1M7HA

Crystal structure of aps kinase from penicillium chrysogenum: structure with aps soaked out of one dimer
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
203
structure length
203
Chain Sequence
FHASALTRSERTELRNQRGLTIWLTGLSASGKSTLAVELEHQLVRDRRVHAYRLDGDNIRFGLNKDLGFSEADRNENIRRIAEVAKLFADSNSIAITSFISPYRKDRDTARQLHEVATPGEETGLPFVEVYVDVPVEVAEQRDPKGLYKKAREGVIKEFTGISAPYEAPANPEVHVKNYELPVQDAVKQIIDYLDTKGYLPAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Adenylylsulfate kinase
publication title Ligand-Induced Structural Changes in Adenosine 5'-Phosphosulfate Kinase from Penicillium chrysogenum.
pubmed doi rcsb
source organism Penicillium chrysogenum
molecule tags Transferase
total genus 76
structure length 203
sequence length 203
chains with identical sequence B, C, D
ec nomenclature ec 2.7.1.25: Adenylyl-sulfate kinase.
pdb deposition date 2002-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01583 APS_kinase Adenylylsulphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1m7hA00
1WE2A 4G01B 3TW8B 1E0KA 4B35A 2GJ9A 1KZGB 4BLRA 4C30A 1U8ZA 2Z43A 4AG5A 1AJEA 2VP2A 4WZBE 2PLFA 3QXSA 3B60A 3NBYC 3RABA 2C04A 1HURA 1C9KA 3WMGA 2FFBA 1P7CA 4FCWA 2NG1A 4YDHB 3BBPA 4QBFA 5FOXA 1U99A 3EA5A 5L3SB 5GJCA 1N0WA 2WWHA 3UMRA 2YWHA 3W8NA 5IK2D 1E2FA 1F2UB 1ONBA 2A9KA 3C4JA 2HUPA 1R4AA 3K70B 2P65A 2GWHA 3SC3A 4B74A 2JJ2A 4MRSA 1XXHA 4JSYA 2J46A 4ITRC 2XJ4A 4DCVA 4DLYA 2PT5A 2W6JA 3L0SA 1GFIA 4AC9A 1SHKA 2ZYTX 4QKQA 2QAGC 1LV7A 2J7KA 4Q21A 4PPNA 3LO5A 2X2FA 2QM8A 3L0IB 1G7TA 3PEYA 2EVWX 1WF3A 2OLKA 3U44A 2O8EB 5CYOA 1C1YA 4EJSB 2UZ3A 1ZAKA 2XJ9A 4IRUB 4IVPA 1W36B 4OJKA 3ADBA 2QP9X 5LB2A 2IS4A 4NCJA 4TLEA 1Z6AA 5EE1A 1AGRA 3MAAC 2XTMA 5L3RA 5TMPA 4LYFA 2ZE5A 4D4LA 2RGDA 3THYB 2YC2C 4QM6A 2V7QA 1G7SA 4TMVA 2BVNA 1LY1A 4QJ3A 5B64A 1N6HA 4R2HA 4B43A 4US1R 1G9XA 3CX8A 1DG3A 1GKYA 3NBFA 2BKUA 4TYNA 3AVVA 2V6JA 2ZYVX 4HZUB 3GLIA 2JLQA 5AK0A 1Y63A 1L4UA 3EZFA 1CF4A 2VH5R 4OHVA 1KI2A 3BFXA 1JR3E 3MWLA 1EFUA 3PUYA 4I1VA 1D5CA 2BM1A 1IJFA 2GK7A 3EIEA 3U3OA 3NVAA 4QFMA 1OXSC 4LYAA 1FMJA 3C14C 5SZJA 1ELOA 4EIWA 4HAUA 3TUIC 1GIAA 3GLFE 3GFTA 3WP0A 3HJNA 1AIPA 4TL8A 5D3MA 3WNCA 3AVWA 2ZI6A 1II8A 3MD0A 4Q9HA 1RW4A 4D0NA 5SZKB 4CGZA 2HCBA 5KUTA 2ZRDA 2GEVA 3EWAA 2ZAOA 4A92A 4DT1A 1QHIA 4HLCA 2VSFA 2DBYA 4ZDIA 4NKRA 1XPRA 1BIFA 4B73A 4HDOB 1XZQA 5FR2A 2C8VA 1AS3A 5C2JB 3I8XA 2J0QA 3J81k 3I8SA 5EZ5A 4UNRA 1G8GA 1F6BA 3D7MA 5B58C 2A7QA 4QNMA 1NN0A 2YWFA 4RCZA 3X1XA 3B13B 4FMCB 1T5LA 3K0EA 2JLYA 1ZCBA 4QBHA 4M2LA 1J7KA 2NO9A 3U3KA 1LF0A 3G5UA 3D3QA 1AGPA 4HUQB 5F9HA 5C18A 1SVIA 1DAKA 3O8BA 4M53A 4BLQA 3SNHA 3FMPB 4L4UA 4RVCA 2ZTSA 4X8MA 5BQ5A 4DUGA 1OFHA 1OPXA 2OT3B 1VKJA 2BM0A 4Z54A 1T91A 3PG5A 2DHRA 4PC6A 1S9HA 2R6CA 4RZUA 2O52A 3RSOA 1W4CA 3D8BA 4Q66C 2A30A 3WYGA 1Q44A 2CJWB 2YNMA 4JMPA 3IKJA 1CJTC 3SEAA 1R0XA 2WVJA 4BWYA 4DIDA 1XTRA 2VQSA 2AFHE 1IBRA 2OESA 3KZ1E 3NC0C 1KJYA 3U7HB 3QOFA 621PA 3WYFA 4DZZA 3TVDA 1Q3HA 3AVTA 5EQTA 1U0LA 3THXA 2R6FA 3CRMA 4F91B 4QGAA 1KKMA 3E5HA 2DWPA 4LC0A 3NBXX 1N5LA 3IEUA 5AR1A 3EZ9A 2HXYA 3CZQA 4LYHA 2NZ8A 2F3TA 1BKDR 1AS0A 2HF8A 1LS1A 1C4OA 2Z4SA 4MYCA 3ZVRA 4DDWA 2D62A 2C95A 2FDCA 4DRZA 1KO8A 3X2SA 4U02A 4PZYA 2VYFA 1WP9A 2OG2A 1HEIA 1GM5A 2ZYUX 1W47A 3FKSD 1GZSA 1SXJD 3GP8A 1FTSA 1UBFA 2WM9B 3EIQA 4GMDA 4R7ZA 4ARZB 2ZANA 5J4LA 2H5EA 1E4VA 3LQQA 3F0TA 1FUKA 4KFTA 2REBA 2H17A 4JLVA 3THWB 1KO1A 3GLFA 4F7WA 4KJZA 4JKIA 4Q7KA 4II7A 3TRFA 3VQTA 5FR1A 1NMZA 3CH4B 5KTYA 3GLHA 1XTIA 2J59A 2YZ2A 1GL7A 5FBVB 4UNNA 4IDNA 1LB1B 4C7OB 2WPDD 3W5IA 4K46A 4YC7A 4PC2A 2TMKA 1E1QD 4KYIB 3ICQB 3LXXA 5H68A 2NQ2C 4ZCIA 2IEYA 3LW8A 3ZD6A 4G5QA 5KSPA 4A6PA 3VX3A 5HE9A 2C99A 1KDTA 3NH9A 3X1YA 4BEJA 4OI4A 1T3LA 1XFAA 4KBGA 3ZVNA 2CHQA 4CT4B 3HYRA 3KL4A 1XXHB 2WJHA 5FBRB 1KI9A 721PA 3U7EB 2W0SA 4ZCMA 2BV3A 3L8YA 1OXVA 5EP3A 3KB1A 2AD1A 2QRNA 2ZJAA 4P31A 2P6RA 4MUBA 4BECA 5UKDA 3Q72A 1D9ZA 4JLJA 1RJ9B 5CM8B 3RS3A 1IN6A 2ZROA 3T06B 1NKSA 2B8TA 2ZREA 4NYMR 2QGZA 5FBLB 1COWD 3IBGA 3HPQA 4LZZA 4ZDJA 1VG0B 2GZAA 4B33A 2ZRGA 2VHUA 2REOA 2XOKA 1CLUA 3RAPR 3VR5A 1I2DA 2IF0A 1KOFA 1NBMA 1KJZA 4Q4JA 4XWKA 5TVKA 4ASUA 4IVRA 4LX0A 5KHOC 1OJLA 2E9SA 2UKDA 3A1UA 3ZD7A 1PLKA 1X86B 4HLDA 4AYTA 5KPJA 1NLFA 2RB4A 5CIQA 3CBQA 4TSFD 2MMCA 3N2EA 1X8KA 1R8QA 4M21A 2VP9A 1MKYA 3PIRA 4Y0VA 5FTKA 1NMYA 3AKYA 1KI4A 3P4XA 1OYYA 3CPEA 1Q57A 3SJBA 4XSGA 2P5SA 1RKBA 4WVFA 2YHSA 1FOEB 4PPQA 1RIFA 5SZHB 4HDCA 4W9MC 4NONA 4QBGB 2WSMA 4TL9A 5C1BA 3LBNA 1VG1A 5IF9A 1TADA 2BMEA 2PCLA 421PA 5DE3A 1RRPA 3DM9B 1ZNYA 2J7PD 3B1XA 5D3MB 1W4RA 1Z0IA 2ZI3A 1I4LD 3KKNA 4JLOA 4KSCA 5BYKA 1J90A 1NI3A 2QGNA 2O8CA 2QE7D 1EFRA 4BZQA 3WRYC 1XPUA 1AN0A 5EP2A 3HDTA 1G3UA 2UZIR 1NSFA 3R9IA 4TMTA 4DT1B 1XJQA 3KTAB 4X8OA 2JJ8A 4LBZA 3U3MA 2FEMA 3KQLA 3W90A 4YXWA 4TTQA 5KO2A 3IEVA 1VHTA 5CJPA 5ELXA 4TQAA 1E2NA 3TSOA 3REFA 4BPBA 2EWVA 4RD4A 4QBIA 1W1WA 3FMFA 4PHTA 2AKYA 5DN6A 2JLSA 5DIFA 5EUMA 4Q9JA 3UK6A 1Z0DA 5G40A 4RKEA 3B1WA 1N6RA 1G20E 2ZI4A 1JAIA 4EFLA 3HU3A 3C5CA 1CIPA 5EE5B 1G64A 1KKLA 3AVYA 4B32A 1W0JA 2A5JA 3EWSA 3KKOA 4GOXA 2B7BA 1QDEA 1UKEA 2P6UA 