1M8AA

Human mip-3alpha/ccl20
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
61
structure length
61
Chain Sequence
b'DCCLGYTDRILHPKFIVGFTRQLANEGCDINAIIFHTKKKLSVCANPKQTWVKYIVRLLSK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Small inducible cytokine A20
publication title The structure of human macrophage inflammatory protein-3alpha /CCL20. Linking antimicrobial and CC chemokine receptor-6-binding activities with human beta-defensins
pubmed doi rcsb
molecule tags Cytokine
total genus 12
structure length 61
sequence length 61
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1m8aA00
1RTOA 2KOLA 2VXWA 2N88A 1XX8A 4X3KA 4CJ0B 2MPMA 1KNAA 4NW2A 3D6WA 4IUTA 1BBXC 1WVLA 4HAEA 4O42A 1B2TA 2NWGA 2MJ8A 2RA4A 1G2SA 2B2YC 2L1BA 1RTNA 5E4XA 1BO0A 1F2LA 2NYZD 2HCCA 2R3ZA 4HSVA 5D65A 1RODA 2X6GA 1SDFA 2B2TC 1GUWA 1DOLA 2B2UC 1ILPA 2KUMA 4UAIA 1G91A 4XDXA 1AZPA 3DEPA 1JICA 2M2LA 4OIKA 3UI2A 1QNKA 2DY8A 1HFNA 1WD1A 1CM9A 1KNEA 2HUGA 1ML0D 2L11A 1EL0A 1HRJA 1BNZA 2K1BA 2CVRA 2HCIA 3DEOA 3FDTA 3GV3A 1EOTA 3Q6SA 4CJ2C 1Q3LA 1QE6A 2B2TA 5EQ0A 2KVMA 1MSGA 5DNFA 2B2WA 2X6LA 1CA5A 2K05A 2FFKB 1PFNA 1WTWA 2L12A 1AZQA 4RWSC 4R9WA 2B2VA 3LWEA 2DY7A 2EE1A 1F9PA 4ZKBB 1X3PA 3I8ZA 2RSOA 3SVMA 1IL8A 5EKIA 2N55A 2FHTA 4DN4M 4X3SA 5E4WC 1ICWA 1TVXA 2NZ1D 2XIWA 1U4MA 3H91A 1WD0A 5EJWA 1HHVA 4IUUA 1DZ1A 1C8CA 4MHEA 1O80A 3QO2A 5JJZA 4XT1B 1RJTA 3MTSA 1A15A 2FMMA 1PFBA 1IKLA 4IUVA 5AFWA 3I91A 4ZLTF 1EIHA 1BF4A 2Q8RE 5EPLA 1G6ZA 1AP0A 1RHPA 3KBXA 1EQTA 2B2YA 4QUFA 2H1EA 4IURA 5CBEE 1F9QA 5COYA 1X32A 2EOTA 1B53A 1U4RA 2JYOA 4R8IA 1PLFA 1DONA 2B2UA 2IL8A 2HDMA 4XT3B 4U68A 3ONAB 5EPJA 1WTQA 1VMPA 3TZDA 1JE4A 1NR2A 4CJ1B 1EIGA 1ESRA 2EPBA 1WTVA 2X69A 1U4LA 1NR4A 1B50A 1B4OA 1ZXTA 2MP1A 2RVLA 3IFDA 4X3UA 5CBAE 3I90A 5CORA 5T1GA 1HA6A 2FJ2A 4X3TA 1WTOA 1WTPA 4HEDA 1F9RA 2HDLA 1HUNA 4OIJA 1HUMA 3MWYW 1S4ZA 1WTXA 1SSOA 1DOKA 2K01A 1B3AA 3FPUB 1X3QA 3P7JA 1CA6A 2J7ZA 1J8IA 1QG7A 2Q8TA 2SDFA 1E0BA 1F9SA 2MGSA 3R93A 4ZK9B 1U4PA 2KECA 4QUCA 1PFMA 4IUPA 4IUQA 3IL8A 2L9HA 1WTRA 1XYIA 3KUPA 1MGSA 3I3CA 1IKMA 3TN2A 1HFGA 4LMQD 5CMDA 4RAUC 1PDQA 2JP1A 4HCSA 3HP3A 2BDNA 1LV9A 1O7ZA 1O7YA 2B2WC 4RA8A 4ZAIA 1NCVA 2K28A 1MSHA 1DOMA 2K03A 2KEEA 3GV6A 1NAPA 1M8AA 2B2VC 3DM1A 1J9OA 3F2UA 2L4NA 4MN3A 5T1IA 1MI2A 1ILQA 2D9UA 3N52A 3G7LA 1VMCA 1SAPA 2KEDA 2K04A 2RSNA 2FINB 5D14A 5EPKA 4ZKCB 1G2TA
chains in the Genus database with same CATH superfamily
1EWHA 1VS0A 4X3KA 1S40A 3JAME 1KNAA 2JA6H 1SNQA 2E2DC 2MHVA 3IKJA 3S1QH 3HOWH 4JPBW 2FMCA 1LT6D 1K73C 2XWBB 2YTVA 4HSVA 1NMGA 4BY1H 1SXTA 1DOLA 4R8NA 5KYIA 1AZPA 1X54A 1CZGA 1QNKA 2DNEA 4AYBB 2NVXB 2DJGC 3BDOA 1PH8A 2GVAA 3NSWA 3GDEA 1R4QB 2EYFA 2M00A 1Q82C 5C0XI 5C0XJ 2DY7A 4S3SA 1A8VA 3TS0A 2QW7A 2D5DA 1DZ1A 1FD7D 5KEEA 4OWXB 2NVTB 2FMMA 4A93G 2O5JC 1ZYRD 1KIXA 5EKLA 1G6ZA 1AP0A 1QUQB 5M5YH 3NWTA 4K6LA 4DV0L 3PMFA 2ZTEA 1Q1EA 5CBEE 1X32A 4KD4A 5G3LF 2HHHL 5DLQE 2IL8A 3J81c 3CCQA 1HZ9A 1KTKA 2OTLA 2JXMB 2NVQH 4DV2Q 2XGTA 1IZ6A 4FXKC 4LF4Q 3F2CA 1XNRL 4CKBA 3VR5A 4KJOA 4KY6A 5LMNW 1EQVA 1CI3M 1KRSA 4M8AA 1EY6A 5G3LD 2UUBQ 2E2HB 2HDLA 1HUNA 4DR7L 4BXXG 1Y1WG 1B3AA 3WOEA 1NUCA 4IPCA 1JOKA 2SDFA 2DN8A 4KLKA 3H3VH 1STBA 3A56A 4RFBA 1WOCA 1V1PA 4PMWA 5M3MB 1EU4A 4B08A 5ELFA 1BOSA 1I50H 2V1CC 4G57A 1SROA 4FF1A 4NDXA 1I4XA 4J6HA 1EY4A 1SNOA 1J9OA 3N52A 2KEDA 4A3EG 1NBWA 2QDBA 3I4NB 2N88A 1XX8A 4LF6Q 3J81i 4HMJA 3OWFA 1EU3A 1Q1BA 1TWHB 1KHIA 4DAMA 1B2TA 2E75C 3WDNA 2JA7G 3A54A 1D2BA 3PO2G 3SXHA 2HCCA 3ZJYC 1HNXQ 1II3A 5A35A 3R2TA 2Q2UA 3M4OB 1U0LA 5TSSA 4FF2A 5L37A 4C3HB 1RF2D 1E1OA 1BCPF 5A2QL 4RH6A 1WI5A 4N8FA 4A93H 3S1NH 3L7ZC 1Y1VB 4YY3Q 3NELA 3I2ZA 3Q24A 2O4XA 2FFKB 1BCPD 3ERQA 2H4OA 4JI1Q 4X65L 3H91A 1HHVA 3F8TA 5LMUQ 2HHHQ 3KLSA 1FNVA 2IX0A 5AFWA 1PFBA 1IKLA 4I7AA 2BDOA 5KNCA 4OXPA 3GD7A 4GKKQ 1TWGH 3QOJA 5KIXA 1PH5A 4BXXH 3RN2A 1Y1WH 2BA1A 2HDMA 4XT3B 5DM73 1ICFB 3NBIA 3V2TA 2A74C 4KJNA 3KLWA 2F52A 2R92B 1UEBA 4LF5L 5CV6A 2X69A 3AFQA 4QCLA 3FRPB 4P2CB 4H7BA 4F8MA 1PTOF 5AJ3L 4DV4L 3RMHA 4DV6L 2IX1A 4DNIA 3JAML 1IYJB 3SK4A 1J5EL 2KA7A 1R9TB 4IOCA 2PMZE 3H09A 4AH6A 2OEOA 1B7YB 2J7ZA 2K7VA 1L1OA 4JI6L 1DGSA 1LTGD 3C1FA 1GOZA 3PGZA 4HJAA 4A3EH 2LSSA 5C44H 3CAMA 1SNDA 3KUPA 3I3CA 1VQAA 3J7AV 4DXFA 1A0IA 1GUNA 3MXNA 3PO2H 5BN5A 1E3PA 5C3EB 3S14B 1A6XA 2FXQA 3S16H 4HIMA 1SLJA 5ELCA 1HTPA 2RQXA 1EY9A 2QKIC 3MFGA 1W2BA 1HZAA 1YIJA 1PH1A 1FNUA 3VYRA 3J80L 4HIKA 1Z47A 5JPMC 2B2YC 2VQFQ 1A3UA 4JI3Q 1X6OA 1SE2A 3K0YA 4DR3L 3E0JA 2ZTCA 4JBMA 4A3GB 2B2UC 3NTIA 3CKIB 2SNSA 4ID6A 1PHJA 3HFZB 1EYCA 3UI2A 1IBKL 2VB3X 1IBLQ 1KNEA 2A6HD 2LMCB 4HCEA 2F0OA 1W6KA 1EZ6A 4WJWA 2B2TA 1K8MA 3SR1A 4KHZA 3S1RB 4YCVA 2IHEA 5I6WA 3FPPA 1XNQL 1JQYD 3PIPA 2XRSD 3LWEA 1AFPA 2AHOB 2SOBA 1Q86C 3SVMA 3CCSA 3LWUA 5EKIA 1U4MA 1JOQA 4YCUA 5JJLA 5JJZA 4IUVA 2G9HD 2M9VA 2YTYA 3X3NA 4A3KG 1S5ED 2EYHA 3LX0A 1VQMA 1YNJC 1C0AA 4GLAC 5JJIA 5CR3A 3CQZB 4KHPL 4DV6Q 1SMYD 4C3IB 3KDFA 3K5OA 4ZQ3A 2F0IA 2LXKA 4FXDA 2EY5A 5C4JB 3CPWA 4H02A 1YNND 1S5CD 2RVLA 5GAGC 4NXNQ 4KN7C 3RD4A 4JI0L 3FVQA 5LL6X 2RBMA 1N32Q 4R4OA 3BS1A 3CRLC 3AMUA 1PYSB 2E5LQ 1GXDC 4X66L 1JE5A 1G8ZD 5IGBA 1J8IA 4L8JA 1KDAA 2HIVA 1E0BA 1QZHA 2IPKD 1YI2A 4RHSA 3E9HA 3K7AH 4U673 3AEVA 1PFMA 4A3MG 2R6GA 1LTAD 4A3IB 2WAQB 5FOBB 1B70B 2UUAL 1IKMA 3MZ5A 3GTPH 4LF8Q 3HOUB 2F0EA 2BA0A 3HP3A 4NPSA 2PI2E 2B2WC 4RA8A 4ULLA 1Z7TA 3HOYG 4GNXA 2D2CC 3GV6A 2K03A 4YHHQ 2B2VC 3GTJH 4LUVA 5T1IA 4DR2L 2EIFA 4MIUA 4C2MB 1MIUA 4ZKCB 1H9SB 2KOLA 4DR3Q 1N8RC 2XN9C 3CCRA 4MTKA 3KF8A 2DUDA 2RA4A 4LF9Q 5LMNQ 3GTOH 3BZCA 2VQEL 3E3XA 4JG2A 1N9WA 5I9PA 2IWHA 1EWCA 4DR4L 2HQEA 2PZWA 1UEAB 5IP9G 1G51A 2JA8B 1EY0A 2QDLA 1SYCA 2PW7A 4GOPC 1V43A 3SK8A 3Q6SA 1A3VA 3E6ZX 4A3KH 4KKUA 1D8LA 2MFIA 2F0DA 4B3TL 5IGCA 3B6YA 3LGJA 3CC7A 2NVXH 4DAYA 4BY7G 4J1MA 3WOFA 4JOIC 4DXGA 1LTTD 3CPFA 4PQXA 1PTOH 1UAPA 5E1FA 4QY7A 2F0KA 3WWVA 2A6EC 1O80A 5JAVA 1I3QH 4Q5VA 1N33L 4KHPQ 4ILWA 2RDHA 2PZUA 2N3SA 4F88A 5BR8Q 5IE8A 2DJFC 4TSSA 5BN3A 2J4XA 2DNCA 1B53A 5M5XB 2VW9A 4QMGA 4K8JA 3CC4A 1Y8NB 3ZYYX 4L5QA 4A3BG 4A3MH 1HCZA 1B44D 1VQOA 3F1ZA 2G9DA 4DV3L 2MQHA 4GN5A 1HZBA 1ASYA 1RCVD 3H94A 1PH6A 3S2HB 2UUAQ 2NN6I 4K5XA 3FPUB 2NVYB 1CA6A 1Q8IA 2E2HH 2UU9Q 1F9SA 2F4VL 4ZK9B 2CW0C 1XYIA 1MGSA 1VF5C 1S5DD 4RAUC 2ZM6L 1Q7YC 1SE4A 4DU9A 4IALA 4BBSB 4A3JG 4QL5A 4HIDA 2D9UA 5D14A 2RCFA 2PZTA 3OW2A 4N8X1 5IP9H 2VQEQ 5M3FB 1A2TA 4GN4B 2CQAA 1QVCA 4DV7L 3C2PA 4C1NI 4V190 4FYDA 3IRBA 4C56C 5F2DA 4BY7H 1SDFA 4JI2Q 3PO3G 4UAIA 2F0UA 1E24A 2F0LA 4B3TQ 1UUPA 1HNZL 1WD1A 2HUGA 2L11A 3M4OH 1OXUA 4RGTA 3TZUA 2BCOA 3A7AB 1Q3LA 2KVMA 1W3SA 1T9HA 3CCUA 2WIIB 1LM0A 4JCVE 5FKAC 3VYTA 1CA5A 4BA1I 1N33Q 1LTRD 1Y1VH 4DAPA 4QJFA 1PRTC 4P72A 4XQNA 5E4WC 1ICWA 4EGVA 2NZ1D 4JBWA 3GTKH 1H9MA 4CBVA 1RJTA 2LXJA 5HGTA 1P8LA 1B9NA 2N8NA 2WFWA 1TT2A 2F3VA 4WJ4A 1RHPA 4QUFA 4IJLA 5HGQA 3H15A 3G4SA 3MXNB 2EOTA 2JE6I 3AB9A 1DONA 2ICEC 4C3JB 4P71A 4DV3Q 1E1TA 2F0MA 2BOSA 2R93G 3MXPA 2Y0SB 1PH3A 1SYGA 1U4LA 4DR6Q 3DHQA 2HT1A 4R4IA 2C9OA 2R92H 1KXLA 4LAAA 1U9RA 1E2VA 3VR4A 2C5CA 3P20A 1EYDA 3M9BA 4DA2A 1RIPA 1SMXA 3D4WA 3ER0A 1AEXA 5E3FA 3AFPA 5JPNC 1PH4A 2DGYA 4PMBA 1IW7C 