1M83A

Crystal structure of tryptophanyl-trna synthetase complexed with atp in a closed, pre-transition state conformation
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
328
structure length
328
Chain Sequence
MKTIFSGIQPSGVITIGNYIGALRQFVELQHEYNCYFCIVDQHAITVWQDPHELRQNIRRLAALYLAVGIDPTQATLFIQSEVPAHAQAAWMLQCIVYIGELERMTQFKEKSAGKEAVSAGLLTYPPLMAADILLYNTDIVPVGEDQKQHIELTRDLAERFNKRYGELFTIPEARIPKVGARIMSLVDPTKKMSKSDPNPKAYITLLDDAKTIEKKIKSAVTDSEGTIRYDKEAKPGISNLLNIYSTLSGQSIEELERQYEGKGYGVFKADLAQVVIETLRPIQERYHHWMESEELDRVLDEGAEKANRVASEMVRKMEQAMGLGRRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tryptophan-tRNA ligase
publication title Interconversion of ATP binding and conformational free energies by tryptophanyl-tRNA synthetase: structures of ATP bound to open and closed, pre-transition-state conformations.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Ligase
total genus 124
structure length 328
sequence length 328
ec nomenclature ec 6.1.1.2: Tryptophan--tRNA ligase.
pdb deposition date 2002-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00579 tRNA-synt_1b tRNA synthetases class I (W and Y)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.240.10 Mainly Alpha Orthogonal Bundle Tyrosyl-Transfer RNA Synthetase Tyrosyl-Transfer RNA Synthetase 1m83A02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 1m83A01
1PFWA 2XRZA 4NDAA 2DXIA 5HUJA 1PFYA 4NZPA 4YMIA 5DEOA 3DO8A 2ZUEA 1O96B 1T6XA 2A84A 1N2IA 3IDFA 1VL2A 1KP3A 4ND7A 4ZCSA 2BYTA 3IMCA 3A2KA 2BTEA 1N2JA 3KT3A 1A8HA 5AHWA 2PG3A 1H3FA 3VRHA 1F7VA 1P7PA 4ZT6A 3KFLA 4U63A 3COZA 3DPIA 3GMIA 1VBMA 1EUYA 1O0CA 1OWMA 3ZXIA 1N2BA 3Q4GA 1WXIA 2X1MA 3KT6A 4JXXA 5H7XA 2J5BA 1U7DA 4MUGA 1M8JA 1EFPB 4MW1A 1KH3A 3RBAA 1IQRA 1IFXA 1WXFA 4ZCQA 3HV0A 1YUMA 4X0EA 4PBSA 4RUKA 3UY4A 4OUDA 1JEDA 2A88A 3INNA 3E27A 1RQGA 1YI8A 3ISJA 4NAHA 1COZA 4MQ6A 1LW7A 1S4MA 3SP1A 2EJCA 3COWA 2PFSA 3IOEA 1TYBE 1EE1A 2PZ8A 5TGTA 1NUQA 3AG5A 2A7XA 1X6VA 4FZJA 3CVYA 3VU8A 3F3MA 3CLUD 3MUEA 3COVA 2YWCA 5LLTA 4ARCA 4YBRA 4EG5A 3IUBA 1K97A 3PNBA 1ZH0A 1KR2A 2E21A 3VGJA 2I1LA 1OWPA 3LE8A 1MOPA 3ZXSA 2HZ7A 1XNJA 4QREA 3NBAA 1KQOA 4YP5A 1WXHA 4KR9A 3OTWA 5LM3A 1M8PA 1PFUA 2DEUA 3D6UA 2YWBA 4GU5A 4DDKA 3ELBA 3IOCA 1UFVA 5TEVA 3FDXA 3PRHA 2J4DA 1KAQA 2E0IA 3CLRC 4MW2A 1N77A 1Q77A 1IVSA 3SZ3A 1U3DA 1R6TA 2RE8A 4EG7A 2QUIA 1KQNA 2JA2A 4S1OA 3FHJA 1N75A 2AG6A 1QNFA 4EG3A 4MWDA 2VXOA 1NUPA 3Q10A 3FIUA 1K92A 3AL0C 1JIJA 5BNZA 4JXZA 1FYDA 4F4HA 1IQ0A 2PZAA 4J75A 1X8XA 3IVCA 3HGMA 4QRDA 3C8ZA 4KR6A 4K03A 2A1UB 1NI5A 4MUJA 4I6EA 3FOCA 3UC5A 3NV7A 2YY5A 3G59A 3RK0A 1G8GA 2WQ6A 4K0RA 1IHOA 1O97D 1R6XA 1SURA 3L92A 4G5YA 4CT0A 2QJOA 4ZT7A 1J20A 1YULA 1T6YA 1VBKA 1J21A 3BL5A 2X3FA 1EFVB 3GUZA 4MAFA 3IOBA 4NATA 3NBKA 1JILA 5DK4A 4MVCA 3CLSC 3CLTD 1OD6A 1QRUA 3DLAA 3ZJVA 1V47A 4L2IA 2CFOA 1GTSA 3M5WA 1H1TA 1XJQA 1QU3A 2IELA 3AFHA 3G5AA 4DJAA 1WXEA 4HJXA 1VLHA 5KCMA 3ZUGA 1K4MA 1KH2A 2JANA 2V0CA 1MAUA 1TYDE 3SDBA 1WKBA 3IVGA 4MUHA 1MBZA 4GRIA 5FNZA 1WZ2A 3Q12A 2GKSA 1M8GA 2NSYA 4MWBA 2G36A 4Q16A 4KPUB 4WNYA 1J1UA 2QJFA 4OJMX 3IVXA 1ZUNA 5K0TA 2VTBB 4ZT3A 2V0GA 5DB4A 4Q93A 3CR8A 4MUNA 3QTTA 2O8VA 1QQTA 3PNYA 3N9IA 4R0NA 1ZH6A 2OQ2A 4CDNA 2R5WA 1O94C 4EG8A 4MULA 3IMEA 2J07A 4ZT5A 5HUHA 2CV0A 4HK4A 2QJTA 1N78A 4F3RA 1QTQA 2AKEA 4I6GA 4XSVA 1M8KA 1WQ3A 3A04A 5DASA 2E18A 1I2DA 2NZ2A 3TQOA 2CYBA 2X1LA 1PG2A 1T9GS 4MVWA 2DUMA 3ZIUA 4ND6A 2DPLA 2QTRA 3TQIA 4AQ7A 1MJHA 4E1AA 1TFUA 4MUKA 1NUUA 1G8HA 3L93A 1LI7A 1EUQA 4MVYA 1JZSA 4MWCA 1F9AA 3H9BA 4YP7A 1PG0A 3TZEA 1O96A 1MAWA 3P52A 4U7JA 2H2AA 5H16A 2DLCX 2GM3A 3FNRA 1YIAA 3IH5A 1Q11A 5J59A 3MLBA 3CLUC 3D6VA 1J1ZA 1KQPA 2CT8A 4ZT2A 5K0SA 2PXHA 4DLPA 5TEWA 1F4LA 3UOWA 4DDHA 3CVUA 4PY2A 3CLRD 4L2IB 1GTRA 1EFPA 1M83A 3SYTA 3X1MA 2A86A 1K4KA 3UK2A 3COYA 4EG6A 1MB9A 2QUJA 5FO1A 4J76A 1NUTA 4ZCRA 2D54A 1TYAE 4KKVA 4RPIA 3K32A 1O0BA 1O95D 1I6MA 3H05A 3MXTA 1NZJA 2CSXA 3MMXA 1KKUA 3CVXA 4H3SA 2Z3VA 3QTBA 3LOQA 3ZJTA 1YIDA 4OUDB 1HYBA 4AS1A 1H3EA 1U0BB 1M8FA 4XFDA 1XNHA 1ZJWA 5J5AA 3CVVA 2IJGX 2IP1A 1GZUA 4I6JA 3HMQA 4UZEA 4A91A 1N2EA 1JECA 4HPWA 5JBNA 3CLSD 2QTNA 4P2BA 2DR2A 3ND5A 2Z09A 3TS1A 3IUEA 1O97C 4QBTA 1J70A 1GLNA 2A1TR 3K9WA 2X0KA 3DV2A 1YUNA 4JZYA 4CQNA 4JYZA 4EGAA 1JMVA 1GPMA 4NX2A 2GOYA 1N3LA 1N2GA 1QU2A 1QRTA 3CLTC 3CA8A 1IRXA 5IJXA 1TQ8A 5TS2A 3RJZA 1NP7A 3N2YA 1NYLA 2D5BA 5KHAA 3IMGA 2TS1A 4JFAA 2CYCA 5KWVA 2J09A 4MUEA 4EG1A 1KP2A 3PXUA 2J08A 4MLPA 1WJGA 5HG0A 1TEZA 1R6UA 3ZGZA 5F23A 1Y42X 2ZUFA 4MUFA 3FH0A 3RK1A 2A4MA 3FG9A 3HZRA 3FY4A 3H99A 2AZXA 3X1JA 1U7XA 3AG6A 2C5SA 1QRSA 4KR7A 4MVXA 2O5RA 3I05A 1NUSA 1O94D 2RD2A 2A1UA 1OWLA 1Q15A 1KAMA 1WXGA 3H9CA 3CVWA 3GLVA 3OP1A 4HJRA 3HFJA 1QJCA 2WQ7A 1KORA 4DNXA 2CV1A 1MC1A 3N8HA 1VBNA 1OBCA 4EFKA 1TYCA 1JZQA 2YXNA 3FI0A 4MWEA 4YP6A 1EFVA 1O5TA 2XRYA 1IQUA 2QTMA 1U3CA 3IODA 2ZP1A 3AKZA 1B6TA 2WSIA 4U8HA 1LI5A 3RHSA 1MRZA 1D2RA 4MW6A 4DDMA 4WSOA 3AIIA 3A05A 3ND7A 2Z08A 1IH8A 4G6ZA 1NURA 4MW7A 1F7UA 1BS2A 3X1KA 3U1VA 1NSYA 1OWOA 1PFVA 1DNPA 3UMVA 3LCJA 1O6BA 3ZJUA 2WB2A 1WOYA 3P0HA 1MB2A 4ZT4A 1EJ2A 1WY5A 1XNGA 3H97A 1V8FA 3QE4A 2A1TS 4MW5A 3KT0A 3N05A 2HGZA 5LFAA 2DERA 2PIDA 3P0JA 4BWVA 3FWKA 4R2LA 1WQ4A 4KPUA 4ZCPA 3KT8A 3A4IA 4TS1A 2JAXA 4PBTA 1JHDA 4DE5A 3SEQA 1N1DA 2VTBA 1JEEA 3TNJA 2H29A 1H3NA 3ND6A 1GAXA 1I6KA 2B7LA 1GN8A 4MW9A 3SEZA 2CUZA 3PNVA 4ZCTA 1OWNA 2OV4A 4EG4A 2D13A 3JXEA 3ILVA 3S3TA 1I6LA 4CDMA 1Q19A 2QUKA 5EKDA 3P0IA 5FO0A 1T6ZA 3FETA 4PBRA 1N2OA 1T9GR 1EXDA 1JGTA 4EF6A 2QUHA 2E89A 2PZBA 4MUIA 1O95C 3G6KA 2HMAA 5J58A 3MLAA 3TZLA 4MW0A 1ILEA 2EL7A 3HL4A 1ULHA 2CV2A 2DETA 1JIKA 1FFYA 1M1ZA 3RFFA 4ARIA 1N2HA 1G8FA 1KH1A 1OBHA 4XFJA 2CYAA 1JIIA 1CT9A 1G59A 4NAUA 1J09A 5IHXA 4R2MA 4MW4A 3SZGA 4UZFA 4G5FA
