1M83A

Crystal structure of tryptophanyl-trna synthetase complexed with atp in a closed, pre-transition state conformation
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
328
structure length
328
Chain Sequence
MKTIFSGIQPSGVITIGNYIGALRQFVELQHEYNCYFCIVDQHAITVWQDPHELRQNIRRLAALYLAVGIDPTQATLFIQSEVPAHAQAAWMLQCIVYIGELERMTQFKEKSAGKEAVSAGLLTYPPLMAADILLYNTDIVPVGEDQKQHIELTRDLAERFNKRYGELFTIPEARIPKVGARIMSLVDPTKKMSKSDPNPKAYITLLDDAKTIEKKIKSAVTDSEGTIRYDKEAKPGISNLLNIYSTLSGQSIEELERQYEGKGYGVFKADLAQVVIETLRPIQERYHHWMESEELDRVLDEGAEKANRVASEMVRKMEQAMGLGRRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Interconversion of ATP binding and conformational free energies by tryptophanyl-tRNA synthetase: structures of ATP bound to open and closed, pre-transition-state conformations.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Ligase
molecule keywords Tryptophan-tRNA ligase
total genus 124
structure length 328
sequence length 328
ec nomenclature ec 6.1.1.2: Tryptophan--tRNA ligase.
pdb deposition date 2002-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00579 tRNA-synt_1b tRNA synthetases class I (W and Y)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.240.10 Mainly Alpha Orthogonal Bundle Tyrosyl-Transfer RNA Synthetase Tyrosyl-Transfer RNA Synthetase 1m83A02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 1m83A01
1QQTA 4JXZA 3L93A 3I05A 5K0SA 2A1UA 1J1UA 1QRUA 4ARIA 4XFDA 2QUHA 1KAQA 4MW9A 4YBRA 1KAMA 4QREA 5J5AA 4CQNA 4DDHA 2CYCA 3MUEA 1O95C 1A8HA 1KH1A 3VGJA 1NI5A 1YUNA 3ILVA 3HFJA 3C8ZA 3FIUA 1U7XA 4MUIA 4G5FA 1T9GS 1KORA 4U7JA 2E18A 1OWNA 4MW1A 3IOEA 4YP5A 1K4MA 2EL7A 4J75A 4WNYA 1YIDA 3AG6A 1JHDA 3SP1A 2AZXA 1YI8A 3U1VA 1NP7A 4ZCQA 1WY5A 4BWVA 3RK1A 1OWLA 1IVSA 2VXOA 4MWDA 4NAUA 2AG6A 2QTNA 4R2MA 2H29A 3L92A 1DNPA 1N77A 1PG0A 2DERA 4J76A 2RD2A 1ULHA 1G8FA 3RBAA 4KKVA 4F3RA 2V0CA 3N2YA 2GKSA 1ZH6A 1O5TA 2TS1A 1S4MA 2X0KA 1EFPB 3LE8A 1QU2A 1KQOA 4I6JA 2QTMA 5J59A 4R2LA 2XRZA 2NSYA 3FY4A 4MUHA 1KP2A 2A4MA 3UY4A 2HGZA 1N2EA 3SEZA 3KT3A 3SYTA 3GUZA 1OWOA 5LLTA 4EF6A 3RK0A 1EXDA 1KQNA 1M8JA 4Q93A 5BNZA 4MW4A 2A1UB 1QRSA 2VTBB 3N9IA 4MW7A 3IMCA 1U7DA 4YP6A 1NUQA 4ZT4A 3CR8A 2Z08A 4NX2A 4G6ZA 4ZT2A 4ZCTA 2IP1A 1JIJA 2H2AA 4MUNA 4U8HA 1QU3A 1FFYA 1OWMA 3CLSD 4ZT6A 3NBKA 2JANA 1N2HA 1O94C 1D2RA 3FG9A 4MUJA 2CV1A 2D5BA 2DLCX 3E27A 4HJRA 2QTRA 3QTTA 1XNGA 1EJ2A 1RQGA 3IODA 3IOBA 1JMVA 4AQ7A 2CFOA 1TEZA 2YXNA 2R5WA 1N2IA 3AIIA 3IVCA 3ZXSA 1MRZA 2A7XA 3DO8A 3AG5A 3P0IA 2O5RA 1JECA 3PNYA 1F7VA 1EFVB 4QRDA 4U63A 4OJMX 3CLSC 3TQIA 3JXEA 4EG1A 4MUFA 1JEEA 3CVVA 1NURA 4PBTA 1QJCA 3VRHA 5J58A 1MAUA 3FETA 3IOCA 3NV7A 1UFVA 1WZ2A 4MW6A 3CLTD 2J07A 3IDFA 1JGTA 1T6XA 4NDAA 2OV4A 1Y42X 4MULA 5H7XA 4MVXA 4MQ6A 1PFUA 5IJXA 1LW7A 1NZJA 1ZJWA 2PFSA 1KP3A 2DETA 1O97C 2EJCA 1V47A 1CT9A 1I6LA 3DLAA 3PNBA 4ARCA 1MAWA 1XNHA 5DEOA 1KH2A 4YP7A 5FO0A 2Z09A 3AL0C 1V8FA 2G36A 1WXEA 3CVYA 1EFPA 3HV0A 5KCMA 3KT6A 4ZCPA 1O6BA 4HK4A 1YUMA 2OQ2A 1H1TA 5TS2A 1MBZA 3PNVA 4E1AA 3KFLA 1VBKA 1XNJA 2WQ7A 3A2KA 3H9BA 1TQ8A 1WQ4A 3BL5A 3H05A 4GRIA 3CA8A 1M1ZA 3MXTA 1ZH0A 3N8HA 2E0IA 4UZFA 1G8HA 1ZUNA 3UOWA 1IRXA 5TEVA 2O8VA 1O95D 1X6VA 1EFVA 1N2OA 1OD6A 2D54A 3ZJTA 3TZLA 1N75A 5EKDA 2J08A 4JXXA 1P7PA 3GLVA 1QNFA 1N2JA 2GOYA 4EG8A 1EUYA 1JZQA 3G5AA 1NUTA 3DV2A 3A05A 4H3SA 1WXHA 4L2IB 2D13A 4QBTA 1F7UA 2JA2A 4PBRA 4RPIA 3LCJA 3ZXIA 4EG6A 2YWBA 1EUQA 4ZCSA 1U3CA 5HG0A 3P0HA 4MW2A 1YIAA 4NZPA 2ZUFA 2PZAA 1GPMA 1NSYA 5FNZA 3COVA 1Q15A 3TQOA 3FOCA 2NZ2A 3DPIA 1R6TA 5JBNA 4EGAA 1O96A 1PFVA 4HPWA 3HGMA 3SZ3A 1GLNA 3COYA 4JZYA 2DUMA 4JYZA 2A84A 2E89A 1YULA 2CUZA 3ELBA 1B6TA 3AFHA 1J20A 1LI5A 2QJFA 4XFJA 5TGTA 3ZGZA 3X1JA 1F9AA 3H97A 3CLUC 3FNRA 4MWEA 1ILEA 3SEQA 1X8XA 1TYAE 3CLUD 1MC1A 4KR6A 3MLBA 4MVWA 1G8GA 2CYAA 4MW5A 1O97D 3G59A 4PBSA 1NYLA 2A86A 3MMXA 4GU5A 3Q10A 2VTBA 4NATA 1VL2A 1N1DA 3CLRD 4G5YA 2QJOA 3D6VA 3ND7A 5IHXA 4EG5A 4MUEA 1PFWA 1K4KA 1K97A 3CLTC 4DDMA 1U0BB 3X1KA 2CV2A 2GM3A 4X0EA 3RJZA 4MVCA 1Q19A 1NUSA 1M83A 1WXIA 3RHSA 3IH5A 1JZSA 3PXUA 1R6XA 1Q77A 4JFAA 1VLHA 2C5SA 1MOPA 4Q16A 3OTWA 4I6EA 3H9CA 3D6UA 3TNJA 2J09A 4EG7A 2X3FA 2PXHA 1I6KA 3TZEA 2PZBA 1N2BA 3KT0A 4DE5A 1M8KA 4UZEA 1Q11A 2WSIA 2PZ8A 4CDNA 2CT8A 1QTQA 3A04A 2ZP1A 1IH8A 3TS1A 1FYDA 4WSOA 2PG3A 1WXGA 3UK2A 1TYDE 1KR2A 5K0TA 1IHOA 1KQPA 1K92A 5HUHA 1BS2A 2X1MA 1KKUA 2A1TR 3CLRC 1QRTA 3M5WA 1U3DA 4DLPA 5DK4A 1IQUA 4MWBA 3OP1A 1OBCA 5FO1A 1O94D 3HL4A 1WKBA 1GN8A 1O0CA 1OWPA 1GAXA 4EG4A 2IJGX 4EG3A 3ZJUA 2HZ7A 1NUUA 4DDKA 3CVUA 1T6ZA 3FHJA 3ISJA 5HUJA 2QUKA 2YWCA 1JIIA 2Z3VA 2IELA 1M8PA 2DR2A 4CT0A 3Q4GA 3CVXA 1H3FA 1WJGA 3IMEA 3NBAA 2JAXA 4A91A 1WOYA 2J4DA 2J5BA 4KPUA 4AS1A 1JILA 5H16A 3HZRA 1J21A 1MB2A 2B7LA 3F3MA 1H3EA 3IMGA 4ND6A 1J09A 3P0JA 1F4LA 4TS1A 5AHWA 2ZUEA 3N05A 4I6GA 2DEUA 3FH0A 1IQ0A 4MVYA 1KH3A 3IVXA 4PY2A 4MLPA 2QJTA 3VU8A 2A88A 2DPLA 1LI7A 1TFUA 2A1TS 4FZJA 2BYTA 2WQ6A 1SURA 1COZA 3QTBA 3ZIUA 2I1LA 4NAHA 3SZGA 2CV0A 1O96B 3G6KA 4XSVA 1WQ3A 2BTEA 2PIDA 2CYBA 1N78A 3GMIA 4R0NA 3FI0A 1WXFA 3SDBA 3IUEA 1HYBA 1XJQA 1I2DA 1VBNA 1PFYA 3COZA 4ZT3A 4ZT7A 1MB9A 2YY5A 1EE1A 3AKZA 1H3NA 2XRYA 3S3TA 5LM3A 4KR9A 1J70A 4K0RA 2QUJA 1JEDA 4RUKA 3K9WA 3FDXA 4MUGA 1JIKA 2QUIA 4S1OA 4OUDA 2E21A 3P52A 3IVGA 3UMVA 4EFKA 5LFAA 3X1MA 1GTSA 1TYBE 4MW0A 1IQRA 4ZT5A 1M8GA 4ZCRA 1O0BA 1GTRA 5KHAA 3Q12A 4CDMA 3QE4A 4K03A 1IFXA 3RFFA 1GZUA 3ND5A 2HMAA 5DB4A 4HJXA 1PG2A 3ZUGA 4DNXA 2X1LA 3ND6A 1N2GA 3MLAA 1T9GR 5KWVA 3INNA 1R6UA 4KR7A 3FWKA 4OUDB 4P2BA 4MWCA 3HMQA 1TYCA 2RE8A 3COWA 3LOQA 4ND7A 1MJHA 3K32A 1G59A 3ZJVA 2V0GA 4KPUB 4MUKA 1M8FA 3IUBA 1N3LA 4F4HA 1NUPA 4YMIA 1I6MA 3H99A 2DXIA 3UC5A 1T6YA 4DJAA 4MAFA 5DASA 5F23A 3KT8A 1VBMA 2AKEA 1J1ZA 3CVWA 2CSXA 3PRHA 5TEWA 3A4IA 2WB2A 1OBHA 4L2IA
