 1I7PA 4YRDA 2KSQA 1AKQA 4S1WA 4ZGGA 4LJ7A 2BFNA 1JDBC 4R0NA 2JW5A 2OEPA 3IDAA 4IDGA 4L08A 2H7YA 1I2CA 4TMVA 2P2YA 1EXNA 5AI5A 5LDGA 3TW0A 2MT9A 2W5UA 1U0GA 2VUIB 4RJTA 5HQ3B 4E07A 3RYCA 1ZNXA 1AGYA 3L6RA 2A1UB 3IELA 3DWGA 1H9BA 2EATA 4FZ5A 4ZMBA 2JGNA 2GK7A 4HNTA 1YL6A 1W6UA 2WZBA 2YH2A 2R8ZA 4RA9A 4Y2GA 3QHPA 4G97A 3C7KA 3C4VA 3SM9A 3BEDA 2EP7A 3MN1A 4MPRA 4X45A 3OPYA 2H65A 5B1SA 2QU7A 2W6ID 1Y7TA 2VDRB 1TL7C 2AFHE 2IEDA 4MV1A 3BCRA 1FK8A 2GXUA 4N3BA 1OZHA 1UBJS 1F06A 3C3AA 3S1AB 3MOGA 1EHCA 1KHTA 4K6OA 3QQ5A 5TMPA 4NV0A 1ST2A 1DWOA 1OLXA 3Q1LA 3N5KA 4DL9A 5FDFA 4JDPA 1XPOA 1GGFA 3AUTA 3G79A 4UU0A 1CP3A 4IPTA 3LDAA 3TXYA 5CVVA 1TRHA 5CBPA 4F4FA 4EL0A 1RRPA 3DA8A 1NNEA 2ZIWB 2Y0BA 4BDTA 1UBSB 3AGQA 2VP2A 3GVPA 3P19A 1BW9B 5SYMA 4IDHA 1I32A 3DEFA 1NLFA 1O8BA 1VHTA 3TTUA 1AUXA 4B4OA 3HBMA 1GRRA 4BZZA 3I5MA 2AW5A 3NTVA 3QVMA 1U0RA 3T3HA 3F7NA 1A27A 1M0TA 1VIDA 3BD9A 4BJ3A 4KR2A 1UADA 4COKA 2VTBB 1V9SA 1ZM9A 2G4CA 2J48A 3KU4A 2UXCB 4XX0A 2HHLA 3ZWAA 1WV1A 1W4AA 1QIHA 1T1IA 2Q2VA 1N1DA 4WZ6A 5AJUA 3D0OA 4GUDA 1U94A 2ZI3A 4HGPA 4Q19A 3UUWA 1DJNA 4I9NA 4N0MA 2Q3BA 4FQ7A 5FKJA 1ZK3A 4GXTA 1RIFA 2B4QA 1G7TA 4L0CA 5AQ1A 2D5IA 5H8WA 2CXHA 4CT5A 1QFYA 3A27A 3UNXA 4YRJA 2E6UX 2QROA 1P0FA 3I4FA 4LJAA 3KKLA 4Y2SA 2B36A 4CN9A 5JD4A 1NBMA 5COAA 1DKUA 4E2YA 3QE9Y 1A98A 2X40A 2X1VA 1P5RA 4TWBA 1EFRA 3KUXA 1MOSA 3DHYA 1KAGA 4FK8A 5FBVB 3PEVA 5CVEA 4KPUA 1QBGA 2D5AA 2NYRA 1FLVA 2OENG 1SCNE 3K05A 3RYFB 1B23P 2Y71A 5E1DA 2HLDD 2OV8A 3C3KA 1JMKC 3MJTA 2GPYA 3AF1A 3HR7A 5LA6F 5BSHA 1YFKA 3LDFA 1NTOA 4DLZA 2M1XA 1RYYA 3LU1A 5JH7A 4PC2A 3H87A 2FRVA 3QHQA 5D7NA 3RADC 1P0MA 5H83A 4V3CA 3C7TA 1R12A 4KWEA 