2CEAA 2EFHB 2KBEA 4QOSA 4YMSA 4A2PA 1G8PA 4URXR 1ETUA 4XOIA 3QSYA 4WA7A 5JECA 2F7SA 2NPFA 2SHKA 3CR7A 1G41A 5FFMA 1UKVY 2ZUDA 4B3CA 1XEWY 3V4FA 2IYYA 2FFHA 2GRJA 1ZC3A 4FD2A 4I1UA 3HPRA 1ESMA 4HEJA 2WJVA 4I1OA 3GJ4A 2IWHA 2C98A 1WMSA 5BYJA 1KGDA 2GJ8A 1M2OB 1ZM9A 4CEIA 2OEPA 1X8JA 2VP0A 1G1MA 3OAAD 4IEEA 1Q0UA 2ZRCA 4A2QA 5HPYB 4AYXA 3LBHA 2FH5B 3K0AA 1JXMA 3PEUA 1D2NA 2ZJOA 3AM1A 2WKRA 4JSTA 5FOVA 5JRZA 1WBDA 4NYJQ 4DSUA 2QMOA 4OK3A 5FTJA 1IXZA 4PQYA 4D81A 2QTVB 3AP3A 2VLIA 3A1WA 3A36A 3Q7PA 3U6KA 3R8FA 1JR3D 1E2LA 4NU0A 3K1JA 3T35A 1HE1C 1BS1A 1II0A 1YZKA 4RZXA 1MO3A 1K6MA 3TUJC 2FV8A 2PJZA 2BEJA 4NDZA 3EX7C 4P33A 1X1RA 2HLDD 2VPPA 2ZM5A 2FGJA 4TT3A 2J3EA 2QPTA 3R9XA 5FOTA 3CRVA 1MR3F 4D0LB 2JJ1A 2PX0A 5BN3A 2ZIAA 3GJ6A 1QHGA 3CUEF 4MGZR 3GLFB 2HYDA 4YDSA 4BUJA 3M6AA 3CRRA 3SBDA 2QUZA 2J0UA 3WY9A 5KDDA 4TQUS 4DLUA 2RHDA 521PA 3U61B 3ZVMA 5K8IA 4HSEA 3ZIAD 2WSSA 4LWZA 4R2IA 5AJXA 1ZC4A 3AVUA 5DHAA 4TYYA 3PENA 3SZRA 1VCNA 5L3SA 1TX4B 1KI1A 1OXUA 4LSGA 2YINC 1UKZA 2XX3A 4GPTA 2WJYA 1XTJA 2N46A 2NO6A 1E9CA 1CR2A 4G5OA 1MO4A 1XEWX 3CLVA 1JBKA 1TQ4A 3ND9A 4KLNA 4Q19A 4XWAA 2FPMA 3VNVA 2GHIA 4BGDA 4PQRA 1R10A 1N6PA 1T9HA 2NTYC 4WBSA 5EXXA 4A8JA 4IHQA 2DY1A 3CR8A 2WTUA 2YOFA 4D0GA 4AKHA 2ZRMA 3LWNA 3AGQA 4V02A 3IIJA 1OIVA 3GCGA 4S35A 4V03A 4EJSA 1U8YA 3QVVA 2BEKA 1E4YA 1W46A 3LXRA 4F4JA 1YJ5A 1HT2E 1QBKC 2CL7X 4B71A 5CJ2A 1ZM7A 1A2KC 3LRPA 4AURA 1Q12A 3KUCA 5EXPA 4QHSA 1Q1ZA 5JEEA 1G4UR 4JLDA 1HYQA 4OYHA 1AKEA 3GFOA 3VTKA 1ZYUA 5JI2E 1TQDA 3THYA 2GTPA 1WB9A 2W6ID 4Q4JB 2OLJA 1J8YF 4RFSB 2VHJA 1B23P 3CIOA 1I4TD 4QHTA 4RCYA 4TLCA 4W5HA 3SJZA 4ZV4A 1NG1A 4Z51A 1L8QA 3VHLB 3E2IA 5JBQA 1VCOA 1I2MA 3UKDA 2B7CA 4PHHA 4DSOA 1BYUA 1OH7A 2X19A 1AZSC 5CDFE 3GEHA 3WNBA 4Q4AB 2RGEA 4V0MA 4O0MA 2OO7A 2JGNA 1KI6A 1OHHD 1IN8A 1KI8A 2GBLA 2KI5A 1SXJE 1GP2A 1KZ7B 4TLDA 4JT4A 4DJTA 1IXSB 1E6CA 4NCKA 3W8RA 2CL0X 4HZIA 1E2KA 4Q1DA 2AR7A 2W0MA 1ZINA 5J4KA 4PR0A 1DAHA 4XD7D 4FINA 4UNPA 2ZU6A 2JDID 2VBCA 2ZI7A 4JVSB 4XJXA 1P60A 3OESA 2P67A 1QF9A 2CK3D 1OW3B 4LK2A 2O8CB 3KJHA 4M1WA 4IVQA 4JJZA 4MKFA 4UXJA 5FTMA 1EX7A 1NRJB 1XPOA 1BMFA 5JFGA 3KQNA 1JNYA 2PCJA 4M9XA 1YR6A 2ZAMA 3NDPA 4IEIA 3M4YA 4OKSA 1W48A 4PXAA 1KK0A 2JLZA 1VG9B 1ANKA 1US8B 1E1RD 1BO6A 3PITA 1NMXA 1X6VA 3UIEA 5TDHA 3VR1A 1Z3IX 1OKKA 1DAGA 5H8WA 4LRWA 4G5SA 1P2SA 1XF9A 2OE2A 4HUQA 2CHVA 4B76A 3TLXA 1DTSA 2F1RA 4JLNA 2QPAA 4RZ2A 3GLGE 3CW2A 3EPLA 1OSNA 3T12A 3SU8A 2Z0MA 5TY0A 4GNKA 5BWMA 4LHVA 3AUXA 3GJ0A 3PCRB 5H1YA 4RSGA 4M9SA 3NG1A 3NEYA 1CKEA 2QT0A 3L0OA 3A1SA 1G7CA 2JLVA 2CJWA 1XTSA 2G6BA 3MGCA 1H8HA 3TK1A 2F1IA 4HB4A 1E2EA 1H8EA 1KO4A 1OFUX 4M0LA 1FTNA 5HR5A 2ZRHA 1W4BA 4NH0A 1XMSA 2O5VA 4IJMA 3KDSE 2WICA 3I3SR 4HB3A 1E79A 4TTPA 4WXRA 2ZRAA 3BH0A 4I81A 3VR2A 3K70C 3L2OB 4IW3B 4O2RA 4LGMA 1WDTA 1G18A 3G0HA 1N5KA 1GAJA 1W7AA 2V8OA 2E87A 2YV5A 4IDQA 2GAOA 2B21A 1R5OA 2IUSA 1G3QA 1E2DA 3EA0A 2XTZA 2ZITA 3K0AB 2LWIA 5FI0B 2XZOA 2GVDC 4EJSC 3BERA 2OCYC 4QGGA 1W36C 4IKEA 3WMEA 2Z83A 1G3RA 3B6EA 3OF5A 1Z0KA 1R8SA 3B1ZA 4JBXA 4KLZA 3DZ8A 4C0BA 1EFTA 2KBFA 3GJ5A 2O0KA 4DLRA 3MJHA 4MRVA 1JB1A 3P26A 2ZQ5A 1UEJA 2LKDA 5IT5A 2V4ZA 1GTVA 4A15A 4GZMA 2WIAA 1LTQA 2ZE6A 1EGAA 3A58B 2QY9A 2V6IA 4KITB 2F55A 4B48A 1NN5A 3TBKA 3U2QA 4AKIA 1YU9A 4GMXA 1N0UA 2IUTA 4RJLA 3W6NA 4DCNA 2W2TA 5DSZA 2ZS7A 5B57C 4B47A 4OI1A 4UJ5A 4D25A 3VR3A 3THWA 3FHTA 1Z07A 4F38A 2XXAB 1D2MA 1GG2A 1ZNXA 4TL7A 1DAMA 4BLSA 2O8BA 2YYZA 3LAWA 2PT7A 4JLKA 3H2YA 2FSIA 4C7OA 3LDAA 1FPMA 2ATXA 2J0UB 3F3YA 4UJ3A 4ACBA 4BFXA 4XIGS 1LVGA 1KSFX 3IHWA 4X8HA 4PHGA 3FMOB 2WPDA 4EAQA 2GK6A 2YJTD 3KFVA 5D3QA 1M6NA 4ZKEA 1E1QA 1JECA 2QU8A 4V0LA 1TU4A 2A78A 2F9MA 5CLLA 1K8RA 2Q9AA 3ETLA 4L8GA 3T5GA 4NE2A 4C0HA 3ADKA 5E7JA 3OFND 1G16A 2FPKA 5L3VA 1FMLA 1Z8FA 4TMZA 1W49A 4PZZA 1ESNA 1KHTA 3QPVA 2HXSA 3DDCA 4KODA 4A0GA 2W83A 2GETA 1E96A 1G3IA 1GITA 3KJEA 4A8JB 2I1QA 1FX0B 2L0XA 2O8DA 4JBWA 1RFLA 3IHLA 1RJ9A 2V55B 5FL7D 1GVNB 1GNQA 4DLSA 4JLAA 2GDJA 2J87A 3EAQA 1HY3A 3A6PC 2DR3A 2BKEA 1ZUIA 5G3ZA 1MV5A 1E9RA 3I92A 2REXB 3KX2A 1S4QA 3BH7A 3NWJA 4NPHA 4Q7MB 1SULA 3I62A 1COWA 3GFPA 4CEHA 1UBGA 4KCGA 1P3JA 4TYQA 1E2GA 1TUEA 1MH1A 2C9YA 4KO8A 2FE4A 3REGA 4LJ4A 4LV8B 4HLUA 2ASEA 3CPJB 5DO9A 2ERXA 3V9PA 3T1TA 3LW7A 4I4LA 5EE9A 1OFIA 5C4GB 3QIAA 4LUCA 1A2BA 1N6IA 2JIZD 4GL2A 3W6PA 1Z22A 4AKGA 2Q3MA 3NBZC 5CK4A 2WOJA 4BFWA 4TSFA 5GJBA 3TGPA 4RFVA 4FXPA 2IUUA 4PAOA 1TPZA 1EESA 4Q47A 3W5JA 1KI6B 3HU2A 5CB6A 3AUYA 1U9IA 3QG1A 4POAA 3IBYA 4BFYA 2FU5C 2QT1A 2DWQA 1T3SA 4HAYA 2C96A 5HE8A 3QUSA 1IJEA 1OB2A 5FPTA 1R0YA 5LD2B 2J7PA 4ESHA 4LC1A 3AVOA 3KTAA 3EPKA 4EDHA 2OFOA 3VKHA 2QE7A 1G19A 5IHPA 2K5UA 2RH5A 4OJQA 2ZVQX 2AKAB 3BB4A 1M7BA 4AWXA 4PC3A 4PSVA 1B0UA 1MT0A 2EYQA 4EQ6A 4JLMA 1ZJ6A 3O8DA 2CBZA 2ZYWX 1YR7A 1XP8A 4KFRA 1P72A 2MSDB 3OEED 2V54A 4QL3A 2ZRBA 1OYWA 1SHZA 2GEDA 4F93B 3ZDQA 4ZI3A 2J9RA 2ZVPX 3KUDA 4WOPA 1E9EA 1WCV1 2PZFA 4Q00A 1PZNA 2CNWD 5J5CA 3VKGA 1ODFA 1P9WA 2RAPA 3GQBA 4PTLA 4NHOA 3BH6A 2FFQA 4M1KA 1JEEA 1OH6A 5LPNA 2ZJBA 5HZHA 3LVQE 4JS0A 4CF7A 3AKCA 1PVOA 1E2PA 1QZXA 5K8LA 1MOZA 3BS4A 2CXXA 1Q1EA 2QM7A 