3VA5A 3OOCA 1CKNA 4WORA 5CMDA 1QOHA 1WCMB 1K28A 1SNPA 3CMEA 1AN8A 1LYLA 1VDZA 4A3DG 5J3BA 3K80C 1TWFH 4DV7Q 2YV5A 5IYCH 4K0KQ 1ILQA 4DV2L 1BVSA 2OF1A 5JVH3 2FINB 4LF4L 1A63A 4G4KA 4JYAQ 4DK6C 1Q8KA 1KQSA 1I6HB 1BDOA 3S9WA 1CKOA 1BBXC 1QVFA 1BKBA 5I2XA 4B3MQ 4YIJA 2Z1CA 5E4XA 1HNWQ 1X3FA 4DUYQ 4P75A 5CV4A 2AKWB 2UXBQ 4CDCC 1CUKA 1GD7A 1ENFA 3K6OA 4POGA 3NENA 4A3GH 1CM9A 2E76C 1JORA 1D1KA 1RDPD 2JEBI 4Y7NH 1KC8C 1BCPB 4A3LG 5ELEA 4APVA 3VR3A 3OSOA 2UXCQ 1QB5D 1GVPA 4K2LA 3EIVA 3L9AX 1G6PA 4DV5Q 2XIWA 4LF6L 3GTGH 1YEZA 2R93H 4MHEA 2K32A 3OHXC 4UP9A 4JC0A 1VQ6A 1CKMA 3FKIB 3C1EA 2NTSA 1D5XC 3JC66 3PIO3 3HOXG 1O78A 2PO4A 3OPOA 1HNXL 3NXWA 5GQOA 4GNXB 5CV5A 1SJHD 3Q8DA 1SFOB 1B1ZA 1O7LA 1FL0A 3HOZG 4OX9L 3S2DB 4CJ1B 1PRTB 4YY3L 1PVOA 2MP1A 4RKLA 3CCLA 5T1GA 1I4RA 2BE5D 1IXRA 1YBYA 5IWAQ 1P16A 1TS3A 1K3RA 5I9OA 2B63G 3KLRA 3BU2A 3MWYW 1WTXA 4A3DH 4JI1L 5FLXE 2E2IH 1QJOA 5EBDA 5IGFA 5LMUL 2AWOA 1LT5D 3HOVB 4IUQA 3NK9A 3D8GA 3H3VI 3M85A 2SEBD 4GKKL 4DF7A 4A3IH 1QVGA 2GN5A 3KF6B 4BS9A 3M3YB 1LV9A 1NSNS 1Y8OB 2F0SA 2R7ZB 4JV5L 4DAYB 2WB1G 3DM1A 1KD1C 1VQBA 4LWCA 1QCBD 3OW7A 3GQBA 2E2JH 3URYA 1VQDA 1SYBA 1FR3A 2UXDQ 1HXYD 1RTOA 1NE3A 4Y52H 1HA5A 4HTHA 3D4RA 3ND9A 2EZVA 4HN7A 1SYEA 1G2SA 3RUZA 3H0GB 4E6IA 3UE0A 1GO3E 1CK1A 1F2MA 4LF7Q 5J39A 4A3LH 3VDYA 1TXYA 2R3ZA 3DXJC 1PH2A 3FP9A 1STYA 5ELNA 3K57A 3D31A 1YITA 3T13A 3I4MB 1JWMD 2DY8A 1HFNA 1LTID 2EY1A 1ML0D 3CCMA 4H13C 4XQJA 1BNZA 2ES2A 4UDUC 3DEOA 3NTKA 3GV3A 4CJ2C 3C3LA 3DWQA 4WFN3 1PZKD 2Z8LA 5C44G 3W5OA 3SK5A 2RHSB 4IFDG 2X6LA 3FHWA 3HOXH 2EJGC 5C6AA 5C4XB 2L12A 2K75A 4PNYA 5IP7H 3D4DA 1LABA 2E8GA 1YJWA 3HOZH 1HPCA 3AYHB 3UDXA 1YNXA 1I4GA 4XT1B 2F0NA 3HKZB 2VQFL 4OX9Q 2QGQA 4JI3L 1Y69U 1HH2P 4TKOB 2H1EA 2B63H 1CSPA 2PCFB 3GTMH 1EZ8A 3EJIA 5M5WH 2UUCQ 2QA4A 1CZWA 4X62Q 1IYVA 1YHAA 5EPJA 1JJ2A 2Q2TA 3D6CA 2K6AA 4O1NA 1IBLL 1VMPA 2CW0D 2EJFC 5M5XH 3I4LA 1B3QA 3V05A 3T1HQ 1TWCB 4L5RC 3CCVA 1JCKB 5CORA 4X3TA 3STBD 1JT8A 5DM63 2EVBA 2WB1E 2A19A 1RD9D 1S4ZA 1XXGA 4B9WA 3G48A 1KRTA 4V0BA 1K9MC 1HZCA 2MGSA 3QOLA 3DLLA 1O7IA 4J8QA 3I73A 1LT4D 4MTNA 4JV5Q 3VR6A 2MUYA 2KHJA 1WTRA 3S17H 3CF5A 4XYOA 4A3FB 4LNQA 5GAEC 5EKKA 3QG1A 4IQZA 2JA5B 1PDQA 2JP1A 4P74A 2B3GA 4ZAIA 2K28A 4RHRA 1PXUA 4ZYSA 2L4NA 1JJGA 1TKWB 2Z4IA 1VMCA 3GTQH 1VQ7A 2VL6A 1Y14B 4IN3A 4CJ0B 1OXVA 4NXNL 2AQ1B 3E9IA 2KQ3A 1T5XD 2R7FA 4UP7A 1PTOD 2NWGA 1N32L 4LW1A 2L1BA 2E5LL 4IFDH 1ENCA 5IIFA 1I6VC 1FVIA 3MA2B 2D0PA 2OCEA 4FF3A 1JICA 2WKCA 4JI7L 1MKHA 3CD6A 4LF8L 1D6EC 1YHQA 1A3TA 2PYKA 2QCPX 3MHBA 3RZDB 1K83B 4YHHL 1MJEA 2WACA 2VUMG 1TR5A 2EE1A 1X3PA 4GOPA 3T4AC 3T16A 2IHFA 2Z4HA 4DV1L 5FLXL 3EVQA 5C4HA 4NP5A 1F2ZA 4LF9L 1PZID 2Q8RE 5LMNL 1IHZA 3L0OA 3GP7A 4O2DA 4R1JA 2CWPA 3TP8A 4BBRG 1TY2A 5FK9C 3S24A 1PLFA 5EGTA 1AE3A 1LACA 3A8KE 4RCOA 2L55A 2PQAA 3VYUA 1FJGQ 4IPDA 1EIGA 1ESRA 4C3JH 1IW7D 1VQKA 1OXSC 4XTCS 3KJPA 5CYUA 2G5DA 2K5NA 2Y0SE 3V96A 1JB7A 2JA6B 2Q8IB 4J15A 1K0RA 2ICIA 2E74C 3HZXA 1H9KA 2V4DA 4OWWB 3S1QB 3HOWB 3E5SA 4KY5A 1S3OA 4AYBG 4N9TA 1CT1D 4BY1B 2CH4W 2I46A 4HJ8A 1TS2A 4GLVB 4UY8C 5CV9A 3NE5B 3TN2A 4CKCA 3L2PA 5BR8L 1L0WA 2XWJB 3J7AF 1IBMQ 3L3OC 1DJRD 1FYCA 4QIWE 1WCMH 1TY0A 3A8IE 4LUOA 4KKTA 5EPKA 1H95A 1WTHA 2PI2A 2K5DA 3VR2A 1G2TA 5K36H 3NBHA 5KNDA 4NW2A 3G71A 4IJHA 1I4HA 4N9PA 4IUTA 2EYLA 4A76A 1TIID 3PQIA 4JI7Q 1SE3A 4KKSA 1MBYA 3SE0A 5D65A 4MNOA 4R4CA 2VUMH 2UU9L 5M5YB 3PUVA 1TWAH 2KENA 2B8FA 4DR1Q 1G91A 4XDXA 3UE1A 1JC7A 4X64Q 5I4DA 3X3MA 1I5FA 1IL2A 5DEHA 1GUTA 1VQPA 1K3BC 2NVQB 1AE2A 4DV1Q 3QWNA 2ENBA 3BDCA 3DWPA 4BBRH 3G6JB 3PIOA 5M3MG 3K7UC 1L1OC 1B8AA 2GVBA 3I8ZA 3J81j 1IL8A 1LO5D 4B9XA 4GLXA 3K59A 1VQJA 1WD0A 2KHIA 1PH9A 2EXDA 3G6EA 4BA2I 2L15A 5GROA 2XRQD 1SNCA 1KDBA 3I91A 4JI8L 5J22A 1BF4A 1PYWD 2D0OA 3KBXA 3O13A 3U4ZA 4JI2L 3FKIH 4AYBE 4R8IA 1QZGA 4L5TA 3I4NG 5HY6A 4U68A 2N49A 4CHTB 2ZT9C 3CXCA 3ULLA 4WRDA 3CMAA 2ZJPA 2EPBA 3TQYA 1L2FA 3NPPA 3TP7A 4KK7A 1WTVA 1HA6A 1CQFA 1TS4A 3BZDB 2BH8A 4EQPA 1VQ9A 1I94Q 1PFSA 1V1PB 1LLRD 4OIJA 5JEAH 1HUMA 1SBBB 4C3HG 1SSOA 4DR5Q 2Q8TA 2NVTH 4OL7A 2MO1A 3MVVA 3UDGA 1Y1VG 1OXXK 4QUCA 5IY0A 3IL8A 5ELOA 1NY4A 3NQIA 3K81C 1XMQQ 4ME3A 2K4KA 1VQHA 1V1OA 3HOVH 3AU7A 2XNAC 4FF4A 2GA4B 4IOAA 4A93B 1UE1A 3KJOA 1MSHA 5LL6S 3TP5A 3PF5A 2EYPA 1VQNA 1OO9B 2A73B 1VQ8A 4DR6L 4KHVA 1HJPA 1EEFD 3BVMA 4OGQC 1A2UA 1BO0A 3U58A 1YJ9A 5KNBA 2R92G 1JWSD 2P5ZX 5M3MH 1KAWA 3H0GH 3RLFA 1TWGB 4LFAQ 2MNAA 1GM5A 1V1QA 2D62A 2EXZA 1PH7A 4C1NK 4I65A 2F0QA 3W1GA 2ATWA 3N6RA 3OYYA 2K1BA 1JWUD 2I5MX 4RGNA 1C9OA 2OQKA 1BCPC 4KV6A 1PZJD 3KFUA 1UWVA 2K05A 2ZJRA 4X6AH 2R7DA 1EYGA 4JI8Q 4K0KL 2K5VA 3I4NH 3GTLB 4H0LC 1STEA 2RSOA 4B3SQ 4JYAL 1TWHH 1TVXA 3UDIA 4HR7B 5IYCG 3QO2A 1KLUD 4DFAA 4A3EB 4DK0A 4B3ML 5C3EG 1HNWL 5FLXc 4DUYL 4HSPA 1GKHA 4IURA 4C3HH 2UXBL 4GNXC 2RCNA 3ICEA 4ABNA 2JA7B 3PO2B 1PV4A 1JE4A 1H9JA 2I07B 4RKBA 3M4YA 1L1OB 3IFDA 5CBAE 1WTOA 4JI5Q 4A3GG 1WTPA 4O0AA 3H6MA 1BBWA 2LFNA 2UXCL 1TWCH 2A8VA 3NUCA 1UE7A 4DPGA 2ZJQA 3PUWA 4YWKA 4DV5L 1CHQD 4DK3C 3K5MA 1N36L 4NB3A 4HJ9A 1LTSD 3MFYA 1FGUA 4NKLA 2WP8J 5IYDG 2NUCA 1NCVA 3A5ZB 1X3EA 2PQEA 1M8AA 4LFCL 3Q22A 2ASBA 1GUWA 4LK1C 1SAPA 4LFBQ 4Z9CB 3OWEB 1BR9A 4UHVA 1EWIA 1JOOA 2K5QA 2MPMA 2A68C 3PSIA 5JVG3 5IWAL 1R9TH 2KCNA 1ASZA 4OO1G 2MJ8A 5CC4A 1TU2B 4C3IG 4TVAB 3J7YW 2F4IA 1K8AC 2WKDA 2WV6D 3PV0A 2PQAB 2A6HC 5K5PA 2QILA 5H1SE 1VQFA 1STNA 2Z6KC 4PZ8A 4RMFA 3T1YQ 3S14H 5C3EH 5GAHC 1MSGA 2F0VA 4L63B 5DNFA 1YJNA 4DAVA 3NQTA 4R9WA 4A3IG 1IYUA 2WAQG 2UXDL 3RZDH 2N55A 4FVMA 3HOUG 3TBIB 3KDFB 1XPRA 3BVZA 3T56B 5JOBA 2OTJA 1BBUA 4LF7L 1SN8A 2A1AA 4GS3A 3GTPB 1SMYC 5C0XG 1M1KC 3I55A 4EX5A 1E7ZA 2VZAA 1YNJD 3W1BA 4ODGA 1WTQA 3MC0B 5IYBH 4B3RQ 3NBHB 3GTJB 5FJ8G 4HMIA 3S1RH 2B8GA 1B4OA 1ZEQX 2A5HA 4JW0A 4PZ7A 2B29A 2O2LD 3NEMA 5IYDH 5IT9c 2VY3A 3IAYA 3BYTB 1N36Q 5ISRA 4P73A 2LKVA 2F1MA 4XXEA 3CHBD 1RKNA 2JA8G 3S1MB 3GTOB 3E0EA 5IP7G 5LHY1 3MEHA 4LFCQ 2TMPA 4RG1A 4DK1A 4HCSA 4OO1H 3CQZH 4C3IH 2AUKA 3CP0A 2UUCL 3EN2A 1SNMA 4X62L 3J7A5 3S15B 4EQ5A 4A3KB 4A75A 3KF8B 4MN3A 5C4JH 1ET6A 4OONA 3QR8A 3T1HL 5IOCA 3T51B 2NTTA 3QB3A 1PTOB 2PNHA 1DXMA 3DM3A 2AUJD 2EY2A 3W3AA 2F0JA 1DCZA 1A62A 1I3QB 1EIYB 2A69C 2OXPA 1F2LA 4R4QA 2WAQE 1H9SA 4KY7A 2NZHA 1RODA 4KMUC 4GKJQ 3J80E 5CV8A 4RGMA 1Q12A 4GZYC 3HOUH 5EBCA 1EOVA 2I0QA 4MZ9A 1EL0A 1HRJA 4OWTB 4AQYL 1EQRA 4A3MB 5FLMG 4IO9A 1SJED 3F2BA 1D5ZC 4I7ZC 5C0XH 4C2MH 1Z6HA 3AQQA 3SEBA 3TEHB 1GHKA 2OT2A 3HOYB 4DUZQ 1XTDA 2K52A 3FMCA 4HIOA 2F3WA 5FJ8H 1WFQA 1LTBD 5KYLA 4CDEC 2A6ED 4BBSG 4KTAA 1U5KA 2B2YA 4TQUS 2RKSA 1NJIC 1CQVA 1SE8A 3Q0AA 1SYDA 2B2UA 4QB4A 1H9RA 1SRUA 3BZKA 4F7XA 5M3FG 4KD3A 2AQ3B 2JA8H 2EQSA 1EY8A 3J7ZC 2PPBC 4FXGC 3RZOB 4G7HC 2KJXA 1Y8PB 1Q46A 2EJMA 4X3UA 2F03A 3A74A 1XJVA 4G7ZC 5D3DA 5BN4A 3U50C 1GUGA 4XYQA 2F0PA 3K8AA 4A4IA 2IX3A 4BY7B 1PA6A 5D3IB 2IW3A 1GJXA 2KECA 1K0SA 4IUPA 4GN3B 1EQQA 4IPHA 5IGDA 4TRDA 1QNUA 3OMGA 2LS01 2KEEA 3NP8A 2L5TA 4ZRZA 5FO8B 2RSNA 1FJGL 2K04A 1SEBD 1XWEA 5KGUA 3CU7A 4F87A 3TMEA 2VXWA 3S2HH 1UNSA 2F0FA 4A3BB 3ERSX 4AIMA 5FLMH 2NVYH 3GTKB 4C3JG 3KLSX 4K5WA 1KDCA 4WJ3M 1DYQA 4DV0Q 4IFDI 1HQMC 1FNWA 3PCOB 4AQYQ 3D0FA 2ALYB 3RLNA 1VQ5A 4IFDJ 5CGKA 2JSOA 