chains in the Genus database with same CATH superfamily
2C8KA 3PQ6A 1V8DA 3U7QA 3UGQA 3FOAA 1XZ8A 2PKYX 3ESBA 3R0QA 5KDDA 1T8YA 3R44A 3TSCA 4TTJA 2P6RA 1NIJA 3R3ZA 1DC5A 3WQRA 2R79A 3DHNA 3JQCA 4RV4A 4FWIB 2BCEA 4MW9A 1CVRA 2ZJ8A 1D4FA 1COWD 2XI4A 5EE1A 2Q6KA 4DCSA 3LKBA 1VMDA 3VR3D 2VDWB 4QU8A 4BX9A 2AUMA 1CRQA 3ELDA 5E6UA 3IEMA 5FDFA 1RJEA 2QVGA 3MUEA 4D44A 2R48A 1QF6A 1P33A 5C35A 2WB4A 4QPDA 4EFLA 5BMVA 3WB1A 5EZQA 5EJ7A 5IJZA 5JH7A 1JXQA 4H3KB 4YNBA 3MJEA 3PUKA 2R6AA 3BFXA 4MW1A 2PQ2A 3DL2A 3EVNA 4PNPA 4DYHA 1KWKA 3MELA 2E1RA 3RU3A 4AF7A 2AV6A 1ZVVA 2X2EA 2G5CA 1RM5A 4R8LA 4WRRA 1PV2A 1Q17A 1LS6A 2ZWOA 1OXKB 4ETMA 2DWCA 4I1YA 1JEAA 5B5SA 2P69A 4N0QA 2FYTA 1AV6A 4PU0A 4J4HA 2YWEA 3P9KA 4P4LA 4PSUA 4DC9A 2CNDA 4NYIR 2FEWB 3FI9A 4KP7A 2IYEA 4LE1A 2R5FA 4CM9D 5JSZB 1DAMA 3U4CA 4C7JA 1W52X 2V45A 4C22A 1R0CA 2FOIA 4YUZA 4CVNA 4RL4A 4L9SA 4COOA 4LOAA 1KAOA 3AEQB 3DZCA 4X1KB 1JHQA 4MRMA 3LUBA 5DSXA 5SZJA 4WOBA 4AYWA 4BEWA 4GE0A 1Q14A 4QYMA 1FSPA 2O3RA 2YW2A 1DWOA 2CE7A 2GEBA 2GESA 2PYDA 2VHYA 2NSYA 2XUOA 3JQGB 1P3Y1 2C2ZA 4UMFA 5BV0A 2BIFA 3NIBA 1ZAYA 1T0HB 2M32A 2YZMA 1UP7A 3GPDG 2HZBA 3JQ9C 4TYYA 2C1XA 5BSUA 5BUSA 4FD2A 4K7JA 4EBBA 1IOZA 2HIMA 1PGOA 2EIXA 2VA9A 4DREA 4GX1A 3PIDA 1PFGA 3W06A 3KKEA 3ZDCA 2J9GA 5FBKA 1FQOA 4DANA 2GXUA 3DDCA 3ZS8A 4KXQA 2I1VB 3OHSX 721PA 1RRCA 3VR6D 2YWRA 1ZK2A 4ARZB 3TRIA 3GQBB 3IE1A 3L8ZA 4NESA 5AW6A 1TZ2A 1P9NA 4C9BA 1KBZA 5JAQA 2RHWA 4G5RA 2Q1SA 4MPTA 3KELA 5CAEB 2QSZA 3ICPA 3N8KA 5AM5A 3AINA 2FW9A 2DP4E 5ALIA 3JQAD 3T5MA 4ARUA 4A73A 1OBFO 3FG9A 3I0ZA 1JEOA 4K2AA 5LP6B 4HNVA 2NTEA 4Z9YA 5ERGB 4NAVA 2CXRA 3FKJA 1O6CA 3R9XB 3OCUA 1I3MA 2X22A 2IUEA 3KV1A 1O87A 4KGXA 4XQEA 3AUAA 4TXLA 2CCJA 3E9RA 3ZOZA 2Q1WA 4LK2A 5TQJA 4LC0A 2PNFA 2O8DB 1N9ZA 1ESEA 2AOWA 3TPZA 3UB2A 3UG7A 1CUSA 1ESCA 1A9XB 2ZBDA 4LRSB 5B1IA 1D6NA 5CDFA 4ZAYA 2QG6A 1HOXA 1QDUA 1MO3A 1UH5A 4P7JA 4RGYA 5JW6A 3IC5A 4H3HB 3O95A 3JZAA 1VLMA 3PHLA 3SFTA 3ME5A 2FAXA 3DE5X 3EOZA 4MWTA 3LMKA 3QPCA 5CLHA 3RSLA 1UKBA 4BFCA 5M7EA 1KSJA 3MM4A 5NLLA 4C3OB 2IPXA 5LD2C 2O7SA 3KSUA 4YQZA 5C53B 3BXZA 3N2LA 4FGLA 2BP7B 1KNQA 4BCBA 2Q2NA 4UBKA 5DHRA 4U7TB 4PBTA 2HA5A 1W49A 4YUXA 5DCUA 4LYAA 4ZPJA 5AOCA 2GN8A 3HJBA 4E09A 2YKGA 4GGPA 4R7TA 4OG2A 3UAYA 4DMHA 3F0TA 3OKCA 3W5VA 1CZKA 1KYYA 2ZRCA 2FSVC 2H59A 4S12A 4QOSA 1G8JA 5CIWA 1IYZA 1RWPA 4HQNA 5LYYA 1CUXA 4BO7A 2AXPA 3HCFA 3KO8A 3JWJA 5JFTA 1Z63A 4RCZA 2MIIA 4DLYA 4OHXA 4JWTA 4R2JA 3HDQA 1WW8A 4L08A 4PHTA 2HIHA 2DB3A 3E7DA 4FNMA 4IF4A 5FOQA 2O52A 2VYQA 3GUVA 3AILA 5HQ3B 2H9YA 2PA3A 3BJEA 5DCWA 3JZDA 3A1UA 2PMEA 3W0LB 3BGIA 4KIUA 2Y1KA 2WAAA 1K5HA 3R23A 5ESDA 5FBRB 4JYPA 1IY8A 2HUPA 4V3BA 2NVBA 1LDNA 1EVEA 1ZVKA 2ZSIA 3CTMA 1Y34E 5E8JA 3VJLA 4UAVA 1W6UA 2NUPB 1XF1A 4G65A 4LBVA 5B1EA 3R0VA 1JJIA 4J7XA 1XTSA 1T2UA 1Y4AE 5KTMA 3LU1A 1T6NA 1ZJ5A 2WWVD 4JVOA 2LPMA 4F21A 1ZGJA 3HI4A 4P3NA 3WLHA 1C1DA 4AP9A 3THSA 1H65A 3BCRA 3PNVA 4YIHA 1KZ4A 1SU6A 2IOYA 3R5XA 1W73A 3RV4A 1RWKA 3E9DA 4C6SA 1PKXA 2FZLA 1J23A 3TUIC 3IHTA 4DSOA 1SQ6A 1ACLA 4MDFA 2AWNA 1BEEA 1LLFA 1AE1A 1MORA 2AX4A 3ZWVA 3ZWXA 1RLJA 2B37A 3QVXA 4PRKA 4Q3EA 4QVGA 3TTUA 3NGMA 4DMCA 4H17A 2F64A 2ZPAA 3DMRA 5JSZA 2AC2A 5FNVF 2WD9A 2Z5LA 2XGSA 4KPUA 1V1MA 5MGNA 1I2BA 4TWJA 2BGNA 2OG1A 3W7BA 4XPIB 1JHYA 3WIUA 2Z58A 3NS7A 4BQRA 2HTFA 2W6ID 3U4QA 4L4YA 1FQJA 4FLMA 4G2TA 1HZZC 2R1UA 4MWZA 3VR4H 2D5LA 1D7OA 1XP5A 3FHCB 4MVJI 1Q2UA 1V4BA 1FVOA 1IZ0A 1ZVJA 2DM6A 2QMQA 3H8VA 4J8PA 4OXRA 1VIVA 1P62B 1PTKA 4H3SA 3A6EA 5JWHA 2P11A 3H84A 1NXWA 2XZTA 3EJWA 5HFNA 4QBTA 4ETWA 4CPDA 3GLIA 4ALIA 2QVLA 1PG5A 2EGGA 3KQHA 3GD7A 3WNVA 4OJNA 3WMEA 2BZ1A 2RONA 5BN3A 3RSQA 3VI4B 4OGFA 1Z4MA 2W6JD 2FGJA 1TQ4A 1ZJJA 2PL9A 3WJ7A 2F8MA 4FFLA 3MXOA 3QHAA 5WRFA 1N6LA 2H4HA 3AFGA 1XZPA 3EB9A 3SBXA 3I42A 5CNJA 2R6DA 3EEBA 3FCXA 4FKZA 5IW8A 3VISA 1KPIA 5JXGA 4ENTA 3W2TA 5C8DA 1X1RA 2YHBA 1M0TA 2EJVA 3U4MA 1CJBA 1BMTA 1J07A 2P9TA 2C4MA 1T8TA 3M70A 2ZRFA 1G6KA 2PJRA 1Z4QA 2DUMA 2FSHA 3BSSA 3ZE2B 1T3TA 1GU1A 3ELBA 4BL5A 1B6TA 4NK4A 2GPJA 2KLBA 3B2NA 3KM0A 3OSUA 4WW0A 1NKVA 3VZQA 1WE2A 1N4AA 5HQJA 3NTQA 4DMMA 2E6UX 3BTUA 1YL6A 2Q5QA 2G6TA 1DKLA 3EGIA 3QU2A 3CLUC 2WJZB 5EGSA 1GKIA 1V6CA 3KX2A 1LQ2A 1ZJYA 3K9LA 1RAFA 2VJNA 5LSAA 2HO5A 4UPEA 3BD6A 3EVBA 3V8MA 5ADUS 2C7PA 2ZS7A 3DULA 4DVGA 2ZR8A 4KQGA 1F8XA 5B12A 1YVPA 3MJRA 3HR7A 4I5IA 5I7OA 1Z6AA 2GAAA 2E4XA 2OHXA 2YVQA 3O9ZA 3RUFA 3VU0A 1I51A 2UYQA 2COUA 1XZCA 4UHBA 4I36A 5KEIA 1UC4B 3FYDA 1T4GA 4EHNA 3OZCA 4L4XA 1JFSA 3ZIAD 1N1DA 1KXZA 2WTBA 5C1OA 