3UC9A 4ETIA 2QE7D 1V1MA 5JNRA 4OI0A 3BS4A 4NBVA 4EF4A 2WINI 1PFWA 1DUIA 2PXCA 3IIEA 2N0SA 1E20A 3VYUB 4EUHA 1C0PA 2HPAA 4LE0A 4S12A 4ZC8A 2I1LA 5HRUA 5IZCA 2V0GA 1U28C 3EIXA 3H4VA 3A1WA 4Y2QA 5BV0A 1NQOA 4FZJA 3Q9UA 4EYGA 3D6AA 4Z6KA 3K9QO 3BRWA 4P83A 4FEAA 1PJZA 5TQJA 3VZPA 4D9BA 2WHPB 5CTAA 1QWOA 5J2UA 5FIUA 4QGHA 1UDCA 1G5IA 5DMHA 4IS2A 1XTPA 3A04A 5BOVA 3VR2D 2LUOA 2R6JA 3AP3A 2HK7A 2NPOA 1E6MA 3RGGA 4ES6A 5T4BA 4OQEA 4Q4HB 3VH3A 3KK0A 3K0EA 4BFYA 3EODA 1CVRA 5CA1F 1ZY2A 3GA7A 2I0FA 2BGJA 1E1QA 1FVFA 4U2GA 3RNLA 1T2EA 1BN7A 2YZ2A 3FFWA 3GUVA 3H9BA 3HP1A 5CDTA 2R47A 5LQUA 3QYFA 1UPTA 2Y99A 3OOWA 2GEFA 1C29B 1II8B 1LC0A 4Q93A 3HPRA 2FAXA 1UQUA 3PC8A 3FIUA 4UFOA 1Q0PA 2WD7B 3JQAA 3T5AA 3EPRA 1Y4DE 3WNQA 1J1UA 3ZJTA 1UKVY 4FI3C 3LQ4A 2VO1A 4B9AA 4Y0AA 2YRFA 5JBNA 1XDUA 4ENQA 5J9FA 1QR6A 3A36A 3CF2A 4G85A 2W6MA 1Z35A 1EAMA 2I2AA 2XZPA 6ABPA 2IIVA 2COUA 1Z9BA 1X7WA 5T3UA 1FU4A 2XUKA 2DOKA 1T2DA 1VB3A 2XPCA 4PXSA 1NL3A 4QECA 5DTMA 2JFYA 1ADYA 3JAMA 2EBHX 3MLAA 2WTBA 1RR6A 5F2EA 3KT3A 2HT6A 2YV1A 4JSRA 3J81k 2GZDA 2JHPA 1ZMRA 3DXYA 3EIOA 4WOKA 1O08A 3AFHA 3FDZA 1PL6A 1T8SA 3THSA 3ER6A 4YAGA 2DFKB 8AT1A 1ZONA 1R00A 1NVDA 1LPMA 2IYPA 2XWSA 3Q0EA 3NWJA 4DVGA 3LW8A 4RELA 5IRCD 2ZE6A 3TX2A 1MO5A 1YFLA 3RQSA 5A0FA 1QGED 4K0KB 2O5RA 4AD8A 5BWNA 4X3PA 3LLCA 3GXBA 1S3GA 1V8BA 1RAGA 5DOVA 3OQVA 2HBZA 1J56A 1VJ1A 2F3UA 1HTWA 1R0SA 4MMXB 4MS4B 3WK7A 5JECA 3WMEA 1AJEA 2OCBA 3DW1X 4PC7A 1P9LA 4M0CA 1M2KA 4F4HA 4QYWA 5B2FA 1NTRA 1GRQA 3LPAA 1PTKA 4ALNA 2EJVA 2AK2A 2YRWA 3GQBA 3MUEA 4O0LA 1EWTA 4XJVA 2H7XA 1KOLA 5F3DA 1V43A 1JT2A 2PS1A 3VZSA 4YP0A 3KYBA 4JEIA 2OXTA 1PLLA 1XVLA 1PEAA 1XYVA 3R7WA 4B79A 