2KUMA 2HQLA 5C5MA 2Y0SG 1D5MC 2Z9HA 4ZCKA 1ONLA 4RGOS 3HRZC 3K5LA 1SR3A 3HKSA 1G291 5IGEA 3NHHA 1XNRQ 5IT9E 1K8OA 1D7QA 2HCIA 3DWAA 1PRTF 3QJYA 5EQ0A 4BBSH 1HR0W 2B2WA 2NBFA 1IBML 1PFNA 3OIQA 4RWSC 2F0HA 2B2VA 4DR7Q 1BQQT 1EEID 1X55A 5NUCA 5M3FH 2FHTA 3PUYA 2YU9B 4X3SA 4JI4L 4IZ8A 1VQLA 2L0CA 3P75A 4A3JB 1PRTD 3M4QA 1WCMG 1C8CA 3GTLH 3BVGA 4K2KA 3SHLA 3MTSA 3ITPA 2PNRC 4ZLTF 1E2WA 1JMCA 3OMCA 3H3VC 1QWYA 2RF4A 5K36G 3R2IA 2CCZA 3NWSA 1EQTA 3M7GA 3VYSA 1F9QA 1KABA 2JYOA 1U4RA 4DR1L 2YYZA 4PV1C 1TQOA 3KBGA 2AWNA 5ELDA 1STHA 4X64L 3ULPA 3CC2A 3M4PA 4FO2A 3T53B 3U4VA 4NMZA 1KAAA 3IFTA 3TS2A 3PO3B 1TWFB 2JA7H 5C3XA 2HD3A 4G7OC 1F2YA 1B9MA 1C4QA 3HGBA 2OQ0A 4ZUIA 1AW7A 1ZKOA 1X56A 1CKNB 2XSCA 4LJZC 2QF7A 3MXGA 4JOIA 2KCMA 2RDGA 3HEJA 1U4PA 2CH4A 2CFMA 3J81E 1OTCA 2L9HA 1ESFA 1YZ6A 2A68D 3LNNA 1UE6A 3NTHA 3PF4A 2PW5A 4DGZA 3KYHC 1M90C 3I72A 2BDNA 2EY6A 2K33A 2IT1A 3MAQA 4Y7NB 1NAPA 1LUZA 2AMCB 1QILA 2K5WA 3R8BA 3G7LA 2ZXRA 1ENAA 3FKIG 4K14A 3I4OA 4X65Q 1V9PA 1EFWA 3BDLA 3D6WA 1C7YA 4OEMB 4R4TA 2CHBD 2I5HA 1I94L 1XTCD 1WVLA 3GTGB 4O42A 2R93B 5EAYA 2IJ0A 2ID0A 1XMOL 1RTNA 4DR5L 2NYZD 4PMCA 1S5BD 1BUVT 1R4PB 4XIGS 2Q2HA 2JQOA 5JEAG 4M1UB 1PYBA 1VQGA 1GUOA 2M2LA 4OIKA 4OHJA 2RDFA 4L6TB 4QQBX 3BG3A 4DKAC 1XMQL 4LF5Q 1EOTA 4OELB 1EIFA 1QE6A 4JI4Q 5AJ3Q 1NTGA 4DV4Q 1RL2A 2NB0A 3U9SA 1SYFA 1EY5A 3EQLC 1VQCA 3PUZA 3CRKC 1J5EQ 1AZQA 3HOVG 1E2ZA 3TSSA 1D1IA 4FP5D 1I6HH 2ZTDA 4JI6Q 4A3DB 1X9NA 3I7FA 2SNMA 3KOJA 4JK1C 2E2IB 1A15A 1K8GA 2R7ZG 2VB2X 3A7LA 4PG3A 5EPLA 2VS1A 5FO9B 1PMRA 4HJ7A 2YTXA 1YHBA 3HS0C 4XQQA 5JJKA 4LUZA 5C4ZA 2JJQA 2KBNA 4LFAL 3DUZA 4FDBA 3ONAB 4EQOA 2H5XA 4JBKA 2JA9A 1NR2A 4EQNA 2BE5C 3VA7A 3H0GG 2E2JB 4CDFC 4BWGB 2WINB 3I90A 1ZYRC 4NXML 5HURA 4CGYB 2CKZB 1EFID 3SK6A 3A55A 2OWOA 3I4MG 5JEAJ 3P7JA 1V8QA 3EROA 4DNRB 4B3SL 3A5UA 1TS5A 2LY7A 1EYAA 3R93A 1I4PA 3OIPA 1I50B 3I56A 1S72A 1IBKQ 1HR0L 1LTLA 3S1MH 4KI0A 1OXTA 5C4XG 1L0YB 4PZ6A 1QUQA 3K58A 2A69D 1XPUA 2NN6G 5IT9L 1HTLD 1SFOH 2I5LX 5CV7A 4UPAA 3S2DH 2EYMA 3F2UA 3TREA 1XNQQ 1MI2A 1DD2A 4RCNA 2VNUD 3HOXB 3RN5A 1XMOQ 1MHWC 3S15H 3HKZG 3CCJA 4IUNA 1CSQA 3KF6A 1JB3A 3TP6A 3HOZB 4JI5L 1C48A 1Q90A 3EBEA 4HAEA 2F0TA 1M4VA 4QF4A 4YWMA 3TDQA 2F0GA 2HIXA 3BYYB 2B2TC 4A3CG 3OTOL 4QGUA 2B63B 1HQRD 3R3OA 3MXUA 3S1NB 3DEPA 4EVOA 3GTMB 1YVCA 2K50A 5M5WB 2NZOA 3M3YH 4DNTB 1VCIA 2R7ZH 2CVRA 3A0JA 3SGIA 4KN4C 4L5SA 1EUJA 2KCCA 4JI0Q 1MJCA 1Q81C 2XVSA 4ZUJA 4LFBL 4X66Q 5FO7B 4A3FG 1W6JA 2Z6KA 4DN4M 4CDDC 2JA5G 2WB1B 4HJ5A 3Q23A 3HOYH 1Y1WB 3MEFA 3J81L 2JN4A 3S17B 3JAMc 3GO5A 2QEXA 2JEAI 5J1ZA 3I4MH 1STAA 2KHSA 2KCTA 4NXMQ 4DR2Q 5ELBA 3TZDA 2Z0SA 3STBC 3GTQB 1B50A 3T1YL 2EDGA 1CTMA 2Z6BA 2FJ2A 5C4XH 1X65A 3RZOH 1VQ4A 2EYOA 1F9RA 2NN6H 4YWLA 2PMZB 1DOKA 1HR0Q 3ND8A 1MD2D 1X3QA 5C44B 3A8JE 2JK8A 1S5FD 3C46A 3HKZE 1F77A 2ZXPA 5IODA 1T5EA 1LT3D 1VQEA 4UP8A 3CW2C 4DR4Q 1Z9FA 1AH9A 1WJJA 2O5IC 3SDZA 3J80c 2B39A 3S16B 1O7ZA 3F2DA 1GUSA 2R61A 1GHJA 3M7NA 1DOMA 2K14A 4A3CH 1N34L 4JBJA 3JAMi 1WTWA 5C5LA 4B3RL 5E7NA 3KK7A 3RNUA 1PTOC 3FEWX 3OTOQ 5M9OA 1L0XB 5IYBG 1WYDA 2CWAA 4K6DA 4ALPA 4FNFA 4YCWA 4A3BH 2X6GA 1ILPA 2N78A 4A3FH 5C3WA 1FGBD 3I70A 3TRZA 1X3GA 2JA5H 1KL9A 1NMFA 3PUXA 2JA6G 3FDTA 1EY7A 4GOPB 1JJCB 2F3IA 3QIAA 2RHQB 3HOWG 1KLGD 3HG9A 3RLOA 2K5HA 3EA6A 4K5VA 4BY1G 1VF7A 1XPOA 4ZKBB 1F9PA 3J80i 5I6YA 2XTIA 1CHPD 4IPGA 2F4VQ 5DAUA 5EJWA 4IUUA 2QEJC 1UE5A 4POFA 5KRUA 2Q2IA 1EIHA 1JR0D 3U9OA 2YU9H 3W2DA 3BJUA 2TSSA 2ZXOA 3UDFA 4A3JH 2CQOA 3PIP3 2ZM6Q 4GKJL 5COYA 3P1HA 5A2QE 2C35B 4ME5A 2AQ2B 2IY5B 1NNXA 2BH2A 1NR4A 1K83H 1ZXTA 1CFMA 4QIWB 1I4QA 3DMUA 5GADC 1DM0B 3PO3H 4HEDA 5I2YA 2MO0A 1J6QA 4Q0FA 3K0XA 2K01A 3K7AB 4CKEA 1QG7A 1VQIA 3K5NA 4DUZL 1STGA 3EFXD 2UUBL 2VUMB 1ET9A 1TWAB 3CCEA 5IGGA 1HNZQ 1N34Q 3RR5A 4H44C 1E22A 1HFGA 4LMQD 4K8IA 1YNNC 3D3RA 2EYJA 2J0TD 3ULJA 1O7YA 4OO1I 2F0WA 1BXTA 4JVZA 4BBRB
chains in the Genus database with same CATH topology
1EWHA 4X3KA 3JAME 1KNAA 1SNQA 2E2DC 2MHVA 3IKJA 2FMCA 1LT6D 2XWBB 4HSVA 1SXTA 1DOLA 4R8NA 5KYIA 1AZPA 1CZGA 1QNKA 2DNEA 4AYBB 2NVXB 3BDOA 3NSWA 1R4QB 2EYFA 2M00A 5C0XI 5C0XJ 2DY7A 4S3SA 2D5DA 1DZ1A 1FD7D 5KEEA 2NVTB 2FMMA 2O5JC 1ZYRD 5EKLA 1G6ZA 1AP0A 3NWTA 4K6LA 3PMFA 1Q1EA 5CBEE 1X32A 4KD4A 5G3LF 2IL8A 1KTKA 2JXMB 4FXKC 4CKBA 3VR5A 4KJOA 4KY6A 1EQVA 1CI3M 4M8AA 1EY6A 5G3LD 2E2HB 2HDLA 1HUNA 1B3AA 3WOEA 1NUCA 1JOKA 2SDFA 2DN8A 1STBA 3A56A 4RFBA 1V1PA 4PMWA 5M3MB 1EU4A 4B08A 5ELFA 1BOSA 4G57A 4FF1A 4NDXA 1I4XA 4J6HA 1EY4A 1SNOA 1J9OA 3N52A 2KEDA 2QDBA 3I4NB 2N88A 1XX8A 4HMJA 3OWFA 1EU3A 1Q1BA 1TWHB 1B2TA 2E75C 3WDNA 3A54A 1D2BA 3SXHA 2HCCA 1II3A 5A35A 3R2TA 3M4OB 5TSSA 4FF2A 4C3HB 1RF2D 1BCPF 5A2QL 4RH6A 3L7ZC 1Y1VB 3Q24A 2O4XA 2FFKB 1BCPD 3ERQA 2H4OA 3H91A 1HHVA 3KLSA 5AFWA 1FNVA 2IX0A 1PFBA 1IKLA 2BDOA 5KNCA 3GD7A 3QOJA 5KIXA 2BA1A 2HDMA 4XT3B 5DM73 3NBIA 3V2TA 2A74C 4KJNA 2R92B 5CV6A 2X69A 4QCLA 3FRPB 4P2CB 4H7BA 4F8MA 1PTOF 2IX1A 3RMHA 3JAML 3SK4A 2KA7A 1R9TB 3H09A 2OEOA 2J7ZA 2K7VA 3C1FA 1LTGD 1GOZA 1SNDA 3KUPA 3I3CA 3J7AV 4DXFA 1GUNA 3MXNA 5BN5A 3S14B 5C3EB 1A6XA 5ELCA 1HTPA 2RQXA 1EY9A 2QKIC 3MFGA 1FNUA 3VYRA 3J80L 1Z47A 5JPMC 2B2YC 1A3UA 1SE2A 3K0YA 3E0JA 4A3GB 2B2UC 3NTIA 3CKIB 2SNSA 4ID6A 1EYCA 3UI2A 2VB3X 1KNEA 2A6HD 2LMCB 4HCEA 2F0OA 1W6KA 1EZ6A 4WJWA 2B2TA 1K8MA 3SR1A 4KHZA 3S1RB 5I6WA 3FPPA 1JQYD 2XRSD 3LWEA 1AFPA 2SOBA 3SVMA 3LWUA 5EKIA 1U4MA 1JOQA 5JJZA 4IUVA 2G9HD 2M9VA 3X3NA 1S5ED 2EYHA 3LX0A 1YNJC 5CR3A 3CQZB 1SMYD 4C3IB 3K5OA 4ZQ3A 2F0IA 4FXDA 2EY5A 5C4JB 1YNND 1S5CD 2RVLA 4KN7C 3RD4A 3FVQA 5LL6X 2RBMA 3BS1A 3CRLC 3AMUA 1GXDC 1G8ZD 5IGBA 1J8IA 4L8JA 1KDAA 1E0BA 2IPKD 4RHSA 4U673 1PFMA 2R6GA 1LTAD 4A3IB 2WAQB 5FOBB 1IKMA 3MZ5A 3HOUB 2F0EA 2BA0A 3HP3A 2B2WC 4RA8A 4ULLA 1Z7TA 2D2CC 3GV6A 2K03A 2B2VC 5T1IA 4MIUA 4C2MB 4ZKCB 1H9SB 2KOLA 2XN9C 3KF8A 2RA4A 5I9PA 2IWHA 1EWCA 2HQEA 2PZWA 1UEAB 2JA8B 1EY0A 1SYCA 2PW7A 1V43A 3SK8A 3Q6SA 1A3VA 3E6ZX 4KKUA 2F0DA 5IGCA 4DAYA 4J1MA 3WOFA 4DXGA 1LTTD 4PQXA 1PTOH 1UAPA 5E1FA 2F0KA 2A6EC 1O80A 5JAVA 4Q5VA 4ILWA 2RDHA 2PZUA 4F88A 4TSSA 5BN3A 2J4XA 2DNCA 1B53A 5M5XB 4QMGA 4K8JA 1Y8NB 3ZYYX 1HCZA 1B44D 2G9DA 3S2HB 1RCVD 3H94A 2NN6I 4K5XA 3FPUB 2NVYB 1CA6A 1Q8IA 1F9SA 4ZK9B 2CW0C 1XYIA 1MGSA 1VF5C 1S5DD 4RAUC 1SE4A 4DU9A 4IALA 4BBSB 2D9UA 5D14A 2PZTA 5M3FB 1A2TA 2CQAA 3C2PA 4C1NI 4V190 4FYDA 4C56C 5F2DA 1SDFA 4UAIA 2F0UA 2F0LA 1UUPA 1WD1A 2HUGA 2L11A 1OXUA 4RGTA 3TZUA 2BCOA 3A7AB 1Q3LA 2KVMA 2WIIB 5FKAC 3VYTA 1CA5A 4BA1I 1LTRD 4DAPA 1PRTC 4XQNA 5E4WC 1ICWA 4EGVA 2NZ1D 4JBWA 1H9MA 4CBVA 1RJTA 5HGTA 1B9NA 1TT2A 2F3VA 1RHPA 4QUFA 2EOTA 2JE6I 3AB9A 1DONA 2ICEC 4C3JB 2F0MA 2BOSA 3MXPA 2Y0SB 1SYGA 1U4LA 3DHQA 2C9OA 4LAAA 1U9RA 1E2VA 3VR4A 2C5CA 3P20A 1EYDA 4DA2A 3D4WA 1AEXA 5E3FA 5JPNC 4PMBA 1IW7C 3VA5A 3OOCA 4WORA 5CMDA 1QOHA 1WCMB 1SNPA 1AN8A 1VDZA 1ILQA 2OF1A 5JVH3 2FINB 4G4KA 1I6HB 1BDOA 3S9WA 1BBXC 5I2XA 4YIJA 2Z1CA 5E4XA 5CV4A 1ENFA 3K6OA 1CM9A 2E76C 1JORA 1D1KA 1RDPD 2JEBI 1BCPB 5ELEA 3VR3A 3OSOA 1QB5D 4K2LA 3L9AX 2XIWA 4MHEA 2K32A 3OHXC 3FKIB 3C1EA 2NTSA 1D5XC 3PIO3 1O78A 2PO4A 3OPOA 3NXWA 5CV5A 1SJHD 1SFOB 1B1ZA 1O7LA 3S2DB 4CJ1B 1PRTB 2MP1A 4RKLA 5T1GA 1I4RA 2BE5D 