1CR0A 2R8RA 4ON9A 2QSZA 5KYKA 1AM4D 1IY2A 3EC2A 2FSFA 1GNPA 3OIUA 3VFDA 4BZPA 4LY6A 1P9NA 2CVFA 1WRBA 1GSIA 1KMHA 3PQCA 2GCPA 3O8RA 5EP4A 1FFHA 3K09A 3A1VA 2IYRA 2QORA 1R7RA 3HR8A 4XTRA 1YKSA 4V0NA 3U6BA 4PX9A 3OAAA 3PUXA 4KXFB 4QGHA 4P4TA 2VP6A 2IL1A 1ZBDA 3KJIA 3LY5A 2YOHA 2IX3A 4BQSA 1DARA 1F60A 2JA1A 2ODWA 2Q3HA 2O0JA 3L43A 3Q9LA 4LHWA 2X2EA 4Q7LA 1VYVA 1P5ZB 1Z0JA 2ZJZA 2J0VA 2BBOA 4US0R 5JS7A 2NO7A 3A4MA 3IUYA 4BE7B 4WZAE 1L2TA 1W0KA 4W7SA 1JR3A 1XWIA 4C9BA 4L15A 4XWOA 2ODEA 1ZD8A 3FGNA 3QXXA 5J47A 2G3YA 1P2VA 1NKTA 4GP6A 5LDDC 2D7DA 1SXJB 4OHWA 1ZD9A 1V5WA 4EUNA 4NYIR 2ZRLA 4TMXA 4QJ4A 1Z6TA 1F3OA 4C4PA 2FN4A 4UXHA 2CLDX 2FNAA 2O8BB 4IOLA 2WOOA 1J2JA 4DLZA 5JJLA 1QG4A 1TQ2A 3SDZA 3AF1A 3T1QA 1XU4A 1L4YA 4NYMQ 2XAUA 4RD6A 1Z5ZA 3ZIAA 1F5NA 1DO0A 4YMTA 1S1MA 1XRJA 3Q7QA 1SQ5A 2IS6A 3BWDD 3TMKA 1YR9A 2FSHA 3RRZA 5KDOA 3T61A 1T4GA 3I73A 2HJGA 2IK8A 3QF7A 2CCJA 2C5LA 2GF9A 3K0CA 4UXIA 1A82A 2XNDD 2R62A 4DCSA 2PEYA 4V0KA 1P6XA 2AK3A 4G5GA 4R98A 2BDTA 2ORVA 2O8DB 2GXQA 1RZ3A 1E0JA 3SFVA 1D8TA 1OXTA 3BC1A 3UWKA 3WP1B 2QPOA 1XJCA 5J40A 1O87A 3MFYA 3W9YA 1HUQA 4G3XA 5TV2A 3WBJA 4PHFA 1N6LA 4TMKA 2VA8A 1ZVQA 2Q21A 1P73A 2R9VA 4G5RA 4NL4H 3EPJA 4CEHB 2FFAA 2QQEA 1NIPA 3R20A 4OI2A 4RFSA 3ZQ6A 2KWIA 3DMNA 5CM9C 3SN6A 3X1WA 4CEJA 2LKCA 2WJGA 3CRQA 4DDVA 4JT2A 4DLXA 3QEJA 4PPFA 5KSOA 3FTQA 3QBVA 1GILA 4PO8A 1VCIA 1E0SA 2OFXA 2ZXUA 4Q4AA 3FE2A 4TN1A 2V1XA 2V7QD 3CPHA 1VHLA 3DVLA 2XEXA 2ZSDA 1TL7C 2KE5A 5E7IA 3R7WA 2N42A 3GEIA 3NHBA 3ZJYA 3FKQA 4WIAA 1R0ZA 2GA8A 2OFWA 4JIMA 2KSQA 2DPXA 3I1FA 1VMAA 1DE0A 3JZMA 3K09C 1XMVA 1KNQA 5FPHA 4BEBA 2JAQA 3QNUA 3Q5DA 1ZNWA 1S3SA 5EZ6B 4C0SA 1SGWA 4UNSA 1KMQA 3JZAA 4D82A 5LB4A 2B6HA 4URYR 2AFIE 4B3FX 4QJ5A 4U7DA 2GXSA 1Z6XA 2HCJB 4CYMA 3PFIA 1II9A 2CK3A 2DFNA 2F43A 3KKMA 3PVSA 2Z6VA 3EG5A 2D4HA 2EU8A 4QXAA 4Z1MA 4E09A 1ZU5A 1US8A 1CR4A 1AZTA 2WJIA 8OHMA 5HZKA 4XSHA 2IF2A 3X1ZA 3THOA 3RRMA 4EQ6B 3SQWA 2VP5A 5HTKA 2XSZD 3CRW1 4DC9A 2IS2A 1E2HA 1E1RA 2ZR7A 4GI7A 3QKRA 4HAZA 1LFDB 3VHXA 5FL3A 2YVUA 3RDPA 1R0WA 1VDZA 3BB3A 5JS8A 2MSCB 2GILA 1SKQA 1IOZA 1NVWQ 3AF4A 4PPGA 5J4HA 5J4VA 3QXHA 4QC2A 1KNXA 2WMOB 4P0TA 5AUOB 4U00A 5TARA 1D9XA 1N6OA 1WQ1R 2BWJA 3AP1A 1SVOA 3PEWA 1GL6A 3IQWA 5JI3E 5CIWA 1EWQA 2Q0HA 3LFUA 4AI6A 3SYKA 3M0EA 4M4SA 1Q3TA 1YE8A 3WBKA 2B92A 3BXZA 1OH8A 2WWGA 1OV4A 4MGYR 1EFCA 4NTZA 1N3BA 3CONA 4TLBA 5FTLA 4FW9A 2Q3FA 1XX6A 5J4YA 1CXZA 1KMHB 4OK6A 3RS2A 1GRQA 3JVUA 4ZI2A 4UQOA 4Q02A 4DUGD 4QM7A 4Q4LA 2F6RA 3AQ4A 4PAMA 1XJ0A 2QEQA 3U5ZB 3IILA 4KV9A 2RGGA 3W6OA 4B2PA 3P32A 2AN9A 4GZLA 2ZSFA 4A9AA 2IYTA 3I72A 4E07A 5ANRB 4DSNA 4ZKDA 2IYVA 2QI9C 4K81B 3CX7A 4L9SA 3V00A 1FQJA 3AGPA 5G41A 1OXXK 4HATA 3ZS8A 2EFDB 221PA 4F92B 1S8FA 4DWJA 4P3YA 1X1SA 2ZRFA 2GF0A 1GDDA 1EWRA 4JLBA 5AJYA 4B34A 4LHXA 2AWNA 1AS2A 1A4RA 2EYUA 5HKKA 1ZD1A 4IDHA 2XXAA 5DH9A 3SE0A 2C78A 4Q7JB 1YHNA 1ZCAA 4PO9A 4YLGA 1PJRA 1ZM4A 1VIYA 2OBNA 3L8ZA 4DHEA 2J5XA 4NBSA 3C15C 2J41A 2G77B 2VF7A 3H0KA 2OCBA 3M1IA 1T3HA 1P2UA 1TEVA 3DM5A 1S96A 1W2GA 2AX4A 2BCJQ 4L16A 4A0HA 4B2IA 2AD5A 2G1JA 2ZSEA 4OL0A 2QNRA 3VAAA 3H1TA 2WAXA 4IFEA 4RD3A 5GVRA 3SJCA 5F9FA 3ZZUA 3P20A 1T6NA 3QKSB 4LBYA 2D3WA 2ZUBA 4XVRA 1S0UA 3NDBB 3K0SA 3L82B 3W3AA 2QA5A 5KNDA 2PX3A 2NGRA 1PUJA 2Z4RA 2CE2X 3CM0A 1OH5A 5IK2A 1M8PA 1YZGA 5E7MA 4A1FA 3OFNA 4EPYA 3H4MA 1FX0A 3E70C 1G3MA 4FCTA 1X3SA 4IOKA 4FMDF 2QBYB 5JWOA 3RWOA 3MWJA 1NVVR 3ZYCA 3FMIA 3RVBA 1SKYE 4Q1BA 3IO5A 1HQYE 3TH5A 5FL7A 3IDQA 4ZCLA 4E03A 2O0HA 3QF4A 2CHGA 1Z2CA 4Q1EA 1KDPA 4A6XA 5L3QB 3LA6A 2QG6A 4RD0A 2XTNA 1G4AE 3B1YA 3KFXA 3QEOA 4FMBB 1E9FA 4CEJB 2YWGA 3RC8A 1G21E 2HT1A 4QG7A 1DEKA 1XCMA 2Q6TA 1OIWA 1JEDA 1QHSA 1GL9B 1J70A 1KTVA 2CLCX 3CX6A 4PC1A 1NBMD 2JIZA 3BD9A 1DO2A 1LS6A 2UVQA 1E98A 1PLJA 5JJIA 1ZRHA 3R7WB 1KSGA 5HCNA 4B6EA 3R9WA 4HAXA 4P32A 4NZYA 1ZUHA 4GSYA 1Z47A 3KKQA 1Z83A 5CITA 4M1OA 4K8OA 2OSBA 2OXRA 3UG7A 4ZO4A 2XZLA 1EX6A 3U4QB 5BN5A 3TAUA 4DB2A 3ND8A 2BJVA 4BFTA 3ZVLA 4TTRA 3U7FB 1LW7A 4M1TA 3SHWA 1XTQA 4R9UC 2WWXA 4MGKR 5AJWA 3EC1A 4KFUA 2IEZA 4IXNA 3KXLA 2IYWA 1DAFA 4FIDA 3RS7A 4IOMA 1OF1A 4B3BA 3VU9A 4EPXA 4P4SA 1VYUA 2F43B 3EXAA 4DLVA 4C2UA 4ESVA 3B5JA 2ZE8A 4KVAA 3TIFA 3A1TA 3E1SA 1EG7A 2ANBA 3C41J 4OQNA 1FL9A 2A2ZA 1EFRD 4OQXA 1KDOA 3HU1A 1G8FA 4B6FA 2RGCA 4V0OA 1QVAA 3B8HA 1S1CA 2RGAA 1KAOA 2VL7A 3S1AA 3DOFA 4HUTA 3RS5A 1XCPA 5EXSA 3PV0A 3B9QA 4Q1CA 3T1VA 2IT1A 3QKRB 2HYIC 5F98A 1Z06A 3MMPA 1DG1G 4LHZA 5EP1A 1F48A 1DS6A 5KU1A 2IYZA 3DKPA 4N1AA 2NMVA 5KNBA 3I32A 1VG8A 3WMFA 4X8LA 4LJ8A 1XCGB 1KK3A 1U98A 4DBLC 2IYUA 3AH8A 2Z5FA 3O47A 5AUPB 5G53C 3LNCA 4LV5B 3VKWA 2XB4A 1XXHE 2PMDA 1M1YE 3MCAA 2C9CA 4ILEA 5DGXA 5C46F 1MO6A 1GKUB 3LBIA 3IO3A 3CWQA 3K0FA 3OIYA 1X8LA 3OE7D 3H84A 4IDPA 2ZRKA 4H1UA 3PUVA 2C2HA 2BJWA 1H65A 5IDVA 1Z0FA 2GJSA 3Q85A 3DKVA 4A8JC 2X77A 3RSLA 4C0JA 3BJIC 3DHWC 2H8KA 1XD9A 3Q3JB 2BBWA 3LX5A 5CYPA 2CCKA 2F9LA 1VPLA 121PA 2DYKA 4Q03A 2BBSA 2PZGA 3CNNA 1E9BA 2D74A 1VIAA 3GLIE 3TJZA 1NSTA 2ODNA 4JYBA 5K8TA 2IXFA 1BYIA 3SQXA 1YZQA 1P75A 3PUZA 2EWWA 1K5DA 1IHUA 3Q8XB 2O8FB 2AWOA 3QKTA 4D4MA 2ANCA 2PBRA 2CMKA 4FCVA 4KSBA 