4HPWA 3V55A 4GWKA 2P7IA 5TGZA 5C1IA 1T8YA 3CR7A 3FCXA 4HWSA 4KI0A 1GTL1 1LS1A 2FUNB 2GBLC 3HACA 3MB5A 4ON9A 4FR0A 3B38A 1UFQA 5EYPA 3TIXB 1Q0UA 2ZE7A 5AW8A 1KWKA 3ZE1B 1J7JA 3E2PA 5JDCA 2EV9A 5AK4A 3U3KA 2A5GA 5HS4A 4ZVTA 2AC7A 4Z51A 2PE5A 2XSZD 3WGMA 4RORA 3AJRA 4AN0A 5L3VA 2J3IA 5KOJA 4KPEC 3WI7A 1GHTA 3QUCA 4ZHQB 1EWQA 5CDYA 2REXB 4FSDA 2OM6A 3CNOA 5FUWA 3Q6MA 2IFTA 1ZRHA 3KZOA 4B2IA 3KLNA 4AJ9A 1UL1X 4FWTA 2G77B 2JAOA 4DAEA 2PHZA 5ALJA 4EMUA 3EVTA 3C14C 5C7LO 1NR5A 1MXFA 2IYZA 2WAOA 4IM7A 4Q82A 1QDLB 3ZIAA 2VQFB 1YAJA 4OXIA 2ZWVA 3STYA 3LUJA 4TMZA 4HAUA 2IV3A 1R37A 1FRQA 3C45A 1M5RA 4V24A 1O58A 2Z4SA 3DSRA 1G17A 3C4JA 5GJWC 4MV0A 2V7QA 3D8NA 4RKFA 3V6LA 4C4XA 3RTGA 4FGUA 1VQ1A 3OJFA 4ATNA 2I76A 3BZBA 1LJLA 3PPIA 4ZU3A 2JJ8A 4JBGA 3BB4A 4U6NA 3FLAA 2QP9X 1J42A 4W9NC 1Z4JA 3UYKA 1FU8A 4KNYA 4WBNA 3RJ9A 1RTKA 5JMPA 4F96A 1EJBA 3F8TA 4AL4A 4WZAA 2A0YA 4FD3A 5CM2Z 2EFGA 3RHZA 1SGWA 1TAHA 5A02A 1PSWA 2Z9BA 2H1LA 4P7JA 1U3UA 2OK8A 4GF5A 1F60A 4QD3A 1DJQA 2QMUA 1GRNA 2ORVA 4FYXA 4JJZA 2GLUA 2I7DA 1CE8B 4M1ZA 2WVAA 4OQDA 1E2GA 4YPFA 3HB1A 1M1XB 1DJMA 4DRZA 1IG3A 4G24A 5JDIA 2VT2A 2WKQA 3H5AA 2QJWA 1TYEB 3BA1A 3N0VA 4F9GA 2YXPX 3CTPA 1KEWA 1OKKD 2BRUA 2WICA 1LF0A 3AEQA 3PRYA 3TX6A 5ISMA 4P4TA 3T1NA 3O73A 2XNCA 3U1VA 1Y9JA 1UBCA 3K0KA 4GYJA 5EKUA 3ZY6A 2OXCA 3IXQA 2UUAB 5LQSA 4PN7A 2XRFA 2ZRNA 1IN7A 2J6CA 3AEUA 3W6UA 2BFFA 2ZK7A 1RYBA 2QX8A 3QITA 1S7GA 1NYQA 3SU8A 1YE8A 3LWBA 4LJ4A 4RZSA 3L18A 4F56A 1KIFA 1R6TA 3CJRA 4J0JA 2IUEA 3L93A 4AJKA 4LJ5A 5U4XA 3JRWA 1USIA 2FR8A 2QE7A 4X0EA 5HHTA 1P9NA 3LT4A 4LQCA 4TMXA 4UHKA 1DL5A 4G65A 5WRFA 1M8KA 3GLUA 2B0JA 4WLFA 2J4DA 5DP2A 2R8OA 1KJ9A 