1TS3A 5I9OA 3KLRA 3MWYW 1WTXA 5FLXE 1QJOA 5EBDA 5IGFA 2AWOA 1LT5D 3HOVB 4IUQA 3NK9A 3D8GA 3M85A 2SEBD 4DF7A 3M3YB 4BS9A 1LV9A 1NSNS 1Y8OB 2F0SA 2R7ZB 3DM1A 1QCBD 3OW7A 3GQBA 3URYA 1SYBA 1FR3A 1HXYD 1RTOA 1HA5A 4HTHA 3D4RA 3ND9A 2EZVA 4HN7A 1SYEA 1G2SA 3RUZA 3H0GB 4E6IA 1CK1A 1F2MA 5J39A 2R3ZA 3DXJC 1STYA 3K57A 3D31A 3T13A 3I4MB 1JWMD 2DY8A 1HFNA 1LTID 2EY1A 1ML0D 4H13C 4XQJA 1BNZA 3C3LA 4UDUC 3DEOA 3NTKA 3GV3A 4CJ2C 3DWQA 4WFN3 1PZKD 2Z8LA 3SK5A 4IFDG 2X6LA 2EJGC 5C6AA 5C4XB 2L12A 4PNYA 3D4DA 1LABA 1HPCA 1I4GA 4XT1B 2F0NA 3HKZB 1Y69U 4TKOB 2H1EA 2PCFB 1EZ8A 3EJIA 1CZWA 1IYVA 5EPJA 3D6CA 2K6AA 4O1NA 1VMPA 2CW0D 2EJFC 3I4LA 3V05A 1TWCB 1JCKB 5CORA 4X3TA 5DM63 2EVBA 1RD9D 1S4ZA 1XXGA 4B9WA 4V0BA 2MGSA 3QOLA 4J8QA 3I73A 1LT4D 3VR6A 2MUYA 1WTRA 4XYOA 4A3FB 5EKKA 3QG1A 4IQZA 2JA5B 1PDQA 2JP1A 4ZAIA 2K28A 4RHRA 1PXUA 4ZYSA 2L4NA 1TKWB 2Z4IA 1VMCA 4IN3A 4CJ0B 1OXVA 2AQ1B 2KQ3A 1T5XD 1PTOD 2NWGA 2L1BA 4IFDH 1ENCA 5IIFA 1I6VC 3MA2B 4FF3A 1JICA 2WKCA 1D6EC 1A3TA 2PYKA 2QCPX 3MHBA 3RZDB 1K83B 2WACA 1TR5A 2EE1A 1X3PA 3T4AC 3T16A 2Z4HA 5FLXL 3EVQA 5C4HA 4NP5A 1F2ZA 1PZID 2Q8RE 1IHZA 3GP7A 3TP8A 1TY2A 5FK9C 1PLFA 5EGTA 1LACA 3A8KE 4RCOA 2L55A 3VYUA 1EIGA 1ESRA 1IW7D 1OXSC 4XTCS 5CYUA 3V96A 2JA6B 2Q8IB 2ICIA 2E74C 3HZXA 1H9KA 2V4DA 3S1QB 3HOWB 3E5SA 4KY5A 4N9TA 1CT1D 4BY1B 2I46A 1TS2A 5CV9A 3NE5B 3TN2A 4CKCA 2XWJB 3J7AF 3L3OC 1DJRD 1FYCA 1TY0A 3A8IE 4KKTA 5EPKA 3VR2A 2K5DA 1G2TA 5K36H 3NBHA 5KNDA 4NW2A 1I4HA 4N9PA 4IUTA 2EYLA 1TIID 1SE3A 4KKSA 1MBYA 3SE0A 5D65A 5M5YB 3PUVA 2B8FA 1G91A 4XDXA 1JC7A 5I4DA 3X3MA 5DEHA 1GUTA 2NVQB 3QWNA 2ENBA 3BDCA 3DWPA 3G6JB 3I8ZA 1IL8A 1LO5D 4B9XA 3K59A 1WD0A 4BA2I 2XRQD 1SNCA 1KDBA 3I91A 5J22A 1BF4A 1PYWD 3KBXA 3O13A 4R8IA 4U68A 4CHTB 2ZT9C 4WRDA 2EPBA 3NPPA 3TP7A 1WTVA 4KK7A 1HA6A 1CQFA 1TS4A 3BZDB 4EQPA 1V1PB 1LLRD 4OIJA 5JEAH 1HUMA 1SBBB 4C3HG 1SSOA 2Q8TA 4OL7A 3MVVA 1OXXK 4QUCA 3IL8A 3NQIA 1V1OA 3AU7A 2XNAC 4FF4A 2GA4B 4A93B 1MSHA 5LL6S 3TP5A 2EYPA 1OO9B 2A73B 4KHVA 1EEFD 3BVMA 4OGQC 1A2UA 1BO0A 5KNBA 1JWSD 3RLFA 1TWGB 2D62A 2EXZA 4C1NK 4I65A 2F0QA 3N6RA 2K1BA 1JWUD 4RGNA 1BCPC 4KV6A 1PZJD 2K05A 3GTLB 4H0LC 1STEA 2RSOA 1TVXA 4HR7B 3QO2A 1KLUD 4DFAA 4A3EB 4DK0A 4HSPA 4IURA 4ABNA 2JA7B 3PO2B 1JE4A 1H9JA 2I07B 4RKBA 3M4YA 3IFDA 5CBAE 1WTOA 1WTPA 3H6MA 2LFNA 3NUCA 3PUWA 1CHQD 3K5MA 1LTSD 3MFYA 4NKLA 2WP8J 2NUCA 1NCVA 2PQEA 1M8AA 3Q22A 1GUWA 4LK1C 1SAPA 4Z9CB 3OWEB 1BR9A 1JOOA 2K5QA 2MPMA 2A68C 5JVG3 2KCNA 4OO1G 2MJ8A 5CC4A 1TU2B 4C3IG 3J7YW 2F4IA 2WKDA 2WV6D 3PV0A 2A6HC 5K5PA 2QILA 1STNA 1MSGA 2F0VA 4L63B 5DNFA 4DAVA 3NQTA 4R9WA 1IYUA 2N55A 4FVMA 3TBIB 3BVZA 3T56B 5JOBA 3GTPB 1SMYC 5C0XG 1YNJD 4ODGA 1WTQA 3MC0B 3GTJB 4HMIA 2B8GA 1B4OA 1ZEQX 2A5HA 2O2LD 3IAYA 3BYTB 5ISRA 2LKVA 2F1MA 4XXEA 3CHBD 1RKNA 3S1MB 3GTOB 5LHY1 3MEHA 2TMPA 4DK1A 4HCSA 4OO1H 2AUKA 1SNMA 3S15B 4A3KB 4MN3A 1ET6A 5IOCA 3T51B 2NTTA 3QB3A 1PTOB 1DXMA 2AUJD 2EY2A 3W3AA 2F0JA 1DCZA 1I3QB 2A69C 2OXPA 1F2LA 4KY7A 1H9SA 4KMUC 1RODA 3J80E 5CV8A 4RGMA 1Q12A 4GZYC 5EBCA 1EL0A 1HRJA 4A3MB 1SJED 1D5ZC 4I7ZC 5C0XH 1Z6HA 3SEBA 1GHKA 2OT2A 3HOYB 3FMCA 2F3WA 1LTBD 5KYLA 2A6ED 4KTAA 2B2YA 4TQUS 2RKSA 1CQVA 3Q0AA 1SYDA 2B2UA 4QB4A 1H9RA 4F7XA 4KD3A 2AQ3B 1EY8A 2PPBC 4FXGC 3RZOB 4G7HC 2KJXA 1Y8PB 2EJMA 4X3UA 2F03A 4G7ZC 5D3DA 5BN4A 1GUGA 4XYQA 2F0PA 2IX3A 4BY7B 5D3IB 2IW3A 1GJXA 2KECA 4IUPA 5IGDA 4TRDA 1QNUA 3OMGA 2LS01 2KEEA 3NP8A 2L5TA 4ZRZA 5FO8B 2RSNA 2K04A 1SEBD 1XWEA 5KGUA 3CU7A 4F87A 3TMEA 2VXWA 1UNSA 2F0FA 4A3BB 3GTKB 4C3JG 3KLSX 4K5WA 1KDCA 1DYQA 4IFDI 1HQMC 1FNWA 4IFDJ 5CGKA 2JSOA 2KUMA 5C5MA 1D5MC 1ONLA 4RGOS 3HRZC 3K5LA 1G291 5IGEA 3NHHA 5IT9E 1K8OA 2HCIA 3DWAA 1PRTF 3QJYA 5EQ0A 2B2WA 2NBFA 1PFNA 3OIQA 4RWSC 2F0HA 2B2VA 1BQQT 1EEID 5NUCA 2FHTA 3PUYA 2YU9B 4X3SA 4IZ8A 2L0CA 3P75A 4A3JB 1PRTD 1C8CA 3BVGA 4K2KA 3SHLA 3MTSA 3ITPA 2PNRC 4ZLTF 1E2WA 3OMCA 3H3VC 1QWYA 5K36G 3R2IA 3NWSA 1EQTA 3M7GA 3VYSA 1F9QA 1KABA 2JYOA 1U4RA 2YYZA 4PV1C 1TQOA 3KBGA 2AWNA 5ELDA 1STHA 4FO2A 3T53B 4NMZA 1KAAA 3IFTA 3PO3B 1TWFB 5C3XA 4G7OC 1F2YA 1B9MA 1C4QA 3HGBA 4ZUIA 1AW7A 1ZKOA 2XSCA 4LJZC 2QF7A 3MXGA 2RDGA 3HEJA 1U4PA 3J81E 2L9HA 1ESFA 2A68D 3LNNA 3NTHA 2PW5A 4DGZA 3I72A 2BDNA 2EY6A 2K33A 2IT1A 3MAQA 4Y7NB 1NAPA 1QILA 2K5WA 3R8BA 3G7LA 2ZXRA 1ENAA 4K14A 3BDLA 3D6WA 2CHBD 1XTCD 1WVLA 3GTGB 4O42A 2R93B 2IJ0A 2ID0A 1RTNA 2NYZD 4PMCA 1S5BD 1BUVT 1R4PB 4XIGS 5JEAG 4M1UB 1GUOA 2M2LA 4OIKA 4OHJA 2RDFA 4L6TB 3BG3A 1EOTA 1QE6A 2NB0A 3U9SA 1SYFA 1EY5A 3EQLC 3PUZA 3CRKC 1AZQA 1E2ZA 3TSSA 1D1IA 4FP5D 4A3DB 2SNMA 4JK1C 2E2IB 1A15A 2VB2X 3A7LA 5EPLA 5FO9B 1PMRA 3HS0C 4XQQA 5C4ZA 3DUZA 3ONAB 4EQOA 1NR2A 4EQNA 2BE5C 3VA7A 2E2JB 4BWGB 2WINB 3I90A 1ZYRC 5HURA 4CGYB 1EFID 3SK6A 3A55A 5JEAJ 3P7JA 1V8QA 3EROA 4DNRB 1TS5A 2LY7A 1EYAA 3R93A 1I4PA 3OIPA 1I50B 4KI0A 1OXTA 1L0YB 3K58A 2A69D 2NN6G 5IT9L 1HTLD 5CV7A 2EYMA 3F2UA 1MI2A 1DD2A 4RCNA 2VNUD 3HOXB 4IUNA 1JB3A 3TP6A 3HOZB 1C48A 1Q90A 4HAEA 2F0TA 1M4VA 4QF4A 3TDQA 2F0GA 3BYYB 2B2TC 2B63B 1HQRD 3R3OA 3MXUA 3S1NB 3DEPA 4EVOA 3GTMB 5M5WB 4DNTB 1VCIA 2CVRA 4KN4C 2KCCA 2XVSA 4ZUJA 5FO7B 1W6JA 4DN4M 2WB1B 3Q23A 1Y1WB 3J81L 3S17B 3GO5A 2JEAI 5J1ZA 1STAA 2KHSA 5ELBA 3TZDA 3GTQB 1B50A 2EDGA 1CTMA 2FJ2A 2EYOA 1F9RA 2NN6H 2PMZB 1DOKA 3ND8A 1MD2D 1X3QA 5C44B 3A8JE 3C46A 1S5FD 1F77A 2ZXPA 5IODA 1T5EA 1LT3D 2O5IC 3SDZA 2B39A 3S16B 1O7ZA 1GUSA 2R61A 1GHJA 3M7NA 1DOMA 1WTWA 5C5LA 3KK7A 1PTOC 3FEWX 5M9OA 1L0XB 4K6DA 4FNFA 2X6GA 1ILPA 5C3WA 1FGBD 3I70A 3PUXA 3FDTA 1EY7A 3QIAA 1KLGD 3HG9A 3EA6A 4K5VA 1VF7A 4ZKBB 1F9PA 5I6YA 1CHPD 5DAUA 5EJWA 4IUUA 2QEJC 5KRUA 1EIHA 1JR0D 3U9OA 3W2DA 2TSSA 2ZXOA 3PIP3 5COYA 3P1HA 5A2QE 4ME5A 2AQ2B 1NR4A 1ZXTA 1CFMA 4QIWB 1I4QA 3DMUA 1DM0B 4HEDA 5I2YA 4Q0FA 2K01A 3K7AB 4CKEA 1QG7A 3K5NA 1STGA 3EFXD 2VUMB 1ET9A 1TWAB 5IGGA 4H44C 1HFGA 4LMQD 4K8IA 1YNNC 3D3RA 2EYJA 2J0TD 1O7YA 4OO1I 2F0WA 1BXTA 4BBRB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RTO A;  2KOL A;  2VXW A;  2N88 A;  1XX8 A;  4X3K A;  4CJ0 B;  2MPM A;  1KNA A;  4NW2 A;  3D6W A;  4IUT A;  1BBX C;  1WVL A;  4HAE A;  4O42 A;  1B2T A;  2NWG A;  2MJ8 A;  2RA4 A;  1G2S A;  2B2Y C;  2L1B A;  1RTN A;  5E4X A;  1BO0 A;  1F2L A;  2NYZ D;  2HCC A;  2R3Z A;  4HSV A;  5D65 A;  1ROD A;  2X6G A;  1SDF A;  2B2T C;  1GUW A;  1DOL A;  2B2U C;  1ILP A;  2KUM A;  4UAI A;  1G91 A;  4XDX A;  1AZP A;  3DEP A;  1JIC A;  2M2L A;  4OIK A;  3UI2 A;  1QNK A;  2DY8 A;  1HFN A;  1WD1 A;  1CM9 A;  1KNE A;  2HUG A;  1ML0 D;  2L11 A;  1EL0 A;  1HRJ A;  1BNZ A;  2K1B A;  2CVR A;  2HCI A;  3DEO A;  3FDT A;  3GV3 A;  1EOT A;  3Q6S A;  4CJ2 C;  1Q3L A;  1QE6 A;  2B2T A;  5EQ0 A;  2KVM A;  1MSG A;  5DNF A;  2B2W A;  2X6L A;  1CA5 A;  2K05 A;  2FFK B;  1PFN A;  1WTW A;  2L12 A;  1AZQ A;  4RWS C;  4R9W A;  2B2V A;  3LWE A;  2DY7 A;  2EE1 A;  1F9P A;  4ZKB B;  1X3P A;  3I8Z A;  2RSO A;  3SVM A;  1IL8 A;  5EKI A;  2N55 A;  2FHT A;  4DN4 M;  4X3S A;  5E4W C;  1ICW A;  1TVX A;  2NZ1 D;  2XIW A;  1U4M A;  3H91 A;  1WD0 A;  5EJW A;  1HHV A;  4IUU A;  1DZ1 A;  1C8C A;  4MHE A;  1O80 A;  3QO2 A;  5JJZ A;  4XT1 B;  1RJT A;  3MTS A;  1A15 A;  2FMM A;  1PFB A;  1IKL A;  4IUV