1NF8A 2P30A 3OLXA 1IUKA 2R11A 4BY9E 1LLQA 2DHDA 1N0VC 4EG5A 1NWHA 3HCWA 1YZYA 3JQ8A 3QXSA 4DDMA 1U0BB 1TZJA 4QUAA 3RUDA 4TTAA 2X15A 3IIMA 4BGUA 4EJSC 2VRWA 1AY0A 1FPQA 1NU6A 3G9XA 1I2CA 3DWEX 5EWLB 3UAOA 2F9MA 2OAQ1 4DMLA 1GCGA 4EQ6A 3W5CA 1B76A 1LQUA 1SVOA 3RG2A 2VHTA 3T3MB 4F2DA 1TCUA 4D26A 1MOPA 4RHEA 1XPJA 4FW8A 4LWPA 4RELA 1Y9ZA 2C82A 2JLBA 2RGNA 1S89A 2IGBA 1OAKA 5KWIA 1OXBB 3URMA 3HJRA 2DECA 5FYDA 3NNNA 2MCFA 4CDNA 1XLVA 1KMHB 5HPYB 2ASEA 2ID7A 1ONNA 5B4UA 2UUOA 3FOEC 4Q7KA 1WXGA 4J07A 2QX4A 5HBGA 4IZHA 4W5WA 4B75A 1W0JA 5ALRA 4PPNA 5HOQA 5KTKA 4RLHA 1P8AA 3SJBA 4YFYA 1E79D 2MINB 5IJ9A 1YCHA 1T5LA 4A0SA 2J9YB 3EDRA 1E8DA 1UZNA 4ZEMA 4FQ5A 5FTMA 3VR5H 4PO1A 5CVCA 1KJ9A 2F1JA 2QRPA 3IDQA 3G2KA 2RH5A 4EZEA 3U6KA 3ANSA 3SJAA 3TQRA 5AW2A 3TUZC 2WV7A 4PAQA 5A71A 3OWOA 4EGJA 4DIKA 4XOUA 1DKPA 5L3ZA 2QUKA 3EZNA 3GH3A 3GFVA 5C5DA 1XEAA 1R0WA 4P5PA 2DHQA 4OQYA 1IN8A 4QT4A 4ER3A 1KMMA 1J49A 4IIBA 4PC1A 3IA7A 2NQ8A 3WAJA 1B6RA 1WV1A 1ADGA 2VR1A 4OI1A 4B40A 1A2KC 1AC5A 1EK1A 3PZRA 3SKYA 1T0UA 1A9RA 1JILA 1B2RA 3AKEA 3LX8A 1EFKA 5SZIA 4FUQA 4DILA 1IRIA 3C6ZA 3GJ4A 3LLVA 4DXHA 3C5VA 3IQEA 3QWHA 4RIIA 1JR3D 1J09A 1VOTA 2IZ0A 2PZKA 1GKUB 4D9MA 4FWBA 1JIVA 4TS1A 4UEKA 2A3NA 5K3AA 5IPFA 3SHTA 4TQGA 2N42A 4TRMA 1AZWA 2X8JB 3PF8A 5BSKA 3RT9A 1SC1A 1T2AA 3RFCA 4U9UA 1JSLA 2PSFA 3CRRA 1V5EA 4LRTB 4MLPA 4PSVA 5FUWA 1P5HA 2RAVA 1OW3B 3MGGA 4GXTA 1N8TA 4ZO4A 4F85A 1SQ0A 3TGPA 1ZIPA 2AMVA 3Q72A 3ZVLA 1ZBQA 1DG9A 1ZW6A 2BM1A 1UXKA 3NCHA 3P4UA 4OI2A 3MF4A 4TV8B 1OFGA 3CWZA 2ZI9A 4YDSA 1BDMA 1KI4A 1KYVA 2PT5A 3ZBTA 3OKFA 1XLUA 3JD0A 3BT7A 1M5RA 3KKNA 1ILWA 1NYQA 3QUTA 1B8OA 1KRHA 2H4YA 2XVAA 4RYLA 4KC0A 4TKMA 1JYEA 2VZEA 3OQIA 3HU5A 3A58B 1E2HA 3SX4A 4MUAA 1PNTA 2GBPA 1Z7WA 4R7ZA 5DSZA 3T3IA 3TXAA 4ZMBA 4KV7A 4GRDA 4D46A 1R6AA 4EHLA 2BEJA 1MXHA 4G4SO 3UFXB 1KZHA 2JLWA 1BQ4A 1TB4A 1JX6A 2Z56A 2GCEA 1LH0A 2P6OA 3LY5A 3OZVA 1KQFA 3NKFA 5KOYA 3W5IA 2IZOA 2YMQA 1E20A 2EQBA 1J8MF 3CE9A 1S1MA 1PUXA 1W4AA 3LKZA 3PUHA 4JBYA 2D62A 4TLMB 5J5VA 2DLNA 4FGZA 1JRLA 2QUJA 3F4BA 5KINB 3ZD7A 1JJFA 3VI3B 3P9NA 3WLTA 3ZPXA 4XWKA 2CJWA 5HWSA 5M04A 4HWPA 3H2SA 4C88A 5ALZA 2X9LA 2O3QA 5L45A 4D1YA 3A2LA 4BO4A 4GKKB 5FI1B 5KQPA 3E3MA 3MJSA 4IMPA 8MHTA 1DIBA 3IVGA 1FUEA 4FOTA 4WN9B 3UMVA 3W7VA 3ZWCA 4EK9A 5IDWA 2P90A 2C2OA 3WNZA 3NVKI 4HH4A 4GPTA 3WB9A 2VPIA 4A2QA 1A5BB 4DLTA 3KIPA 3COSA 1GTRA 4JL6A 3D4LA 4ZYXA 1ZVMA 3Q12A 4Y2GA 4CDMA 2GK4A 1A98A 1GZUA 1N5OX 3H42B 2O8BA 2J0SA 1NNI1 2QLJA 4PZYA 2BI4A 4MMXB 5ER9A 3DMGA 3DLIA 2GF2A 3ZUGA 3FA2A 5CXUA 4ML3A 5LB4A 3VV2A 3ZQ4A 1KE1A 3ZZTA 4UVIA 4R40A 1N7HA 2B98A 4X71A 4AF8A 4GUAA 3UJAA 2HWUA 5DFAA 4KR7A 1ENOA 5K05A 3SS9X 4OUDB 1ESMA 1YBHA 4RIHA 4Q4HB 1E2IA 1YDHA 3M0EA 4GT1A 2VEDA 4RD0A 1CJSA 5M3BA 5LIRA 1SWVA 1LWOA 2BDUA 1I1HA 1DWQA 1L7NA 1HKUA 4Q19A 1R4MB 3CGWA 3BXPA 4D9KA 2X5OA 2RI6A 3O8OA 3OESA 4AG5A 4OB6A 3RODA 4Q48A 1A76A 3N2ZB 2EGUA 5DGTA 3OF3A 2Q1TA 3EQ7A 1L5MA 3V9AA 1JWBB 1XD9A 3VZSA 4TMTA 5EZYB 1E0KA 3FUXA 1FU8A 1OC4A 3KBOA 4AJJA 5K45A 1Y82A 1E5QA 2I66A 3ISTA 3A4IA 3CLHA 1D6JA 2VJMB 4L0DA 1SUBA 4MGIR 4ZDKA 4LRQA 1FP2A 3L4BC 1NRJB 1RADA 2PZLA 3PDIB 4E5NA 1ZZGA 3EODA 4WX2B 3TSWA 1P6QA 3EGOA 4EVIA 4HNSA 4XSHA 1QIIA 4B80A 3WKCA 2BJHA 5GOZA 1KPGA 1YC2A 1VYHA 4M22A 3ZCXA 2EARA 4C03A 2WF5A 4DLSA 2OBMA 4EUKA 5ISMA 4DG5A 2NPFA 4LHZA 4HY3A 1N36B 1XF9A 1BE6A 4MRAA 4H1WA 2I1WA 4ZO6A 2JI8A 3BIFA 3LT4A 2DRIA 4NKRA 2YWGA 1IXRC 1FU7A 4A5SA 2Q2OA 3GD5A 1YUNA 4KDEA 3BS4A 3EZ9A 2CE2X 2IITA 4D56A 1EIWA 2IQIA 2AL7A 3GLGE 3WSWA 1NYRA 4B35A 2ZIUB 3AM4A 4YLGA 5IK2D 1K6MA 1ICIA 1X77A 1E2JA 4R1NA 3VR4D 1YZVA 2GI4A 2E4AA 3TEJA 8OHMA 1DAEA 2AG8A 1XHEA 4MWSA 3RADC 4B3TB 3QQ5A 4DXDA 3EA0A 2KJQA 5LQUA 4H9GA 1CJKC 3RWMB 4UDYX 4BNIA 4AJOA 4DOMA 1Y1SA 2FCRA 1ZBDA 4FWTA 2OBXA 2QTNA 4GM1A 4TTPA 3U7HB 3B1WA 1TW2A 3LXXA 3A11A 2X86A 3G0GA 4ISBA 4O3FA 4I1RA 4AT1A 2EX1A 5JCOC 3MWDB 1ZR2A 4OD0A 3HB4X 4UUQA 1BD4A 3RVOA 3N2YA 4F71A 3QSYA 3DAFA 3OTHA 4MJLA 1KZ1A 2UXDB 4CT4B 4J0DA 2OLJA 3DEYX 4RD4A 3B3FA 2HCRA 3PHBE 4R3UC 4XVHA 1QU2A 2WKRA 4UE3S 3UUEA 2XUFA 4KO1S 1QIEA 2QA5A 1GN9A 2VDPB 3B1VA 4ZPXA 3RIMA 3WHLA 5A0VA 2D7DA 2FG6C 4X7BA 1KMHA 3ZU4A 2ZSDA 4RLFA 3BE4A 3PE3A 1VI5A 3NQ41 1JP7A 4Q4AB 4BVBA 5C7LO 2HB6A 4W1QA 2J3IA 5GADl 1DUIA 4OQ4A 4XGIA 3DKVA 2G8LA 1OWOA 2C7GA 2WUEA 3JW8A 3ZKWB 1U4OA 5A03A 4QM6A 1VHTA 4X61A 1YBAA 3RRXA 2RK6A 3BWVA 1VPVA 4H16A 3AUFA 2WF7A 3PDIA 2EBWA 2PKRA 3GN2A 3NJ8A 3TRKA 1RCUA 3QOWA 3KHSA 3FOBA 2ZBRA 5ARDA 4RE6A 1E2GA 1YBVA 4MKRA 1U7DA 4CFSA 3WLQA 3U5ZB 3ILXA 1NF2A 2WIBA 1BW9A 3HXQA 1WCIB 3S2IA 4Y2XA 1NW3A 1ISHA 1XR3A 2V1XA 3CJTA 1TMKA 2R1VA 2XTMA 3PJDA 4RQTA 4RBNA 3WKDA 5CVTA 4C0KA 4A8HA 1UBHS 5CA0F 2IUTA 4M7PA 2RB4A 5E7JA 3ZE7A 4HQOA 3UNXA 5HKOA 1MC5A 2VHQA 5EAIA 3HBFA 2DLCX 1PRYA 1XDUA 3SM9A 1N7JA 4D3DA 5TC4A 1J33A 2JAUA 2SNIE 3Q7QA 4YCDA 4LWQA 2HIGA 3KDAA 4CEIB 4Y6LA 1JKJB 5DF1A 4Y30A 2Q3JA 2JFOA 5T5QA 4L8GA 3AIMA 4L4SA 1NW5A 4UNNA 3L5KA 3JRWA 3QLEA 4IIEA 3GJYA 4HKTA 4EUNA 5BT8A 3GEPA 5GV8A 3T7JA 2UVPA 3GGCA 3GVPA 3OPMA 4H60A 1JECA 2AOXA 1H0SA 1XALA 3ZDBA 3IRUA 2WIAA 4D9GA 1WWKA 2WK1A 5CFNA 2RIPA 4JGIA 1W2HA 1KDZA 3R77A 4QJIA 3RSHA 4W9RA 