chains in the Genus database with same CATH superfamily
3HYSA 3BK2A 4LJLA 3VVMA 5BW6B 3BPSA 3NUGA 2DPYA 4FGSA 3SBEA 5CX1B 1G6OA 2JD2A 2VJCA 3CVOA 3ETNA 1OX5A 3GD5A 1RKXA 1RHKA 5F51A 4E3ZA 2ZQZA 3KHUA 3OBBA 1CF4A 2HO5A 3IUYA 2PZKA 2I5PO 4PHHA 1KP3A 3WSTA 5JEEA 5BYAA 3LCUA 1KKMA 1QG4A 3UKJA 4UFOA 2W98A 3AUAA 3HBNA 1HE4A 1X1DA 3AUXA 3WTBA 3KE9A 4MPRA 4RHTA 4MYHA 3DHYA 3LNCA 1OPXA 2BKVA 4JYMA 4L3OA 4JBYA 4TSRA 4ZT6A 2G6BA 2F4NA 1B6SA 2BFCA 3UAXA 1RC1A 5FUBA 2NLOA 2XADA 2IHZA 5M5BA 1CS4C 2V4UA 2OP0A 1M10A 3UV7A 1WY7A 2WWHA 3O31A 3OMXA 1KYYA 4KQXA 2JGEA 3WMFA 2V59A 3P2JA 4NCJA 4CL8A 3GT0A 1CEQA 2BFWA 3E9YA 1HNWB 4DA0A 4MUGA 1KOGA 4IPTA 2I4OA 4C7OA 3WGQA 2WUDA 1GPDG 3EFEA 4GOND 3VSBA 1F0YA 2GCEA 2WMNB 4B9AA 1N6HA 1CTQA 4LJSA 4QGAA 1BCSB 5LZ5A 3BH6A 4Y1EA 3ABOB 4RK1A 1JQJC 1I33A 1KOJA 2B4TO 3K6SB 3N0TA 2EZ4A 3BFXA 2GCGA 4DUYB 3A9UA 3PKIA 4OMDA 4KGDA 4NS1A 5AK4A 4BMOB 3A4YA 1F8FA 1R0SA 4K28A 4ZDJA 1UINA 1J49A 4KC0A 5A7GA 1YZGA 5P21A 2BM9A 2ZWIA 4NZOA 2FHSA 3DDCA 2A9JA 3N86A 5BY2A 1IB6A 4TTQA 4D4GA 5BN4B 1TYBE 1U9ZA 1VXOA 3FAZA 3CKYA 4ZFNA 1H22A 2GK7A 5DYTA 3LHKA 4JBXA 3NHZA 3DLBA 2H9AA 1RXYA 3VI3B 1S96A 3G8BA 2AJCA 4FZJA 5CIWA 3SYNA 3VU8A 1SVUA 2X9VA 3HABA 3OFSA 4WH0A 3W5BA 4EDHA 1PL8A 2PX5A 4CKBB 5BT9A 3ERCA 1ELOA 1AURA 2YIJA 2FP3A 4QDTA 5LLTA 1RW4A 2P67A 4GD3Q 3TSCA 5ITZA 5E9JA 5E2BA 5AHRA 3ZW8A 3CSUA 1G38A 2XLCA 5LBTA 4LZWA 4FFWA 1JLHA 3M6IA 3DMNA 1JXMA 2GF9A 3P2YA 4ZO6A 1BW9B 1O8BA 2BCEA 3A14A 1JT2A 2DSNA 2OFXA 4F46A 1QH1B 3U7EB 2VP3A 4MRAA 2E4AA 5DX1A 3ES9A 5KZMB 4N18A 1H2AS 1QH8B 1YAHA 4QFBA 1ZD2P 3WGLA 3FPJA 4QPPA 5TC4A 1NVEA 4GEGA 1ISMA 5ELXA 5DHFA 2R11A 3K0HA 1U1FA 3PRHA 3PHIA 4L7VA 3WLAA 5BSGA 1SBZA 3M4XA 2PM8A 3B36A 2BEJA 5AVXA 2DQ4A 3OZSA 2YASA 1DXYA 3LY8A 4OU4A 4FD2A 3FHLA 2VBGA 3OO1A 4BO9A 5ALSA 5EYPA 4TTPA 4DIDA 1N75A 4PAGA 1W6RA 4CMHA 1V6CA 2WHPA 3LQRA 1TI7A 1RWPA 2VJNA 3AY7A 3NTXA 3OT1A 3PICA 4X7BA 3S81A 3FNBA 1SCAA 2X6TA 2GZRA 2NUPB 1EWKA 4QRDA 5EP3A 2PTGA 3PPXA 4YLGA 3MWEA 1K7FB 4KWTA 3T54A 2EFHB 1U4NA 2YFYA 3GJ5A 3WNQA 1OV4A 3ELWA 3BSFA 3UAVA 2WG1A 1KFEB 3F8SA 7REQB 4I6EA 5FP0A 4CMJA 2Q8QA 1U80A 1OZHA 2CUNA 5JI3E 3ZEIA 1A76A 4DNFA 5AW9A 3TSWA 2VXBA 4DQKA 1DVRA 3ZE9A 4TV9B 1E1RD 2WKQA 1Y8CA 1CD5A 3L07A 3NHRA 3JAMA 4B2IA 2I80A 1FQOA 1J21A 1KI1A 2VDUE 3UJBA 1AMOA 4FT4A 4HDMA 1Z5OA 4BRZA 1H8ED 3B3GA 2LKCA 1Y8RB 2WRZA 1PCXA 1OLUA 2QORA 1KIMA 1V5IA 1LLDA 2GD1O 4GI5A 4BBPA 3O7MA 4JXKA 1UMCA 4WOBA 4CF5A 4CMAA 1KJ8A 1NF8A 1THTA 4D8VA 1E2HA 4WBNA 2VSXA 2IGTA 3I1YA 3DLAA 1JJAA 3ZG6A 1FUKA 1ZN2A 1FUYB 2W2LA 2ZSAA 1Z12A 4I4IA 4CTOA 3UZUA 2XWJI 1UAYA 2LP4Y 3HJCA 1JUDA 3ZJVA 1EP3B 2H59A 3LHSA 2OG2A 4Q21A 3A3OA 1BMQA 4QPZA 1KO7A 3WL6A 4O3MA 1CUXA 1ZGJA 3BKXA 4LF8B 5J4HA 3V1MA 3C43A 4HSEA 4BBAA 4TQUS 4KH1A 1ST3A 1TYEB 4INJA 2X4GA 4OKIA 1SCKA 1WXEA 1VGVA 4LC0A 5CYOA 1D1TA 3A1UA 2P2CA 3AFOA 1GGNA 3LT0A 4LJ5A 1RKUA 1JQ5A 4YDQA 5C52B 3AP3A 1CERA 5BQFA 3GA7A 3FWYA 4BGIA 1XVLA 3A26A 3AHGA 3E81A 1CP2A 1ZICA 3E8XA 3IVGA 4P3NA 2EKZA 4RDCA 2HRBA 3C7CB 3DZGA 1QMGA 3GW8A 1ZX1A 4F5YA 2CXRA 3EG5A 3RFXA 4F06A 4CG0A 4KFCA 2NPIA 4FK8A 1CULC 2GYVA 2ZWVA 4HDKA 1B0ZA 4Q16A 4YP9A 3LCCA 4NBUA 1I7DA 1VMDA 3NOQA 2JGKA 4EGJA 1ETHA 1ZGAA 8OHMA 3OHPA 4ZQHA 5DN9A 3ZD7A 1Z2NX 3NDRA 4HEQA 3OM0A 4KCGA 4PFSA 1CDZA 3WK8A 4BAGA 4BKMA 4O4IA 2UUPA 2VBIA 2UUBB 1QQTA 1XG5A 4QGFA 2A58A 3UK7A 4ZEXA 4OGGA 4RSRA 3H1EA 1SCIA 4C0KA 1E2GA 1VHTA 4UVHA 1QTQA 2UZ1A 3QNUA 4IFBA 1GYRA 4Z7QB 3CRVA 5HM8A 4KQEA 1U2RA 5EFOA 5FUWA 4PCLA 2A9FA 3LL7A 1KZ6A 4HQFA 2GBGA 5KWEA 2ZBFA 1RQLA 1S02A 2LD4A 1WXWA 2KLHA 3S8EA 2WMYA 4BNFA 3VNSA 3HYCA 2AMJA 2F1OA 2XT6A 3DKIA 4J1NA 4MINA 4CZ2A 1H1LA 2G76A 3ASVA 2X86A 3H13A 2GK3A 1CUIA 3N0RA 3KPJA 4WGGA 5AYVA 4ROTA 4MUKA 2TECE 4M76B 4J4TA 4CT5A 4TSKA 1P9RA 5A9SA 4RVSA 1NT2A 1P2UA 3SMQA 1XJ0A 1WF3A 3Q2IA 1H6CA 1UZAA 1X7YB 2QK4A 3TZCA 5AM5A 5CB6A 5BN1A 1DBSA 1G8AA 2B2NA 3C3YA 1I10A 4OBEA 4LGYA 3RO7A 3AFGA 5AI9A 3EXIA 1P91A 4NU8X 4UCWA 3HN2A 5KVVA 1QOPB 1ISGA 2OORC 3GEDA 1SN7A 2CGEA 2G9QA 1CY2A 2V8OA 4OOEA 3ZDFA 1RXCA 3JZIA 5J59A 3HKEA 4BBZA 2O23A 5KYNA 1W0JD 4ARVA 4XD2A 3WYAA 2L18A 3NHMA 3OCXA 1UMDA 1AGYA 9ABPA 1II8A 1LK0A 1FTYA 1IVYA 1ZY2A 2HDNB 3KKPA 1TPYA 1GN9A 4NBRA 3EDMA 5IFLA 1VJTA 2BBWA 4FBGA 2PL3A 3VZBA 1RAEA 1RC0A 3N2IA 1EB8A 1FTNA 4OXRA 1JFSA 1YZFA 5E95A 4DR7B 1T2AA 3G8AA 5BR7A 3FW1A 1NLMA 1XDDA 1OC2A 4GSYA 3G5UA 1PR4A 3U80A 4Z4EA 3ZVKA 4A36A 4MRNA 3MMZA 2VNHA 4YMWA 1NBMD 5FLYA 1OLOA 3EGOA 2NVOA 3L77A 4ARZB 1RU3A 4FR0A 2W6ID 3MW8A 2WJZB 3D3QA 2B69A 1O0BA 