A;  5AFW A;  3I91 A;  4ZLT F;  1EIH A;  1BF4 A;  2Q8R E;  5EPL A;  1G6Z A;  1AP0 A;  1RHP A;  3KBX A;  1EQT A;  2B2Y A;  4QUF A;  2H1E A;  4IUR A;  5CBE E;  1F9Q A;  5COY A;  1X32 A;  2EOT A;  1B53 A;  1U4R A;  2JYO A;  4R8I A;  1PLF A;  1DON A;  2B2U A;  2IL8 A;  2HDM A;  4XT3 B;  4U68 A;  3ONA B;  5EPJ A;  1WTQ A;  1VMP A;  3TZD A;  1JE4 A;  1NR2 A;  4CJ1 B;  1EIG A;  1ESR A;  2EPB A;  1WTV A;  2X69 A;  1U4L A;  1NR4 A;  1B50 A;  1B4O A;  1ZXT A;  2MP1 A;  2RVL A;  3IFD A;  4X3U A;  5CBA E;  3I90 A;  5COR A;  5T1G A;  1HA6 A;  2FJ2 A;  4X3T A;  1WTO A;  1WTP A;  4HED A;  1F9R A;  2HDL A;  1HUN A;  4OIJ A;  1HUM A;  3MWY W;  1S4Z A;  1WTX A;  1SSO A;  1DOK A;  2K01 A;  1B3A A;  3FPU B;  1X3Q A;  3P7J A;  1CA6 A;  2J7Z A;  1J8I A;  1QG7 A;  2Q8T A;  2SDF A;  1E0B A;  1F9S A;  2MGS A;  3R93 A;  4ZK9 B;  1U4P A;  2KEC A;  4QUC A;  1PFM A;  4IUP A;  4IUQ A;  3IL8 A;  2L9H A;  1WTR A;  1XYI A;  3KUP A;  1MGS A;  3I3C A;  1IKM A;  3TN2 A;  1HFG A;  4LMQ D;  5CMD A;  4RAU C;  1PDQ A;  2JP1 A;  4HCS A;  3HP3 A;  2BDN A;  1LV9 A;  1O7Z A;  1O7Y A;  2B2W C;  4RA8 A;  4ZAI A;  1NCV A;  2K28 A;  1MSH A;  1DOM A;  2K03 A;  2KEE A;  3GV6 A;  1NAP A;  1M8A A;  2B2V C;  3DM1 A;  1J9O A;  3F2U A;  2L4N A;  4MN3 A;  5T1I A;  1MI2 A;  1ILQ A;  2D9U A;  3N52 A;  3G7L A;  1VMC A;  1SAP A;  2KED A;  2K04 A;  2RSN A;  2FIN B;  5D14 A;  5EPK A;  4ZKC B;  1G2T A; 
#chains in the Genus database with same CATH topology
 1EWH A;  1VS0 A;  4X3K A;  1S40 A;  3JAM E;  1KNA A;  2JA6 H;  1SNQ A;  2E2D C;  2MHV A;  3IKJ A;  3S1Q H;  3HOW H;  4JPB W;  2FMC A;  1LT6 D;  1K73 C;  2XWB B;  2YTV A;  4HSV A;  1NMG A;  4BY1 H;  1SXT A;  1DOL A;  4R8N A;  5KYI A;  1AZP A;  1X54 A;  1CZG A;  1QNK A;  2DNE A;  4AYB B;  2NVX B;  2DJG C;  3BDO A;  1PH8 A;  2GVA A;  3NSW A;  3GDE A;  1R4Q B;  2EYF A;  2M00 A;  1Q82 C;  5C0X I;  5C0X J;  2DY7 A;  4S3S A;  1A8V A;  3TS0 A;  2QW7 A;  2D5D A;  1DZ1 A;  1FD7 D;  5KEE A;  4OWX B;  2NVT B;  2FMM A;  4A93 G;  2O5J C;  1ZYR D;  1KIX A;  5EKL A;  1G6Z A;  1AP0 A;  1QUQ B;  5M5Y H;  3NWT A;  4K6L A;  4DV0 L;  3PMF A;  2ZTE A;  1Q1E A;  5CBE E;  1X32 A;  4KD4 A;  5G3L F;  2HHH L;  5DLQ E;  2IL8 A;  3J81 c;  3CCQ A;  1HZ9 A;  1KTK A;  2OTL A;  2JXM B;  2NVQ H;  4DV2 Q;  2XGT A;  1IZ6 A;  4FXK C;  4LF4 Q;  3F2C A;  1XNR L;  4CKB A;  3VR5 A;  4KJO A;  4KY6 A;  5LMN W;  1EQV A;  1CI3 M;  1KRS A;  4M8A A;  1EY6 A;  5G3L D;  2UUB Q;  2E2H B;  2HDL A;  1HUN A;  4DR7 L;  4BXX G;  1Y1W G;  1B3A A;  3WOE A;  1NUC A;  4IPC A;  1JOK A;  2SDF A;  2DN8 A;  4KLK A;  3H3V H;  1STB A;  3A56 A;  4RFB A;  1WOC A;  1V1P A;  4PMW A;  5M3M B;  1EU4 A;  4B08 A;  5ELF A;  1BOS A;  1I50 H;  2V1C C;  4G57 A;  1SRO A;  4FF1 A;  4NDX A;  1I4X A;  4J6H A;  1EY4 A;  1SNO A;  1J9O A;  3N52 A;  2KED A;  4A3E G;  1NBW A;  2QDB A;  3I4N B;  2N88 A;  1XX8 A;  4LF6 Q;  3J81 i;  4HMJ A;  3OWF A;  1EU3 A;  1Q1B A;  1TWH B;  1KHI A;  4DAM A;  1B2T A;  2E75 C;  3WDN A;  2JA7 G;  3A54 A;  1D2B A;  3PO2 G;  3SXH A;  2HCC A;  3ZJY C;  1HNX Q;  1II3 A;  5A35 A;  3R2T A;  2Q2U A;  3M4O B;  1U0L A;  5TSS A;  4FF2 A;  5L37 A;  4C3H B;  1RF2 D;  1E1O A;  1BCP F;  5A2Q L;  4RH6 A;  1WI5 A;  4N8F A;  4A93 H;  3S1N H;  3L7Z C;  1Y1V B;  4YY3 Q;  3NEL A;  3I2Z A;  3Q24 A;  2O4X A;  2FFK B;  1BCP D;  3ERQ A;  2H4O A;  4JI1 Q;  4X65 L;  3H91 A;  1HHV A;  3F8T A;  5LMU Q;  2HHH Q;  3KLS A;  1FNV A;  2IX0 A;  5AFW A;  1PFB A;  1IKL A;  4I7A A;  2BDO A;  5KNC A;  4OXP A;  3GD7 A;  4GKK Q;  1TWG H;  3QOJ A;  5KIX A;  1PH5 A;  4BXX H;  3RN2 A;  1Y1W H;  2BA1 A;  2HDM A;  4XT3 B;  5DM7 3;  1ICF B;  3NBI A;  3V2T A;  2A74 C;  4KJN A;  3KLW A;  2F52 A;  2R92 B;  1UEB A;  4LF5 L;  5CV6 A;  2X69 A;  3AFQ A;  4QCL A;  3FRP B;  4P2C B;  4H7B A;  4F8M A;  1PTO F;  5AJ3 L;  4DV4 L;  3RMH A;  4DV6 L;  2IX1 A;  4DNI A;  3JAM L;  1IYJ B;  3SK4 A;  1J5E L;  2KA7 A;  1R9T B;  4IOC A;  2PMZ E;  3H09 A;  4AH6 A;  2OEO A;  1B7Y B;  2J7Z A;  2K7V A;  1L1O A;  4JI6 L;  1DGS A;  1LTG D;  3C1F A;  1GOZ A;  3PGZ A;  4HJA A;  4A3E H;  2LSS A;  5C44 H;  3CAM A;  1SND A;  3KUP A;  3I3C A;  1VQA A;  3J7A V;  4DXF A;  1A0I A;  1GUN A;  3MXN A;  3PO2 H;  5BN5 A;  1E3P A;  5C3E B;  3S14 B;  1A6X A;  2FXQ A;  3S16 H;  4HIM A;  1SLJ A;  5ELC A;  1HTP A;  2RQX A;  1EY9 A;  2QKI C;  3MFG A;  1W2B A;  1HZA A;  1YIJ A;  1PH1 A;  1FNU A;  3VYR A;  3J80 L;  4HIK A;  1Z47 A;  5JPM C;  2B2Y C;  2VQF Q;  1A3U A;  4JI3 Q;  1X6O A;  1SE2 A;  3K0Y A;  4DR3 L;  3E0J A;  2ZTC A;  4JBM A;  4A3G B;  2B2U C;  3NTI A;  3CKI B;  2SNS A;  4ID6 A;  1PHJ A;  3HFZ B;  1EYC A;  3UI2 A;  1IBK L;  2VB3 X;  1IBL Q;  1KNE A;  2A6H D;  2LMC B;  4HCE A;  2F0O A;  1W6K A;  1EZ6 A;  4WJW A;  2B2T A;  1K8M A;  3SR1 A;  4KHZ A;  3S1R B;  4YCV A;  2IHE A;  5I6W A;  3FPP A;  1XNQ L;  1JQY D;  3PIP A;  2XRS D;  3LWE A;  1AFP A;  2AHO B;  2SOB A;  1Q86 C;  3SVM A;  3CCS A;  3LWU A;  5EKI A;  1U4M A;  1JOQ A;  4YCU A;  5JJL A;  5JJZ A;  4IUV A;  2G9H D;  2M9V A;  2YTY A;  3X3N A;  4A3K G;  1S5E D;  2EYH A;  3LX0 A;  1VQM A;  1YNJ C;  1C0A A;  4GLA C;  5JJI A;  5CR3 A;  3CQZ B;  4KHP L;  4DV6 Q;  1SMY D;  4C3I B;  3KDF A;  3K5O A;  4ZQ3 A;  2F0I A;  2LXK A;  4FXD A;  2EY5 A;  5C4J B;  3CPW A;  4H02 A;  1YNN D;  1S5C D;  2RVL A;  5GAG C;  4NXN Q;  4KN7 C;  3RD4 A;  4JI0 L;  3FVQ A;  5LL6 X;  2RBM A;  1N32 Q;  4R4O A;  3BS1 A;  3CRL C;  3AMU A;  1PYS B;  2E5L Q;  1GXD C;  4X66 L;  1JE5 A;  1G8Z D;  5IGB A;  1J8I A;  4L8J A;  1KDA A;  2HIV A;  1E0B A;  1QZH A;  2IPK D;  1YI2 A;  4RHS A;  3E9H A;  3K7A H;  4U67 3;  3AEV A;  1PFM A;  4A3M G;  2R6G A;  1LTA D;  4A3I B;  2WAQ B;  5FOB B;  1B70 B;  2UUA L;  1IKM A;  3MZ5 A;  3GTP H;  4LF8 Q;  3HOU B;  2F0E A;  2BA0 A;  3HP3 A;  4NPS A;  2PI2 E;  2B2W C;  4RA8 A;  4ULL A;  1Z7T A;  3HOY G;  4GNX A;  2D2C C;  3GV6 A;  2K03 A;  4YHH Q;  2B2V C;  3GTJ H;  4LUV A;  5T1I A;  4DR2 L;  2EIF A;  4MIU A;  4C2M B;  1MIU A;  4ZKC B;  1H9S B;  2KOL A;  4DR3 Q;  1N8R C;  2XN9 C;  3CCR A;  4MTK A;  3KF8 A;  2DUD A;  2RA4 A;  4LF9 Q;  5LMN Q;  3GTO H;  3BZC A;  2VQE L;  3E3X A;  4JG2 A;  1N9W A;  5I9P A;  2IWH A;  1EWC A;  4DR4 L;  2HQE A;  2PZW A;  1UEA B;  5IP9 G;  1G51 A;  2JA8 B;  1EY0 A;  2QDL A;  1SYC A;  2PW7 A;  4GOP C;  1V43 A;  3SK8 A;  3Q6S A;  1A3V A;  3E6Z X;  4A3K H;  4KKU A;  1D8L A;  2MFI A;  2F0D A;  4B3T L;  5IGC A;  3B6Y A;  3LGJ A;  3CC7 A;  2NVX H;  4DAY A;  4BY7 G;  4J1M A;  3WOF A;  4JOI C;  4DXG A;  1LTT D;  3CPF A;  4PQX A;  1PTO H;  1UAP A;  5E1F A;  4QY7 A;  2F0K A;  3WWV A;  2A6E C;  1O80 A;  5JAV A;  1I3Q H;  4Q5V A;  1N33 L;  4KHP Q;  4ILW A;  2RDH A;  2PZU A;  2N3S A;  4F88 A;  5BR8 Q;  5IE8 A;  2DJF C;  4TSS A;  5BN3 A;  2J4X A;  2DNC A;  1B53 A;  5M5X B;  2VW9 A;  4QMG A;  4K8J A;  3CC4 A;  1Y8N B;  3ZYY X;  4L5Q A;  4A3B G;  4A3M H;  1HCZ A;  1B44 D;  1VQO A;  3F1Z A;  2G9D A;  4DV3 L;  2MQH A;  4GN5 A;  1HZB A;  1ASY A;  1RCV D;  3H94 A;  1PH6 A;  3S2H B;  2UUA Q;  2NN6 I;  4K5X A;  3FPU B;  2NVY B;  1CA6 A;  1Q8I A;  2E2H H;  2UU9 Q;  1F9S A;  2F4V L;  4ZK9 B;  2CW0 C;  