4Q01A 4KBFA 4M22A 5CDFA 1KSHA 2WAYA 3AF2A 1NN1A 2ZRPA 4MKHA 3LQRA 4B3XA 3I5YA 3FKSA 1SXJA 2A5FA 2W2VA 2ZEJA 1T0JB 1TF5A 2GKSA 1M7HA 1W44A 1KO5A 4BFZA 1IAQA 4HAVA 4CDGA 3AB3A 3JVVA 2P6NA 4LOAA 1CJKC 4LBVA 4LJ9A 5IRCD 2GBLC 1XEXA 4AY2A 3NEJA 4MUAA 2FWRA 2RGXA 1GWNA 2ZJ8A 4TT3D 5K8UA 4TQ9A 4PFSA 1RYFA 3W34A 3ZZ0A 1DAEA 2X1VA 3RRYA 2IHBA 4EPWA 1DVRA 1NLYA 3OEHD 4KU4A 2PLRA 4NCHA 5DI3B 5JJKA 2JJ1D 2DWOA 5LD2C 3LVRE 3SYLA 2ZE7A 2RGNA 4YMUA 4PQFA 1G6OA 3RHFA 2EFCB 3QQ5A 4D4JA 5B30A 5BN4A 2VRWA 1TQ6A 5GVSA 1VCMA 3N2IA 1RRCA 2QL6A 2ATVA 2WWIA 1W2HA 2FSGA 3QJYA 4I99A 1ZMXA 2H57A 4PANA 1CTQA 2WSSD 1YZUA 1S3GA 2ODBA 3TE6A 1K5GA 4O2LA 5EXTA 3ADDA 2DCUA 4RZ3A 2BIFA 4BRUA 3GJ7A 5KSYA 1F2TA 1IN4A 2JLRA 2XNDA 4CZ2A 5KDLA 3B82A 4LPKA 4MGIR 2F1JA 3GLGA 2QTHA 5JCZA 3SOPA 3K70D 3AP2A 2FMXA 4US2R 3MUFA 4JVMA 5JMTA 1JQLB 1XTKA 3RNLA 2CE7A 5JLJA 4EPVA 2MMGA 3QF4B 4YONB 1JALA 2G1KA 4FI3C 1W5SA 1TEXA 4BRWA 3EPHA 2WWYA 4TWZA 4LJ6A 2BOVA 1W36D 1HV8A 3TSWA 3TW4A 1NY6A 3BB1A 2IXEA 4URUR 2PL3A 2F3RA 2WKQA 2ORWA 2AXNA 4G0NA 4JL6A 2OUKA 3CF2A 4M9QA 4BLOA 1VECA 4EFMA 4DLTA 2FJUA 4HLQB 4DXAA 3AEZA 2OHFA 5FOSA 3IGFA 4CVNA 1U2RA 1Z28A 3MRSA 4MRNA 1PV4A 2FOLA 4LHYA 2W58A 4PAQA 1VYTA 4EPTA 4TZ0A 2H92A 3K9HA 1G291 4Z8YA 4Q4HA 1CP2A 5AWFC 2GAAA 2ZS8A 1N25A 1T0HB 1KSJA 4DIEA 2OZEA 5JCPA 2ZRIA 3DO6A 1I4DD 2R6DA 3KQUA 4NCNA 3QG5A 3FFBA 1AK2A 5A5GA 1D6JA 1KK2A 3IIMA 4PSAA 3DL0A 3ICEA 1QHHB 4DKXA 2RKOA 2OILA 4B3DA 3FHCB 1CRQA 3VU9B 2BCGY 4P4SB 1DADA 2IYLD 2VIIA 4OBEA 2D2FA 3I5XA 2VP4A 2W2XA 1FZQA 2ZI5A 2I3BA 3FYHA 3GLHE 1MO5A 3GPLA 3KQKA 1KI3A 1BMFD 4KFSA 1SXJC 4CIDA 3AVXA 3KQHA 2A5YB 1M34E 1ZNZA 4R71A 1NN3A 3S1AB 5EJEA 2OV2A 2QP3A 2XSZA 2C77A 1PLLA 2PH1A 1TAGA 5FTNA 2LCFA 1RC8A 3TQCA 4D6PA 1YZLA 3CH5A 4LJAA 4OQFA 4GRAA 4BLTA 2G0TA 2VHCA 3BIFA 4M1MA 2JLXA 2QAGB 4MDEA 3NC1C 1Z2AA 5M04A 1OKKD 4J0QA 4DEYA 4N0DA 3TR0A 1ZM2A 1U81A 1KI7A 1AA9A 4H1VA 1N6KA 4Q9IA 4P4UA 3SFZA 3U3RA 3IPXA 2H7VA 1XB2A 2RGNC 1N0VC 3NIBA 5JZVA 4GOJA 3LX8A 3T1OA 1HQCA 2JLUA 3K0FB 2AK2A 3KKPA 4ZIRA 4KHZA 1E69A 4B75A 1YZNA 3BRWD 1ZW6A 1SKYB 3ASZA 5JHGB 2Q9BA 2JEOA 3BOSA 2JLWA 3AKDA 1MABA 2PEZA 5A4JA 1NBME 1H8HD 1H8ED 1E99A 1UAAA 2FEOA 4NYIQ 4URZR 2IW3A 3BFVA 3RS0A 2QP4A 1E79D 5CLQA 1CRPA 3KB2A 2WHXA 1TU3A 3A8TA 1UBCA 2FF7A 4TLAA 4WXPA 3OIVA 4G1UC 2GCNA 2XZPA 2ZR0A 1TNDA 1E94E 3P4YA 3FWYA 3GJ3A 1G8HA 4FMCF 1FW6A 4YMWA 5B2ZA 2IYXA 1NJFA 2FZLA 2HJVA 2NO1A 4HLUC 3AF3A 1IN7A 1WXQA 1P62B 4BFVA 3B2EA 1SVMA 4KAXA 1XBTA 2RMKA 1KYIA 5G3YA 2RGBA 1G6HA 5L8VA 1KK1A 4B2LA 5JWHA 3A4NA 1GUAA 3DOEA 1NG9A 3AV0B 2HLDA 4Q1AA 4A82A 1R6BX 1AQUA 3TVTA 2BBTA 5EE3A 4JLPA 4RY2A 3L0PA 1NVXQ 2QENA 4LPSA 3GJXC 1UM8A 2G88A 3QBTA 1U9IC 1XEXB 1G5TA 3CWZA 1GNRA 3B78A 3KXIA 3UMFA 4C3ZA 1G8YA 5HCIA 3TAHA 5FUWA 1FNMA 4OK5A 3UATA 5FBWB 3EZ7A 3MJRA 2GNOA 1NNEA 3QKSA 4YMVA 3NHAA 2JATA 3TSZA 2FX3A 3UANA 1M74A 1NP6A 2QRZA 2P2LA 3DZDA 3CKLA 4JBYA 3F5FA 4GFDA 2OXCA 5FUYA 1Z29A 2XB2A 2C03A 5FUVA 3MG9A 5FPYA 3OIWA 3CZPA 3F8TA 3EARA 1NY5A 3SYNA 3ZZTA 3UG6A 1TF2A 1V43A 2VO1A 2V9PA 2VSOA 2QBYA 5F3WB 3N70A 1F2TB 2QMEA 3FPAA 4DB4A 4MDFA 3DMDA 1NVUQ 2GZHA 4C0LA 4RD1A 2WBLC 1IM2A 3GLGB 2GEUA 3IPYA 5JRJA 3LH5A 2IYQA 2ZUCA 2D7CA 4LJYA 1EK0A 2JJ2D 3B1VA 1W4AA 2HEIA 2V3CC 2AXPA 2W6JD 1XDBA 2ZJ2A 5L3QA 2QAJA 3HP1A 1HH4A 4MYHA 3K9GA 5FUXA 1RE0A 4AK9A 2E1RA 4HAWA 1QRAA 5DHFA 5JHHB 4OQLA 1QHNA 1S2MA 3SI7A 2KB0A 4L5BA 1QHXA 4E5UA 1P61B 2IYSA 3SS8A 5C4MA 1SVLA 4D2IA 2W6IA 4D80A 4CW7A 1G5PA 1WBBA 1FNNA 2HDNB 1IXRC 1O3YA 2BMFA 3U44B 2OBMA 2IBMA 2ZJYA 1MRSA 1RYHA 3U60B 3I4LA 4MITA 3TR5A 2I4IA 4YQFA 5JSZA 1E3MA 4LJ7A 5DYIA 4LBWA 1QVRA 1E2QA 2PJRA 2QMHA 2KJQA 1FUUA 3K9LA 3VMFA 3GD7A 3QI2A 4DCUA 1TF7A 1J8MF 1PUIA 6Q21A 1OHHA 4IFBA 4Q4HB 4TL6A 4Z8XA 1E32A 1LNZA 1UEIA 2QSYA 3U4QA 3P1JA 1R5NA 2QROA 2OAP1 3GLIB 1KO7A 1S9DA 3CO5A 1N5IA 2ZRJA 1FP7A 5GADl 1DOAA 2B8WA 2YC4C 4IOJA 4ZPXA 4HB0A 4BASA 4XD7A 2ZJ5A 4OHXA 2JDIA 2XITA 4JZKA 5FOWA 3WHLA 1IQPA 1EXMA 1A7JA 4KVGA 3K9NA 2CDNA 1GRRA 3UPUA 3DEFA 1UF9A 1CBUA 2EFGA 3NTUA 3T34A 1JJVA 2XNSA 4A0RA 1XD2A 5AUNB 1II8B 5DNYB 3GEEA 2J45A 4GOKA 1IN5A 1UADA 1CJUC 4JYCA 2QN6A 2FG5A 3TKLA 1SVWA 2VEDA 3ZLJA 2CVHA 4F4CA 2QTFA 1OB5A 4Q48A 2WKPA 5KSZA 1NLZA 2HT6A 1OT3A 4CT5A 4NCIA 1U0HC 3EZ6A 2IS1A 3VX4A 3PEVA 1DBSA 4GT1A 1ZP6A 4MRPA 4HDQB 2ERYA 3KJGA 5E4FA 2WJJA 3FFAA 3ZH9B 5EE0A 2EW1A 1OIXA 2A5GA 3B7GA 1NF3A 3HR7A 4XVQA 1CJVC 2ZSAA 3EZ2A 4ZDWA 1M7GA 1UPTA 3LLUA 3A37A 5DISB 1DPFA 1Z08A 1TTTA 4U5XA 4JVLA 4JJKA 4CRWB 2F1HA 1Z6YA 5EUQB 3D31A 5JEDA 4ZIRB 3K0CC 1XD8A 2NO0A 3UWOA 2X8AA 3OE7A 4QRHA 3RS4A 1JQJC 2NIPA 1MABB 4PSKA 3HWSA 4MA4A 2J1LA 2N1BA 2NPIA 2VF8A 2GESA 3TQFA 3SR0A 4IDOA 3NH6A 821PA 2BMDA 2GJAA 5FPKA 1P9RA 2PMKA 4RD2A 2CL6X 4W5JA 1XMIA 1T8TA 2O8FA 1YVDA 5BW8A 3C5HA 5LBIA 3PR1A 3THXB 4V0ME 4LV6A 5E3HA 4JVNA 2R6GA 2WWWA 1OLOA 1U90A 1CS4C 2ZRNA 1AKYA 4DVGA 2AHOA 3K53A 2YWEA 1YRBA 1N6NA 3C8UA 3KXKA 2HV8A 2ORIA 1MRNA 4L9WA 3I61A 1CU1A 3QY0A 1QG2A 4C0QC 1UJ2A 4FMDB 4XVUA 1W0KD 1IY1A 1Q1BA 1OFTA 4M8NE 3WXMA 1D2EA 1JI0A 5CB8A 4QNRA 2YKGA 4B3GA 2H16A 4Q9LA 5DYGA 3AF0A 2FA9A 3CF0A 2P3SA 2IWRA 4EKDA 