2QQFA 1WHTA 3PTZA 3VZRA 2Q28A 4BRSA 2HWKA 4N47A 3R09A 4LSGA 1Z34A 2FN3A 2Z9BA 4J0IA 1RZRA 2FZ5A 2P6MA 2BFOA 3LUHA 3CUUA 1FDVA 2Q6OA 3K1YA 4BCCA 4QLBA 5CLQA 5FUQA 1A8PA 1KIFA 5AW7A 3HADA 5IDXA 4I1VA 1E1NA 1JGTA 1HLPA 2XCIA 1OROA 1VSVA 1Z9BA 4DR5B 1XRQA 4OXYA 3NOXA 2AC4A 1LDEA 1UMCA 1G5HA 4O2BA 1NTRA 5BMOA 1ZJWA 3KXLA 3PA6A 3FZEA 4IG9A 1JBEA 1CQXA 1TNDA 2YNMD 2AZTA 3UFXA 3O7MA 3BF7A 2Q9AA 1Y7PA 2NUBA 5EKXA 1OXMA 3ABRB 1NMEA 1RQXA 3RNOA 1TC2A 1RWVA 3D2CA 4UOZA 3PXCX 3TB6A 2EKLA 4MGKR 1U5BA 2Y1CA 5BSEA 3HSYA 2GLXA 3MB5A 4AJ9A 1CD5A 1PK8A 4HQ6A 3HJGA 3D5EA 4M3NA 5F3RA 1JI3A 1OZFA 2B2NA 4HWKA 5KCMA 2NU8A 2JLZA 2DWPA 3HCOA 3WQBA 2H2WA 1HYQA 1ABBA 3ELUA 1P2VA 1ZLXA 5ANRB 2OBLA 5EZ6B 3VH1A 1ONPA 3ZOKA 1U6KA 1RXVA 4MYSA 2BF4A 1XMIA 3FSGD 4YAKA 1WEHA 5HTOA 2AK2A 1JKFA 2WFZA 4P33A 2M6KA 3DHEA 2BBOA 2D0DA 3W5BA 3DKRA 5IUKC 2H18A 1G291 1TQ8A 5FI0B 2EW1A 3A6KA 3Q15C 5L40A 5JYDA 1QHIA 2CJPA 1L4KA 3NR2A 5DOZA 2IV2X 4YRPA 4RVSA 4IIDA 3MWDA 3P5BA 4H7HA 2A0WA 2G0TA 1U2DC 3K1TA 4LCEA 3MOIA 2CKDA 2Y0CA 4EI8A 5HZMA 5ILQA 3WYFA 4FYMA 5JQGA 5JUWA 1TIBA 1Q0PA 1ZA2A 2OM6A 4X93A 5FA8A 4BPRA 4E4TA 5CAEA 1H6AA 2V74B 5K5EA 5A4FS 1Y1KE 1N75A 2GCPA 2GJ9A 3OEEA 3TJMA 4DLRA 3Q8LA 5EYPA 2KSQA 3LVFO 1EMDA 2ACKA 3EFEA 3PENA 5ICGA 2GPAA 3BDVA 1GDTA 4FC7A 1PJTA 4DM3A 2AXNA 3FCUB 3FCOA 2H08A 4CR7A 1U0SY 4MQMA 4E6EA 2CLKB 5CA1F 4KNYA 1JBQA 1E62A 4LBYA 2VSNA 3DOJA 1UAYA 4JJGA 4NZZA 4WBSA 2XQVA 4Y0AA 4YJGB 3ZD8A 1QOQB 1G6OA 4PCVA 4GXRA 1W5EA 1QF7A 1QHFA 1F6BA 4MVJF 1L5HB 1E8MA 2CLDX 2H11A 5FRDA 1XGKA 4YH1A 3N2GB 1MOQA 1YASA 1AUPA 4OMCA 5AVXA 2POCA 1VKRA 4XVCA 3R74A 1DDOA 4A0HA 1AX9A 3OFJA 1LPBB 1SRQA 4RMGA 4CMEA 2H5JA 5LDGA 4CFZA 1W35A 3ABQB 2RHGB 1C2TA 3BWYA 1NE7A 1XMJA 2ZG6A 4JS0A 3CH6A 4BC1A 2ZUDA 3F8SA 5EINA 2WTXA 1P1JA 1RQ7A 3COYA 3P9IA 5HX7A 4BECA 3MJFA 4IP0A 4MQ4A 2XYGA 4LQDA 3ZWQA 2PJZA 1GQFA 3BCSA 2AZ4A 1COWA 2WU4A 3DPSA 3R6WA 4YHBA 1ORIA 1YK1A 1JJBA 1A95A 2BKLA 1DBQA 3HO1A 3ADOA 2C2GA 4CJXA 3W7AA 1F9AA 2ZBFA 4D02A 1YFZA 4DR2B 2O8CB 1D3AA 4ZGWA 4KXFB 4ZOAA 3ZS9A 2ZYHA 3CLUD 4QEZA 4LOKA 2ZAGA 3I28A 4JOCA 5HF9A 2BJWA 3RSZA 1YRAA 4MV6A 5CITA 2OLEA 5GJCA 1UJ6A 1DAPA 3PNMA 3WL7A 2Q62A 2OK7A 2I7TA 2AMFA 1GFIA 5A7HA 1CDZA 1R0YA 1F6WA 2ZM6B 2D06A 2JJMA 3UV3A 1WDLA 4F5DA 4NEGA 4G5YA 2CKMA 4HGNA 1QC5B 2WG0A 4XSGA 5DIFA 5DJ5A 3CWQA 2QSJA 3HEBA 3ND7A 4M9UA 4ER0A 5A4DA 5JAIA 3WRXC 1EUDA 4DLZA 4AKHA 3IB6A 6AT1A 1X1QA 5F7JA 2DHRA 3V1KA 4NYMQ 1CF4A 2GHIA 1E9CA 4YCLA 4JKYA 2WT9A 4RVGA 2W2LA 4C30A 2XYQA 2EBHX 3E58A 3QY0A 1CEQA 1RAHA 5GTDA 4HL6A 3ZLUA 3QWBA 2IBTA 1Z4OA 2WDPA 5JE8A 3W05A 3GN1A 4C89A 3LO5A 1P1RA 1TQHA 2VQ3A 4HLUC 3VPHA 4P84A 3OAAA 4XZ3A 2BT4A 4N5NA 2VH1A 3ICWA 1KSFX 4F8JA 3WRXA 4E1VA 4YT5A 1QFMA 2FP4A 3NCTA 1Z7GA 1V1RB 4A6DA 4BVJA 1UJMA 4RQAA 2A8YA 1V43A 4U7WA 1L7QA 3K96A 2J0VA 2OXFA 4PQEA 1KEKA 4WCDA 1GSHA 1TYDE 1KR2A 1RMYA 3IAXA 3QG5A 3JR7A 3G17A 2Q5FA 1YDEA 1SIWA 4UHJA 3ZU2A 4I08A 3VKFA 3BMCA 3G5TA 1X3LA 4KXWA 1ZRSA 4UM7A 4LY3A 1U0NA 1EFAA 3GDGA 4IEEA 2PNJA 3LXMA 3KJZA 2E4YA 2WIJA 3ZHSA 5IT4A 4A36A 3QEOA 2C8VA 2RGYA 3DR3A 4MROA 1X80B 1IJKA 1RKVA 3G9UA 4BRWA 3TLCA 2Q4BA 1IBKB 1PO7A 4O1IA 4DNPA 2WILA 4FN4A 4ALMA 2O2DA 3QXCA 4Q05A 4QXRA 4Y0NA 3PK0A 3V7FA 1KL7A 3WK5A 4PLZA 5CA0A 2WLTA 3MB8A 3U7IA 3UJ8A 2HI0A 2YFQA 4LUCA 3TGWA 2ZJYA 4YJDA 5DYWA 1WBDA 2WTUA 2IHZA 3PQCA 3DR5A 3A1CA 4EHDA 2JFHA 3QNWA 3BTVA 3IMEA 3PQ7A 3NKLA 2ZRHA 3NBAA 1HE8B 4UARA 3SC2A 1QAMA 3VYUB 4HNUA 2J4DA 3H7AA 5JR3A 2VEOA 4G09A 2ZE8A 3IEXA 1HE1C 1K5GA 1Y1TA 1II8A 5H16A 1UBLS 2WWHA 3C3JA 3DNFA 3EXG1 3K94A 5JS6A 4PFQA 4ROTA 5BQ5A 1J8YF 4I81A 4MYUA 3TZQA 4D4GA 1ONSA 1C0IA 1NNUA 1QONA 4CN8A 3RBXA 1JAYA 1L7AA 3N05A 3P5SA 4I6GA 1P7ZA 3FUUA 1WCIA 3K7EA 1FUUA 3WIEA 2B7BA 1CJMA 2ZUCA 1EHCA 2Q45A 4KH1A 1E4OA 3TZCA 4MKHA 4DT1B 4PY2A 4DRYA 3JD1A 1E3EA 4DIUA 3LPMA 5MHTA 1IATA 2BV3A 3NHPA 1UMCB 3LFUA 4H6PA 4GFDA 1LI7A 3VMMA 1E2MA 1FNCA 2A1TS 4FZJA 3ZV3A 1MRSA 3CB2A 5ELMA 3DE1X 3F5DA 4P93A 4AJPA 4EPTA 3KK0A 1XE3A 3FZYA 5AP9A 1HT0A 1Z4KA 3B1FA 3IFSA 1EDBA 1ZITA 4K6FA 1MEEA 5L3RA 5IULC 1DRUA 3FUTA 9LDBA 1RTTA 1KBQA 1RSZA 2WABA 5D3MA 1NXVA 1SG9A 1OREA 4GM0A 5G53C 2O3UA 4IDNA 5L3VA 5KI6A 3KVRA 4R0NA 3E22B 2A9QA 1H93A 3VU1A 3FWZA 3MQFA 4Q34A 4L8WB 2OSVA 2FW7A 3ZZUA 4F38A 2XXAA 4N0PA 2ZUWA 4NFHA 4R9SA 1MB0A 3OUTA 2IVZA 4HWSA 4LYEA 3VTZA 5JNUA 2UU9B 1GDHA 3L04A 1Z22A 4HGOA 3CB4A 4JOBA 1ULSA 4UDOA 3LUKA 4PLVA 3RB8A 4EYOA 4IWNA 3LPNA 4C0XA 3HPRA 4QAJA 4BMNA 5DRTA 1UWVA 1WIWA 1N2CE 3JWIA 4PZEA 5EWMB 5AT1A 1P3DA 1FFXB 5LU9A 1SXQA 3TM5A 3UMGA 1QP4A 1MEOA 1XMPA 2LNDA 4PFJA 1G2OA 4KR3A 2OAEA 3EIFA 4CG2A 3PEYA 4HDNB 1ZSNA 3B5EA 1X15A 5DM60 3ZK8A 3MCWA 1GPAA 1H6BA 4P0TA 2AYZA 1M54A 2E2WA 4IVNA 4QUIA 1H2FA 4JP1A 4EB0A 1QG2A 3MWFA 3LRXA 2B2CA 5GP1A 5LXTA 5I8ZA 1XQYA 4FE3A 5FWAA 3B51X 4B3XA 1H6DA 2WVJA 3L05A 5G4LA 4ZZ2A 3GFRA 1YZHA 3QU4A 1DHTA 5HKKA 4EVRA 5L4SA 3KQSA 1E7WA 4RANA 1USWA 2PMBA 1PWZA 3SE0A 2BD0A 2F3SA 4EMSA 3INNA 2O8EB 2GEVA 2NSDA 2Q9UA 3SEAA 1P9OA 1LBEA 5LNK6 2IXAA 5PGMA 1IBRA 1R4AA 2QTFA 2I9KA 2H1FA 2YJGA 1G59A 3AVWA 1GQQA 2WKPA 1TZBA 3BULA 3GFPA 3GP8A 1T2DA 5KX5B 1OJLA 4N54A 4JJZA 2WY2D 3OURA 4BO2A 5FIUA 2QRVB 