1XYI A;  1MGS A;  1VF5 C;  1S5D D;  4RAU C;  2ZM6 L;  1Q7Y C;  1SE4 A;  4DU9 A;  4IAL A;  4BBS B;  4A3J G;  4QL5 A;  4HID A;  2D9U A;  5D14 A;  2RCF A;  2PZT A;  3OW2 A;  4N8X 1;  5IP9 H;  2VQE Q;  5M3F B;  1A2T A;  4GN4 B;  2CQA A;  1QVC A;  4DV7 L;  3C2P A;  4C1N I;  4V19 0;  4FYD A;  3IRB A;  4C56 C;  5F2D A;  4BY7 H;  1SDF A;  4JI2 Q;  3PO3 G;  4UAI A;  2F0U A;  1E24 A;  2F0L A;  4B3T Q;  1UUP A;  1HNZ L;  1WD1 A;  2HUG A;  2L11 A;  3M4O H;  1OXU A;  4RGT A;  3TZU A;  2BCO A;  3A7A B;  1Q3L A;  2KVM A;  1W3S A;  1T9H A;  3CCU A;  2WII B;  1LM0 A;  4JCV E;  5FKA C;  3VYT A;  1CA5 A;  4BA1 I;  1N33 Q;  1LTR D;  1Y1V H;  4DAP A;  4QJF A;  1PRT C;  4P72 A;  4XQN A;  5E4W C;  1ICW A;  4EGV A;  2NZ1 D;  4JBW A;  3GTK H;  1H9M A;  4CBV A;  1RJT A;  2LXJ A;  5HGT A;  1P8L A;  1B9N A;  2N8N A;  2WFW A;  1TT2 A;  2F3V A;  4WJ4 A;  1RHP A;  4QUF A;  4IJL A;  5HGQ A;  3H15 A;  3G4S A;  3MXN B;  2EOT A;  2JE6 I;  3AB9 A;  1DON A;  2ICE C;  4C3J B;  4P71 A;  4DV3 Q;  1E1T A;  2F0M A;  2BOS A;  2R93 G;  3MXP A;  2Y0S B;  1PH3 A;  1SYG A;  1U4L A;  4DR6 Q;  3DHQ A;  2HT1 A;  4R4I A;  2C9O A;  2R92 H;  1KXL A;  4LAA A;  1U9R A;  1E2V A;  3VR4 A;  2C5C A;  3P20 A;  1EYD A;  3M9B A;  4DA2 A;  1RIP A;  1SMX A;  3D4W A;  3ER0 A;  1AEX A;  5E3F A;  3AFP A;  5JPN C;  1PH4 A;  2DGY A;  4PMB A;  1IW7 C;  3VA5 A;  3OOC A;  1CKN A;  4WOR A;  5CMD A;  1QOH A;  1WCM B;  1K28 A;  1SNP A;  3CME A;  1AN8 A;  1LYL A;  1VDZ A;  4A3D G;  5J3B A;  3K80 C;  1TWF H;  4DV7 Q;  2YV5 A;  5IYC H;  4K0K Q;  1ILQ A;  4DV2 L;  1BVS A;  2OF1 A;  5JVH 3;  2FIN B;  4LF4 L;  1A63 A;  4G4K A;  4JYA Q;  4DK6 C;  1Q8K A;  1KQS A;  1I6H B;  1BDO A;  3S9W A;  1CKO A;  1BBX C;  1QVF A;  1BKB A;  5I2X A;  4B3M Q;  4YIJ A;  2Z1C A;  5E4X A;  1HNW Q;  1X3F A;  4DUY Q;  4P75 A;  5CV4 A;  2AKW B;  2UXB Q;  4CDC C;  1CUK A;  1GD7 A;  1ENF A;  3K6O A;  4POG A;  3NEN A;  4A3G H;  1CM9 A;  2E76 C;  1JOR A;  1D1K A;  1RDP D;  2JEB I;  4Y7N H;  1KC8 C;  1BCP B;  4A3L G;  5ELE A;  4APV A;  3VR3 A;  3OSO A;  2UXC Q;  1QB5 D;  1GVP A;  4K2L A;  3EIV A;  3L9A X;  1G6P A;  4DV5 Q;  2XIW A;  4LF6 L;  3GTG H;  1YEZ A;  2R93 H;  4MHE A;  2K32 A;  3OHX C;  4UP9 A;  4JC0 A;  1VQ6 A;  1CKM A;  3FKI B;  3C1E A;  2NTS A;  1D5X C;  3JC6 6;  3PIO 3;  3HOX G;  1O78 A;  2PO4 A;  3OPO A;  1HNX L;  3NXW A;  5GQO A;  4GNX B;  5CV5 A;  1SJH D;  3Q8D A;  1SFO B;  1B1Z A;  1O7L A;  1FL0 A;  3HOZ G;  4OX9 L;  3S2D B;  4CJ1 B;  1PRT B;  4YY3 L;  1PVO A;  2MP1 A;  4RKL A;  3CCL A;  5T1G A;  1I4R A;  2BE5 D;  1IXR A;  1YBY A;  5IWA Q;  1P16 A;  1TS3 A;  1K3R A;  5I9O A;  2B63 G;  3KLR A;  3BU2 A;  3MWY W;  1WTX A;  4A3D H;  4JI1 L;  5FLX E;  2E2I H;  1QJO A;  5EBD A;  5IGF A;  5LMU L;  2AWO A;  1LT5 D;  3HOV B;  4IUQ A;  3NK9 A;  3D8G A;  3H3V I;  3M85 A;  2SEB D;  4GKK L;  4DF7 A;  4A3I H;  1QVG A;  2GN5 A;  3KF6 B;  4BS9 A;  3M3Y B;  1LV9 A;  1NSN S;  1Y8O B;  2F0S A;  2R7Z B;  4JV5 L;  4DAY B;  2WB1 G;  3DM1 A;  1KD1 C;  1VQB A;  4LWC A;  1QCB D;  3OW7 A;  3GQB A;  2E2J H;  3URY A;  1VQD A;  1SYB A;  1FR3 A;  2UXD Q;  1HXY D;  1RTO A;  1NE3 A;  4Y52 H;  1HA5 A;  4HTH A;  3D4R A;  3ND9 A;  2EZV A;  4HN7 A;  1SYE A;  1G2S A;  3RUZ A;  3H0G B;  4E6I A;  3UE0 A;  1GO3 E;  1CK1 A;  1F2M A;  4LF7 Q;  5J39 A;  4A3L H;  3VDY A;  1TXY A;  2R3Z A;  3DXJ C;  1PH2 A;  3FP9 A;  1STY A;  5ELN A;  3K57 A;  3D31 A;  1YIT A;  3T13 A;  3I4M B;  1JWM D;  2DY8 A;  1HFN A;  1LTI D;  2EY1 A;  1ML0 D;  3CCM A;  4H13 C;  4XQJ A;  1BNZ A;  2ES2 A;  4UDU C;  3DEO A;  3NTK A;  3GV3 A;  4CJ2 C;  3C3L A;  3DWQ A;  4WFN 3;  1PZK D;  2Z8L A;  5C44 G;  3W5O A;  3SK5 A;  2RHS B;  4IFD G;  2X6L A;  3FHW A;  3HOX H;  2EJG C;  5C6A A;  5C4X B;  2L12 A;  2K75 A;  4PNY A;  5IP7 H;  3D4D A;  1LAB A;  2E8G A;  1YJW A;  3HOZ H;  1HPC A;  3AYH B;  3UDX A;  1YNX A;  1I4G A;  4XT1 B;  2F0N A;  3HKZ B;  2VQF L;  4OX9 Q;  2QGQ A;  4JI3 L;  1Y69 U;  1HH2 P;  4TKO B;  2H1E A;  2B63 H;  1CSP A;  2PCF B;  3GTM H;  1EZ8 A;  3EJI A;  5M5W H;  2UUC Q;  2QA4 A;  1CZW A;  4X62 Q;  1IYV A;  1YHA A;  5EPJ A;  1JJ2 A;  2Q2T A;  3D6C A;  2K6A A;  4O1N A;  1IBL L;  1VMP A;  2CW0 D;  2EJF C;  5M5X H;  3I4L A;  1B3Q A;  3V05 A;  3T1H Q;  1TWC B;  4L5R C;  3CCV A;  1JCK B;  5COR A;  4X3T A;  3STB D;  1JT8 A;  5DM6 3;  2EVB A;  2WB1 E;  2A19 A;  1RD9 D;  1S4Z A;  1XXG A;  4B9W A;  3G48 A;  1KRT A;  4V0B A;  1K9M C;  1HZC A;  2MGS A;  3QOL A;  3DLL A;  1O7I A;  4J8Q A;  3I73 A;  1LT4 D;  4MTN A;  4JV5 Q;  3VR6 A;  2MUY A;  2KHJ A;  1WTR A;  3S17 H;  3CF5 A;  4XYO A;  4A3F B;  4LNQ A;  5GAE C;  5EKK A;  3QG1 A;  4IQZ A;  2JA5 B;  1PDQ A;  2JP1 A;  4P74 A;  2B3G A;  4ZAI A;  2K28 A;  4RHR A;  1PXU A;  4ZYS A;  2L4N A;  1JJG A;  1TKW B;  2Z4I A;  1VMC A;  3GTQ H;  1VQ7 A;  2VL6 A;  1Y14 B;  4IN3 A;  4CJ0 B;  1OXV A;  4NXN L;  2AQ1 B;  3E9I A;  2KQ3 A;  1T5X D;  2R7F A;  4UP7 A;  1PTO D;  2NWG A;  1N32 L;  4LW1 A;  2L1B A;  2E5L L;  4IFD H;  1ENC A;  5IIF A;  1I6V C;  1FVI A;  3MA2 B;  2D0P A;  2OCE A;  4FF3 A;  1JIC A;  2WKC A;  4JI7 L;  1MKH A;  3CD6 A;  4LF8 L;  1D6E C;  1YHQ A;  1A3T A;  2PYK A;  2QCP X;  3MHB A;  3RZD B;  1K83 B;  4YHH L;  1MJE A;  2WAC A;  2VUM G;  1TR5 A;  2EE1 A;  1X3P A;  4GOP A;  3T4A C;  3T16 A;  2IHF A;  2Z4H A;  4DV1 L;  5FLX L;  3EVQ A;  5C4H A;  4NP5 A;  1F2Z A;  4LF9 L;  1PZI D;  2Q8R E;  5LMN L;  1IHZ A;  3L0O A;  3GP7 A;  4O2D A;  4R1J A;  2CWP A;  3TP8 A;  4BBR G;  1TY2 A;  5FK9 C;  3S24 A;  1PLF A;  5EGT A;  1AE3 A;  1LAC A;  3A8K E;  4RCO A;  2L55 A;  2PQA A;  3VYU A;  1FJG Q;  4IPD A;  1EIG A;  1ESR A;  4C3J H;  1IW7 D;  1VQK A;  1OXS C;  4XTC S;  3KJP A;  5CYU A;  2G5D A;  2K5N A;  2Y0S E;  3V96 A;  1JB7 A;  2JA6 B;  2Q8I B;  4J15 A;  1K0R A;  2ICI A;  2E74 C;  3HZX A;  1H9K A;  2V4D A;  4OWW B;  3S1Q B;  3HOW B;  3E5S A;  4KY5 A;  1S3O A;  4AYB G;  4N9T A;  1CT1 D;  4BY1 B;  2CH4 W;  2I46 A;  4HJ8 A;  1TS2 A;  4GLV B;  4UY8 C;  5CV9 A;  3NE5 B;  3TN2 A;  4CKC A;  3L2P A;  5BR8 L;  1L0W A;  2XWJ B;  3J7A F;  1IBM Q;  3L3O C;  1DJR D;  1FYC A;  4QIW E;  1WCM H;  1TY0 A;  3A8I E;  4LUO A;  4KKT A;  5EPK A;  1H95 A;  1WTH A;  2PI2 A;  2K5D A;  3VR2 A;  1G2T A;  5K36 H;  3NBH A;  5KND A;  4NW2 A;  3G71 A;  4IJH A;  1I4H A;  4N9P A;  4IUT A;  2EYL A;  4A76 A;  1TII D;  3PQI A;  4JI7 Q;  1SE3 A;  4KKS A;  1MBY A;  3SE0 A;  5D65 A;  4MNO A;  4R4C A;  2VUM H;  2UU9 L;  5M5Y B;  3PUV A;  1TWA H;  2KEN A;  2B8F A;  4DR1 Q;  1G91 A;  4XDX A;  3UE1 A;  1JC7 A;  4X64 Q;  5I4D A;  3X3M A;  1I5F A;  1IL2 A;  5DEH A;  1GUT A;  1VQP A;  1K3B C;  2NVQ B;  1AE2 A;  4DV1 Q;  3QWN A;  2ENB A;  3BDC A;  3DWP A;  4BBR H;  3G6J B;  3PIO A;  5M3M G;  3K7U C;  1L1O C;  1B8A A;  2GVB A;  3I8Z A;  3J81 j;  1IL8 A;  1LO5 D;  4B9X A;  4GLX A;  3K59 A;  1VQJ A;  1WD0 A;  2KHI A;  1PH9 A;  2EXD A;  3G6E A;  4BA2 I;  2L15 A;  5GRO A;  2XRQ D;  1SNC A;  1KDB A;  3I91 A;  4JI8 L;  5J22 A;  1BF4 A;  1PYW D;  2D0O A;  3KBX A;  3O13 A;  3U4Z A;  4JI2 L;  3FKI H;  4AYB E;  4R8I A;  1QZG A;  4L5T A;  3I4N G;  5HY6 A;  4U68 A;  2N49 A;  4CHT B;  