1TUIA 1L7VC 1ZIOA 1R5BA 2ONKA 5TB5A 3ZGXA 5DI3A 1NVVQ 4PO1A 3FDIA 4WZ6A 2CLSA 2GCOA 3RWMB 2QZ4A 2VTKA 1R2QA 2Q9CA 4NYJR 3QVUA 5SZIA 3OEHA 1A5TA 1RVDA 3ECCA 5FBQB 1J99A 3LV8A 5CK5A 1W5TA 2XGJA 3BORA 2A3RA 2OCPA 1GKIA 1KDRA 3IQXA 3MWKA 3GLHB 4M1SA 4XH9B 3U7GA 1HTWA 2ZETA 1E0AA 2WZQA 4D26A 3WNDA 3OZXA 4OHYA 3SBEA 2VSXA 1SVSA 3H86A 4MH0R 1TMKA 2CCGA 3DPUA 4O25A 2RCNA 4NMMA 4Y0AA 2GVZC 3PUWA 5FI1B 4EPRA 1U0JA 1ZUNB 3QXCA 4H9GA 1G5RA 4QHYA 1F2UA 5AUQA 4AD8A 1SVKA 2P0EA 3AKEA 2HF9A 4ERNA 3QKUA 1UFQA 4TMWA 3UMSA 2GXAA 4KI0A 2ONJA 4KYUA 5H70A 1HT1E 1Q20A 1E2JA 1KY3A 1RPZA 1U94A 4RKFA 1G17A 3A4LA 4LDJA 2FGKA 1HA3A 4A2WA 1KIMA 2VHQA 1CULC 1P2TA 1FP6A 4GBMA 4QGFA 1LF5A 1Z0AA 1JJ7A 2IXGA 2G9NA 3BK7A 3T15A 3O8CA 2O8EA 1JAHA 1JPJA 2W00A 1ZIPA 4Q9KA 3PXGA 1JXOA 4BFUA 3ADCA 2XOKD 2DFKB 5GJWC 1ZU4A 1XEFA 4ASUD 4S2EA 4UNQA 5JSZB 1YR8A 1Z63A 2J0SA 3RRNA 1Q1QA 3TUZC 4URWR 3WYAA 3VR4A 1ZM3A 2D2EA 4PZLA 4XTCS 3QENA 3X1DA 3LLMA 3FVQA 1EFHA 3B9PA 4OQMA 4DEXA 2MSEB 4FWIB 3WHKA 4HZUA 3MSXA 2OM2A 3EIHA 3B85A 2DFLA 4O3MA 2H1LA 4DDUA 1IY0A 3U3JA 1N2CE 1SZPA 3AVPA 2AL7A 3RYTC 1KAGA 2RHMA 2ZI9A 3EASA 4EFNA 1U8AA 1XNJA 3RANA 4MKIA 4E22A 2EFEB 2NOAA 1UDXA 1QHHA 4AKEA 3RC3A 1QHYA 1Y3AA 5BXQC 2YOGA 3BGWA 4C0AC 5AJVB 2WWFA 5KOYA 1YRAA 2VHTA 4LJ5A 3W3ZB 4AIIA 3PJRA 3CNOA 1RRFA 3NKVA 2WMNB 4WAUA 4HYYA 1YQTA 4HB2A 4PC7A 1XD2B 4URVR 3ZS9A 4DSTA 2A5DA 5KNCA 4BZXA 1JR6A 4ACAA 5AJZA 3ASYA 4M9ZA 1CR1A 1RRGA 1G7RA 2DFTA 1JPNA 2FZ4A 4YXWD 3FB4A 3G82C 2Y8EA 3OEEA 3GMTA 5P21A 4Z1MD 4C2TA 2OBLA 3OHMA 4OHZA 5FOUA 4TYWA 4FWTA 2QQ0A 4JL5A 4TYPA 4MYTA 3QXJA 4Q5IA 2ZR9A 4DCTA 4MYUA 3FOZA 2QAGA 2ECKA 1A1VA 1OE0A 5DN6D 5F2EA 4WW0A 2DB3A 4BFSA 2CNWA 2ZS9A 4GP7A 3QPUA 2IC5A 4D4KA 2JCSA 2ZU0C 3VR6A 4AG6A 4ZDKA 1DELA 1WA5A 2I1VB 1GRNA 3MLEA 1W0JD 2OCAA 3R8CA 1AQYA 2GZDA 2D06A 4LI0A 5FH9A 1E9SA 4W5WA 4FN5A 1IONA 2EQBA 2PZEA 3CF6R 5E95A 3T5DA 4B44A 4JL8A 4LYJA 1BH2A 1VTKA 3HYTA 4TZ6A 2R2AA 4DLWA 4N0EA 3GJ8A 3CB4A 4N3NA 1UDWA 2P5TB 3AVQA 3P27A 3SHFA 3QE0A 2GJKA 3BFKA 5GJVC 4BLPA 1Q22A 3C7KA 1DAIA 2GXUA 3BE4A 5FPSA 5JWRA 4A4DA 4C0KA 2G0NA 2G83A 1XZPA 1Z6GA 1NL3A 3FHOA 4F4IA 1T5IA 3CNLA 2H18A 2ZPTX 3ONWA 2WIBA 5DI9A 2NZJA 2R6AA 4OI0A 1KY2A 4MRRA 3WRXC 4CEIB 2IHYA 4MQBA 4JKYA 4NP6A 1E2MA 3V4RA 4LCBA 3K8YA 1E9DA 2V1UA 2OAQ1 4M1YA 1UBEA 3UXMA 2QMUA 3MWYW 3IIKA 1N5JA 5DLQC 3RLFA 1KJWA 4IXMA 1P4SA 5KPDA 3D6TB 3TNFA 2ZSBA 5A0FA 1E2IA 1XMJA 4DDTA 1HE8B 1CEEA 2WV9A 3VNUA 1CJMA 2FPLA 1Q21A 1UKYA 5TXGA 2JASA 3C16C 4GDFA 1NIJA 2R65A 3BAFA 3QPWA 4HI0E 2R44A 2BMJA 3EW9A 2C9OA 3NXSA 4MKGA 4A36A 4ARZA 1E9AA 1GOTA 1BOFA 1T8UA 3SJAA 5HKKD 2BC9A 4AYWA 1NJGA 2IA5A 4Q18A 3LD9A 4A0FA 1FQKA 2GCOB 1YZTA 3Q5EA 4I1SA 4ABYA 3N5CA 4UKDA 4Q1FA 2BHRA 3ZQJA
chains in the Genus database with same CATH superfamily
1WE2A 4G01B 3TW8B 4B35A 1K2WA 4QYXA 2OL4A 1NBWB 2PX5A 1T1SA 2Z43A 3KHUA 2VP2A 2JBWA 3UYKA 1NR7A 2V6FA 2ZBGA 3ECAA 3P2MA 4QODA 3NBYC 4IINA 2VWPA 4NBKA 4IJQA 4UCXA 2HUNA 4AROA 4FCWA 1ZGJA 4YDHB 1TLLA 3CNQS 3BBPA 2WHEA 4QBFA 4X1IB 3U39A 1AY0A 1OTYA 1AURA 2XT6A 1XJ5A 1BCRA 2QRVB 3BK2A 5GJCA 1GPUA 4LZJA 3UMRA 2JCYA 3W8NA 5ALVA 1E2FA 3A1DA 2HHAA 2I62A 3NHRA 4F1JA 3WAJA 4CR6A 4I9GA 1DDIA 4G56A 4OO3A 4UVEA 1K06A 2WZBA 3RTEA 2JA2A 3ZTYA 4U2EA 1XXHA 1M1YA 4UMDA 4YWJA 4DLYA 5JZMA 1ZUD1 2PA0A 3NT2A 2J7KA 3DZKA 3FTCA 3PS9A 3LO5A 4PPNA 2VF5X 5AIAA 5CFPA 1QK3A 1G7TA 5FLXA 3PEYA 2XI4A 1WF3A 1MX1A 2HSGA 2EG9A 2OCKA 3MCZA 3THSA 3TL6A 1V1MB 2QX6A 1V26A 3ZJVA 4YRGA 1SOWA 3N9IA 5K0CA 2PL9A 4IRUB 1W36B 1LPOA 5LB2A 2XGMA 1LLFA 3L18A 3VNBA 1Z6AA 3F49S 5EC8A 3K9FC 1N2HA 4ZI5A 4O59O 4X20B 3WI7A 3CH6A 4LW8A 4DM3A 4DGSA 2ZE5A 3DT9A 3L92A 3RG8A 1HQDA 2AJTA 3AB7A 3DG9A 1T35A 1VBNA 2YC2C 4MUHA 2I80A 1OLSA 1LC0A 3AEKB 2I54A 4LNHA 5LMCA 2FPSA 1Y7LA 4H35A 4Y6QA 5B64A 5KKAA 1N6HA 1QP4A 1JG3A 1G9XA 3CX8A 4Y67A 1GKYA 3KOOA 4DPKA 3AVVA 4QGBA 2ZYVX 3MERA 4HZUB 4O63O 3GLIA 2RHOA 3GT4A 1WX1A 2WAAA 3HCAA 4Y2TA 5LZ9A 1Y63A 4DR7B 1QP7A 4BKOA 5I7AA 3ZDDA 4OHVA 5JPCA 5JDIC 1D0SA 5DMXA 1AGXA 2VZ8A 3GVXA 3H3JA 3LT5A 2JVJA 2VK4A 5IAKA 4RETA 1ZG3A 3BMCB 4N48A 2DBQA 3NVAA 1WOMA 4PG4A 2YJ3A 3O4JA 1GG9A 1P2FA 1FMJA 1VSQA 3DUFB 1ELOA 2NX2A 4HAUA 1DZIA 3HBFA 1XYVA 3GOHA 1CUGA 1MGPA 3NATA 4I50F 5BPHA 3ID6C 1KEEA 3KJNA 5JAHA 3OVMA 3AVWA 1KFJB 3PFFA 1II8A 4Q9HA 1RW4A 4UOEA 3WOHA 3LF1A 4DV0B 2D2XA 2HCBA 1J5XA 1PSWA 1WNTA 4LOIA 3R74A 3UJDA 1WXXA 2BUBA 1P1RA 3MAJA 3MVEA 3EWAA 2ZAOA 4FOSA 3I2GA 4GYYA 4RABA 2RBEA 1QHIA 3GZNB 3UA3A 3F5DA 5KINB 3HFGA 3EGWA 1HQKA 4H7DA 3D7NA 2DBYA 2R7NA 1Z16A 4XUGB 2JI8A 3KPYA 4YCCA 1RLUA 1Q0LA 1XZQA 1FP1D 3JX9A 1GZ5A 2QU7A 4OCZA 5FR2A 3WLQA 1DFHA 4J07A 3I8XA 3J81k 3TLGB 3EEOA 3I8SA 2Q3CA 3E3OA 5B58C 1TUBB 2IEIA 1DBPA 2WRZA 4S3MA 2OFFA 4C3VA 1LRLA 4DS3A 3I5MA 1Y6GA 4ISBA 3L7DA 4QLAA 4LF4B 2XUHA 3Q3EA 1DKNA 2GHQA 1PNVA 2GEFA 3PZRA 5KYYA 3U7IA 4FTWA 4BVAA 4D74A 4YJFB 4EGSA 1G60A 4GE3A 4QBHA 3IUQA 4RBNA 1LF0A 2E4XA 4TMFA 1GSOA 3EFBA 4JELA 4CM5A 1P9OA 1FRVA 4QXMA 5JXWA 5F9HA 3FNGA 2AR0A 1IATA 1SVIA 5CDTA 4EYEA 1DAKA 4M53A 4WY5A 2GN6A 3OC0A 1YIAA 3KSAC 2QUIA 4RVCA 1N9GA 1DHTA 4TWAA 4J29A 3E3MA 4X8MA 4ZAGA 