2BZSA 2ZSHA 3NTLA 3DT9A 3EDYA 3ZV6A 4YRGA 3H86A 5IKOA 1Y3DE 1XWIA 4CKBA 4UHFA 4KE7A 1L3CA 2FZEA 4E14A 4QSHA 2P4SA 1VA4A 3RVDA 5K1ZA 1QGAA 1IEQA 4LDRA 5LIPA 5JSKA 3ZHVA 3KZMA 1SBHA 4H1TA 1IMJA 3K9CA 5REQA 3MTEA 3HSKA 1QYDA 1KGDA 4LE2A 3QVJA 4LQLA 4WACA 5EMHA 1OBHA 2PCJA 2QUBA 3ADPA 1SKBA 3L02A 5JRJA 3BVPA 4HB0A 4RX1A 1XHLA 2GM5A 5KQLA 1QYIA 5C52B 4IH4A 3LRPA 2XQKA 4PQGA 4TWRA 1PR4A 4IZIA 2I2BA 3PFFA 5JO9A 2GD0A 3CHYA 5D5QA 1KAMA 5GPBA 1RIIA 3RU2A 2F43A 5FUMA 2QNBA 3HB0A 3INTA 4RVDA 5JI3E 4Q66C 3LP8A 3W8FA 1GILA 2V5AA 2I3AA 3DCIA 3KS9A 3M1AA 4BAGA 4ITVA 4ZTZB 1QFJA 2FDXA 1Y8CA 1P74A 3RTDA 3VAZA 2G72A 2WWWA 5EIFA 4JLOA 3IQXA 1XLWA 3D0RA 3T7SA 4G5FA 2ORIA 4NE2A 3I45A 3Q3CA 1OWNA 5A5FA 1Z6XA 4BPBA 5ITZA 4HNTA 5AOVA 2XF8A 2JHAA 3G49A 1CU1A 3OA0A 2P40A 2QTBA 2ZJ1A 3A9SA 4J75A 4HAOA 5IP5A 3PC8C 5KYVA 5CB4F 1EZ1A 4L7QA 1JDZA 2NU6B 2NO7A 2XQFA 3LWZA 1EUDB 4GPBA 1U8EA 3H6KA 4NG5A 1D1QA 1N6RA 1NP7A 1OZGA 1V41E 2VUTA 4PLTA 4ZCQA 4DT1A 3Q7IA 3GP5A 2WJGA 3LCUA 3RS8A 2BFDA 1A5ZA 3HRIA 3LD9A 3OT1B 3O9MA 4N3AA 3R6GA 1E64A 3CPJB 3S2FA 5AVUA 2XZLA 1PG0A 2WHPB 1X3SA 4WBNF 4HFRA 5LB2A 5C9ZA 4CQMB 3FVTA 2V55B 2EG9A 4Y98A 4RKEA 4QTZA 1O5TA 1Z2PX 2A3RA 2AMLA 3EWNA 1DCTA 3IQDB 4IJQA 3ASUA 1QORA 2IHJA 3VMFA 4RXMA 4EUHA 1ESZA 4A8JA 5EFZA 3PB3A 1THMA 3GLRA 2NO4A 4Q9DA 2XRZA 2IC5A 1W36C 2NADA 4DB2A 4OP1A 4FJ0A 1PZEA 4UHKA 1K8ZB 4KLCA 5G41A 1A0OA 1MEJA 3RANA 3GZ4A 5FCDA 3HMKA 5DBEX 1L4EA 2EFJA 1UK8A 4KLRA 2VNKA 4TLEA 1KQNA 1R9NA 4PWYA 3JD2A 4Q1EA 4CV2A 2VTBB 3N9IA 2ZDQA 1ADYA 1CLUA 2B99A 3AB8A 3I83A 4CTNA 3CEHA 5EWMA 4H6WA 3IS3A 3TTSA 4BJ6A 1A27A 3SYMA 3M6WA 4MUNA 2YCBA 2VT7A 2C0CA 4IFIA 4P3PA 1K3TA 3H1FA 4X9XA 5DWDA 2DKFA 2HYIC 3NBKA 3O4JA 1KYXA 1H2BA 3RVQA 4F97A 1GCIA 4PM4A 3BERA 3REFA 1SXJD 4FFSA 2HCJB 3H0KA 2QX6A 1UOQA 3RWBA 4ZI3A 4JASB 4GGMX 1J2TA 2WA2A 4YDRA 1EJ2A 1NPDA 2IIVA 1HFJA 3N5KA 3S4YA 4BE9A 1SUCA 4FCWA 4WEQA 4EKDA 1ZGAA 2JFPA 4R81A 2Y2UA 3U80A 3VH3A 1I32A 5TPWA 3LWNA 4B3BA 3WWCA 1YA8A 2H1OA 4F4JA 1QCDA 4KUHA 1SXJB 1QPBA 1L5GB 5CNMA 4JROA 3QVVA 5I7FA 1LK0A 2LZ0A 2ZUBA 2V9CA 4LHVA 3VO9A 3MWEA 1BHQ1 1N8NA 3PFGA 4N7BA 1E2UA 5LBIA 3F3KA 1TO1E 4ZARA 3CKMA 5C8ZA 3I34X 2YWXA 3HFGA 5E6RA 3ANXA 4JI8B 4XLLA 3RFUA 4IX9A 2UZAA 3BKXA 5EP4A 1N0HA 2PH5A 3FTNA 5J58A 1M2VB 4H6VA 4JT9A 4CIVA 1NXPA 1YHZA 1BA3A 3HY3A 4O5AA 5CVVA 2WZBA 4LF8B 2A9OA 1XAHA 4XCXA 3PCRB 4FGWA 2P91A 3HFRA 3HYTA 1H0KA 1F12A 3IEPA 4WZAB 1G5IA 2IYZA 5GQSA 3TQTA 4E30A 3AUKA 1MP0A 1QRAA 4ZI7F 4ZVRA 2GHTA 3DEHA 4EW2A 3AHFA 4MV8A 3GAAA 4D81A 4MVJH 5HM6A 3ZY3A 4OSPA 1K1EA 1ZEJA 3W5SA 1OLUB 2FFRA 1J9GA 4DHEA 1SUIA 1JAZA 2FPLA 1MENA 4S3MA 1V71A 1UXHA 1F1JA 2ABWA 1FFXA 4CKEB 1YR9A 2VYVA 3HPQA 4G8BA 3HZHA 2JGDA 3IAFA 3OQ6A 3JVEA 4MKFA 5J4HA 2HJGA 4O4HA 1EG2A 2BFEA 2K7FA 3T9FA 4AZVA 1FDTA 4V02A 4CLHA 5DEOA 2WWRA 2C9CA 2E48A 5FO0A 3QZUA 1T2CA 3HCBA 2OCDA 4ZAXA 3FAZA 3E1GA 3UW3A 5I7HA 3O31A 3STHA 2OCGA 3AV3A 2PTHA 2QTVB 3WFZA 1AQNA 2ZZNA 2Y1LA 1AGRA 2XBUA 3DDNA 3AJAA 2Z5FA 2GN2A 4RK5A 2GFIA 1B16A 4HN4B 2IUFA 3KUUA 3T94A 3WWZA 5TQ0B 5BV2P 3HDYA 1MBZA 3OZSA 4TT3A 5K4GA 2FPXA 2JD0A 3TAXA 3H9BA 3E9ZA 3KJNA 4GMXA 3T7KA 3WI7A 3U7FB 2JJ1D 4B73A 1G5FA 2BGUA 1DQNA 1CLEA 1Z0IA 3KKPA 4JFRA 4PVDA 4U7HA 4X44A 1EFTA 1FTWA 3HVHA 1E94E 4QBGB 4UM8B 1Z6YA 1F2DA 4CKEA 2WUVA 4LRWA 4MQFB 5FEMA 3UHAA 1W30A 3V46A 4BGDA 3FSGA 3KJQA 2D1RA 3H4MA 3ZX5A 1G9SA 2PZMA 4HC4A 3BXXA 1AO0A 3GLIE 1HDYA 2ZJ3A 3L6BA 3BWXA 2JA1A 4IDQA 2Q1UA 1C9EA 3H8JA 4MLCA 2XT9A 1GFZA 2Z95A 1DOZA 4XE5A 3UHOA 5CFRA 1XT6A 1ZISA 1GTMA 4HTFB 4C7BA 3TAUA 4CMAA 2AN4A 4UUMA 4EG8A 3OZDA 2CLMB 2BEVA 2UAGA 2NMVA 4XUGB 4UREA 3KZVA 3C5WP 2R8EA 3RPEA 1JPNA 2VJQA 5JYBA 5E2IA 3WO1A 3FMOB 2JBHA 2P4UA 3HGTA 2WAXA 4KGDA 1O8BA 4IJ5A 5BORA 3DZBA 1JKJA 4K9LA 1VG1A 4ASUD 2HJSA 3SZUA 1U2EA 4BKOA 4UOEA 4FYKA 5AH0A 4ZYUA 5HG0A 3UANA 4ZHQF 3LK7A 4Y0VA 1YIAA 5L6MB 3EPJA 1NP3A 1YQ9A 3ZK9A 1DAKA 1L9KA 1WCWA 1XN4A 3ABSB 2I91A 5JRDS 1R8YA 3AM1A 3AR4A 1V3UA 3UCXA 1ZINA 2KMLA 1Y1QA 2XADA 1JFLA 4YRLA 3R24A 5JJCA 2BGKA 1S96A 4E7OA 1R4ZA 3FB1A 1KYQA 2HNBA 3F5FA 4JZKA 4AAYA 3OFKA 1U7HA 3AHCA 4HPWA 3UWKA 1PCXA 1Z8NA 4AO8A 1R18A 2QYTA 1IE3A 1WMEA 2JIQA 2QN2A 2E89A 1KFEB 2H1SA 4RY0A 1PR0A 4YB8A 2R6JA 5BQOA 2JLVA 4OL0A 1IZZA 1LI5A 1EB8A 2AFIA 2NU6A 4K26A 2ILTA 3JATB 4F5WA 4ENRA 4OXQA 3HS3A 1A7JA 2CJFA 2LW7A 3IT2A 3SCZA 3X1JA 2IDJA 1H5UA 4EA7A 2OHOA 4WLNA 2NZXA 4QWWA 3TCXB 2PMKA 5ULLA 2IBMA 4ZODA 1R3UA 4NDZA 1USGA 5AJHA 1LBIA 4UATA 2JW5A 3K0CA 4WADA 5EKUA 1MH1A 1QB7A 3G7NA 4QPNA 5JLAA 3LECA 4B6PA 3D9QX 4NP6A 1F38A 1PSWA 4QUHA 4FU0A 1S3SA 2DBYA 1M1YA 2KLHA 1QZUA 3U39A 1NYLA 2BKEA 2FX5A 4NOLA 1OBOA 3DKIA 3DJYA 3KPWA 1SKUA 1YJXA 4LXYA 1CS4C 3U4IA 3N58A 3MJVA 1B93A 2VK2A 1RWWA 4DQDA 5T41A 3U3JA 5JSQA 3WLLA 4ZT7A 4I19A 3KR0A 1FTYA 4HB2A 1YCDA 8ABPA 4CG1A 4W9MC 4XJSA 3C1UA 3WRYA 4XJVA 3CLVA 2VF8A 4B87A 2W8BB 3RFTA 5E8RA 5IXSA 2BMAA 3MGBA 3AHGA 3O8LA 3ONFA 5GIOE 2OR3A 2HIAA 2W37A 3DV0B 3KWFA 2GSWA 2F4VB 1GA4A 3L46A 2W6IA 3E8SA 4YVFA 3QFTA 1GXSA 3OTWA 1YK0A 3MTBA 3OCJA 3QE2A 3MUNA 4C4XA 3A6PC 2ZIVB 5BWMA 2Q5IA 1S9DA 2GZDA 1U7TA 1RM3A 2B6NA 4B84A 5DO9A 4O4HB 4DE5A 5A5EA 4CMCA 2VAPA 1RDFA 2V3WA 2ZKIA 