2ZT9 C;  3CXC A;  3ULL A;  4WRD A;  3CMA A;  2ZJP A;  2EPB A;  3TQY A;  1L2F A;  3NPP A;  3TP7 A;  4KK7 A;  1WTV A;  1HA6 A;  1CQF A;  1TS4 A;  3BZD B;  2BH8 A;  4EQP A;  1VQ9 A;  1I94 Q;  1PFS A;  1V1P B;  1LLR D;  4OIJ A;  5JEA H;  1HUM A;  1SBB B;  4C3H G;  1SSO A;  4DR5 Q;  2Q8T A;  2NVT H;  4OL7 A;  2MO1 A;  3MVV A;  3UDG A;  1Y1V G;  1OXX K;  4QUC A;  5IY0 A;  3IL8 A;  5ELO A;  1NY4 A;  3NQI A;  3K81 C;  1XMQ Q;  4ME3 A;  2K4K A;  1VQH A;  1V1O A;  3HOV H;  3AU7 A;  2XNA C;  4FF4 A;  2GA4 B;  4IOA A;  4A93 B;  1UE1 A;  3KJO A;  1MSH A;  5LL6 S;  3TP5 A;  3PF5 A;  2EYP A;  1VQN A;  1OO9 B;  2A73 B;  1VQ8 A;  4DR6 L;  4KHV A;  1HJP A;  1EEF D;  3BVM A;  4OGQ C;  1A2U A;  1BO0 A;  3U58 A;  1YJ9 A;  5KNB A;  2R92 G;  1JWS D;  2P5Z X;  5M3M H;  1KAW A;  3H0G H;  3RLF A;  1TWG B;  4LFA Q;  2MNA A;  1GM5 A;  1V1Q A;  2D62 A;  2EXZ A;  1PH7 A;  4C1N K;  4I65 A;  2F0Q A;  3W1G A;  2ATW A;  3N6R A;  3OYY A;  2K1B A;  1JWU D;  2I5M X;  4RGN A;  1C9O A;  2OQK A;  1BCP C;  4KV6 A;  1PZJ D;  3KFU A;  1UWV A;  2K05 A;  2ZJR A;  4X6A H;  2R7D A;  1EYG A;  4JI8 Q;  4K0K L;  2K5V A;  3I4N H;  3GTL B;  4H0L C;  1STE A;  2RSO A;  4B3S Q;  4JYA L;  1TWH H;  1TVX A;  3UDI A;  4HR7 B;  5IYC G;  3QO2 A;  1KLU D;  4DFA A;  4A3E B;  4DK0 A;  4B3M L;  5C3E G;  1HNW L;  5FLX c;  4DUY L;  4HSP A;  1GKH A;  4IUR A;  4C3H H;  2UXB L;  4GNX C;  2RCN A;  3ICE A;  4ABN A;  2JA7 B;  3PO2 B;  1PV4 A;  1JE4 A;  1H9J A;  2I07 B;  4RKB A;  3M4Y A;  1L1O B;  3IFD A;  5CBA E;  1WTO A;  4JI5 Q;  4A3G G;  1WTP A;  4O0A A;  3H6M A;  1BBW A;  2LFN A;  2UXC L;  1TWC H;  2A8V A;  3NUC A;  1UE7 A;  4DPG A;  2ZJQ A;  3PUW A;  4YWK A;  4DV5 L;  1CHQ D;  4DK3 C;  3K5M A;  1N36 L;  4NB3 A;  4HJ9 A;  1LTS D;  3MFY A;  1FGU A;  4NKL A;  2WP8 J;  5IYD G;  2NUC A;  1NCV A;  3A5Z B;  1X3E A;  2PQE A;  1M8A A;  4LFC L;  3Q22 A;  2ASB A;  1GUW A;  4LK1 C;  1SAP A;  4LFB Q;  4Z9C B;  3OWE B;  1BR9 A;  4UHV A;  1EWI A;  1JOO A;  2K5Q A;  2MPM A;  2A68 C;  3PSI A;  5JVG 3;  5IWA L;  1R9T H;  2KCN A;  1ASZ A;  4OO1 G;  2MJ8 A;  5CC4 A;  1TU2 B;  4C3I G;  4TVA B;  3J7Y W;  2F4I A;  1K8A C;  2WKD A;  2WV6 D;  3PV0 A;  2PQA B;  2A6H C;  5K5P A;  2QIL A;  5H1S E;  1VQF A;  1STN A;  2Z6K C;  4PZ8 A;  4RMF A;  3T1Y Q;  3S14 H;  5C3E H;  5GAH C;  1MSG A;  2F0V A;  4L63 B;  5DNF A;  1YJN A;  4DAV A;  3NQT A;  4R9W A;  4A3I G;  1IYU A;  2WAQ G;  2UXD L;  3RZD H;  2N55 A;  4FVM A;  3HOU G;  3TBI B;  3KDF B;  1XPR A;  3BVZ A;  3T56 B;  5JOB A;  2OTJ A;  1BBU A;  4LF7 L;  1SN8 A;  2A1A A;  4GS3 A;  3GTP B;  1SMY C;  5C0X G;  1M1K C;  3I55 A;  4EX5 A;  1E7Z A;  2VZA A;  1YNJ D;  3W1B A;  4ODG A;  1WTQ A;  3MC0 B;  5IYB H;  4B3R Q;  3NBH B;  3GTJ B;  5FJ8 G;  4HMI A;  3S1R H;  2B8G A;  1B4O A;  1ZEQ X;  2A5H A;  4JW0 A;  4PZ7 A;  2B29 A;  2O2L D;  3NEM A;  5IYD H;  5IT9 c;  2VY3 A;  3IAY A;  3BYT B;  1N36 Q;  5ISR A;  4P73 A;  2LKV A;  2F1M A;  4XXE A;  3CHB D;  1RKN A;  2JA8 G;  3S1M B;  3GTO B;  3E0E A;  5IP7 G;  5LHY 1;  3MEH A;  4LFC Q;  2TMP A;  4RG1 A;  4DK1 A;  4HCS A;  4OO1 H;  3CQZ H;  4C3I H;  2AUK A;  3CP0 A;  2UUC L;  3EN2 A;  1SNM A;  4X62 L;  3J7A 5;  3S15 B;  4EQ5 A;  4A3K B;  4A75 A;  3KF8 B;  4MN3 A;  5C4J H;  1ET6 A;  4OON A;  3QR8 A;  3T1H L;  5IOC A;  3T51 B;  2NTT A;  3QB3 A;  1PTO B;  2PNH A;  1DXM A;  3DM3 A;  2AUJ D;  2EY2 A;  3W3A A;  2F0J A;  1DCZ A;  1A62 A;  1I3Q B;  1EIY B;  2A69 C;  2OXP A;  1F2L A;  4R4Q A;  2WAQ E;  1H9S A;  4KY7 A;  2NZH A;  1ROD A;  4KMU C;  4GKJ Q;  3J80 E;  5CV8 A;  4RGM A;  1Q12 A;  4GZY C;  3HOU H;  5EBC A;  1EOV A;  2I0Q A;  4MZ9 A;  1EL0 A;  1HRJ A;  4OWT B;  4AQY L;  1EQR A;  4A3M B;  5FLM G;  4IO9 A;  1SJE D;  3F2B A;  1D5Z C;  4I7Z C;  5C0X H;  4C2M H;  1Z6H A;  3AQQ A;  3SEB A;  3TEH B;  1GHK A;  2OT2 A;  3HOY B;  4DUZ Q;  1XTD A;  2K52 A;  3FMC A;  4HIO A;  2F3W A;  5FJ8 H;  1WFQ A;  1LTB D;  5KYL A;  4CDE C;  2A6E D;  4BBS G;  4KTA A;  1U5K A;  2B2Y A;  4TQU S;  2RKS A;  1NJI C;  1CQV A;  1SE8 A;  3Q0A A;  1SYD A;  2B2U A;  4QB4 A;  1H9R A;  1SRU A;  3BZK A;  4F7X A;  5M3F G;  4KD3 A;  2AQ3 B;  2JA8 H;  2EQS A;  1EY8 A;  3J7Z C;  2PPB C;  4FXG C;  3RZO B;  4G7H C;  2KJX A;  1Y8P B;  1Q46 A;  2EJM A;  4X3U A;  2F03 A;  3A74 A;  1XJV A;  4G7Z C;  5D3D A;  5BN4 A;  3U50 C;  1GUG A;  4XYQ A;  2F0P A;  3K8A A;  4A4I A;  2IX3 A;  4BY7 B;  1PA6 A;  5D3I B;  2IW3 A;  1GJX A;  2KEC A;  1K0S A;  4IUP A;  4GN3 B;  1EQQ A;  4IPH A;  5IGD A;  4TRD A;  1QNU A;  3OMG A;  2LS0 1;  2KEE A;  3NP8 A;  2L5T A;  4ZRZ A;  5FO8 B;  2RSN A;  1FJG L;  2K04 A;  1SEB D;  1XWE A;  5KGU A;  3CU7 A;  4F87 A;  3TME A;  2VXW A;  3S2H H;  1UNS A;  2F0F A;  4A3B B;  3ERS X;  4AIM A;  5FLM H;  2NVY H;  3GTK B;  4C3J G;  3KLS X;  4K5W A;  1KDC A;  4WJ3 M;  1DYQ A;  4DV0 Q;  4IFD I;  1HQM C;  1FNW A;  3PCO B;  4AQY Q;  3D0F A;  2ALY B;  3RLN A;  1VQ5 A;  4IFD J;  5CGK A;  2JSO A;  2KUM A;  2HQL A;  5C5M A;  2Y0S G;  1D5M C;  2Z9H A;  4ZCK A;  1ONL A;  4RGO S;  3HRZ C;  3K5L A;  1SR3 A;  3HKS A;  1G29 1;  5IGE A;  3NHH A;  1XNR Q;  5IT9 E;  1K8O A;  1D7Q A;  2HCI A;  3DWA A;  1PRT F;  3QJY A;  5EQ0 A;  4BBS H;  1HR0 W;  2B2W A;  2NBF A;  1IBM L;  1PFN A;  3OIQ A;  4RWS C;  2F0H A;  2B2V A;  4DR7 Q;  1BQQ T;  1EEI D;  1X55 A;  5NUC A;  5M3F H;  2FHT A;  3PUY A;  2YU9 B;  4X3S A;  4JI4 L;  4IZ8 A;  1VQL A;  2L0C A;  3P75 A;  4A3J B;  1PRT D;  3M4Q A;  1WCM G;  1C8C A;  3GTL H;  3BVG A;  4K2K A;  3SHL A;  3MTS A;  3ITP A;  2PNR C;  4ZLT F;  1E2W A;  1JMC A;  3OMC A;  3H3V C;  1QWY A;  2RF4 A;  5K36 G;  3R2I A;  2CCZ A;  3NWS A;  1EQT A;  3M7G A;  3VYS A;  1F9Q A;  1KAB A;  2JYO A;  1U4R A;  4DR1 L;  2YYZ A;  4PV1 C;  1TQO A;  3KBG A;  2AWN A;  5ELD A;  1STH A;  4X64 L;  3ULP A;  3CC2 A;  3M4P A;  4FO2 A;  3T53 B;  3U4V A;  4NMZ A;  1KAA A;  3IFT A;  3TS2 A;  3PO3 B;  1TWF B;  2JA7 H;  5C3X A;  2HD3 A;  4G7O C;  1F2Y A;  1B9M A;  1C4Q A;  3HGB A;  2OQ0 A;  4ZUI A;  1AW7 A;  1ZKO A;  1X56 A;  1CKN B;  2XSC A;  4LJZ C;  2QF7 A;  3MXG A;  4JOI A;  2KCM A;  2RDG A;  3HEJ A;  1U4P A;  2CH4 A;  2CFM A;  3J81 E;  1OTC A;  2L9H A;  1ESF A;  1YZ6 A;  2A68 D;  3LNN A;  1UE6 A;  3NTH A;  3PF4 A;  2PW5 A;  4DGZ A;  3KYH C;  1M90 C;  3I72 A;  2BDN A;  2EY6 A;  2K33 A;  2IT1 A;  3MAQ A;  4Y7N B;  1NAP A;  1LUZ A;  2AMC B;  1QIL A;  2K5W A;  3R8B A;  3G7L A;  2ZXR A;  1ENA A;  3FKI G;  4K14 A;  3I4O A;  4X65 Q;  1V9P A;  1EFW A;  3BDL A;  3D6W A;  1C7Y A;  4OEM B;  4R4T A;  2CHB D;  2I5H A;  1I94 L;  1XTC D;  1WVL A;  3GTG B;  4O42 A;  2R93 B;  5EAY A;  2IJ0 A;  2ID0 A;  1XMO L;  1RTN A;  4DR5 L;  2NYZ D;  4PMC A;  1S5B D;  1BUV T;  1R4P B;  4XIG S;  2Q2H A;  2JQO A;  5JEA G;  4M1U B;  1PYB A;  1VQG A;  1GUO A;  2M2L A;  4OIK A;  4OHJ A;  2RDF A;  4L6T B;  4QQB X;  3BG3 A;  4DKA C;  1XMQ L;  4LF5 Q;  1EOT A;  4OEL B;  1EIF A;  1QE6 A;  4JI4 Q;  5AJ3 Q;  1NTG A;  4DV4 Q;  1RL2 A;  2NB0 A;  3U9S A;  1SYF A;  1EY5 A;  3EQL C;  1VQC A;  3PUZ A;  3CRK C;  1J5E Q;  1AZQ A;  3HOV G;  1E2Z A;  3TSS A;  1D1I A;  4FP5 D;  1I6H H;  2ZTD A;  4JI6 Q;  4A3D B;  1X9N A;  3I7F