1O95D 4OA5A 5DIZA 4JCOA 2FR8A 2GBLC 2RC5A 4FX5A 4MKIA 1E79D 3ZVRA 1JE0A 4NBTA 4UFNA 1M6VB 2DRIA 5JECA 2CSXA 3MWLA 3D3NA 1U2DC 4JOBA 2MSDB 1UM9A 3RRMA 2I6TA 1JSZA 2P6PA 3OE5A 4C3OB 1K98A 5JT1A 1OU0A 4JMLA 2W2PA 2VDVE 3X1YA 5ILGA 3RAJA 4NLLA 3DDOA 2XDAA 1DMRA 1JMKC 1IDN1 3A10A 4JC5A 2XMSA 2XQIA 4RACA 2W58A 4HS9A 4H7HA 1X7ZA 2JFFA 3UTCA 2H5JA 3MGCA 4XTCS 1Z16A 3PQDA 2QAGB 5KYVA 3RKUA 3CBGA 3U26A 5E3HA 2VLIA 1JFFA 3E1GA 3SNHA 1BYIA 5AICA 4EL5A 5KWIA 3WNZA 1Q3HA 2JH9A 3QF4B 4MEAA 2Z09A 1ILWA 2J7KA 3G2QA 3LBHA 3MGKA 3OKPA 1DWUA 3TW6A 4IDHA 4B33A 3K9WA 4UVGA 4CLXA 3GJ8A 1SHUX 1DQPA 2NUTB 3HCDA 3O2JA 3OZCA 3QYJA 4J6FA 5AM0A 1P9NA 1ZG3A 3ZLVA 5JDCC 3FLBA 1RABA 3C1TA 2J45A 5TQVA 4L0QA 2OHIA 1NNLA 3O8OB 3EEBA 3CBQA 4TVBA 4XFKA 3TQQA 4FN4A 2HB6A 1JQLB 2VJMB 2G1UA 3GBSA 1P29A 1G8JA 1YS7A 3N58A 2ZTUA 3QGMA 5LMCA 1Z74A 1GPUA 2QTCA 4EECA 3G1TA 1AUPA 1UPTA 3SYKA 4BE9A 1KBZA 5TS2A 3GJRA 2D2VA 5D7NA 3OIGA 2A92A 2DKNA 2OLKA 2WK1A 4L8FA 3UMYA 1IY9A 2FRDC 5AVOA 2HJWA 1NIPA 1Y9DA 2D5AA 4WLEA 1A9XB 4X9XA 3OE7D 1XMPA 2BLNA 3C6ZA 4P36A 3F6YA 4PXYA 4H08A 1YRQA 2DHCA 2M6SA 1IWOA 3M0EA 3GFOA 5EZYA 3PTLA 3GA0A 3DV9A 1M74A 1LI4A 5BMOA 2ZUFA 3R9XA 4LZNA 4NZMA 3KSUA 2FG7C 2PO7A 5JTTA 5A4JA 1PQWA 1U7XA 2K6GA 2C5SA 4EF4A 2ZT7A 3GIDA 5JY1A 2G5GX 4HI0E 1MEOA 2QN3A 5SY4A 5COAA 2PGXA 1NYQA 2WZCA 4BGVA 2CLHB 2O1SA 2XUDA 2XIQA 3G88A 3K8YA 4MAMA 3HV2A 1D8TA 2XJ9A 4NZYA 4UVEA 3T4EA 1E2FA 4ZAZA 4ZAWA 1CR4A 1SXQA 5EHQA 1H69A 5WRFA 2RB4A 3RRXA 3TDNA 3TEJA 3W04A 2ENUA 2Y9MB 1GUYA 1Q6ZA 1VLQA 2JJMA 1P33A 3H0EA 2VDNB 1I7PA 1L4NA 1TYCA 3HCNA 1EM8B 3MXOA 4JL5A 3IJ5A 2E49A 5FTNA 4D97A 3FPBA 1X0XA 1KYQA 1CUYA 2ZT6A 2LGJA 3GPDG 2AR9A 3R3YA 4G5OA 3MM4A 1U0GA 3IODA 5JAQA 1BQEA 3ZX5A 3P4UA 3K15A 1WDWB 3DTNA 2GLTA 1ZUIA 4YWJA 1SULA 4WKPA 5LQAA 4EYGA 4M1EA 3R5JA 1BXZA 2IXFA 4WNAA 3TNLA 3TN7A 2YNMA 2HSWA 3VJRA 1R4NA 1P1IA 3A3YA 3AILA 3HWRA 4Y6OA 3K96A 1SU4A 4CBVA 1K89A 2PWYA 4PW0A 3EN0A 5CDUA 2RK3A 2WWYA 1CLEA 2GVNA 4N48A 5DHQA 5EZYF 3X1KA 3U1VA 3L0OA 3OEEA 4BEBA 2Z9CA 3R0QA 5TQ2A 4JUCA 2IXGA 2O54A 2YIVX 5CUQA 1HSOA 3KQLA 4GM0A 4K46A 4JXJA 3K6JA 2R7NA 4LSWA 3TSYA 4JP3A 4QG7A 3LUJA 3QE4A 4R83A 3BXGA 1CUGA 2AT1A 3KUXA 1BNCA 3RSOA 1K1EA 2AI2A 5NLLA 1AU9A 1VSVA 1DOZA 1EYZA 1M34B 1A2OA 4CR7A 4CEHA 1XZFA 2DAPA 3WLSA 3P0JA 1E1DA 1YA4A 4U1RA 1NY6A 3UCFA 1OROA 3O4RA 2HHHB 1GPBA 5GJWC 1Y6GA 3AEUA 1WVMA 1GT6A 1XKXA 4NH0A 4QFCA 5DU2A 1JHDA 1SIOA 1SBTA 1VTKA 2BMJA 3QOYA 4HPJB 3SEQA 1NMXA 1EE9A 1GG2A 1LLFA 2JASA 3K92A 4ZGGA 4F6RA 2ZXFA 3NHJA 4MYDA 5E4FA 3VPXA 4TYQA 3MQ4A 4WZAE 4YTEA 4ENVA 1J2UA 2W2MA 2XNSA 1E2JA 3MMPA 3ILVA 4MTLA 1RI3A 4TUYA 3MB8A 1T9KA 1ZH8A 3AZPA 4IXDA 1TZMA 3S2YA 2C20A 2HHLA 1LD3A 4XDHA 4ZHQA 5LM3A 2GHTA 5ALTA 1CV2A 1E18A 1Q20A 1QZXA 1MV8A 1TX4B 3GELA 3IALA 3KE8A 5I9LA 3KQOA 3NT4A 2A7QA 4NESA 5BMVB 2VRCA 2ODPA 1DC7A 3UG6A 5EIBC 4CIDA 3NPAA 3W4KA 5CG1A 1XPRA 1J9EA 1SG6A 4BL5A 1E5XA 3KUDA 2HMAA 3MLAA 3M5CA 2IY7A 4IMPA 4QXOA 4GPD1 5K01A 4CGYA 4YJ2F 4CLRA 2NADA 2QIOA 2EKQA 2YVLA 2G7MC 2QQFA 3W9UA 3RFFA 2R8ZA 1OI2A 4X8HA 3LKDA 2CNWA 1YBHA 1Q3TA 1UDRA 1YTLA 6GPBA 5LIPA 5I5GA 4QBIA 3OKCA 3STXA 3OO0A 4IZOA 2XNJA 4PLGA 2PUCA 2J8ZA 4QRIA 3CX4A 1Z7BA 4YONB 2O06A 4W9NA 1P3DA 4FJ2A 4LXXA 1I3LA 1QAOA 4KYIB 2AE1A 3T7JA 5JQWA 1HMYA 4Z2YA 4E08A 1P7VA 2P5YA 1KQGA 3VQTA 1PFYA 4JVSB 5ALGA 1O94A 4B6FA 4DQDA 4RD0A 1TIPA 1PNQA 2ANCA 2J5RA 1EX9A 2YN4A 5DEOA 3MCVA 3ETCA 4A9AA 1Y9JA 2GZHA 4G9BA 5FAKA 4FJ1A 1IZ8A 5FPSA 3IKVA 4MQEB 1DX6A 3FDJA 3FFBA 3A2KA 3NX4A 2H18A 4D5EA 2WU3A 4IEIA 4MNTA 3OM8A 4A5OA 3GRUA 1KDTA 4V0OA 5AHWA 1WKCA 3VRHA 1C1DA 2AG8A 4ZHQF 4ROSA 3IE0A 2COKA 2CLOB 3DWFA 4JLVA 4C5AA 4DRZA 1H2XA 4U63A 2IYZA 5I8PA 1IJBA 1VE6A 1XQXA 1IBSA 1AKRA 1P72A 1J8QA 4MQLA 4O2BF 3VC7A 2OV6A 1ZPDA 5LQKA 1WR8A 3N07A 3HNRA 3HVRA 4PSAA 2HNAA 2XD9A 2X1MA 3CJRA 2Z2ZA 4FSDA 2K2QB 4XUDA 2PS1A 3LTEA 1K63A 1B42A 3O1JC 2FPGB 4JSTA 3TMKA 2PU7A 5C8YA 1H4VB 2OD2A 1MDFA 2HPZA 2EWMA 1G0NA 4FYJA 1KH3A 4DA6A 2VF5X 1N9ZA 2JPDA 2RMKA 1PV1A 2J0UB 4JVLA 1RLTA 1VKHA 3P26A 5AVZA 4OHXA 2EJWA 4FHCA 2GDJA 1QGOA 4V0KA 4DQXA 4D9KA 1O0SA 5M04A 1A4IA 3FVRA 1H2WA 2ICAA 3C3JA 4J1TA 1D6MA 4A4DA 4AJKA 1XYYA 2HGSA 1P0CA 1GSAA 3OEHA 2Q0XA 4LQLA 3RG2A 1VCMA 4TXMA 4R05A 4IX9A 4NAHA 1EINA 3ZV5A 1C5KA 4EGQA 5BSFA 1PL0A 2Z5LA 3BK1A 4ER3A 4O0LA 1EBBA 1NP3A 1S4MA 1C4KA 1KDVA 1YZHA 1KAHA 2FETA 5JY6A 5C4IA 2YHBA 2FQWA 2VRWA 5JBIA 4BWYA 1QOQB 5LZ2A 1IRIA 3PJFA 3MOIA 2OOKA 4Q19A 3EDCA 2E3JA 4R9RA 4TQGA 5IZ4A 2B2XA 3L8MA 1X0VA 1Q14A 1ENYA 1Z4LA 1FLAA 1ORHA 1DAPA 3MLEA 1HO3A 3FYTA 3A6EA 4I1OA 3TIIA 3P4XA 4YUYA 1JYSA 1SFRA 3TQHA 1EWVA 3K9LA 3IAS1 2DE0X 4UEKA 1F4PA 1WXDA 2XUAA 2WIFA 1GKUB 5IJ0A 3EAGA 3N6VA 1DUSA 4CFZA 1RWKA 3FFWA 4XIYA 4YJGB 5DBHX 1TUBB 1ADGA 4E5NA 2EF1A 1USIA 3G7NA 9LDTA 2FOIA 2WFMA 4NMLA 4BWFB 2PXAA 4M21A 2MCFA 2QVZX 4K6KA 4BX2A 1A9YA 5A6SB 4EPTA 4RKEA 5EQTA 1MV5A 1Z4JA 4CEHB 4EHKA 5DGHA 3SJBA 1XVIA 4ZTBA 1LX6A 4US0R 2DCUA 3ZNOA 1B2RA 1YCGA 2X5NA 3D3EA 2BFEB 3OECA 4FGKA 1ZI6A 2AV6A 4CIVA 5GZ1A 1TF2A 4HAIA 3QVMA 4W5NA 1MT3A 2YJZA 3NEPX 3AUUA 2AOUA 2NXCA 2NZUG 2V7WA 2CDCA 4LY3A 2C9OA 2IW3A 4NZ9A 5BN5B 4X6LA 4UDXX 2P2SA 2QP9X 4IFIA 2IRWA 2AE2A 