5BQ5A 3JQBC 4XQGA 5I7FA 1Y7HA 1VKJA 1THTA 2BM0A 1T91A 5JFOA 1FU8A 4H15A 2A30A 3CYFA 5LBTA 4BNWA 3RTDA 4JMPA 4R54A 1VL0A 1CJTC 4DSAA 4PWZA 1R0XA 3FN4A 4BU1A 4BWYA 5CA1A 1Z7YA 2VQSA 3DEKA 4LXGA 2I6QA 3AZOA 4MS1B 4QYWA 4DIUA 1G21B 3LBFA 4YV7A 1P0CA 2VJAA 2YUTA 2CXOA 4K40A 1CDEA 2E4ZA 3TNYA 4DZZA 4UM5A 3TVDA 4JBHA 1U0LA 1FU7A 3LJKA 4M0MA 4QGAA 2CJPA 3C87A 4QULA 1T34A 1JTEA 1Q91A 2OAGA 3BL8A 4HO1X 4FI3F 4FSDA 1VYHA 1GCAA 3CZQA 3C3BA 1LLDA 3CG4A 4IIJF 4RPKA 1BKDR 4DR2B 1AS0A 2HPVA 3TG8A 1R6XA 1O5TA 1P1HA 1PQUA 4ZK6A 1C4OA 2Z4SA 1U7XA 3KKEA 1KZYC 5FBZA 3M5WA 5DLPA 3GRRA 3HZOA 4AN1A 5ALOA 1GGHA 3UZUA 2D62A 3DZJA 3EUAA 2FDCA 4X54A 1B41A 2DR0A 2MDTA 3DLTA 2NYAA 3FUVA 3CLSD 1HEIA 3Q7IA 4LN1A 3S28A 3CUVA 3ABRB 3K9QO 1GZSA 1TGVA 4M36A 3GCDA 4GGOA 1UBFA 2Q5EA 4GMDA 2XMCA 3R6GA 1ENPA 2QRUA 4MPRA 2H5EA 1IMOA 2I7VA 3IRVA 1ODSA 1SCAA 4QU9A 4CU5A 5H0IA 3L8DA 3ZGOA 1IXYA 1EDEA 2WJ6A 4DMHA 3R2JA 4AULA 4LDNA 2REBA 1A72A 3QVSA 3THWB 3V4SA 4QYTA 2H51A 3WSTA 3GLFA 2HSDA 4XJSA 4JKIA 4II7A 1NMZA 2YXDA 4E31A 3P0HA 1AB5A 1XTIA 1KVUA 2P4QA 2YZ2A 3F71A 1XZNA 2DLDA 2PRKA 5FBVB 1A9SA 4WUVA 4IDNA 4LZLA 2HLHA 4QD3A 5DTJA 4K46A 4YC7A 4BATA 5IH7A 2JRCA 4RK0A 4PC2A 3DP9A 1JEAA 3AI2A 2LIPA 2NZYA 1RWQA 3NEPX 2PFSA 4ZAZA 2DTDA 5H68A 3DVRX 4MO9A 3K6JA 1UFVA 4CMBA 1T9CA 2I22A 3CA8A 3G8DA 3MPUA 2VUHB 3M49A 3CMMA 4KX3A 2C4KA 2B1IA 4GYJA 5KSPA 4FE7A 4QDJA 3WLMA 1BCRB 3ANSA 3BE5A 2HGZA 4EZBA 3RFVA 4F5ZA 3QTTA 3AV3A 4HEA1 3NH9A 2IUFA 4PO3X 3WIEA 4G9EA 4OI4A 3UM9A 4CMHA 1XFAA 1NQTA 3WLPA 4X6LA 5L3QA 1XXHB 2WJHA 1M1YB 4X84A 1JIVA 4KV7A 1JTFA 3ZNOA 3U7EB 2W0SA 1FUEA 4MCAA 1VP3A 3UFXA 1H94A 3L8YA 5JIBA 1OXVA 2NPOA 5TJ9A 1RLMA 2QRNA 3JAKB 4JI3B 4DADA 2P6RA 1N2XA 2PRJA 5UKDA 3TNJA 4ARIA 4NXMB 1D9ZA 1RJ9B 2ZROA 5IW8A 1NKSA 2B8TA 1CUSA 4P6VF 5JBIA 5JH7A 1COWD 3F6RA 4IXTA 1VG0B 1DJLA 1KPGA 1Q7EA 1RLOA 2X6TA 3IQGX 3RQSA 1N2OA 5LLSA 3INGA 4IIYA 4OQDA 3RVPA 2VDUE 3USZA 1XA4A 5KTKA 5EMHA 1NBMA 1HT3A 1Q19A 2EKDA 5L4LA 1P18A 2Z1MA 4BC0A 3N53A 4XX0A 1WZIA 5IZCA 1OLSB 2E9SA 1VIVA 4M54A 5I3CA 4J90A 1LVHA 5KPJA 1L7NA 2WD8A 4A23A 2V7PA 3CBQA 2JGRA 2BKXA 2ID8A 4MW4A 3JS5A 5BR4A 2Z8YM 4ZHSA 1KR5A 1IHPA 1J0DA 5SYMA 2A0XA 1I10A 4WK4B 1EK6A 1L1EA 3M6UA 2ABWA 4KQFA 3STVA 3CZCA 3QE4A 3K6KA 3TSYA 4ODIA 3KTOA 3HACA 4WVFA 3ADOA 4YUXA 3R5SA 4PPQA 4CE6A 1Y4SA 2FVYA 5SZHB 3NWEA 4R3WA 2YTZA 3CH7A 1NQUA 4WRRA 1QGUB 3Q9NA 3VVBA 4HMQA 2Z5GA 4YT4A 2W6CX 2PQ0A 3L7JA 4I14A 2BMEA 4MOWA 4ZQGA 1DPGA 4BYMA 421PA 2IIVA 5DE3A 3DM9B 1RT9A 1KEEB 1ZNYA 4RYLA 1ZN2A 2OZPA 1Q7BA 3IA2A 5BYKA 5B1YA 2NVUA 2Q8PA 1J90A 2WYIA 4HFRA 2O8CA 3VZQA 2AN4A 5AKJA 1Q77A 1QFJA 1OAAA 4ECEA 2UZIR 2XIJA 4L3VA 2FQQA 4ETNA 1ZOLA 3SZMA 1SCUA 4XPIB 4LBZA 1LC3A 2HDWA 4KNWA 1X7ZA 1OLUA 4OM7A 3FCAA 4YXWA 3TQIA 3C3AA 5KO2A 1MC1A 2ZT8A 3PRHA 5K03A 3RRJA 1TK9A 4HDNA 4EUHA 1VSUA 3REFA 4BPBA 1FYDA 4OYYA 1T8WA 3L1IA 3V4VB 4RD4A 1W1WA 2HA3A 4H59A 4WEOA 5GGYA 2VHXA 2Q7OE 2ONCA 4IHKA 4YALA 2ZTUA 3RIYA 1QQ6A 1Y5NA 5AFSA 1N6RA 3MB5A 3PCTA 4UBKA 1JAIA 1YZVA 4WZZA 4WZBB 5KYYB 2Q0XA 4P93A 3AVYA 4B32A 1W0JA 1JVBA 2A5JA 3ZCTA 4YVFA 2FQWA 3S3TA 5AMXA 1NJSA 2AOTA 1NBAA 1Y89A 2BAGA 4PLVA 3KKKA 3JQFC 2CEAA 2KBEA 5D5PA 4A2PA 4D9CA 4J1QA 4BJ5A 4XOIA 3QSYA 4GGPA 1J8VA 3I45A 1ILWA 1J7JA 2C0QA 2FW6A 4G09A 5BWCA 5FFMA 2B35A 2BR4A 4B3CA 2VWQA 5IBQA 2BHTA 3OP4A 4N6GA 4O4LA 4MVJI 2HQ1A 1I0LA 1PHRA 3DAPA 1ESMA 3U80A 1WMDA 2I4RA 2QG9A 2W11A 3EUFA 3O0TA 3QOWA 4I5GA 3TLEA 3VKFA 3GJ4A 5CVTA 4AP5A 1WMSA 3K05A 5BOSB 4DV6B 1SG9A 2JARA 1KGDA 1NWCA 2GJ8A 5CA1B 4DUYB 2GGSA 5KHLB 1SIOA 3L3BA 4R05A 2XY4A 5U1PA 4IEEA 1Q0UA 2GM4A 2G71A 1JDJA 2RAVA 4UE6A 3P96A 3PBKA 1JXMA 4ZI7B 5I51A 4AZ3A 1YIOA 1XMOB 3AF5A 3R4VA 3C1AA 1UAGA 4MULA 3INTA 2H0RA 3W5SA 1WSBA 1U3UA 1Z82A 4RVHA 4F8YA 3OLVA 4BTLA 3ZDEA 4OK3A 3GMIA 4XJVA 3A3PA 4FLFA 1IXZA 4XDGA 3SZLA 3SZ3A 1IRIA 4D42A 2YWRA 2VLIA 1B1CA 3U6KA 1XNGA 3VBCA 2GPBA 2CNLA 2G04A 1JR3D 1SCQA 5G1NA 2NTJA 4RHYA 4ZVPA 2VNAA 2XMSA 3A6FA 3UK7A 1II0A 2Z4TA 1I3LA 4YDRA 4I4CA 2QJWA 4KIFA 4RZXA 1MO3A 4REOA 4HNVA 5I9IA 4FYHA 2B61A 1JDUA 4NDZA 2XUQA 3EXG2 3SYRA 4F96A 4P33A 5JAZA 2HLDD 1ZZGA 2VPPA 4TS3A 5D7NA 2WSYB 4ZT2A 2VDOB 4X0EA 3ZWKA 1Y6JA 2GQ0A 2MHCA 1FP2A 3EISA 3O92A 2XCUA 1LSSA 1RC1A 2JFXA 1CQXA 3CRVA 2H59A 2WHYA 1MR3F 2JJ1A 4RAQA 3VPGA 3GLFB 1QHGA 1ZD2P 2HYDA 3TRKA 1WULS 4BUJA 3CRRA 4RF4A 4Y9UA 3CX4A 4ZRNA 3KWFA 3ZE9A 1GPKA 2IEAA 2J0UA 2QUZA 3I9OA 3MC1A 3QX8A 3WY9A 3FTDA 1DXQA 2AQIA 1NZDA 3D7RA 1WIWA 3LHSA 2ZIZA 1BROA 3U61B 4IJWA 1F12A 3ZVMA 1WZNA 1P7VA 5K8IA 1VL6A 2QRPA 1G5QA 1Y4DE 1FS6A 4HWKA 4JR1A 3QYJA 3AVUA 3TIGA 4AJIA 3DNFA 4A27A 4HNHA 2G28A 3OE1A 1IG0A 1Z5NA 4GL4A 3IOBA 5KYWB 4GPTA 3ER9A 5B2EA 4O4IF 1XTJA 3NIFB 1PVVA 1FC0A 2NO6A 4KIUA 1SUAA 4B7XA 3ZLBA 1CR2A 3OJCA 1ADYA 1MO4A 2ZWMA 5AW4A 1TQ4A 4P83A 4TXHA 4WESB 3B3AA 3I2HA 4BGDA 3PNLA 4PQRA 1A4IA 4O3FA 1T9HA 4I36A 3UENA 3CVVA 2VQFB 1Y9DA 1IBCA 3ELYA 3CR8A 5EXEA 1RWVA 2VNIA 4UEKA 4D0GA 3PFGA 5SICE 3LWNA 4F4UA 3AGQA 1F38A 4R4JA 4UMVA 1DC7A 5B3JC 2B4TO 1R4MB 3GCGA 4S35A 4V03A 2EKBA 2HWWA 2BEKA 3MXOA 2ROQA 4K9MA 1R6UA 3LXRA 4X24A 3DXZA 1YJ5A 1HT2E 1QBKC 4HRVA 4KK3A 