1ZD9A 2XITA 1WXIA 4GXRA 4X8HA 2IGBA 2PVCA 4GWGA 3LHIA 1PLJA 2D4HA 2ZYVX 4M76B 2VKQA 4CM3A 4UMDA 4WZBE 2CK3A 1XRQA 4C7BA 4CV2A 5L45A 4HGQA 1QIFA 3IDQA 3KLBA 4MUAA 1KY2A 1NDUA 5I5EA 4OQYA 4ZK6A 3WAJA 2WJWA 3QLEA 4TSFA 2VPXA 1NOIA 1UBGA 4IIBA 1GM5A 1V47A 3K70B 3A1CA 2DAPA 1RVV1 1SHUX 2PWZA 2Y3IA 3S7TA 3TZKA 2G1PA 3LI2A 1ZVMA 4LC1A 1BG6A 1ZH8A 1S4MA 4CM7A 3FRJA 2YYSA 1E5DA 2VDMB 1MO3A 1L0BA 3MT9A 3R9IA 4A03A 3IPAA 4DXHA 4ESHA 2IA5A 4QREA 1TT5A 1ZS9A 1O03A 3NB0A 2C5BA 2MSCB 2VT7A 4QXMA 4YLGA 1VI6A 4A0FA 5B3LA 3NMUF 4P3YA 3SSAA 2XX3A 1AS0A 5IKXA 2RGEA 3DDUA 3PWZA 2XTAA 2YICA 2A92A 2CVHA 2UVPA 1Q92A 2XNSA 3FKQA 4HBGA 1Y3CE 5B3JA 3UOWA 3H5IA 1KVSA 3NQ41 4ZO6A 2ENWA 1KO5A 1XEWX 3HEAA 3FNFA 4FFLA 3I12A 5DNAA 2JIOA 4F8YA 1GXSB 5IBCA 1OGIA 1SVOA 4KSBA 4WLEA 1J8DA 3K71B 5EIEA 4BASA 4QJ3A 3WLPA 1PVDA 1DBPA 4IJQA 5F4ZA 2DTEA 2R86A 4UW9A 3PEFA 4B2YA 5JLJA 5E4JA 4I1UA 5HZMA 5AFSA 2P30A 1C7JA 2WU8A 1LK5A 3WBBA 4F6LA 4MQ5A 3WKBA 1I2DA 1YONA 1ZIXA 2CF6A 3M83A 3QY9A 4Y6RA 2PQ2A 3LHKA 3PDWA 1FJXA 1Z4PX 4DIDA 1V3VA 4F60A 4Z2AA 1AQNA 5PGMA 1Z0AA 5KJ1A 4JLOA 3UJAA 1I94B 4OFXA 2H7CA 4KV9A 2JHAA 3I04M 4Q9NA 2QKYA 1G3QA 1Y3IA 4UUOA 5B37A 4OQNA 3RVDA 3UK2A 1DDOA 1WL8A 2YBEA 4QUJA 4QBKA 3ZK7A 1KQFA 3KO8A 4GQBA 2OBBA 1TQ2A 4ODIA 4LYDA 4KQFA 1GZ3A 4YMIA 4RPKA 1VL2A 4ID3A 1J2TA 3TZ6A 4FYPA 1Y6GA 2ID9A 1RWQA 2A14A 5JALA 4OXQA 3AVUA 3L43A 4YJHB 4DNQA 1Q7EA 8ATCA 4Y98A 3Q8MA 1ZU5A 2IEAA 3LY7A 2X15A 1FP6A 4NZZA 5JJCA 3OFJA 4L0MA 5FL3A 1NE7A 1PG0A 5FUQA 4IVRA 3VSAA 4MLPA 5B1IA 4HRXA 1JZTA 1ZQ1A 1EFKA 4XB6B 2C1XA 5H02A 4O4JB 4M53A 1XZFA 1UH5A 3EZLA 3IGFA 4CQLA 3PL5A 1V4NA 4JLWA 4MZDA 4Y6OA 2ODEA 4JLSA 1JHYA 4QXRA 