3GFGA 2Z6UA 1WDKA 2G9NA 1SBQA 4Y1RA 1TJYA 1JAHA 3PQ5A 1N7GA 4IDBA 1GYPA 1IH8A 3MWLA 3DLTA 3QY9A 4MWOA 4HWGA 2DC1A 4RLSA 4QQKA 4X7MA 2OSBA 3S2SA 4I1SA 2ZZMA 4TV9B 1GG8A 3IHWA 4JJFA 4YUVA 1UBEA 4PHCA 1OCEA 1V35A 3RS9A 1BS2A 1JSCA 1N5LA 2NUAB 5FWXB 1E3MA 2AFIB 3SFVA 4CL0A 4DF3A 4ATNA 5CG1A 2EF1A 3RS2A 1TKBA 4BYMA 3PGLA 3T4XA 5ECWA 3D8BA 4LHWA 4BWFB 2WKSA 1V11B 2RHLA 3A3KA 4XD7A 1XEWX 1WKBA 1JT9A 2R9VA 3N3AC 4Y2YA 1GN8A 4ZRDA 6REQB 2TYSB 1OWPA 4WCFC 5JCZA 2D59A 4P4UA 2W2PA 2ALJA 1XPOA 3LH5A 3A28A 4UMDA 1ZD9A 5GM2A 5TDHA 3DEJA 1BXRB 4GX5A 1I7PA 1K0FA 1L4FA 1OIXA 3L5OA 3TE6A 3STUA 3FTFA 4PCAA 2IZ1A 3BICA 1B26A 1M8PA 4ZQIA 3B8HA 3DLPX 3KR2A 4PX5A 3Q4GA 1K8YB 4JJ8A 3UW1A 4A8PA 4P35A 1ORVA 4UE6A 3FR7A 2F1KA 4HMPA 1SULA 4IEFB 2BEVB 2WVAA 5KVAA 2C98A 4ZD6A 3B6IA 1GZ3A 2OBFA 1Q44A 2BGRA 4MICA 4F2WA 1ZGCA 3LXRA 4TRJA 1MB2A 1U4NA 4NHOA 2N1BA 5TRTA 4CEJA 1Y48E 1RWQA 3UAZA 4K6MA 4U6NA 5J4YA 4QDJA 4HAZA 5HF5A 1EVIA 1HBJA 1Y9AA 2GO1A 4Z1MA 1FB5A 5LZ7A 3TBKA 1QX4A 5KDOA 1IQ0A 2ID9A 1XFAA 3O3OB 2PUBA 4EPXA 4AI6A 1ODKA 3H04A 4FCVA 3L6UA 4KE8A 3L6CA 1U11A 4HDRA 4LGMA 3ZHRA 4E12A 3PVZA 3TD9A 1Y9EA 4NU6A 4FLFA 2HUNA 2OXEA 2QZSA 3MILA 5AO9A 3VNQA 4YYEA 3ZG6A 1MZPA 3CX7A 3GAZA 4UPVA 2WFAA 2D1YA 1T8WA 1DRKA 3HJNA 3KZCA 2I1LA 1Z12A 1RHMA 1W46A 1ZN8A 4J9VA 4XCVA 3ROQA 2QT1A 4WL0A 4DJ5X 4YPVA 4AMGA 1T24A 4QPJC 1MW8X 1L7BA 2C78A 2CCKA 2GT1A 3FE2A 2ZXFA 4KYUA 1ENPA 1NOIA 2QW8A 2VYCA 4OU4A 4V0MA 1OH6A 4ZCIA 3IDSA 3BL6A 3GMIA 4FSHA 3JX9A 4PQRA 5ITSA 1OJ7A 1WXFA 4IIHA 2PRIA 4LVUA 1WEKA 2AE1A 5FWXA 1C3JA 1B00A 2ZE6A 5CM9C 4ERNA 1GTZA 1UINA 4C3VA 1KI1A 1KDYA 2GVZC 2XUDA 4PZ9A 4UCXA 2PKCA 2PN1A 1KO8A 2YIVX 3L41A 2W2KB 1PFYA 1VA5A 1PJ8A 3T1OA 2CXNA 4YT8A 3V4LA 1W0JD 4I3FA 2BUAA 1OKKA 1W581 2PFGA 4G1BA 4R01A 4W6QA 4XLTA 3T7AA 1J70A 1F2UB 5EOVA 3ZHBA 1AA9A 1VHJA 4G5OA 3R3VA 3NUGA 4CUZA 1GG9A 1NBWB 1TLLA 2QVYX 4I46A 4K9MA 4KRXA 4QASA 1HLFA 3S81A 2UZ1B 5DCYA 2Y76A 2FOLA 5TS3A 2CFRA 4ESVA 3CO5A 2II6A 2EFHB 1MX1A 3IEIA 5BN5B 2JGLA 4AROA 3RTCA 2H00A 4JBLA 3NI2A 2AJLI 4RDCA 5KYXB 2EDAA 4F9GA 1EVJA 1BE0A 1GITA 3BRSA 3CX8A 2G0AA 1XQ9A 4XI9A 1TYBE 2A5JA 1CCWA 4MLZA 4DA6A 1I30A 2OHFA 4UNQA 3W90A 1DJQA 1TD1A 3ZE8A 1QH1B 5JDCA 5EJEA 1WMSA 3GJQA 1H4VB 3GPCA 1FXUA 1RBYA 3FGNA 4LSZA 2HQSA 4AY3A 2HMAA 3KJIA 4DEYA 5K01A 1A8QA 3TL3A 2PUAA 3OZIA 1EBBA 1VE5A 2XX3A 1NJGA 4KMOA 5JS7A 1X7ZA 4DTIA 4BMPB 4D79A 1Z33A 3I53A 2REQA 2QN6A 2VNAA 2B82A 4YV7A 3WGOA 1AF4A 2PTGA 1JWAB 3VFDA 2GYUA 3E9QA 1W48A 1KC1A 2XUQA 4MWCA 3H8SA 4Y6QA 4YDQA 8ADHA 4HHEA 5I4KA 3QU5A 2Y93A 1PDWA 4KPUB 4X7PA 3EMDA 4BDTA 4CLOA 2QTTA 4J0EA 3I6ZA 4NMHA 3VR1A 4DEXA 4F1JA 1A7KA 2FUEA 2F3QA 2HK7A 1G63A 2XLBA 5HE9A 3BH6A 4DPKA 1JEYB 4DR6B 4G1EB 1JXAA 2J5RA 3QKIA 5AR1A 4LVCA 5F35A 1F8FA 3AU8A 3VJMA 1D6MA 3VSAA 1M2FA 1WD7A 1IU9A 1N9GB 2AHRA 4TWZA 5GONA 4DR4B 2NM0A 2QENA 2VUUA 4B7AA 1VMEA 1WMDA 1TQ2A 3R7WB 3I9KA 1NA5A 2DR3A 1UP6A 2O1XA 3TTTA 3CH7A 2FFQA 2HRRA 3ILSA 4ZI7A 2EJWA 1P0CA 2H4WA 3A1TA 3PDCA 2PY6A 2QTWB 2Z2IA 4MKXA 4N40A 5C2JB 4JXZA 2OB1A 2A1UA 1WD5A 5EIBC 5THQA 1BYUA 4GBJA 4AJ2A 1OH5A 4FNAA 4XFDA 2GEFA 1X1EA 3FKSA 4COKA 4L15A 2WLSA 3L6EA 3RJTA 4L7VA 1U04A 1T8UA 2A9KA 1C9DB 2ORYA 2YXLA 3EAQA 3IRVA 2I33A 5J5AA 5AVRA 3KOYA 4Y6PA 2XD9A 4ZGBA 2Z2JA 4E07A 1U0GA 4O0MA 5AKXA 2PHZA 4NULA 2AFIE 2R86A 1ZOSA 3QFSA 1V8PA 1JT2A 3E05A 3NZEA 4MMZB 2OFFA 4YK7A 3RSCA 2ZBEA 3FHLA 3K9NA 4A16A 1CHNA 5JATA 1SA0B 3VNUA 2IYNA 4NFLA 1VRWA 1P3JA 3DAPA 5JY6A 1YS6A 5F4BA 3QVUA 1B4DA 3FPKA 2UXCB 1JEQA 7REQA 5KNDH 3H2BA 2B8EA 1O3YA 3ROEA 2DPMA 4DZTA 3EXHC 2ZWVA 1E5VA 1HV8A 1JHDA 1RJDA 1L6IA 1DJNA 5CFZA 5JD5A 3DYVA 3WGNA 1PX0A 1IK4A 2PXAA 5AHXA 2UUCB 2M6RA 1KEEB 3QPAA 4Q3BA 4Q37A 4GWKA 3DZDA 4EAAA 4UUOA 2IZZA 2ZPTX 3E9EA 7GPBA 4B2YA 1H2RS 2L69A 2PGLA 1DNPA 1LW6E 1RQNA 3EQ6A 4IAOA 4M8SA 1QGED 3N7AA 4NONA 2WWGA 3EQ8A 5G40A 4AN4A 5ALWA 4NK5A 1SCAA 1TOAA 1KVUA 2V0CA 3OX4A 4PG4A 1RJFA 3KKKA 1GM5A 4RADA 2WIKA 2OZVA 2EFEB 3VM6A 4OJQA 2OGSA 2JAOA 3RWOA 1D09A 4BNFA 3FHTA 2VNSA 1DO8A 1BCRA 2B4RO 2EBFX 2HNKA 1LNSA 1N3BA 4G85A 3EEQA 4AWXA 4WMLA 1UUFA 2HGZA 4FDMA 3TBFA 1J90A 4D99A 5BSFA 4PFKA 1N2EA 2GEJA 2CVFA 1J39A 5EJ5A 3SEZA 1T3HA 2QI9F 1LPMA 2E3JA 4XGNA 1MGPA 3P0EA 3L0IB 3HDTA 4RV5A 2OYCA 3T7IA 2IU6A 3GP3A 2FRVA 4ZQEA 3TPFA 3VA7A 1AURA 1HRKA 1TGVA 2FSUA 3FLMA 3H5TA 2NNLD 3KOWA 2A1UB 5BNZA 1Y33E 4IZ6A 2ZYIA 2A57A 1U9IA 2NZJA 3B7WA 3BFPA 1YTUA 2OC9A 3HY4A 4GC5A 2P2YA 4LJ6A 3DLCA 3BCUA 3MFQA 4JUFA 3VYVA 5KSZA 1Q92A 2AWOA 2Q5JA 5LMZA 2HEGA 3QPUA 5EVJA 4I1PA 1S1CA 3NBFA 2XMPA 3FWYA 5C8YB 4MOWA 3CLSD 1A97A 3VVMA 1KMIY 5BP7A 2PSJA 1KU6A 2OCXA 3C7AA 3UJ3X 3EG9A 4R05A 1L7MA 5K0EA 4RTRA 4RXUA 4QXAA 1HDEA 4QICA 3S70A 1XNGA 4OHZA 2O0JA 5B3JC 1DG1G 4G01B 1IN7A 1LJUA 5CHEA 4L0QA 3QLUC 3IOBA 1BGVA 2GBLA 1U0LA 3DVQX 2RHRA 1RW4A 5IABA 1NZFA 3IVCA 2Q7XA 5DU2A 1UBMS 1YB6A 1A72A 2LR0A 4LDJA 4TWIA 1R0SA 3NIGB 4O1HA 3ZJYA 3IP8A 4UNRA 4CR6A 3GLHB 1R64A 4MS3B 4F6RB 1R5NA 3T61A 4REOA 3W5JA 4MP8A 2FPSA 2N75A 1DKUA 2DTXA 2BMWA 3HJUA 3LHDA 5FORA 3WDMA 1L4HA 1NMZA 4IHJF 2FFBA 3SK0A 3T7CA 3NRBA 3WWEA 4BU0A 3H2IA 3CW8X 5DT9A 4OJMX 3NRCA 2V3CC 2X8WA 4PYKA 2ODWA 2QP9X 1HT2E 5LZ4A 1NVTA 