2WIAA 2XZTA 3H83A 3CNBA 4XTRA 1U5BA 2G1JA 1HDOA 4U4AA 4MWDA 4TVKA 3C3PA 3ZDXB 3BJIC 5IMBA 2FVYA 1VJ5A 3JYOA 3HKCB 3KR0A 4GOKA 5DE3A 3TCNA 5IM4A 1HC7A 1QUEA 3EQ7A 3KEGA 4AW9A 1TZCA 2HCBA 3L1JA 4C14A 5JALA 1DV2A 1XZDA 1B8OA 3GRFA 5AKXA 1ONPA 3F6SA 3EF0A 4BBJA 2NP7A 3ZZNA 3OLZA 3AEZA 4LE1A 4PGHA 2OESA 5A71A 2FPIB 4OATA 4L5YA 1B7GO 3CZPA 1Z4MA 3PE4A 2H1HA 2D1SA 1LNQA 3R20A 3RYHB 3PV0A 1R64A 3OLCX 3EB9A 4K0RA 5FI5A 3RS7A 5AW4A 5LN1A 1U2GA 2R5FA 1DBPA 2IZ0A 1FW6A 1P9WA 3LYAA 1JJBA 1R4AA 4AJOA 1ZM9A 1RI1A 1C80A 1E3IA 4ZT7A 5I9BA 1T6YA 4GP6A 4Y2VA 1U9YA 5CCEA 4NDZA 2Y76A 1J9ZA 3EVZA 1HBJA 3ZPXA 3EK2A 2J9FA 4U7HA 4YP0A 3T94A 5SZJA 5IUNC 4JLAA 3FXAA 3GG2A 2CNBA 3OZXA 3ZKWA 4POAA 4OM7A 3VYVA 5B7NA 3CLTD 3RKRA 4F8EA 1E7WA 4NDNE 2RGUA 3QUSA 4EX6A 2V7GA 5TIIA 3VV3A 3GVXA 1I3NA 5AUQA 4YAEA 1WB9A 4P83A 3A1NA 3JVEA 4ZI7B 4R1SA 2B8TA 4RY8A 4HEA6 4CI9A 2WAXA 1BEEA 1C29B 5KYWA 2HHJA 5AI5A 4AXXA 3LO8A 1IEXA 2PWPA 5HM6A 3BMCA 4E4TA 3T35A 1JX6A 1Z0IA 2OV1A 4BN0A 3T4PA 1EMDA 2GCOA 5COQA 1K4MA 2OBYA 2V1XA 2Y1WA 4TTVA 5C7LO 4OX9B 3FR7A 5IM4F 3H5NA 2PXCA 4QQKA 2ZIWB 5G53C 5HFAA 1XRPA 2V5UA 3ANMA 3TRDA 1IEQA 2BRUA 3HKBB 2AS0A 3L1HA 4G4SO 4G0OA 4LVCA 3TNDA 1Y4SA 3NATA 3RYFB 4LNAA 5A0VA 4GRIA 5FNZA 1R12A 1ZL0A 3FB1A 3C3DA 2RKWA 3DAPA 3DDHA 3HDHA 4RIEA 5EP1A 5C1BA 1UKZA 3ZVNA 1CY0A 3AVPA 3G13A 3N74A 5B6IA 1Z73A 2CL5A 5KTRA 3D6FA 3H1AA 5CH3A 3URMA 3WFIA 1MHPA 1ZUNA 1ODSA 2JH3A 2YV4A 2XCLA 2ZJ6A 1O8CA 4QQ8A 2PRIA 3ESDA 4CMEC 3UPTA 2XF2A 1QZZA 3DWEX 5FAXA 1NY5A 1UBCA 4FD3A 4C04A 4HNAA 4JSRA 2O5VA 3W5AA 2FLWA 4DTCA 2CLMB 4ETWA 1YZVA 3GR6A 1KZ9A 4HBGA 4F45A 1QWOA 5L3SB 4B6SA 1N78A 1HYEA 3RJ5A 4BFZA 5CM8B 3QX8A 3VMFA 1XRRA 1E62A 5BYBA 4QE3A 3ZDYB 5FEUA 1XPUA 4B6PA 3TQOA 1TAGA 3M81A 1X9IA 3GX1A 1T9GS 1IDOA 3U5ZB 1TA9A 1V7ZA 4NPCA 1Y48E 2Y0PA 3LT1A 4X8OA 5CTAA 5DCYA 4UAVA 1SXJE 3IBCA 1D4FA 2DJIA 3OT5A 4KO8A 4E1AA 3KOZA 1CFZA 1QDLB 1C8VB 3HZHA 2OP1A 3HCOA 1P6UA 3BX1A 4B73A 2O8FA 1E1QD 1AG9A 4MVYA 4L5AA 2RGEA 1BD3A 2BEKA 4GXNA 3UTDA 2MSCB 1AKUA 1F9AA 1TPZA 2EKPA 1V95A 1FTGA 1PG0A 2VCEA 2ZYRA 3DQPA 4JJKA 4CN8A 1TW3A 1Z36A 3N0XA 3RYIA 4MB2A 2ZSDA 1TRHA 3NWOA 5YASA 1GDHA 2H17A 4D4JA 5IANA 3O47A 3FNRA 2GM3A 2OGTA 4KKXB 1CW2B 2JLRA 5DW0A 4B0PA 5GOZA 4JT2A 5K8IA 5FB3A 2WTAA 2RBKA 3N7AA 1JR3D 2VWHA 1F0KA 1OXKB 1XQ9A 3VR4H 5JYBA 1OZFA 1SKQA 3U81A 5BVGB 2G1KA 3LIPA 1QTIA 1AB6A 2EJUA 1FFBA 2I03A 3D4BA 4ENTA 2JAPA 1KEPA 5E2IA 4I0WB 1XTJA 3S28A 1X7XB 4NQRA 3IT0A 1Y7LA 3OVMA 3N5KA 4X54A 2ZTSA 3S40A 5GY7A 5L7TA 3CVUA 2NTJA 3WRXC 3QVGA 4YAOA 2FMIA 3AV3A 5I9NA 2WT9A 1E66A 1ADJA 4G2TA 4P9NA 4RVHA 2IF2A 3B6ZA 4YRLA 3ZGYA 3X0DA 1YC2A 1CQPA 1DELA 1K4KA 1SCUA 3DL0A 3FNGA 4RV4A 4WOJA 2Q4EA 4A2WA 4M86A 2RHGB 4EG6A 5FUQA 1SKMA 1FMTA 1X80B 3WQRA 2X5JO 4ZTZB 2PT5A 1V39A 3C2QA 2IY8A 1QX4A 1VI2A 1VDZA 1I3CA 2FEOA 2P3QA 2WUWE 2WTBA 3ADOA 3E2MA 2Q9UA 1T5IA 5HZGA 5FLKA 1Y1RA 4M89A 5EWLA 2AKAB 2H48A 3MGGA 4RMJA 3NU1A 3CEJA 2PVSA 1SC9A 1BEUB 1U3FA 2E4WA 2QRVA 3K8ZA 4WPGA 3GCXA 1W4LA 2GEBA 2R8PA 4GOMD 4MUMA 2EGUA 2Z8XA 3K1ZA 3CVXA 2VXYA 1DRKA 1TCUA 5K4HA 1OFUX 1HYBA 1SUWA 3FJ1A 1GL6A 3CUTA 1RBZA 3L0BA 4ZI7F 2RHJA 1ZJWA 4UNPA 1LJUA 3B1XA 3QUCA 3OLQA 5DISB 2Y1XA 1I4WA 3OE4A 1TO1E 1N2EA 3VDNB 2BZSA 3UMBA 1RZVA 2EDCA 4ZZ3A 4R8SA 4HLUC 5FI0B 3S6JA 1X1CA 5SYMA 1P2GA 4HLQB 3UMMA 3NASA 4CGZA 3N2KB 1UOPA 4Q03A 1YRAA 4ZA2A 3D3WB 1UDWA 4XM2A 4W8HA 5DNYB 3B6IA 4MZDA 2ZJ1A 4HGRA 1ISPA 2MIIA 3VU9B 2FW9A 1E1CA 3KZCA 1OFVA 4S35A 4DQLA 2W8BB 2HV9A 4Q1VA 5DYWA 3N53A 1JE1A 4LRUA 1B73A 5H0IA 4D8WA 1L8AA 1M7BA 1ESDA 4PFKA 4GO1A 3ED5A 1H42A 3NQ41 5IJXA 1DDGA 4JI5B 4R2HA 1ZD8A 2GK6A 3L1KA 5ALLA 4PAWA 4DLRA 4EG0A 1HG1A 1P4HA 1ZRHA 2D5BA 4FVTA 3JWGA 3CRZA 2ZRNA 3R9WA 1GGKA 1E60A 1G20E 1YQUA 2GTHA 1P19A 2D00A 2Y71A 3D81A 2RAUA 4OCZA 3CUUA 4N40A 4I9HA 4GGOA 5IXYA 2IDMA 3ZWBA 1F2UA 4EPVA 3LVQE 1PK9A 3S2IA 1WV0A 3R0VA 3D54D 4MEJA 4M7PA 1TUGA 2BKAA 5DNUA 2IW1A 3ZE1B 1KOFA 3QVKA 3AYZB 4PTLA 3HP4A 2Y67A 4RFSA 1KOLA 3MIZA 4KR7A 1JKMA 1C0PA 1A5AB 4PYQA 4P2GA 3L0PA 2CCKA 5TR9A 1A3CA 2GAFA 4ZU1X 4NSNA 4EFDA 2RD2A 1UT6A 4R8KA 3S5JA 4AY6A 4J0GA 3SEFA 2CNOA 1D5CA 1NJGA 2SCUB 2XCQA 1X1TA 5M3BA 4ZU6X 2PU5A 2GD2A 3MCUA 4I99A 4E5YA 4EJSA 4FSHA 1HE8B 2CW5A 4IJWA 2Q3HA 5EJGA 1G64A 1I2AA 1LDNA 3GG9A 5ILQA 2AOWA 1QP7A 1F2TB 5ERXA 4R9VA 5DX8A 2CDRA 3L6RA 4R7ZA 4RYDA 1A4UA 1FRVA 4E2WA 5B57C 4XWKA 5JQGB 3AF4A 3HHEA 2QTMA 3F7MA 5FNVA 1NW4A 4PPFA 3IAM6 4FQ7A 4RVDA 5BV8A 3CF4A 3P2EA 3DNFA 2UV8A 4BO6A 5DSXA 3NW9A 3LKBA 4D74A 4HWTA 4LBWA 1T35A 1US8B 3T3EA 1J8DA 2FJPA 4MQ4A 1CZRA 3F96A 1ISHA 2INGX 5DMXA 2KPOA 1LKZA 4R1OA 5CM2Z 1H9CA 4DC9A 3NOOA 2IIQA 2IUTA 4QJ5A 5IABA 1Z6YA 3GJ0A 4HQ6A 3FVWA 4BKUA 4P82A 4E12A 4R2KA 4G5SA 5AJVB 3WXMA 4CIYA 2BTQA 3LU1A 2IOHA 4ZOEA 4NECA 2WTXA 4HDRB 1OWOA 1TKBA 2AN1A 2AGVA 2ZB2A 5ERGB 4WCFA 1YVEI 1THZA 3EF1A 4HFRA 2GM9A 3ICPA 3S7TA 3ZKAA 1WOYA 5JC1A 4GX5A 1EJ2A 3KXLA 1WY5A 3VJLA 1EDBA 2FSVC 3ZY4A 3TQTA 3LI2A 2E4VA 2I34A 2VDPB 3DMDA 2RGXA 1TE2A 3MPUA 3N05A 1POWA 2UVQA 3OETA 4QXQA 2BEUB 3WE7A 4DTIA 2A6PA 4QXRA 2QW8A 2VAXA 2YR0A 3CF2A 2CZCA 1XD2B 3EDYA 3ORQA 4QUEA 4HRAA 4I4LA 4LXGA 1JR2A 2JIRA 3B1VA 3LRPA 4QATA 4D56A 1ORWA 