4X1YA 5FEMA 2A9PA 4B71A 4IUBS 4R0MA 8ADHA 4E1BA 4RULA 4WLNA 2C9ZA 1XCLA 1PR3A 2D5AA 1KVTA 4YR7A 4OYHA 1HYQA 2HF2A 1AKEA 3GFOA 2YHUA 1JLRA 2CVOA 4J7AA 4CKEB 5JI2E 1WB9A 1FJXA 1DKQA 3DULA 2EJTA 1YDWA 2EP7A 4XX0B 4CHGA 1B23P 3I30X 2MSLA 2PSDA 3VZBA 4EG1A 2EARA 4CN9A 1NG1A 4LVUA 3H9EO 4E07A 4ZV4A 1UQUA 1EUQA 3ETJA 1RCUA 1VCOA 1I2MA 2DUWA 2FPIB 4PHHA 4XUDA 2O06A 3H5AA 3NTOA 5BQ3A 2X19A 5CDFE 1IDOA 2TS1A 4KQJA 4BGEA 1WZ2A 2FK8A 3GVHA 2Q6OA 4O2BF 2HW8A 2ADOA 1VKRA 1KZ1A 4V0MA 5ALYA 1MAAA 1OBFO 1OBCA 1Q1GA 1KI6A 5EYPA 3CHYA 4RTPA 1IUOA 1STOA 1K7EB 3BMOB 4TLDA 3DQZA 3G8BA 2ZUTA 4DJTA 1IXSB 3QFRA 4G0XA 1P5HA 2Q2OA 2CL0X 3A3YA 3JD0A 4HZIA 1Y37A 2JCBA 2CMHA 4RPJA 1V8OA 2W0MA 1ZINA 2AMYA 3DTYA 3M9WA 3QLUA 4G0YA 1JKFA 2Y71A 3GHYA 4PR0A 2HNKA 3SQMA 1TYAE 4UNPA 2WAOA 4KQEA 2P2ZA 2P41A 2ZI7A 4EA8A 1DC6A 4NMHA 5DBEX 3OPYA 4P4LA 3ZWXA 2P67A 3NVDA 4GC9A 1QF9A 4YH1A 2NVUB 1OW3B 3LQ1A 4LK2A 4M1WA 4AWBA 2O8CB 4UARA 3T7DA 3ICPA 3IKLA 5EEHA 2CXHA 4FILA 3KQNA 2PCJA 2HB6A 1NHWA 3HVIA 2VT3A 2ZAMA 4S1NA 4G86A 1X7ZB 1E3SA 1OLUB 1W48A 4PV7A 5HK9A 1BRMA 1TC1A 4OU5A 2I6SA 2E3JA 2JLZA 4GI3A 1QGAA 2Z8ZA 3R6TA 2KPOA 4HDNB 2HJ9A 1M33A 1RBZA 5L7YA 2RONA 3BHMA 3EIUA 3PKIA 5TDHA 3TI9A 2J3MA 3VR1A 3HXTA 3JQ7B 2ZW9A 1YJBA 2CLKB 1OKKA 3M8KA 2TECE 1PIWA 3WLSA 4LRWA 5H8WA 2ZPAA 3EOAI 4K6CA 2X6QA 5LSAA 4I1PA 1GT91 4HS9A 3ROZA 2D13A 2QPAA 3H16A 1HL7A 2Q29A 2AOTB 3CW2A 5FD8A 2XRZA 3NR2A 2LRHA 4DREA 3R6LA 1UWLA 3NI2A 5BWMA 2BFAA 4XWTA 3T9CA 3NHYA 2FPOA 5H1YA 2RHRA 4KQHA 4M9SA 3A7EA 3VU1A 2ZYDA 3L0OA 3DV9A 1QHFA 3A1SA 2ZWAA 4HXYA 4DIOA 2JHCA 4DILA 2CJWA 1XTSA 4G6ZA 2A0KA 3PB3A 1JZTA 4HCJA 2Z09A 2YS7A 2QNIA 1HKUA 1KO4A 5EZQA 3Q15C 5HR5A 2ZRHA 1EUCA 4K6MA 2LR0A 4NH0A 1TAUA 6GPBA 1XMSA 1S8OA 3DKKA 4HB3A 1JHYA 2YIDA 3K70C 4I81A 4D6YA 4IW3B 4RTOA 5KJCA 4TLLB 1LBHA 1WDTA 2R48A 4FHFA 1G18A 1N5KA 1EFKA 3DDUA 2V8OA 2E87A 2B21A 4FZ3A 5ICCA 4YBRA 3EA0A 2F9FA 1HPLA 3C0KA 3NKLA 1P1BA 2ZITA 1XR3A 3R76A 5L53A 4QTTB 4AZ3B 3JYPA 2XZOA 1W88A 4FKZA 4OGGA 3QE3A 2OCYC 4D45A 4QGGA 4QUKA 1MQSA 2PAAA 2PWZA 3B3JA 2GNPA 2OCIA 3OF5A 3OH8A 1R8SA 3B1ZA 4KLZA 3DZ8A 1UANA 3CZ9A 2J4CA 2O0KA 2YYYA 3MJHA 3CUTA 2HZ7A 1JB1A 1JAZA 3TKAA 4ZGWA 5KTMA 1L8AA 1YVEI 5IT5A 1Z9BA 4FFNA 4HC4A 4OXKA 3OF2A 1VB3A 1WHSA 5L9AA 1BGVA 2ZE6A 3A58B 2QY9A 5ALWA 2JZNA 3KBBA 4GIBA 1FDWA 2FDXA 1MB9A 3RIGA 2F55A 1ABBA 1QRTA 1WETA 5CH5A 2R7AA 3P2OA 2XHEA 4RJLA 2OYRA 3VI3B 2CLHB 4G63A 2W2TA 3HV2A 4X00A 3GRKA 3VMMA 2DXIA 1AGNA 2HEGA 1OGJA 1XK7A 4KE8A 3DZIA 3VR3A 1SB8A 5IAOA 4TVSA 1VJ0A 4JR0A 3QEKA 4PEVA 2W4IA 1F8UA 2Q9UA 2YW9A 3MGBA 2ONYA 2YHIA 4UW9A 3CWCA 4D4HA 4JC8A 2VTEA 2FCRA 3AEXA 3H2YA 3QPBA 1L5WA 3ROPA 3NAGA 2E89A 3TNLA 3K92A 5BWOA 3OQ1A 2J0UB 3F3YA 5C7IO 1C7ZA 3ZX5A 1LVGA 2AF4C 4TV8F 4X8HA 1RI1A 3L84A 3DBRB 1GAEO 3FMOB 1OWLA 3O3OB 2YJTD 5T4BA 2BFBA 5A4IS 3E2PA 2PWBA 4EEXA 4KN5A 1JECA 1Y1LA 3AIOA 2YZNA 3JWHA 4L74A 1VJRA 4MRMA 1QNFA 2F9MA 5ITVA 3LWZA 3W6ZA 3WZLA 3VZRA 3U7RA 3ADKA 5AM3A 3JPWA 3OFND 3OJWA 3QM1A 4XCQA 2PS1A 1FMLA 1Z8FA 3FMGA 1XFDA 3GGCA 2F2TA 3LUAA 1FDSA 1BWPA 1F6WA 2NUPA 5AKLA 3BWBA 3R7BA 3OMLA 3GGJA 2HXSA 3DDCA 1DAPA 2W83A 1QK4A 1GITA 3F3SA 4YFYA 2AIRA 1BXRA 3SQOA 1XZJA 1LKZA 2FG7C 3RVLA 4BWGA 1RFLA 5BSHA 1R0KA 2OVFA 3FRHA 4F6RA 1OI7A 1RACA 2XNCA 3CGGA 2YMLA 2UUOA 3EAQA 4OYRA 1A88A 3QYAA 2JHAA 1MV5A 3I92A 4Y2GA 2REXB 1M6YA 3WYNA 2I6TA 3TLYA 3KZKA 1SULA 2OCXA 4G07A 4PZCA 1W6RA 3GFPA 4HZGA 1L7AA 5CLGA 1E2GA 2X7JA 1NTOA 3IJPA 4LECA 2MJLA 3LSYA 1R66A 4M9CA 3CPJB 1DQRA 5DO9A 1IZYA 5KQPA 2R68A 3T1TA 3FM9A 4AJJA 4I4LA 4MWTA 3HTXA 3W77A 5FAKA 1PJ3A 4BP3A 3GB9A 3W6PA 2Q3MA 4PBSA 1JQDA 1NQWA 2JKVA 3O8OA 2E21A 3VR4D 2VT6A 2G8LA 4LRQA 4PAOA 4EFKA 3NRJA 4BMDA 4JD5A 1ZBQA 5IM4F 2AN5A 2XQIA 3EC7A 3JCZA 4LISA 5EYPB 1KI6B 4J0JA 1I3OA 3C39A 3UGTA 1COZA 2NAPA 4A16A 5CB4F 2H2WA 2G1AA 4IUYA 3QMWA 1UP4A 2Q1SA 1QE0A 3IBYA 4RV4A 4BFYA 3NPAA 4H6PA 4KTVE 1B7GO 4GX5A 4LKOA 2DWQA 1L1FA 3TL3A 4HAYA 3OD5A 1XAIA 3P9XA 1KORA 4KPUA 3CO0S 3ZE1B 5DHQA 1IJEA 4Y2VA 5NULA 2C4HA 3UOWA 3C24A 2HMYB 1G2OA 1IB0A 4MGHA 3JWIA 5LD2B 3F3KA 5DIZA 1TJPB 3PI6A 4F6CA 4H7PA 3RUPA 3OPYB 2J7PA 4ZVNA 4YJ2F 3ZW9A 4C5CA 1S89A 2CUNA 3NV7A 5C8VA 7ADHA 1AKTA 3KTAA 4Z9BA 3KETA 2O2CA 3EPKA 4LNAA 2C83A 1DBIA 2QVZX 2BCEA 2YQZA 3QHQA 4XW2A 4D9BA 3K4HA 4UCWA 3MS7A 2K5UA 2Z98A 4OJQA 2ZVQX 1TO6A 1ZMRA 2AKAB 3PGA1 5B1SA 2X3FA 2GWRA 3JQCA 4WINA 1HNZB 3WMWA 2ZJ6A 5HNKA 4FEAA 5EIAA 3COWA 4JLMA 1ZJ6A 2JCVA 4LG1A 3RM3A 4RMJA 3WE7A 5JMWA 3WDKA 2CBZA 2XE6A 2ZYWX 1VHWA 4QOGA 4AP6A 1ZH8A 1XP8A 4NOJA 5JNUA 2MSDB 3LVBA 2WZCA 4WY2A 5D86A 1U0NA 4QL3A 4YWHA 2OB2A 4LZOA 5AT1A 2GEDA 4UNIA 4F93B 4DLLA 3ZDQA 5KNBD 4ZTZB 1TYDE 3ZCVA 4WOPA 1E9EA 2PZFA 4JYAB 2CNWD 3IDFA 1P2DA 3PI7A 3VKGA 2OECA 2CW5A 4DSZA 1DNPA 2XQKA 3EVTA 4M1KA 1WJGA 1N0IA 5E38A 3MQ2A 5B53A 1QIGA 2MOKA 3OC6A 3V8NA 5HZHA 3LVQE 1D4ZA 5FJIA 2B4RO 1E2PA 2F1KA 3T9EA 1K92A 3L1JA 4ZCQA 2DX7A 3L8EA 4FONA 2PWAA 2QM7A 3GUCA 5THXA 5F2NA 2QSZA 1KDVA 2C4TA 2O59A 3OIUA 3VFDA 5BUZA 1ZHFA 4OU4A 2OKGA 1U5BB 4LSWA 4LY6A 3FLBA 1BJRE 1P39A 1EUCB 1BH6A 4J9UE 3R7SA 4RJIA 1GSIA 5F3DA 3TL2A 2Y3IA 4YN3A 2GCPA 2Q4EA 4W8HA 