2BFAA 4C87A 2CF5A 2HK6A 1EFCA 3D4BA 1SPXA 2IXBA 3HKDA 5JD6A 3T1HB 4ZV7A 4HNHA 1VG8A 1PI3A 1RYFA 1NBOA 1RR6A 1XZDA 4PR3A 4DV6B 1H2EA 2CLOB 4C4TA 1Z6ZA 2P0AA 4QPCA 2LD4A 2R68A 3GIDA 1WZ2A 5IAOA 4CIWA 2EFYA 1FIUA 1M5UA 4ENVA 4PG7A 1VIMA 1G42A 1OGIA 1U0TA 4PYMA 4BNGA 4MR8A 2GN9A 2YFHA 1KEVA 1FFSA 2WWIA 3C8MA 3FJOA 1K8QA 3AYXB 1F2UA 1FXWA 4II7A 2A9PA 2F1OA 2QRZA 2ZRMA 4MINA 3JSXA 1OFHA 1VSTA 2QSUA 1QYXA 3HA3A 4M0KA 2J48A 3B53X 3IO3A 4B6FA 3AMVA 1V47A 1VPDA 2AC7A 2H07A 1DCMA 1DEHA 1QIDA 3L7MA 1HC7A 3DOFA 1M7BA 1MKYA 1KE2A 2A7QA 4LYYA 5A02A 4D3SA 3O75A 3FOFC 4YRTA 2GO7A 1IZ8A 3WNQA 4C76A 3B13B 1BCSB 3M83A 5DNVA 1XTRA 3FDJA 2XVZA 5BWBA 4H2DA 3RG8A 2CLSA 2ODTX 1RBZA 3DXZA 3GNSA 4HGYA 4LC1A 2AF3C 2OFPA 4XQCA 3WKBA 4KVGA 2JGEA 3BMOA 1TYEB 4IIJA 4EZBA 4OBBA 3ONWA 3LIIA 1T1RA 1W4ZA 4O4JA 2MYPA 2NW6A 2OO5A 4KR0A 2BTOA 1C9JA 1PJCA 2QY9A 4RZUA 5H83A 5IVHA 1E4EB 1PNRA 2ERXA 3DCNA 3NC1C 2C4WA 3MCVA 1CQZA 2KHZA 2ZT8A 1B15A 4E2XA 4TZ0A 2DF8A 4UZFA 3GYGA 5UKDA 1ZUNA 5GOTA 3UK7A 1NVXQ 2JKZA 2VP2A 4HFNA 3SKXA 4BNKA 5AW1A 1H2HA 2CNKA 2EEPA 5CT5A 4L0MA 4JGGA 1ABEA 5AKEA 1IDN1 5CFMA 3W5AA 4DV3B 2DWOA 3EXHB 2NAPA 4L1KA 1OC2A 2ATXA 4X8HA 2QD4A 3M8KA 2ZYAA 2P1DA 2JJ1A 4WUTA 4HATA 5A7GA 2PQMA 1RPNA 4D9BA 4IOMA 4B6SA 4D3FA 3DEKA 5I5GA 3TYXA 1MNQA 1H1DA 2SICE 1P81A 3JQBA 2O7NA 2XCLA 2J7KA 2YXPX 3LUPA 2JKVA 4PPGA 1EUYA 1T5SA 2AEFA 5FAKA 3F73A 3CYFA 3LWDA 1CETA 1RLOA 4BVKA 1CUFA 1SBYA 3IHLA 4D96A 4X66B 2NZUG 1W85A 2QT9A 3T3HA 2WQ7A 2J0EA 4FYVA 3ZXIA 4YXWA 1PL0A 1WCYA 5DHTA 1X2EA 1GPWB 1P91A 4GXQA 4ZV4A 1YF3A 1T43A 2PGXA 2FN7A 3U81A 4TMKA 1HG0A 1P77A 3DCYA 1J25A 3KAJA 3COVA 1BRMA 1D0IA 1J2EA 5IX8A 1LRJA 5C8YA 4DJTA 4ZYVA 3OY2A 4UC0A 3TQOA 4ZYWA 2O8FB 3PPVA 2LCQA 1SVIA 1EK0A 3G9QA 4WN9A 2ZVDA 2AJTA 1W29A 3E48A 3PGKA 3BX1A 3VTFA 1GL3A 1V9CA 1MJFA 1BCSA 1Z0DA 3GJZA 3LUAA 2Z6AA 3DC7A 1BX3A 3Q7RA 5JXHA 3H0EA 3JASB 1U7ZA 1J20A 3HA5A 4HEQA 3AF0A 1GJRA 3OE4A 4NMXB 4BKUA 9GPBA 5H9WA 1EK6A 1DMRA 1Z2EA 3GEBA 1YQTA 3DVRX 4BZQA 1GLGA 3CINA 2Z8YM 3GC6A 2AQKA 5EIOA 3W8EA 1DWUA 2GEDA 4O0LA 4PYNA 1WABA 4Q6WA 4N5LA 5SYAA 5EJ8A 1KARA 1XD2B 4GG1A 4JB3A 3RIYA 3VKHA 4MVWA 1B0PA 2P9YA 4O02B 4YJ3A 1ADJA 3NHJA 4W82A 3HDVA 1Q0ZA 5FTWA 1ZKMA 1Q1NA 1YVUA 3FJYA 1OH7A 5KAPA 3L0OA 4OMDA 3HJCA 2XYPA 5BWLA 5F3WB 2PRYA 3UXMA 2DR0A 2EC5A 3BJMA 1Z6PA 3DB2A 3ET4A 5L51A 2JC3A 3GHYA 3IEUA 3O8RA 2HPZA 1HE3A 1GA1A 2GJSA 2XTJA 3F1LA 4OHKA 5JIBA 5M34A 5M5BA 3GB9A 1W75A 5AM0A 3JD3A 3QFRA 3ASYA 3ZDZB 5M29A 4RF2A 2OQIA 4PLFA 3ORFA 4MS1A 2H48A 3DOIA 4MYCA 1XJ5A 1II8B 5EXTA 1V5GA 2Z98A 3Q3JB 4XB2A 5AK6A 2XW6A 1TUGA 5A62A 4YQYA 4JFAA 2OZKA 1KI9A 1VLHA 2Z6VA 1E7SA 3LZDA 3KPJA 2ORVA 3PGA1 3TTYA 3DAGA 3D6UA 1AHNA 3HBLA 4IDGA 5IAEA 1SU4A 3JPYA 4DJEC 4DV0B 1T1GA 3G3EA 1BROA 1AKEA 4C4ZA 1VCIA 1E77A 1ML3A 3IUPA 4LTNA 2GVDC 1NVUQ 1NC3A 1PZXA 1T1EA 2H2GA 1C7JA 3DM5A 3HCDA 4IDFA 5BSTA 1U02A 2GKOA 3WMRA 1FYDA 2FGKA 3UA3A 1CRPA 2I62A 2UUPA 1ZL2A 3O3MB 3SQWA 4IWYA 1Q7BA 4DQUA 1LC0A 1QYCA 4PX2A 5LN1A 3K9QO 5FI3A 1YRYE 2R4TA 3JQFC 2HM7A 2V96A 4YWHA 1D5CA 4R9RA 3F2IA 3ZGLA 4TL9A 3WR5A 4B4OA 4ESOA 3P2KA 2NXCA 3SAJA 1EKXA 4IHQA 2WICA 1MRNA 1TA0A 1L5LA 1ZH2A 1OBCA 1ZMRA 5FO1A 4LRYA 1WUJS 4QJ3A 1PK7A 3C5HA 3R0XA 4OHFA 3FVRA 1ZUNB 4UEWA 1E2BA 1C5KA 1SHTX 3C0KA 1NBIA 2ICAA 4D6XA 5ALJA 4IICA 5JVDA 1SKAA 2GCOB 4XQ0A 2O6LA 3TI9A 1GEEA 2W71A 3EY9A 2G4VA 2HZ7A 3LVBA 3T5GA 5J4KA 3L9XA 3CJQA 5AVYA 4ZDWA 5SZHB 3FHJA 1EGMB 1R4NB 3PFKA 4ND8B 5IAJA 1X13A 2OQVA 3K70B 2PX6A 2Y6VA 5JJIA 2ACWA 3IQZA 2HC9A 2HMVA 5I7AA 3LTEA 5FULA 3R4VA 4M21A 4PYOA 1IXKA 3GG2A 4FOPA 5F5XA 2IKSA 5FD8A 4WNAB 3RTEA 3H9EO 4FB4A 4ZKDA 2XNHA 1P17A 3LGAA 4IUBS 4D7AA 4RPCA 2Z6QA 1EWQA 3FDZA 5EQTA 3EWIA 3HVIA 2BFNA 2HN9A 4ALNA 2WU8A 3AR9A 1UWCA 3HU3A 3C7CB 3O2SB 3K9HA 1ULTA 2VJAA 1NQXA 4IWXA 2WZCA 5T3YA 4Y18A 4E4YA 4EAQA 4UXHA 1FX1A 2RJOA 1P18A 4UTZA 1KA9H 5AQEA 2O05A 4NOMA 3UV6A 1QGZA 3OTOB 2RARA 5KTNA 4C2UA 3M3DA 1BXZA 5F2OA 3JY6A 4NIMA 2P2ZA 3H2ZA 1CRLA 1X19A 3HLYA 3C87A 3FF4A 3NO4A 3EFHA 1P60A 5HCIA 4KFTA 3OVMA 4WGFA 4OXNA 4QXMA 1GZ7A 4AMVA 2ESRA 3R5TA 4JELA 5BUZA 3R5JA 5KKCA 2I4RA 3PR3A 4H08A 5EHIA 1YR3A 1G2QA 3Q2OA 5BN4B 2J3JA 3TVDA 2C0PA 2N1MA 1FP4A 2A9JA 2B2XA 2QDXA 3GT3A 4G9BA 2BRUA 4LF7B 2XUAA 3KLMX 5FTKA 2O8BB 1U9IC 2A35A 2I65A 1C4OA 2YJ5A 5F1OA 5HFAA 3TFQA 1A96A 1MJ5A 2CFCA 3BRWD 4WQMA 2GHQA 1V6SA 4I14A 3ZHXA 1QBKC 3A1DA 4OSOA 2OXRA 3OE7A 1I0ZA 2CBGA 1DX4A 2GN6A 1NN1A 2IIQA 4NBSA 3YASA 1WUHS 2B36A 3ECCA 4LI3X 1V7QA 4QNRA 4QDTA 4BTLA 2QAIA 4G0YA 1JV2B 4R84A 2WYWA 4CRWB 5KQRA 4MP6A 4AIRA 3BHMA 3H1EA 4RK1A 3EPLA 4RSGA 5J2TF 1SHLA 2XCUA 3M2TA 1CC1S 1SRRA 2WHRA 3AKDA 3CKLA 4HS4A 2PGDA 2A67A 5JBQA 4QBFA 3K09C 1DG3A 4UKDA 3KQNA 2V7BA 4B7XA 3SN6A 4Q4HA 3E8XA 3OI7A 4I4CA 1WB5A 5HEKA 2IDZA 1KJIA 4B6GA 2I8CA 3K5HA 4B3IA 5IWAB 4H0NA 4RZSA 2Q8NA 3F7NA 2QAJA 4YROA 3RYTC 3W4JA 4G0VA 1RYZA 3GBSA 3JD4A 1O0BA 2GSDA 3D4IA 3OKPA 1YZKA 1P2GA 5CVUA 1QG0A 3TZHA 4YX9A 3KPUA 3LYHA 5I7WA 2ZRJA 5K3FB 1OVGA 2ZUTA 2YVLA 4UQPA 3DOUA 4MR7A 3HACA 5L53A 1FFDA 2FK7A 3KEOA 1UPFA 3DW3X 1PVVA 3H65A 3OFNA 5HF6A 4ZJUA 2JIDA 1LLUA 3I61A 1LPSA 3QMVA 3ETGA 3AUUA 1JHZA 2B4KA 4DMFA 4R2XA 1Z0KA 3AYZB 