4CKCB 3BEDA 3IOYA 5BURA 1MHTA 3QFSA 4RNDB 4BP8A 2DPMA 4LQCA 3T8YA 3R9KA 4LUCA 1LF0A 1XDBA 4HAXA 3TB6A 2CHFA 4D9IA 1QONA 1W0CA 3HDTA 3GLHE 4TLEA 3T7RA 3TXYA 3ZDQA 1VECA 1T4CB 3EVBA 3ZGLA 2JLZA 2J0VA 4QEZA 3O3NB 4IV0A 1Q21A 4DIUA 3HNOA 4DZTA 3PNMA 1RP7A 2AFVA 1SXHA 3BHJA 2M6LA 3ZLUA 2V9ZA 3EJWA 3ICVA 3BWVA 3GB9A 4BKQA 2FZ5A 4G0MA 4MR8B 1V7QA 4C6SA 3BDIA 4BVLA 2P0AA 3F8WA 1RXIA 2ODNA 4A6EA 6REQB 2O3QA 4BCCA 1RFGE 1YONA 2ATXA 1QYVA 4KVFA 4JR0A 3PVZA 4MITA 5F3RA 4D3DA 4E2FA 4C01A 3F6EX 2GM4A 5JAIA 2JL1A 1D2EA 3DDZX 1OW3B 3C8UA 2QS9A 3UUGA 3ZV4A 1ZCBA 4A8JB 1LRLA 3F4KA 3M7IA 4IF4A 3LPDA 1L7MA 1JVSA 1AZTA 4UHJA 1G59A 5K8UA 3JTEA 2FWAA 3SZGA 3CIOA 5FBHA 1JDTA 4EJ6A 2D59A 1CHDA 3GRAA 3KTAB 2WD7A 3GNTA 1Y1LA 3RC2A 2P2ZA 5BN3B 3DNPA 3INGA 1T4MA 1TCCA 1DCKA 3WK7A 3EFOA 1QNLA 4NYMR 4TKLA 3BFKA 5EEHA 4A2PA 1NF9A 5A03A 1ZSYA 3LSTA 1IY8A 4GXTA 3KS9A 3O3MB 5EHGA 5G4KB 3FBGA 3S2EA 4BV2A 1KWKA 3A9VA 1W48A 3PHBE 3THWB 1VL2A 2ZK7A 1P4RA 1KY5A 1E8DA 2Y1EA 1C1HA 3IVAA 2HSGA 4FDMA 3TVTA 5L8VA 3VC2A 4XD7D 3WLOA 1EVEA 1I9GA 2HIAA 3DF7A 3H4IA 4YRDA 3T1QA 5GZ3A 4GMGA 1VJ1A 3IPYA 4ZQEA 4FLEA 1QM5A 4DCTA 3HU5A 1K7SN 2VHQA 4IJ6A 5AJXA 2BISA 4A1FA 1RM4A 3PXDA 4IGKA 1PW5A 2BI7A 2GFQA 3PI6A 5HKBA 3J81k 4L8YA 3Q0EA 3FCEA 1PD1A 2RHOA 1M2OB 1T2EA 1ZXBA 2C7VA 2XB9A 4YAUA 4XGQA 3HJTA 2GXUA 1N32B 1R0RE 3WLQA 4JI4B 2WYUA 3IP9A 4I14A 1S5PA 4RWZA 1S6YA 3WDKA 4UE2A 4Q15A 2FCAA 5FWXA 5HUQA 1JHXA 4IDQA 1GSOA 3PNOA 4N39A 4EI7A 1HOTA 4IS2A 5HSGA 3RROA 2AEEA 2IDJA 4F4FA 4RQUA 3SQLA 4IIYA 4YPFA 5AK0A 5IM5A 5JTUA 5IRCD 4M0UA 4EL0A 721PA 4F85A 3H5VA 5JS1A 2IQIA 5DWDA 4YMUA 5EJFA 3QF7A 3COWA 1UBMS 2PFSA 5CHYA 3TZBA 3FPHA 3FTEA 3QUAA 3LAWA 4UNNA 1SUAA 1Z17A 3FRHA 3ZGNA 3DEFA 421PA 2GAAA 4AL4A 1XPJA 3F7NA 1X6VA 1VGQA 1PDVA 4HNUA 3NHLA 1IXRC 3Q9NA 5E6UB 1U9IA 4J9UE 1DX9A 4IJMA 3UMFA 4PIVA 4LTNA 2IEZA 1KRXA 3JQ8A 4OYRA 3IUQA 4R98A 2UYCA 3L4KA 1GQYA 1URPA 1KI9A 3F6RA 3GARA 1T36B 3IP6A 5C5EA 4G37A 2DKOA 1Z88A 2XYQA 5AVKA 1R0ZA 4WKCA 4BP9A 3ETEA 2MDTA 3Q6IA 5CFLA 3H2JA 3SK0A 1U0LA 4AZTA 2HJRA 3DUFA 2WTUA 4RENA 1ZLYA 1QHYA 3D0QA 3PR3A 3LW8A 1VI6A 2HWWA 4JU8A 5DM60 1RLUA 1ZVMA 2G8LA 1OASA 4E7PA 4TLCA 1KO1A 1VYTA 4TKZA 2ZBDA 1KXJA 1WG8A 3D6UA 1Y37A 2YC2C 3WGUA 5TEVA 2J67A 3Q1LA 2AUNA 2KBFA 3WYCA 2ZIZA 1Z18A 5JZOA 3CGGA 4EUHA 2BJHA 2J4DA 3KYDB 1ZD5A 2ODTX 2EXXA 3OTOB 4X95A 3SVZA 2Y0BA 2C5HA 2XZDA 1SB8A 2YJNA 3ZN2A 4BJHB 3I62A 3VJMA 1UJ6A 1ZRSA 5J63A 5TQ0B 4WNIA 2DTEA 5ALKA 5IYZF 5FEMA 3LT4A 3IT2A 2HDWA 4JVOA 1AHPA 1N9KA 1P1BA 2NIPA 1H65A 1T8TA 2I62A 2WJYA 4DMKA 4UREA 2Y6VA 3T7IA 1KO4A 2PZAA 2OKGA 3KOOA 4Q37A 3RTDA 5KUTA 1OT5A 2EX4A 1OLXA 1NFRA 3QX3A 5KYUB 4KJZA 2PZJA 2WWRA 3BUSA 1N7HA 2W2NA 3C8ZA 3GFVA 1ZSNA 3R3JA 4UKDA 3PEUA 1CQXA 3I45A 1P2DA 4QLBA 4GPTA 1XLVA 5ALZA 3O38A 1TTHA 5A04A 4JZKA 2CDNA 2UDPA 1T6BY 2F6RA 1X1RA 4KJXA 2FWJA 2CDAA 1RWNA 2WIDA 3IKLA 4CKWB 3ZLBA 5K3BA 3X1XA 3B1ZA 2FUG1 5CD9A 3C5HA 1LDBA 3IOBA 3GEIA 4A10A 4ZHSA 3AJEA 2JB9A 1DKMA 1NC3A 4OHUA 4ETNA 5MHTA 1C0IA 2OCLA 1LS6A 1YDEA 5DN6A 5GIPE 3JV7A 4Y0NA 1AQNA 1AXGA 1RBYA 1Z6GA 4DLSA 2UYQA 4C07A 1N6NA 1MJNA 4TTIA 3QVUA 4M37A 4LF6B 4K6HA 1MP0A 2MR6A 3JAWB 3FUCA 5EVCA 2OAGA 5LD2C 1QIHA 1XJQA 1CCWA 3AFHA 4F1KA 1XJ5A 3LC0A 2XCTB 4YT2A 2R8YA 5K0ZA 1E4YA 1FSGA 2Z3ZA 1PYDA 3HBFA 4ALIA 2O2CA 1E6CA 4IOLA 3T34A 1P44A 4W7SA 4CM9D 2PX4A 3M6FA 4W1PA 4N7MA 4IQ4A 3PXGA 1R50A 3SE0A 2ZE8A 2B25A 2V0CA 2HCRA 4QGGA 5EJ2A 2FX3A 5KTSA 1N2XA 1TYDE 5HJ2A 2WSSA 5KJ1A 1WKBA 3HC7A 5C0OE 4EJ0A 3T7DA 2YYYA 5K4GA 2JRCA 3T12A 2PJDA 5LXTA 2EG9A 5DV9A 2IV2X 5DNDA 4GBJA 3ZU2A 1S3IA 4RQTA 1L8OA 3NUQA 2G36A 3TVYA 3UMJA 4CL0A 4GI7A 2OBLA 2ODWA 1RR6A 4X93A 3U44B 4GR4A 5U9CA 2LPMA 3DKRA 5K0TA 4RA6B 2UXBB 2V0GA 5FV4A 3M70A 4AZ3B 3HVIA 4HT3B 4UM8B 4TL8A 5FFFA 2D4AA 2PRKA 3LX6A 1M6YA 3PC7A 3NALA 4F4IA 2YQ5A 4R0NA 2QNBA 3WYBA 4Q4LA 1X7WA 2PMFA 2RHDA 3N59A 1UAAA 2Q5QA 3R2JA 5G41A 1TKAA 1U2SA 4CLOB 2AKEA 1EFUA 1GPNA 4TLDA 1M8KA 2JRLA 2W4IA 3BTSA 2QU7A 2C2XA 1QHSA 2C7RA 2SNIE 221PA 1Y5LA 4W5TA 1PS0A 3H1PA 2AK2A 2PSDA 1GM5A 4EB8A 3I0NA 2QTRA 3AR5A 2ENWA 2DF8A 1CS0B 1E3LA 5J4KA 4IIBA 4Q7LA 4YRKA 2OBNA 1E5QA 1T4DA 3TTTA 2WVAA 3KEQA 2FZEA 3KR9A 3NNSA 1RQRA 1AMUA 1G8HA 1NBHA 3FGNA 3L93A 3SC6A 5LQUA 3DC2A 1ZESA 1GKIA 5LNK1 1ATZA 2JCYA 2A5GA 1JAHA 3COPA 3EMVA 4KQ9A 4MI1A 4UBIA 2VF2A 3L02A 1AXEA 1NVXQ 2R7MA 4QIHA 4F8JA 4YX9A 4LBYA 1OVGA 3AHEA 3WGVA 4OHWA 5CYPA 3HXLA 4Z9FA 3UW1A 3VV2A 2VJAA 1S2DA 1GILA 1JEAA 4P7GA 1JKXA 1XD9A 3HEMA 4QD3A 4DQVA 4HTFA 4XPZA 2XSZA 3JQ9A 3V4OA 1SQ5A 1XIVA 1FEZA 2XWBF 2VS1A 3O93A 2W6JA 3GWZA 4HFNA 5A1JA 3C3AA 4P4NA 2UUAB 3OZAA 1GADO 3G2NA 1KQPA 1V8PA 4ARBA 5LP1A 2FW8A 3G89A 4YHHB 3OPYB 3R8FA 3RVQA 5FOQA 1EAMA 4W5QA 5TNXA 2IZZA 4RL6A 4XW2A 1MABA 1OFUA 4XWWA 2G5PA 3A6KA 4ZMRA 4Q3BA 2KS6A 4TTRA 3U3JA 4RTLA 4BV9A 1Q7RA 2QN1A 3QXGA 4PPNA 2RBEA 4JT4A 4MLDA 3ROFA 2WJWA 4J94A 4KXUA 2AZ4A 3SGLA 1SUIA 2BGWA 5KBYA 4N6GA 3JZMA 1TVCA 4UHEA 4DILA 4HAVA 4IP0A 1MB9A 3TZ6A 2BAGA 2DECA 2RK4A 4D0SA 1J5EB 3DZJA 4J76A 1GGHA 2ZR0A 1Y6QA 4R01A 5KDLA 3T7EA 5BWNA 3U6KA 4W6QA 3OWOA 4LHYA 1Z15A 4YGXB 5HE8A 3FUXA 4J1QA 1TCVA 1WP4A 3KJEA 4H7FA 4AF8A 3U4QB 2FDCA 1KVQA 2JAHA 