1FFHA 2VC2B 2FR1A 1K8YB 1R7RA 1TI7A 2QORA 3HR8A 1Z74A 1OI4A 3T4UA 3ZQUA 3HBNA 5DBGA 5FXMA 2AKEA 3EGXA 1T26A 5I9NA 5FADA 3U6BA 4GUAA 4PX9A 3OAAA 3I9V1 4QQNA 3PUXA 4YRRA 4EHIA 5GTDA 4RORA 4KXFB 4LWQA 3MILA 2VP6A 2X9VA 3ABIA 1W88B 4P2GA 3QLTA 1SH7A 1XMPA 4V24A 3BTSA 4MHTA 1F60A 5A7HA 1UPUA 2ODWA 2O0JA 3L43A 9LDTA 2NVBA 3PQ3A 2BGKA 1P5ZB 2PZBA 1Z0JA 4EY4A 2ZJZA 1Q1AA 1BA2A 4U9HS 1RR6A 2G09A 2NO7A 3A4MA 4RF3A 3DMFA 3IUYA 4DV2B 1DJQA 3GG2A 4J8PA 5H82A 2XB6A 4Q6BA 1W0KA 1WHSB 1PR6A 4JXZA 4R40A 3GRUA 1V8PA 2PS9A 1XWIA 4NK4A 5DBIA 5DEOA 4XWOA 1ZD8A 2VYND 2Q28A 3QXXA 4N5NA 2G3YA 3ISJA 4NDNE 3LLCA 2CVZA 2OC9A 3DDHA 3RUIA 3GFRA 4MEBA 2KM1A 3FLEA 3LU1A 5DNCA 5LDDC 3AJDA 4GMGA 4Y9SA 4HMPA 1NZFA 4NYIR 2WILA 2ZRLA 1RQXA 1THZA 1APBA 4FZRA 4QJ4A 3SKVA 3ZE2B 3UBTA 1JAYA 1UK7A 2Q45A 4PQEA 3FDJA 7ABPA 3BZUA 1PJBA 1QMGA 3F90A 2YHIB 4UM8B 2PD4A 2EHDA 4FFDA 4LXIA 1TKCA 1S3FA 1E6UA 1YWGO 2FDRA 4L4XA 3MJDA 3VR4H 3I76A 2HTFA 1YMQA 3BBLA 1L4YA 3I2YX 4BO9A 4NYMQ 5IDQA 1K9SA 2XAUA 2EAUA 4RD6A 3EDYA 1NRWA 2BFBB 4KR3A 3ZIAA 5LDHA 2QGFA 2VP3A 4GKKB 3A3KA 3Q7QA 4MRMB 5LYJF 2ISQA 2ZT5A 3BWDD 1FPQA 4BWFB 1EG2A 1Q95A 3HKCA 2GCIA 1ISRA 3FLMA 3T61A 4G4JA 2ACEA 4E1AA 4G25A 3I73A 5TQJA 3L8GA 2NUPB 3QELA 3RR2A 3HBAA 4DCSA 2R62A 1GN9A 2PEYA 2YZKA 1GFSA 3I9V6 1J25A 4IHAA 2HNBA 1J09A 2AN3A 4G5GA 4ITVA 2DGDA 4HY3A 4QUIA 4YREA 3QP9A 5A1JA 3DE1X 3VGPA 3WADA 2V65A 2G9UA 1JQEA 2YRWA 4CM6A 4FHZA 3V7WA 4F6RB 5IFLA 2IPLA 1D8TA 2VF4X 3WP1B 4J0CA 1T24A 2QPOA 3N1UA 2IPAB 3M70A 2HA5A 2QD1A 4EHAA 4YP0A 2WFZA 4OP1A 5KNCH 1U2ZA 1Q0RA 3HWX1 1NA5A 2RE8A 4MLZA 1N6LA 4R7GA 2VA8A 3O9ZA 2VAMA 2HDHA 3D3NA 1WDKA 3QJGA 5TS3A 4NL4H 3EPJA 2QQEA 5CDGA 2Z08A 3KJZA 4Z7JA 3X1WA 3BXPA 2Z6UA 1PFWA 2IX9A 1DEOA 4Y6RA 4JT2A 4HMOA 3EXG1 2PWPA 5CA0A 1I8TA 4Z4GA 4ZZ0A 3ZCUA 2XMDA 4OYLA 3NBAA 1JLMA 5AW7A 4DAOA 5KSOA 1E5TA 4C5AA 3QBVA 5IVHA 1GILA 3C74A 4Q24A 1RABA 1VCIA 3ZY5A 5HP4A 1L8XA 3EHEA 4JC5A 5E0KB 2ZXUA 5TT0A 1I5RA 1H2XA 3VYTB 1RWWA 3R7WA 1AKMA 2N42A 4RHTA 3QPDA 1Y48E 3NRBA 3ZJYA 1LA2A 3FKQA 1XLWA 4ALMA 5IG2A 5AM0A 1GKKA 3GLUA 5FPHA 2AEFA 2D0OB 2JAQA 3QNUA 3PNVA 4C0SA 4E5YA 2JFGA 2BY4A 4L5CA 1WB4A 1SGWA 2GN0A 4KO1S 1WP4A 4KPUB 5IT9A 1LQTA 3HUUA 4YRBA 3SZUA 4ZA2A 2QVYX 2PAFA 4URYR 1DWUA 2UUCB 1Q5PA 2RK6A 5IAJA 3S8YA 4X7BA 5HKLA 5A04A 1P0FA 1XQ6A 1T2EA 4RY8A 4N03A 3ZHCA 1KEWA 4L9RA 2HCJB 3NAQA 3PFIA 4CYMA 2C5FA 4UPVA 2JFVA 2CK3A 4YRLA 3V46A 3T3NA 3VDNB 3ZWBA 1BWRA 1SM4A 4ZZIA 2LD4A 2DKOA 3CBGA 3I6ZA 2WA2A 4JP3A 1OZHA 2EU8A 1GNLA 2ENUA 1YUNA 4PX2A 1US8A 1CR4A 3GX1A 3W6UA 1J1UA 3R5FA 3UO8B 3VJKA 4CLXA 3FPHA 3THOA 3HB4X 3JVDA 4GRIA 1CUYA 4KG7A 3W8DA 3V80A 4R1SA 2VJPA 5CW1A 2BE9A 2O5RA 2Q2QA 4PSCA 1WXHA 4P08A 3GJTA 4N3BA 2ID7A 1XCOA 1LFDB 1EQ2A 3RDPA 5MN6A 5JMOA 2W71A 3ZDXB 1QCDA 4RDHA 2XQVA 1VHJA 2RGUA 3CE9A 1C3XA 1SKQA 1TMGE 3ES9A 2BP7A 3MIIA 5J4HA 1SQ6A 3NTLA 3O1JC 1KNXA 3QXHA 1KPHA 3IP3A 5ESRA 5AUOB 5HM8A 1PT6A 1YCDA 4RGVA 5KU7A 1RZRA 3L0YA 1DOZA 3HXMA 3KT0A 2X40A 1REQB 3L8CA 4Z1OA 1HDZA 4XWYA 4ZANA 4AI6A 3FZNA 1PWEA 4MIEA 3T6KA 1NDUA 3CKMA 1WCIA 5EXDA 3KKZA 2AVDA 1R1DA 2PUHA 3KNZA 1ONPA 2B92A 1OH8A 4TQGA 1HWYA 1NP3A 1S2NA 5AJTA 4FW9A 1K4MA 2Q3FA 3FY4A 3RROA 2PGIA 4E7OA 5J4YA 3RS2A 4EY8A 2HOQA 4HXFB 2QUAA 5DNAA 4QM7A 5F7OA 3OT5A 1JA1A 3AFNA 2B1JA 1YU6A 2BGLA 4XIYA 3MQ4A 3Q1LA 4RXTA 4DXDA 3R0VA 4PAMA 4D8WA 1PJLA 1VLLA 3Q9UA 3RUFA 5I4CA 3HY4A 2B20A 2QEQA 3IYLW 5IYZA 2RGGA 3U5ZB 3EMKA 3AZPA 3W6OA 5CBPA 4BTVA 1TUGA 4LCEA 4MKRA 1ZISA 4LYDA 1O2DA 1BXKA 2J85A 4HX5A 4MJ3A 4R9SA 4DSNA 1TA0A 1P80A 1ZGHA 1CZKA 1UPFA 4EAAA 3QUQA 4Y30A 1FRNA 3I9LA 2QI9C 3DOHA 4D3ZA 3OCXA 3IULA 4RYDA 3RAGA 1FQJA 3ZV5A 1QS0B 4A2CA 1OGYA 2EFDB 2JFZA 5SV2A 4F92B 4DWJA 3HMQA 2ZDGA 3RVNA 1LUAA 2HIHA 3DKRA 1PL8A 5E6SA 4A5SA 1BKYA 3H5TA 4RDXA 5KWIA 5M29A 4XYLA 2CNBA 4B34A 1SMKA 5T6BA 2AWNA 1HEYA 4Y9RA 4I2NA 1AS2A 3AU9A 2O8VA 2QTNA 3SF8B 5HKKA 2GYWA 4IDHA 4OREX 3KWJA 5DH9A 1TYZA 1GPNA 1KJNA 2ZLBA 1OFUA 4HDRA 1BU8A 1M83A 4YLGA 1AXGA 1KE1A 4QUAA 1RLTA 4H6XA 1C8LA 3AHIA 1K63A 4W1QA 1JG6A 3ZXSA 4P54A 3PZBA 4DHEA 3FTNA 2J41A 2Y68A 2VF7A 4G2TA 4H3SA 2I76A 1J0XO 1T6ZA 1H93A 1U7PA 3KP1A 3LSTA 4MICA 3ZY4A 2FR8C 5ED0A 3DM5A 1W2GA 3DFFA 1F0YA 4DLPA 2P62A 2AD5A 2O2DA 4OL0A 1L4GA 4UTPA 1YOVA 3KT6A 3ZE7A 3SJCA 1KAMA 1X15A 1T6NA 1ZMTA 2L17A 3QHAA 2ZUBA 3GP5A 4EVIA 1W93A 4XLTA 3NDBB 2QJOA 3N8IA 3O31A 3W3AA 2IVZA 3IOEA 2QA5A 2QL7A 5KNDA 3S27A 3FCOA 1NF2A 2I4NA 1DC5A 1EP2B 4RACA 5D85A 3A3OA 1JIUA 1USKA 2JFWA 3BTVA 1YZGA 3EH2A 1BE8A 3FUUA 3ORRA 3QELB 3H4MA 4H7JA 2GFIA 4Y8VA 3KQWA 4EPYA 1XZMA 1G3MA 2IP2A 1Z7GA 4BMOB 3TZBA 3EY4A 1UBRS 4EUFA 5FWYA 2AHRA 2PZLA 2QZPA 4K1XA 3IRUA 2C2GA 3S2FA 5CP8A 3CEHA 2HBQA 5A7GA 1NVVR 2M2IA 2VRCD 3KV3O 1ODKA 2PSFA 3AUKA 5TX7A 3E3LA 3QQPA 1YQGA 1N1DA 1NV9A 3E9QA 3IDQA 4I50A 3TB4A 4OXXA 3LHFA 2CHGA 2AJCA 4MB6A 1T13A 3SHVA 1MVNA 2AN1A 3B8EA 4S12A 5IULC 2JGIA 3LA6A 2FPXA 2EHJA 2QG6A 3I04A 1Q7TA 1G4AE 5LNK1 2ZIGA 3QITA 1TO1E 1B43A 1WCWA 1E9FA 4FYPA 4BNLA 1E92A 2JC3A 2VUTA 5CA0B 3MSCA 4QAJA 1DEKA 1PJTA 1YAHA 3K30A 4QG7A 2Q6TA 1EM8B 2IJGX 1OIWA 4YPFA 2NW6A 5IM5A 1UR5A 1IFXA 3NBKA 2G5CA 4KXNA