1X1DA 4Q7LA 5F12A 1CBUA 4TN1A 4DYDA 1JG3A 1GPNA 4G63A 4YGXB 1CYEA 1QH8B 3EGEA 5L95A 2W2MA 4K5QA 3WHKA 1T9ZA 1HH4A 2HBRA 3NEJA 4GX0A 4WFKA 4XWWA 2R0QC 4RZ3A 4Z8YA 5KTOA 3T38A 1FMLA 4RF5A 1E1CB 3RH0A 3NC0C 4RC9A 1I6MA 2CMKA 2CLHB 3EXEA 1VGRA 1OT3A 4CKBB 1N1MA 3HXMA 4DJAA 4CM8B 3P2MA 4MV1A 3PSHA 1J1ZA 3HP7A 2VK4A 3I32A 1L4BA 3OZBA 1ZONA 3BE8A 4JDUA 5KYUB 1CZOA 2FNAA 1K7SN 1TKAA 2J5KA 4WKOA 1WA5A 5DHAA 4YJ3B 3IKLA 4JY7A 4PHGA 3V8EA 3ZCSA 2QTAA 1PEKE 3FPEA 3I9V6 2QW1A 3GW8A 5COBA 4WBNB 3BRWA 3F5SA 3FX2A 5JRZA 2Y92A 3GRKA 5JG7A 1PS8A 5TLSA 2PO5A 1PKEA 3KPYA 1A1VA 1H2XA 1JW9B 2VQDA 5KBYA 1UPAA 1VECA 5KJ6A 4DUPA 5JTUA 1O2DA 2PKXA 5B58T 3II6X 4L5AA 4YAFA 4D4IA 5G0WA 2VTEA 1IUOA 2Q4EA 4GP7A 3IT1A 3OHMA 4QO7A 1Y7IA 1PYOA 1AKRA 2UZIR 4TUYF 1NASA 5CD9A 1CFZA 2F6RA 2CNNA 2EJTA 4U2CA 1NQ5A 3LBIA 4BZZA 2CYCA 4CMGA 2QNIA 3RAGA 1KH1A 3TQFA 1DSSG 1P6XA 2D2IA 3AGQA 1NXSA 3P0RA 5HKKD 3CNNA 1XU4A 3WGZA 1ZGHA 2GF9A 3OJCA 5DKFA 4CM6A 4K9OA 4P3OA 5CBPB 1E0JA 1J00A 1K4MA 2AB0A 2I7CA 2GN4A 4NOKA 3RW9A 3T15A 1BX0A 1QHGA 2ZIWB 3AWIA 2P2CA 2XMGA 3LX6A 3CNOA 4R6XA 3OEED 5MN6A 2LXNA 3GT4A 1GL9B 1QAQA 4EI7A 3SJZA 2Z2YA 4Z9XA 2BGTA 4WBXC 2WZDA 3TRHA 4BWVA 3AEXA 2FEOA 2VXOA 4NAUA 2J67A 1SXJA 3QIVA 1NVBA 4GI7A 4JYCA 3ZGYA 4RS3A 4DQVA 1GQSA 1L8QA 4R2WA 4PPQA 3K0SA 2ZK7A 4YIKA 3PC2A 4M1ZA 1GNQA 2XUZA 2P9ZA 2TS1A 1PGNA 4RA6A 1MF7A 3U4QB 3LE8A 3TECE 5AKYA 1VCHA 5DM1A 2YRFA 1MJGA 4U4AA 5IVIA 4MPPA 5JHGB 1WPXA 4L85A 1OR8A 4B7UA 5AUQA 1DPGA 2ZJ5A 4ZVVA 2VP0A 3ESDA 3MAGA 5DOVA 1QP7A 4TZKA 3LP6A 1P0MA 1QH1A 3SBDA 4D3ZA 3HRHA 3IE0A 4FVTA 4KI0A 3SYTA 5KQMA 4RF3A 1E3WA 3NORA 3WMFA 3F98A 1WZNA 3C3MA 4NI5A 1OX5A 5EQJB 2AI1A 1XYVA 1S7CA 1ZH4A 4PZLA 4RM3A 4WA7A 3C6KA 3L8MA 4TXHA 2QF7A 4J6EA 4F6LA 1W96A 2JGMA 1X1CA 2PA0A 4O29A 5JSFA 4LCBA 2CVHA 2JFWA 4ZU3A 4IXNA 4ZT4A 4NV1A 3ZV7A 4HEA1 1RFLA 2ODBA 2WA1A 4M8KA 1Z5OA 1Y3FE 1M33A 1BOFA 4JCCA 3ORHA 1GQYA 4MS1B 3H0CA 4OGGA 3UWPA 5E9AA 3KYBA 3ZHQA 4PXSA 2W2LD 1Q1QA 3ZR4B 1HE4A 1P4JA 4HGPA 5D85A 1JSZA 4Q4LA 4UHEA 1I2MA 3LHSA 3JAWA 4JJKA 4C21A 3D7RA 1RPZA 1Q2XA 1Y9JA 1Y8QA 2HWXA 5EESA 1TEZA 1Z62A 3EIOA 1PJZA 5AW4A 5GIPE 2CVPA 2Q0SA 1GCUA 2FMTA 3G13A 1WVMA 4EA8A 1PR9A 1IIRA 4GLFA 4RJ2A 3H2YA 4WJLA 1BDJA 4BO0A 1D4ZA 2OVFA 1QH8A 4V0OA 2ATVA 3M3PA 3VHQA 3LDUA 3V1TC 3GK3A 1YVEI 1I14A 1RXYA 4RVOA 4Y8VA 1LCIA 2PGNA 2W83A 4U2DA 1GU7A 2J31A 4YDHB 2H5EA 1LV7A 3O4FA 4LK3A 1FLNA 3CO0S 3TXXA 5JBIA 1Z0UA 5KNDD 5KSYA 1JLRA 3KFXA 3JTEA 4RMHA 2O7QA 4QQ8A 2XT6A 2YWFA 1MAUA 1PJSA 2H2IA 2VLBA 1BJKA 1D2HA 1K7EB 3HV2A 4IV0A 1DTEA 5B1SA 2OV3A 3F90A 4N7JA 2IXGA 2K87A 4D9IA 3UVEA 3VDRA 4EELA 4IOKA 1YBFA 1P0QA 4NYJR 2BI8A 3LA8A 3U4GA 2E55A 2GAFA 3PDHA 4ZP1A 1Y42X 1Y1RA 3SIXA 4BO5A 2JK1A 3OO1A 3V4VB 1GEGA 1Y5IA 1GUYA 3CZCA 2CXQA 3PWZA 3GLTA 2IEBA 3MQ2A 1ZOIA 3WGQA 1TC1A 5JQGB 2WIGA 4X8LA 5FOVA 2C8LA 3O8CA 1XV5A 1CEYA 1RAEA 3U6BA 2WOJA 1KP3A 2GK6A 3S8MA 4QELA 4EL0A 2F62A 1KJYA 4L0CA 2XDQA 4NCIA 2FQXA 3V8BA 4UEOA 1EVLA 5K03A 1ENZA 1GGJA 1ZD3A 1U9ZA 3RUPA 2N0SA 5LQKA 2ETXA 3S8YA 1VMAA 1XRLA 2FKNA 4WLUA 2IUSA 3IAS1 1ODFA 1XNHA 1YQXA 2IT1A 3HU1A 3K2IA 521PA 3QHPA 4IGFA 1YRLA 5JNTA 1K8RA 3THXA 4BFVA 1LNQA 2Z3WA 3O2NA 5KU1A 4RPKA 3CVYA 3VC3A 3ORYA 5LVAA 2Q49A 2B0JA 1Z0AA 4U6SA 1NLFA 2B94A 4Y1EA 7MHTA 3GOHA 4HZIA 1EAYA 4HK4A 2WU3A 5DTEA 3QEJA 2B4AA 4KLZA 1JLHA 3O0TA 4KQ9A 5KWEA 4KQCA 1MPTA 1K68A 2O2SA 1PEDA 1XCOA 4S0ZA 1BFDA 1XNJA 3HLTA 4TROA 1T6BY 4DLKA 1F17A 4D2IA 5ABPA 5G0VA 5C81A 1ZHOA 1DAHA 1H0HA 1P19A 1GRQA 1ODLA 3MXTA 4M86A 3I0MA 1TTQB 2WUGA 3QBDA 2UZ0A 4OHRA 5JC8A 1MIOA 1QIMA 2AF4C 1XA3A 4M7RA 1MU0A 3PX2A 5EMKA 2IHKA 4MR7B 1XMXA 2H1RA 1NLYA 2KBEA 2Q2WA 3AI1A 5THXA 2H2DA 4GZ5A 5KYWB 4JC5A 4MQFA 4BNVA 3BIWA 2HEIA 1XKTA 1R15A 2ZXEA 5ALYA 3GLVA 1GUAA 4X1KA 1QNFA 3L4EA 5TX7A 4EYKA 4TS4A 3NLLA 5HCUA 1QFZA 5CEEA 4UTOA 1BXKA 1I33A 3A05A 3PE6A 1H1LA 10MHA 2XXAB 2P77A 4XB6B 3LA6A 2OZLB 1QHNA 2QVXX 3G0IA 2C3OA 1M9NA 1VKZA 4WH0A 4NF2A 1E6WA 2C5EA 2OAP1 4UU1A 5HDQA 4MR9A 3KB2A 5G4KA 2H54A 4JLDA 3ZC3A 3DZGA 5FWYA 5CVEA 3I30X 3TTWA 1P7VA 2D2EA 3ZE0B 4HLDA 5E6SB 4LCJA 3IUNA 5JEEA 2OV1A 4K3UA 3FOCA 5TXGA 2JLQA 4EPWA 3LO8A 4EHAA 2XNKA 1NQVA 4MV9A 1QOZA 1ZP6A 3SOPA 2O2IA 3CE6A 5TMEA 5AW5A 3UWOA 1GLNA 5A4MS 1MG0A 4B6EA 1I2AA 1NVDA 4KIWA 3WMWA 5CA0B 1Q50A 3QPBA 3Q9UA 3ZQ6A 3FYHA 2QLFA 4IOJA 2REOA 3K6JA 2XD4A 1RLUA 2MHCA 4A4DA 2Q3LA 3I8OA 3FNBA 5DGDA 5IMBA 5AD1A 5EHZA 1RACA 4IJ6A 4I66A 5I8WA 3PUZA 3ONDA 1QH9A 5FI5A 5CBPA 2ST1A 4A7PA 2REBA 3WGMA 1N8SA 1BDHA 1N7IA 2M1ZA 2NU9B 1SR8A 3ZWMA 4YN3A 3CRNA 3WB2A 1R12A 1XZBA 1SOWA 5IM5A 4XEUA 1P44A 1X39A 1NW8A 3TMKA 1TD9A 5IARA 4DV1B 2ARKA 5FHQA 4CDGA 2A86A 3U49A 3W1VA 3LWBA 3PFNA 1ISIA 2L18A 2QPOA 3AL3A 4G5XA 5G3YA 1CDOA 1QVAA 3F9IA 1ACJA 3CLRD 4FR2A 3OZRA 2YW9A 4JXJA 3OC0A 3WLSA 4OLBA 3RRZA 2ERYA 5FV7A 2OFXA 2PWBA 5IXJA 1A9OA 4GZLA 5K3EA 1ZD4A 5ILOA 3NYQA 5TNXA 2F2TA 2P6UA 3C3XA 5AK0A 2CFSA 2X6TA 3SPXA 3OFVA 4GECA 3QQPA 4HXEB 4OA5A 4M9RA 3HBMA 2WOOA 1NPYA 1NR7A 3GG9A 1UJNA 3PEEA 1ODSA 3WL4A 5KYNA 5GVRA 3DGFC 1QGDA 3AUXA 5A3VA 3UKJA 1TF5A 3K5IA 5GONF 4BKPA 3R8CA 2B8JA 3SWWA 3HTXA 3E81A 4HAXA 5JMTA 4KIJA 1XKQA 3HDHA 5JU6A 1HDRA 3A8TA 1ZHFA