4XZ3A 3T61A 3VDQA 3ZBQA 4CI0B 4DCUA 2ZDGA 4DB2A 3E3NA 2Q1SA 2B20A 1SB9A 3AKDA 3HUEA 4AG3A 1U3WA 3OZ7A 4G4GA 4ZVRA 1AT1A 2D06A 3EFBA 3JVIA 3RASA 3WMGA 1E98A 1FRQA 2EWWA 2HIHA 5LQNA 4AS1A 1FP4B 2P69A 3T9DA 1XEXB 1IZZA 3BMNB 5HEKA 1Y63A 3EGVA 3H0KA 4HSGA 2ON6A 5AKEA 3D9QX 1W0KD 1F5NA 4AZ0A 2IP1A 4Q4AB 4HUQA 4LY0A 4U00A 1NI4B 2I2FA 3I2GA 1R3DA 1WTAA 2E5LB 3LT5A 4CT4B 1ZA1A 3H84A 3K4QA 3A1DA 5HIIA 1NW7A 2GBFA 1BHSA 3CNQS 4UPVA 8GPBA 2FE1A 3HO1A 1PNVA 2D7DA 1PQUA 4QYTA 3FFXA 1QK4A 3BCHA 1NQXA 5F76A 2VBCA 3RUEA 5REQA 3VBEA 2QL9A 3S29A 1PN3A 2XB8A 3GDWA 4QOSA 3PD0A 2WUVA 1JMVA 3IUSA 3PRJA 1M54A 1GPMA 2WNSA 16PKA 2H4HA 2VZ0A 2XRMA 5D7BA 3SBOA 3E82A 3VR1A 1HWYA 4TWAA 3SAJA 1ZEMA 4NYIQ 1QORA 1M1UA 2VYND 4FGJA 3KXDA 4II2A 4N8EA 1TQ8A 3AFMA 1OGIA 1PR1A 4V0QA 2FR8C 3KFVA 3N1UA 4UJ5A 3RIXA 4BZXA 5F3WB 1QUFA 2PTHA 4KVAA 3UB2A 5C37A 1CSEE 4RK7A 1D9ZA 5EIAA 4E22A 4OLBA 2W11A 1OI7A 2TS1A 1T9ZA 3FGOA 2JARA 2VNKA 3PQ6A 4ISBA 1N6IA 1QK3A 4IWYA 1EUCB 4KQ1A 3TQSA 1JT9A 3BL6A 1CEYA 3ER8A 1RAIA 1AV6A 1L0BA 3P0RA 5F23A 2BT4A 2ZROA 4RHXA 3WIEA 1XMJA 3AY0A 5DWQA 2A3NA 5LKAA 4C4PA 1RP1A 1SKBA 4H59A 4CM7A 1XCLA 1GWNA 2EHJA 3HZRA 1L9KA 1X1BA 4DRYA 4G5XA 4Q1DA 1Z8DA 1H2FA 1FUIA 1W85A 1ZMBA 3ZHSA 1V37A 4XEHA 3O74A 4WMLA 1L7EA 3D59A 3DCNA 4GX0A 3ITEA 1K8ZB 2JGMA 1CQJA 4LI3X 4IKEA 1TJYA 1ESNA 1K5GA 1WXGA 1KAMA 1HTBA 2UZ3A 1VL6A 1UFQA 1G0OA 3HFJA 1S1CA 3NANA 1DZ3A 1L8XA 3QBVA 4IDEA 3WB2A 4BO1A 4DSTA 3C5WP 3MWJA 2PT6A 4UBOA 2F2TA 1RRGA 4MTCA 5T64A 3SS9X 3HGTA 3AF5A 2BD0A 3N8HA 1BWPA 2ZTLA 3TTWA 2I3DA 2FGJA 3WY9A 1UBUS 2W6NA 1DBWA 4FTWA 1ESEA 3GEBA 6Q21A 4QXMA 3AVYA 3KB8A 2BUCA 3EIUA 4LGCA 1JG3A 4IGIA 2PT9A 2MINB 2VQDA 1XRSB 4G8JA 4KNVA 5CX1A 1L3IA 3RLFA 1KXZA 2C4KA 3LQYA 1DAKA 3ASZA 3G0OA 3STWA 1B4DA 1WW3A 3CJTA 4I9UA 1YRLA 3JY6A 1D2RA 1OYWA 4BX8A 5GMOA 2XF8A 3ON5A 5CBPB 1J42A 1S4QA 3VKFA 5GOTA 5B1YA 3AQIA 1V1JA 3A3KA 3QKTA 2K2WA 4KQHA 2YVUA 3VHXA 1R8JA 1IXKA 4URUR 1Y9ZA 3HB7A 1Z5NA 3A27A 2ZATA 4BFUA 4UNRA 4UAJA 3UF0A 4FYIA 2A0WA 4TTTS 2PLRA 3U3DA 1U9CA 1FUEA 3UKOA 2JG3A 2DFTA 4BFXA 3RTAA 2EDAA 4EI8A 2WILA 3LXRA 4NCKA 1I36A 3NJRA 5L6LB 3D31A 1VOTA 3B89A 5G0TA 1DCMA 3PUWA 1B8PA 2WJIA 1YB2A 1O5OA 2GTPA 1GKLA 3PITA 4IVQA 2A8YA 4OB8A 1E3MA 2H1CA 1M2GA 2PIDA 1CRZA 1AM4D 4S1NA 1VJDA 3HS3A 3I2FA 1DC6A 2VNAA 2JHGA 2ZAGA 1X1SA 3BXOA 1SIUA 2B21A 2H57A 4LJKA 2VAVA 4ND5A 4Q7KA 4XR9A 3TBHA 1BCSA 4HV4A 3OF3A 4AUMA 4E03A 3FSEA 4AUEA 1N1DA 3OJEA 3C41J 3WYDA 2P2LA 1H3NA 1XTSA 2MT9A 2V7QD 3O4GA 5EWMA 3TD9A 3K6SA 1Y4DE 1CVLA 4A8HA 1OWNA 1QFXA 4FU0A 4EBBA 5JAHA 3P9IA 3K2BA 4F2GA 2D13A 3DMRA 2BP7A 4H77A 1RRPA 2ZB3A 1V7PC 2Q5OA 3AI7A 1UOOA 3ND9A 2I65A 3O5AA 4MO2A 4AYXA 2CHEA 1EX7A 3QENA 1D2AA 3QA9A 5ECWA 5T57A 2HJHA 2QD4A 1TIBA 2OZPA 4M8SA 1KYTA 4EH1A 1XA3A 1VJCA 3D8HA 2VHXA 4ESOA 2BMFA 2OSVA 3C48A 1CJMA 1GZ4A 3I83A 1N5IA 3OMWA 5CT4A 5DBGA 5AM2A 3UA4A 2C4NA 2F62A 1PT9A 4Q9KA 3PNQA 3NHBA 4KOEC 4OHBA 1G3QA 2D2XA 2CN1A 4TRJA 4WA8A 3DBRB 1XEWY 3QLJA 4DEXA 4UU0A 3A2NA 5DM2A 2P9CA 4C0HA 4ZZ0A 3ZBPA 1N36B 3FHTA 4RZ2A 1JA1A 3OKFA 3OQ6A 3ZDBA 3F3SA 1ZNXA 2VNSA 4JUIA 4PLFA 4J2TA 3UHOA 5A5DA 2G04A 3EA4A 1BW9A 3FM9A 3H2YA 3ONVA 3NWBA 5AW2A 1QH1A 4Z0TA 2ZZMA 2ZR9A 4N3GA 1YR9A 3EQZA 1Q74A 1XCBA 4LF4B 1EVIA 2QRUA 4PU0A 3MJHA 3WBBA 5HXAA 3HJBA 4YROA 1MX5A 3QELB 1RKVA 4NHEA 2AJTA 3KRTA 1H8HA 2VWPA 4JLSA 2CJWB 4YMIA 3D4OA 5FRDA 1DWPA 2AG1A 2BGIA 2PH7A 5HOQA 4ZVOA 2ZUEA 4O59O 4P08A 3ZQJA 7MDHA 3ZD9A 3UFXA 4NXNB 4Z9YA 5JANA 4KDRA 1G1MA 2PEZA 3V6LA 4FE7A 4HEHA 2CY0A 4WK4B 3ZE2B 4EITA 3KT3A 1J25A 4DCOA 4G0PA 1LPSA 1DMSA 1N5RA 3AESA 2QQGA 3M9WA 2IL1A 3OQJA 1P3Y1 5DHAA 3TX2A 3VR3A 4RU1A 3E0XA 3UUWA 3CKMA 4M6WB 3S2UA 3BVPA 2AMYA 2WU8A 5DTIA 4ZRMA 4Y7CA 4KQ6A 4XVHA 2QR2A 4EGSA 2NUPA 3EPPA 5KJEA 4UC0A 4JXXA 1Y6RA 1L7DA 4CMKA 3IAFA 1V1RB 5C1PA 1E64A 1HL3A 1CUEA 3AKEA 1SVMA 1Q0UA 2WAAA 2ZQYA 1VSBA 3L0DA 4FGLA 3KUKA 1C3VA 3MJFA 4IICA 5AI0A 3TRJA 1E0SA 3JQ6A 4OHFA 5LA6B 3K6KA 2WWWA 4UDYX 4ZCQA 4GLLA 1WOMA 1ZYUA 2RKOA 3AFIA 1FIUA 4OFXA 1TEXA 2CSUA 1VL5A 2QG4A 2DH6A 4LIPD 5HMMA 3RSGA 1UBEA 4HKTA 1CY6A 1Z38A 4IDAA 4TV9A 4BY9E 5JJIA 4DR3B 4L3WA 1S3SA 5BR1A 5K8JB 1YJBA 4LXUA 1TAQA 2V6JA 1CUZA 1YWGO 1E6LA 1G5QA 2HSZA 3LXUX 1VLVA 3JQDA 3O4VA 4HQNA 2HSJA 2P6UA 3SLRA 1MFZA 4XJSA 1DU4A 1P4SA 5K2MA 1KYWA 4R1TA 5DXFA 2JJ8A 3H4VA 3DW3X 1XVAA 3D5QA 2A35A 3I32A 4EB0A 2O2GA 5EMNA 1P2SA 1FE8A 4L1KA 3EYWA 3EODA 2LTAA 5GAJA 3SOZA 3AEYA 4NBVA 2QP3A 3OJCA 5F64A 2ONKA 1Y4UA 5H8WA 3RLIA 1ORVA 1SH7A 5AVJA 3WLTA 1GUZA 2JCVA 3F74A 2QU8A 4JI6B 3AG5A 3D8BA 5H9VA 4N3CA 2J0QA 2O3JA 4MYCA 2X0DA 1QGZA 1W581 2QUZA 2XE4A 3COVA 4EO4A 4D2IA 5HOEA 3DL2A 4DVJA 2PX3A 1V7CA 1E58A 2Q4RA 5GONF 3BS4A 3BSSA 4R7TA 4BFCA 1E2LA 3VR4A 1JG1A 1Z34A 3B53X 3WO0A 4RTPA 4DR6B 1U6JA 2FMKA 1QIEA 1R6VA 4JT9A 3R6GA 4E5PA 4HN2A 3ZXSA 2HZ7A 3A9WA 3RHZA 4DOMA 1OKKD 4LF5B 1JU9A 2XHEA 3EH2A 1UFOA 3I6BA 1U7UA 1Y3CE 1ZVKA 3LUAA 2A5LA 4KR9A 4KO4S 4H7EA 2A9VA 3QHQA 3FYUB 2XMRA 4MA5A 3SEAA 2IBSA 4J1TC 1MC8A 1SCNE 3ADBA 1GFIA 2H9YA 1JNXX 1DQYA 5H02A 1IPFA 2GZ1A 1KFCB 4BZWA 3MTQA 4Q66C 3NBUA 1IJKA 3CLRC 3D4IA 1TCAA 1IVSA 1Q77A 1TADA 1EHCA 4M9XA 1ZVJA 4I3FA 2H92A 4X60A 4IJ5A 2LIPA 