1V5FA 3WSVA 5TMEA 3MPOA 3V2UA 1Z4MA 3IDZA 2ZVQX 4Q6WA 5J5AA 4ZT6A 1NG1A 3VJMA 1TQ8A 3E2MA 3W5CA 3GJ3A 1L3IA 4AZ3B 1P80A 2Q5OA 2E1PA 5B3AA 5E9WA 2XMQA 4KE7A 3T4UA 1DC8A 1Z5PA 1E18A 2P1RA 2R7KA 4J75A 3EFOA 3OTGA 5AJZA 2UUPA 1VLLA 3BB3A 3SHWA 3GZNA 5DGCA 3TLKA 4A6DA 3HCNA 1KAHA 3L4EA 4F11A 4LUCA 1D4OA 3PRJA 5BYBA 1SC9A 1I3LA 3TQQA 2CNOA 3A11A 3E3LA 1GSAA 1Q50A 3HVJA 4QXPA 4EYKA 3OWHA 5ICGA 3CX4A 3FAZA 3KKPA 1G60A 3AEKA 5GVRA 1SUEA 4KQGA 1I8TA 4Q3CA 4Q4LA 1BYIA 3R3WA 1E3SA 2XCTB 4HAIA 3HJTA 3FVTA 3MT8A 4I55B 3LO8A 1RHMA 3ME5A 3MWDB 2F90A 3OMXA 3R7LA 2ZZKA 2ZS9A 3WR5A 3LYAA 5AVKA 4KX5A 1P1CA 1V1RB 2OCIA 3R5FA 5DULA 2ZJBA 2VJDA 1T10A 1T3HA 4GHWA 4TROA 4Z7QB 2VQEB 1U0FA 2HTEA 5C80A 1Z68A 1KFEB 2WM3A 5IJ0A 1R10A 1VCHA 4RD6A 4TS1A 3LQ2A 2BUCA 4MX8A 2XDQB 4Q9AA 2QMQA 3AJEA 4QLAA 4XQGA 2AT1A 3W2HA 3DE6X 3ETCA 3ZGVA 4DUGA 2NP6A 1XTZA 3ILYA 4FONA 5KWIA 2G0TA 1O94A 4UM7A 1IQPA 1KDOA 3FTCA 1XZIA 2ADMA 3QKSA 5ALRA 4BMYA 1FFEA 4X1YB 4ERXA 4MINA 3AF6A 4AM8A 4D8YA 1NX6A 1FLDA 5C4MA 1MVOA 4FFOA 3AFGA 4YAOA 2AFIE 3CRZA 2H2FA 3QV2A 2XMCA 4HDCA 3DOUA 5G41A 2WT9A 1KZGB 4EYSA 4UPEA 1EIWA 5ALYA 2GCPA 1C8LA 2OG1A 2B8TA 1M1NA 3WA7A 1A82A 3GLGB 4WKOA 4W9MC 3CZMA 3GJ4A 5EUCA 3UJ3X 3H5OA 2GILA 2V1XA 3DUFA 4RL4A 5EJFA 4D9GA 1ISRA 2AOUA 4OAPA 4C0XA 4N48A 4IR7A 3RAJA 1F0PA 2SECE 3ORRA 1SRRA 3HV0A 4JVOA 1K2WA 4YIHA 4TV9B 4GR9A 1WVIA 5LP6A 1GNPA 2I80A 3VZBA 4LVUA 5I7WA 4XEHA 2VL7A 2ZI5A 4O1HA 5E1MA 3AZPA 2PXHA 1TPYA 4E2ZA 7REQA 5C31A 1UFRA 2EOAA 4PGMA 3ZCXA 2E89A 2G9QA 3TOXA 4NULA 1M5TA 1TJ4A 1EX6A 2D2EA 1FMLA 1SWVA 2IYTA 5HF9A 3TXXA 2FWRA 2W98A 5C5DA 5L40A 3EXG2 9ABPA 5L4SA 3TLYA 3L1JA 4PEVA 5AKHA 1M34E 1I0IA 1IHUA