4EG7A 4UBNA 2DT8A 4DWVA 3RARA 4JKYA 2XWPA 4F7WA 2GJ4A 5DCLA 4Q3KA 2FK7A 1RWXA 4ZICA 4J0IA 4OLJA 3W2IA 4GAEA 1KC1A 3RYCB 2Q6TA 5JD4A 1XELA 4J75A 1PR9A 3IVCA 4MKFA 2FHPA 4HDNB 4X1YB 1Z39A 2G08A 4Q0MA 5CITA 2AVDA 3KLBA 3UPDA 4YAGA 2QTFA 3D2BA 3I6MA 5HFNA 1SC6A 3FLEA 3MWFA 2IYLD 2MSLA 2WW8A 1XK7A 2O4UX 2UVDA 5FWYA 3IEMA 5ED4A 4PPQA 4BLTA 1VLJA 5LOVB 5LQDA 1R6XA 4XWTA 4NBLA 2LXNA 4KMRA 1Q6YA 2J30A 3BE6A 4G0NA 4X6YA 1JBKA 3GOHA 4S12A 4A27A 2XJ4A 4RWEA 3R7WB 1U94A 3TIFA 3GVCA 3GUZA 4B45A 2F8SA 3HQ4O 3NBQA 3WQSB 4H2DA 3WL8A 3BE4A 1XWIA 1M6EX 3EA5A 2H1WA 4G25A 4Y9RA 5KAMA 4EKDA 5DSZA 1NUHA 4UTRA 4ZO8A 4HNQA 3GL9A 2NG1A 2SKCA 2ZUCA 5EJ8A 1G6Q1 3ITNA 2NNLD 1RSZA 2BBSA 2PPVA 2QL7A 2XEXA 1S3GA 3B70A 3O21A 1R8QA 3QPAA 3T0GA 4HL6A 3AR3A 4JOCA 3LKVA 3V4ZA 1HSZA 2X2FA 1QU3A 2WHQA 4IDDA 4D0LB 3G5AA 5TDHA 1IY1A 5AOVA 3FPFA 4X3OA 1ID8A 1JFRA 4ZN6A 3UXMA 2J7PD 5M7EA 4NS4A 3FSRA 3UJDA 4JYBA 4UHHA 4OP1A 3WGYA 4AWAA 1XAJA 1G2IA 1TQDA 2BGMA 3SDBA 4C2BA 3GRKA 3AO0B 1CUAA 3HU2A 3VU3A 1KJIA 1FVXA 3HWX1 3Q3VA 5J2UA 1M6VA 2UXDB 5JNVA 4D45A 4DDVA 5KWSA 4N5IX 2H9IA 3C70A 1JSXA 1P2VA 3BFJA 3L9XA 3I9KA 4H7PA 3V8QA 5JNSA 3L04A 1S01A 4MS1B 4UXHA 4A0GA 3ZHVA 5FTMA 5FORA 4U6SA 1VCHA 3G02A 3FZYA 3MS7A 2HWYA 1DXOA 3O95A 1JDJA 2V8BA 5K51A 5CH5A 4DQ0A 4MAAA 1Z0FA 4A2CA 2R1VB 3H1GA 3RKSA 3G2JA 2BTOA 1MA3A 2VHJA 5C18A 5M2QA 5CVCA 1MZVA 5FA6A 2Q3JA 1SCJA 4G1BA 3WISA 2A1IA 5JS6A 1Y3AA 1NMZA 1TIKA 1TKRA 3NM4A 5D85A 3PNLA 5AJHA 2NV2B 1USGA 1I2DA 2YYZA 4P34A 3CPEA 5HJ7A 3QF4A 4RD3A 3TM5A 4BGUA 4TLAA 4FP9A 1B93A 4O4JB 3UJ6A 4A5SA 1PJTA 3PZRA 5LMUB 2NUTA 3CZCA 4I08A 1SBCA 4AK9A 1E4VA 1WSBA 2H2HA 4OGLA 3IOMA 2O20A 2Y4OA 3O8OA 4EW1A 1QO9A 3O2SB 3C15C 4YUVA 1TFUA 3JQBC 3D8NA 2PQ0A 3TUZC 1UBRS 2CBGA 4H7JA 4WZBB 3RAEC 1EUQA 3A25A 3N2NA 2AG5A 2BRUC 1RPAA 2J9YB 4J1SA 3TKLA 1VCIA 1PR2A 1NASA 1O96A 1CIPA 1P8AA 4L4XA 4P7JA 4DR5B 3AUYA 4Y1RA 3U17A 1Z5ZA 1RAHA 3REQA 1HTWA 5F52A 4FR5A 1BRTA 3I5XA 4KNYA 5HK8A 1UXKA 3T7CA 1FNMA 1Q11A 3OG9A 2HOQA 4TQ9A 4QUDA 1UBGA 1J0EA 2ZRFA 2ZUTA 3T1YB 1ZMXA 4HC4A 2ZJOA 3GT4A 3JZAA 1ZIPA 3EVDA 3RB8A 4LF7B 4MSUA 4PN3A 4L76A 5K0SA 5AKZA 1PWHA 1J8VA 2H07A 5HTOA 1SUPA 2X6QA 4LTMA 4Y30A 4WLFA 4G0QA 2IS4A 2IPOA 4HLDA 4NQZA 3KJXA 4QWMA 1E92A 2O2ZA 4L2IB 4BE4A 3H9QA 1M2VB 1VXRA 4LSGA 1EFPA 4G5HA 4XIFA 1GG9A 4A7PA 1W36D 2QW0X 4HEJA 5FUXA 1NJ1A 3X1DA 1R7RA 3C97A 4DCPA 3F9CA 4YYEA 2C5GA 4HZUB 4EHHA 3P9RA 1FFXB 1LVUA 3R77A 1YA8A 1UK8A 1DJLA 2D54A 1N0UA 3QVVA 2BJVA 5HIKA 2IS1A 3CNLA 3OIUA 4XM1A 3ZHUA 5CDGA 1TK2A 1WPRA 2EIHA 3L8EA 4E5VA 5LWHA 4TWIA 3LVFO 4JKOA 3AEKA 1MOSA 3ZV6A 4RFVA 3GPCA 5E1DA 4DCMA 1NFQA 1V4VA 2FDRA 4NMHA 3G85A 1KZGB 3FSJX 4B17A 3TKAA 1C0KA 3M34A 4NU6A 4FMDB 1U6IA 3FYHA 4U39A 4WY2A 2C7PA 1LBHA 1UH5A 4IY1A 4OH7A 4XFDA 5JVDB 1UBOS 1QQ6A 3M1LA 4I19A 3W6UA 3DBHB 2F1HA 4KBGA 5EQJB 2W2OA 2ZAIA 2VHCA 4HB3A 4I50B 1B26A 4TWZA 3ZCVA 2CMHA 3JRWA 2X8AA 4G9GA 2YTZA 4ERXA 9GPBA 2JIMA 1ZP6A 3LP8A 4R5HA 5IJAA 3VH2A 2WA2A 4TM7A 2ZU6A 4K86A 4B80A 3ZCUA 3JYNA 5F7JA 2XUKA 2P5UA 2VUHB 2DR2A 4QUHA 1I32A 2XUQA 4LYEA 1F06A 2RGYA 5GM2A 5CEJA 2PMDA 3ZWYA 2CCJA 2G88A 1P81A 1O6GA 1GHTA 2GX6A 3HNPA 4YRBA 2NTYC 1M34A 3D2AA 3RABA 4JYZA 5I3CA 3BF8A 3E35A 5CR9A 3AVQA 4ZC1A 3T5DA 4ZGBA 1DG3A 4BQEA 1MR3F 3D8TA 1PJBA 1QQ5A 2EKBA 2HFKA 2YIDA 5E3IA 5ELMA 3AVTA 1QRTA 2O5EA 3H4TA 3JQAA 1U9JA 2PSHA 2VYQA 4MDEA 3CA8A 4LRSB 4QFMA 4OI1A 4JOQA 5HPYB 4X45A 3V48A 1XV5A 1JSCA 2Y1DA 4PC2A 4GKKB 3VHRA 4BO0A 4NONA 1Z6TA 3N6XA 1A88A 4H27A 1NYLA 3H04A 3PB3A 3PHLA 4KSBA 1OXTA 2V7UA 4C4TA 3E5HA 4RDXA 2CYCA 1KGSA 4EG1A 2H0QA 1KP2A 5ECDA 3DZIA 3TVDA 2UAGA 4LCJA 5C34B 1J99A 3GGGA 3OCZA 4KO2S 1GNQA 4EAAA 2OUKA 3V34A 2JNWA 4IDFA 4EFNA 5BMVA 4QVIA 3B20A 1QB8A 1SBIA 3NTVA 3P96A 4JT8A 2A0FA 2JIOA 5DLEA 3INTA 3IVRA 4UW9A 1PT8A 1S2OA 2AFHB 2WSYB 3W8EA 3AL3A 2B5WA 3EQ6A 4V39A 1R1DA 2C5AA 2QGZA 2R8RA 2O48X 3GQBB 5D3KA 3VH4A 2WKRA 4Z8XA 5EJEA 1C7FA 3SC4A 1U81A 1CUHA 1BG6A 2ZBGA 1SU6A 5JD6A 4TSFD 4Z4CA 2IH5A 1XGKA 3GFRA 3GY0A 3GXBA 3WICA 5EJIA 4GSKA 4QQRA 1I5RA 3J7TA 4IIHA 2CMKA 4N12A 1JHPA 1UFKA 5I7EA 3OQPA 2CFTA 2OEPA 3ILYA 3QV1A 4X00A 4F1JA 5DYNA 1H66A 1UZNA 3FNQA 4QBHA 5TF4A 1JDNA 1GO2A 3TQFA 3W5SA 5CVTA 4KRFA 3BJZA 2OMEA 3RVDA 3R7SA 3HDJA 3U0VA 1AA9A 4XDZA 4YA6A 2ZYWX 4HVTA 4YRIA 5UKDA 1FMLA 3OZGA 2P9QA 1E1KA 4KLNA 1Y5NA 2XOEA 1P7WA 3B2QA 4UUQA 1JG2A 4NL4H 5J1TB 2GYUA 3ETLA 4IHAA 4BQRA 4F9FA 4OHRA 1VGRA 1X3SA 1GNVA 1XEFA 3F8TA 4EY3A 4JLKA 3RODA 2VPZA 1GGFA 2QWXA 2ZJ0A 4AO6A 2JZCA 2MJLA 1QP0A 1WMBA 3AONB 1HR0B 3MHTA 5U4QA 1MB2A 3O82A 2FY8A 3GO4A 4E21A 2V7TA 1NLZA 2ZRMA 1UQTA 1GFWA 2IOQA 1Y5MA 4US1R 2VYFA 1GGEA 3DEKA 2DERA 2BGNA 2VEOA 3E0QA 2YJ4A 4Y18A 1XAGA 2QVBA 3GLGB 1OX4B 4CXMA 4EJSC 4LSMA 2J0UA 2JAXA 4JC8A 4DNOA 3BGOS 3C6KA 1HMPA 3OQBA 2J48A 3T1OA 1T2UA 5HR5A 2OOSA 1YDWA 4FMDF 5JSFA 2VTBA 3MAJA 4KR3A 1FXWA 5JASA 1VMIA 5JVDF 2B7LA 2ZI4A 2MSKA 2ID7A 3H5IA 1ZJ4A 1EWYA 4HGOA 4C06A 4JSYA 4ZCTA 4LDRA 4RZ3A 3EW9A 2GR9A 5KTMA 1EI9A 1JEJA 3GOQA 3RIMA 1LVGA 2YRFA 1I6LA 5IKOA 2AG0A 1H4SA 3O9MA 4MRVA 4AYTA 4BQQA 3NNNA 4IW3B 4PBRA 3D6JA 5LZ4A 1YB1A 2ZE7A 3OJFA 3RI3A 2CUTA 4K3UA 2VZEA 1EXDA 4XGIA 2EZ8A 1T1JA 2IZ7A 2VP4A 3DDUA 2NXNA 1SWVA 2AMVA 2ZBPA 2YFHA 4CMBA 2C07A 3VZDA 1Y6FA 1YNOA 1E5TA 2IBMA 2X1VA 2FUKA 3NFYA 2I71A 3DZHA 2Y68A 2BFFB 1I13A 2LIVA 2PX8A 5ADVA 4IHJB 4I46A 1NE2A 4FEEA 1JIKA 1PSWA 4I66A 4RPHA 4EI2A 4YR7A 4ZTUB 1Q50A 3HFRA 3SIPA 4Y0VA 2BZ0A 4CQMA 4IZIA 1RJEA 1TUBA 3K9BA 1CJBA 4MP6A 4HB4A 5GVSA 1WULS 2ODQA 3OD1A 4ZYYA 3G5TA 4IV5A 3NYQA 3Q8LA 3RFUA 3ZWKA 4BO7A 1Z82A 2GRJA 4B3GA 4UMVA 3DT6A 3H2SA 4I81A 3I9MA 1M2NA 1HEUA 1GDTA 2V03A 4JJAA 3E8SA 3H42B 5HUJA 1Z2PX 3AF2A 1ULBA 5FOWA 1R66A 5GQSA 3ROEA 1R9JA 1HT2E 1DX4A 1KU0A 2GA8A 4P32A 3ELDA 4D1YA 1BSVA 4KZKA 1NG9A 4ZCSA 3BWYA 5HCNA 3ANYB 2RH4A 3HWWA 3JZFA 5IBCA 1AZSC 2EATA 1KAEA 2NGRA 2QMYA 4JGBA 4WUTA 4LNUA 1LDEA 3QY9A 5G0UA 3UJ9A 1XL1A 3CSSA 3UCEA 2WJ4A 3NAGA 3AJ9A 1F17A 3FYDA 3HBLA 1PWZA 2VDQB 3R74A 3W8DA 3HKCA 3L7BA 1O0CA 3KQQA 4BQSA 3MJTA 4LBVA 5FUYA 1HDEA 4OBXA 4PYKA 1I2ZA 4I1VA 4AROA 5ICMA 4LRQA 1AQIA 5IAOA 1YOVB 3VPCA 3U3RA 2H16A 3AKCA 3LZCA 3WGMA 4AJJA 2Q6OA 4UTVA 3P2OA 4NENA 1YBVA 1A7KA 1Q2XA 5BQXA 3ZNQA 4FE4A 1SVIA 4E88A 3GNLA 3RU9A 3IS3A 5K45A 5AW6A 4JGIA 3RYHA 3DEJA 3KD3A 1NSTA 1WMAA 4K9RA 3RVJA 3WGOA 4BDTA 4R68A 4XQGA 1YC5A 1Q17A 5AJYA 3LUGA 2DPGA 2TMYA 3JQGA 4KDFA 4RETA 4Y9SA 4BAZA 2I6FA 2RHLA 5FUVA 4BB0A 3KX2A 3DWGA 2VQ6A 5E6SB 2WTNA 2FPXA 1WU8A 2CLDX 4K6FA 1O6ZA 4JQZA 1NKVA 1UKEA 4FHDA 5D3QA 1HTTA 1L1QA 5IDYA 3PGLA 4ITRC 3VDRA 4L22A 2O0KA 1EJ0A 1QR6A 2C29D 1E2MA 3OUUA 1FS5A 5KYTA 3SMVA 4FHZA 2PJUA 4D79A 3F5FA 2VDRB 2ZTHA 2X42A 4HWOA 4JH0A 3PFBA 4IG4A 1UBNA 2RI0A 1B8UA 1IN4A 4F1WA 4DYVA 3VR2A 1ZLXA 5B2FA 5AVRA 1L5HA 2R44A 2X23A 2QHXA 3FBTA 4HCJA 1UPBA 1CRLA 1Z7GA 3EGDA 3K9QO 3QEMB 4K9KA 3NWJA 1N5MA 4OXXA 1RAAA 1MW9X 2J3JA 2PZEA 2Q4DA 1M5UA 4J4HA 5AM1A 3TLAA 4KZPA 2HU5A 2HL6A 1P75A 2MYPA 3CX3A 1YO6A 1RHUA 3HKBA 2AJDA 2QRHA 3O73A 4B3XA 5E38A 3M2PA 3OC0A 3EMBA 2XUJA 4P1ZA 3OESA 5TPWB 1XDSA 4CYMA 1FSZA 1EFCA 1KJZA 1MJGA 1TK9A 3EBPA 4FMBB 4MR7B 1XFDA 1E2BA 3K2QA 3LA8A 1LQTA 5D6OA 1L1EA 1OH7A 5KNBH 2PWBA 1G5TA 2VH1A 4JFRA 2CXXA 4OH1A 2OHHA 4RS3A 1N8SA 1ZITA 4GU5A 5I01A 2DEUA 2O5CA 2VPPA 4FINA 3OEYA 2JGIA 5LR6A 1G9SA 1S9HA 2WHXA 5KSYA 1NL3A 2E0IA 2GKOA 2VLBA 3E23A 1P6XA 4MW2A 5DVZA 3SZ3A 2IIVA 3GFPA 4LC1A 3RWBA 5F5LA 1R3UA 1A5TA 5HRUA 2JBAB 2XT9A 5KNDD 1R5JA 4I4NA 2X2PA 1K6IA 5AXCA 4BX9A 1TZKA 5JC8A 1B16A 3MCZA 3MG9A 1GA1A 5CD1A 2E4ZA 2BBTA 5F5NA 3ZDRA 2UVPB 3T99A 4C0LA 3WLPA 4YRMA 1J07A 2JW5A 2NYUA 4XM0A 4LRXA 5BNZA 5JADA 5CCBA 1DO8A 2A0YA 3MT8A 5LZ9A 2ERYA 2B1JA 1X8XA 2W43A 3THOA 3K09A 1U9IC 2BC9A 3IXQA 3PWKA 2P77A 3Q7EA 4J0EA 1UP7A 1GEEA 1U8TA 2R6R1 4NHOA 2OG1A 4MRPA 3OTIA 3RUHA 5SY9A 4KMOA 4RIIA 1M2HA 3A1EA 1NI5A 1UT8A 2GERA 2WLSA 4AKEA 5EY5B 2BF7A 4QTZA 1IJEA 3CW9A 3I92A 3PF9A 4P81A 1CEXA 4QARA 5LWQA 4V24A 3ORRA 4AQYB 3B7GA 3K73O 2QJOA 5CB4A 5JYDA 2P68A 3MTJA 3WHIA 2V97A 3OOHA 4RTSA 2GVZC 2R1TB 2ZB4A 4FB5A 2A78A 1J39A 1KFJB 1GA4A 4XWYA 5ALWA 2Q21A 2A9KA 4RVGA 3WLEA 2HKIA 3UCXA 1FQKA 5B3AA 5BVGA 1BD4A 2AIRA 3LC7O 5DXJA 3CPJB 1K06A 2ID8A 1W88B 3N3BC 4HN9A 1QRUA 1MJGM 1ONNA 2PL9A 2VTEA 4MMZB 1X7XA 3M6LA 4W7HA 4PVCA 2C84A 1PIWA 1SQGA 1NVTA 1DUVG 2I2CA 3DAYA 4UUMA 2HLHA 1WW2A 5HGXA 4OLAA 3K1AA 3KQMA 3LG2A 1UPCA 3V8RA 3D4NA 2R84A 4HJXA 5KYXB 2WJHA 3NZEA 2I3ZA 1SIWA 4NBNA 3RTCA 4MYTA 2D6FA 5K6AA 4XVRA 2JANA 4X24A 1U8ZA 3UJCA 4PFQA 1R74A 2IPNA 1W2WB 4OOFA 4HAYA 1HQDA 2RAFA 5FT9A 3T0IA 2IT1A 4IMIB 3KJQA 2ASVA 2LCQA 2OQVA 2OL4A 4N5NA 3ASYA 1OC4A 3WV5A 1F48A 1P4JA 4OFBA 5LC1A 4B9EA 1COWD 4BLQA 4BQFA 2Q3FA 2X14A 4HWPA 4YJFA 1EE2A 2NV6A 3SJAA 3BORA 2SKEA 1XZJA 1IHXA 3KOWA 5LYJB 1X8KA 3WLMA 4UUOA 3HYTA 1LZLA 1NPTO 3OPQA 1VG8A 3R7LA 5CB4F 1JEQA 5BWLA 1D1SA 2YHAA 2BDUA 4IOJA 3KL2A 2QQ5A 3KTFA 4URWR 1RZ3A 5D3MB 5THKA 3U56A 3STVA 2KSQA 2O8VA 3QU7A 2JIZA 4Q3AA 3PNYA 4I5DA 4M46A 3T5CA 3WKEA 4TZ0A 1IXSB 2J9XB 1RVDA 1X94A 2J3KA 3RRJA 1M1YE 3B82A 3L6UA 1A97A 1SC4A 4RJKA 2FSSA 2OZEA 3WS7A 4XYEA 4I5EA 1ZZEA 4NJMB 3BMXA 2W6QA 3N2KA 4YJ3A 2XNCA 1KJWA 4L6AA 4KACA 1ZM7A 1IM2A 2X1LA 2HMTA 3MTEA 1CJUC 1Q1GA 4YCNA 2AQ8A 4IDGA 5JHHB 5AKYA 1ZU4A 2CEKA 2QD3A 3CF6R 3N28A 3EULA 4FUQA 2W8BA 1THMA 1FCJA 2OFOA 4PHFA 3UT5B 1RXSA 2NO6A 1QHGA 5CLHA 4ZOLF 2JATA 4YIKA 3SC2B 3TIGA 4B8WA 5J23A 1UFRA 3BRWD 1E1YA 1WCIB 2FEMA 3ZD8A 5LQRA 1JZSA 2GJ9A 3H3JA 2JAQA 5C80A 1EFLA 4TWJA 4H31A 3R5TA 2PGNA 1JHUA 5JPIA 4IXMA 2IEBA 1K5PA 3TLGB 3BTOA 4IBOA 3V2GA 5AUOB 4RTOA 4W9MC 3MJSA 3H3XA 5H16A 4HNHA 4K8OA 1RD4A 2C9ZA 3OQMA 1CK4A 4FI3F 3TG8A 2B7BA 5ALEA 1YKSA 2JDIA 3IAUA 3SSMA 3P4YA 4MUAA 4H1HA 1LLCA 2J5XA 3A1CA 1BQ4A 2Q3MA 3H6GA 4JVNA 3ZY6A 5BYJA 1XXHA 1JAIA 4RTRA 1YB7A 4L5CA 5C2JB 5H1YA 1YJAA 1PEDA 1YQQA 1JLLA 2YWHA 5GP1A 4GE3A 1SM4A 3G2HA 2VPTA 4Y9TA 1N1EA 5K3FB 3PF8A 1YE5A 4YJ3F 1XZBA 2FPOA 2B3DA 2SCUA 2A86A 1V2GA 1W25A 3HCFA 3PUZA 3ZZ1A 4BMNA 2HTEA 2G4VA 3EFHA 4MRRA 4CN9A 4D8TA 2DB3A 3PNPA 1T5OA 3KG2A 2YX1A 1D3AA 3O91A 4MP3A 4TMVA 5FO1A 4W5OA 4P4TA 5EIBD 2WYOA 4G0ZA 4C6TB 3A06A 4HD8A 2G70A 5AHKA 2GPJA 4TZKA 5B3JA 1X39A 1ZONA 5AJUA 5FKJA 5JQGA 3I52A 4JBGA 4ETMA 5E4YA 5DGTA 1CUDA 1CYEA 2F3QA 4F11A 1NDUA 1DJMA 3EBLA 1US8A 4BZQA 4LWQA 2Z4RA 4M54A 4M87A 1XT6A 1FLDA 3L9WA 2FP4A 1GPJA 4P53A 4V03A 1H2HA 2G0TA 3GP3A 5CW2A 3V2HA