A;  2SNM A;  3KOJ A;  4JK1 C;  2E2I B;  1A15 A;  1K8G A;  2R7Z G;  2VB2 X;  3A7L A;  4PG3 A;  5EPL A;  2VS1 A;  5FO9 B;  1PMR A;  4HJ7 A;  2YTX A;  1YHB A;  3HS0 C;  4XQQ A;  5JJK A;  4LUZ A;  5C4Z A;  2JJQ A;  2KBN A;  4LFA L;  3DUZ A;  4FDB A;  3ONA B;  4EQO A;  2H5X A;  4JBK A;  2JA9 A;  1NR2 A;  4EQN A;  2BE5 C;  3VA7 A;  3H0G G;  2E2J B;  4CDF C;  4BWG B;  2WIN B;  3I90 A;  1ZYR C;  4NXM L;  5HUR A;  4CGY B;  2CKZ B;  1EFI D;  3SK6 A;  3A55 A;  2OWO A;  3I4M G;  5JEA J;  3P7J A;  1V8Q A;  3ERO A;  4DNR B;  4B3S L;  3A5U A;  1TS5 A;  2LY7 A;  1EYA A;  3R93 A;  1I4P A;  3OIP A;  1I50 B;  3I56 A;  1S72 A;  1IBK Q;  1HR0 L;  1LTL A;  3S1M H;  4KI0 A;  1OXT A;  5C4X G;  1L0Y B;  4PZ6 A;  1QUQ A;  3K58 A;  2A69 D;  1XPU A;  2NN6 G;  5IT9 L;  1HTL D;  1SFO H;  2I5L X;  5CV7 A;  4UPA A;  3S2D H;  2EYM A;  3F2U A;  3TRE A;  1XNQ Q;  1MI2 A;  1DD2 A;  4RCN A;  2VNU D;  3HOX B;  3RN5 A;  1XMO Q;  1MHW C;  3S15 H;  3HKZ G;  3CCJ A;  4IUN A;  1CSQ A;  3KF6 A;  1JB3 A;  3TP6 A;  3HOZ B;  4JI5 L;  1C48 A;  1Q90 A;  3EBE A;  4HAE A;  2F0T A;  1M4V A;  4QF4 A;  4YWM A;  3TDQ A;  2F0G A;  2HIX A;  3BYY B;  2B2T C;  4A3C G;  3OTO L;  4QGU A;  2B63 B;  1HQR D;  3R3O A;  3MXU A;  3S1N B;  3DEP A;  4EVO A;  3GTM B;  1YVC A;  2K50 A;  5M5W B;  2NZO A;  3M3Y H;  4DNT B;  1VCI A;  2R7Z H;  2CVR A;  3A0J A;  3SGI A;  4KN4 C;  4L5S A;  1EUJ A;  2KCC A;  4JI0 Q;  1MJC A;  1Q81 C;  2XVS A;  4ZUJ A;  4LFB L;  4X66 Q;  5FO7 B;  4A3F G;  1W6J A;  2Z6K A;  4DN4 M;  4CDD C;  2JA5 G;  2WB1 B;  4HJ5 A;  3Q23 A;  3HOY H;  1Y1W B;  3MEF A;  3J81 L;  2JN4 A;  3S17 B;  3JAM c;  3GO5 A;  2QEX A;  2JEA I;  5J1Z A;  3I4M H;  1STA A;  2KHS A;  2KCT A;  4NXM Q;  4DR2 Q;  5ELB A;  3TZD A;  2Z0S A;  3STB C;  3GTQ B;  1B50 A;  3T1Y L;  2EDG A;  1CTM A;  2Z6B A;  2FJ2 A;  5C4X H;  1X65 A;  3RZO H;  1VQ4 A;  2EYO A;  1F9R A;  2NN6 H;  4YWL A;  2PMZ B;  1DOK A;  1HR0 Q;  3ND8 A;  1MD2 D;  1X3Q A;  5C44 B;  3A8J E;  2JK8 A;  1S5F D;  3C46 A;  3HKZ E;  1F77 A;  2ZXP A;  5IOD A;  1T5E A;  1LT3 D;  1VQE A;  4UP8 A;  3CW2 C;  4DR4 Q;  1Z9F A;  1AH9 A;  1WJJ A;  2O5I C;  3SDZ A;  3J80 c;  2B39 A;  3S16 B;  1O7Z A;  3F2D A;  1GUS A;  2R61 A;  1GHJ A;  3M7N A;  1DOM A;  2K14 A;  4A3C H;  1N34 L;  4JBJ A;  3JAM i;  1WTW A;  5C5L A;  4B3R L;  5E7N A;  3KK7 A;  3RNU A;  1PTO C;  3FEW X;  3OTO Q;  5M9O A;  1L0X B;  5IYB G;  1WYD A;  2CWA A;  4K6D A;  4ALP A;  4FNF A;  4YCW A;  4A3B H;  2X6G A;  1ILP A;  2N78 A;  4A3F H;  5C3W A;  1FGB D;  3I70 A;  3TRZ A;  1X3G A;  2JA5 H;  1KL9 A;  1NMF A;  3PUX A;  2JA6 G;  3FDT A;  1EY7 A;  4GOP B;  1JJC B;  2F3I A;  3QIA A;  2RHQ B;  3HOW G;  1KLG D;  3HG9 A;  3RLO A;  2K5H A;  3EA6 A;  4K5V A;  4BY1 G;  1VF7 A;  1XPO A;  4ZKB B;  1F9P A;  3J80 i;  5I6Y A;  2XTI A;  1CHP D;  4IPG A;  2F4V Q;  5DAU A;  5EJW A;  4IUU A;  2QEJ C;  1UE5 A;  4POF A;  5KRU A;  2Q2I A;  1EIH A;  1JR0 D;  3U9O A;  2YU9 H;  3W2D A;  3BJU A;  2TSS A;  2ZXO A;  3UDF A;  4A3J H;  2CQO A;  3PIP 3;  2ZM6 Q;  4GKJ L;  5COY A;  3P1H A;  5A2Q E;  2C35 B;  4ME5 A;  2AQ2 B;  2IY5 B;  1NNX A;  2BH2 A;  1NR4 A;  1K83 H;  1ZXT A;  1CFM A;  4QIW B;  1I4Q A;  3DMU A;  5GAD C;  1DM0 B;  3PO3 H;  4HED A;  5I2Y A;  2MO0 A;  1J6Q A;  4Q0F A;  3K0X A;  2K01 A;  3K7A B;  4CKE A;  1QG7 A;  1VQI A;  3K5N A;  4DUZ L;  1STG A;  3EFX D;  2UUB L;  2VUM B;  1ET9 A;  1TWA B;  3CCE A;  5IGG A;  1HNZ Q;  1N34 Q;  3RR5 A;  4H44 C;  1E22 A;  1HFG A;  4LMQ D;  4K8I A;  1YNN C;  3D3R A;  2EYJ A;  2J0T D;  3ULJ A;  1O7Y A;  4OO1 I;  2F0W A;  1BXT A;  4JVZ A;  4BBR B; 
#chains in the Genus database with same CATH homology
 1EWH A;  4X3K A;  3JAM E;  1KNA A;  1SNQ A;  2E2D C;  2MHV A;  3IKJ A;  2FMC A;  1LT6 D;  2XWB B;  4HSV A;  1SXT A;  1DOL A;  4R8N A;  5KYI A;  1AZP A;  1CZG A;  1QNK A;  2DNE A;  4AYB B;  2NVX B;  3BDO A;  3NSW A;  1R4Q B;  2EYF A;  2M00 A;  5C0X I;  5C0X J;  2DY7 A;  4S3S A;  2D5D A;  1DZ1 A;  1FD7 D;  5KEE A;  2NVT B;  2FMM A;  2O5J C;  1ZYR D;  5EKL A;  1G6Z A;  1AP0 A;  3NWT A;  4K6L A;  3PMF A;  1Q1E A;  5CBE E;  1X32 A;  4KD4 A;  5G3L F;  2IL8 A;  1KTK A;  2JXM B;  4FXK C;  4CKB A;  3VR5 A;  4KJO A;  4KY6 A;  1EQV A;  1CI3 M;  4M8A A;  1EY6 A;  5G3L D;  2E2H B;  2HDL A;  1HUN A;  1B3A A;  3WOE A;  1NUC A;  1JOK A;  2SDF A;  2DN8 A;  1STB A;  3A56 A;  4RFB A;  1V1P A;  4PMW A;  5M3M B;  1EU4 A;  4B08 A;  5ELF A;  1BOS A;  4G57 A;  4FF1 A;  4NDX A;  1I4X A;  4J6H A;  1EY4 A;  1SNO A;  1J9O A;  3N52 A;  2KED A;  2QDB A;  3I4N B;  2N88 A;  1XX8 A;  4HMJ A;  3OWF A;  1EU3 A;  1Q1B A;  1TWH B;  1B2T A;  2E75 C;  3WDN A;  3A54 A;  1D2B A;  3SXH A;  2HCC A;  1II3 A;  5A35 A;  3R2T A;  3M4O B;  5TSS A;  4FF2 A;  4C3H B;  1RF2 D;  1BCP F;  5A2Q L;  4RH6 A;  3L7Z C;  1Y1V B;  3Q24 A;  2O4X A;  2FFK B;  1BCP D;  3ERQ A;  2H4O A;  3H91 A;  1HHV A;  3KLS A;  5AFW A;  1FNV A;  2IX0 A;  1PFB A;  1IKL A;  2BDO A;  5KNC A;  3GD7 A;  3QOJ A;  5KIX A;  2BA1 A;  2HDM A;  4XT3 B;  5DM7 3;  3NBI A;  3V2T A;  2A74 C;  4KJN A;  2R92 B;  5CV6 A;  2X69 A;  4QCL A;  3FRP B;  4P2C B;  4H7B A;  4F8M A;  1PTO F;  2IX1 A;  3RMH A;  3JAM L;  3SK4 A;  2KA7 A;  1R9T B;  3H09 A;  2OEO A;  2J7Z A;  2K7V A;  3C1F A;  1LTG D;  1GOZ A;  1SND A;  3KUP A;  3I3C A;  3J7A V;  4DXF A;  1GUN A;  3MXN A;  5BN5 A;  3S14 B;  5C3E B;  1A6X A;  5ELC A;  1HTP A;  2RQX A;  1EY9 A;  2QKI C;  3MFG A;  1FNU A;  3VYR A;  3J80 L;  1Z47 A;  5JPM C;  2B2Y C;  1A3U A;  1SE2 A;  3K0Y A;  3E0J A;  4A3G B;  2B2U C;  3NTI A;  3CKI B;  2SNS A;  4ID6 A;  1EYC A;  3UI2 A;  2VB3 X;  1KNE A;  2A6H D;  2LMC B;  4HCE A;  2F0O A;  1W6K A;  1EZ6 A;  4WJW A;  2B2T A;  1K8M A;  3SR1 A;  4KHZ A;  3S1R B;  5I6W A;  3FPP A;  1JQY D;  2XRS D;  3LWE A;  1AFP A;  2SOB A;  3SVM A;  3LWU A;  5EKI A;  1U4M A;  1JOQ A;  5JJZ A;  4IUV A;  2G9H D;  2M9V A;  3X3N A;  1S5E D;  2EYH A;  3LX0 A;  1YNJ C;  5CR3 A;  3CQZ B;  1SMY D;  4C3I B;  3K5O A;  4ZQ3 A;  2F0I A;  4FXD A;  2EY5 A;  5C4J B;  1YNN D;  1S5C D;  2RVL A;  4KN7 C;  3RD4 A;  3FVQ A;  5LL6 X;  2RBM A;  3BS1 A;  3CRL C;  3AMU A;  1GXD C;  1G8Z D;  5IGB A;  1J8I A;  4L8J A;  1KDA A;  1E0B A;  2IPK D;  4RHS A;  4U67 3;  1PFM A;  2R6G A;  1LTA D;  4A3I B;  2WAQ B;  5FOB B;  1IKM A;  3MZ5 A;  3HOU B;  2F0E A;  2BA0 A;  3HP3 A;  2B2W C;  4RA8 A;  4ULL A;  1Z7T A;  2D2C C;  3GV6 A;  2K03 A;  2B2V C;  5T1I A;  4MIU A;  4C2M B;  4ZKC B;  1H9S B;  2KOL A;  2XN9 C;  3KF8 A;  2RA4 A;  5I9P A;  2IWH A;  1EWC A;  2HQE A;  2PZW A;  1UEA B;  2JA8 B;  1EY0 A;  1SYC A;  2PW7 A;  1V43 A;  3SK8 A;  3Q6S A;  1A3V A;  3E6Z X;  4KKU A;  2F0D A;  5IGC A;  4DAY A;  4J1M A;  3WOF A;  4DXG A;  1LTT D;  4PQX A;  1PTO H;  1UAP A;  5E1F A;  2F0K A;  2A6E C;  1O80 A;  5JAV A;  4Q5V A;  4ILW A;  2RDH A;  2PZU A;  4F88 A;  4TSS A;  5BN3 A;  2J4X A;  2DNC A;  1B53 A;  5M5X B;  4QMG A;  4K8J A;  1Y8N B;  3ZYY X;  1HCZ A;  1B44 D;  2G9D A;  3S2H B;  1RCV D;  3H94 A;  2NN6 I;  4K5X A;  3FPU B;  2NVY B;  1CA6 A;  1Q8I A;  1F9S A;  4ZK9 B;  2CW0 C;  1XYI A;  1MGS A;  1VF5 C;  1S5D D;  4RAU C;  1SE4 A;  4DU9 A;  4IAL A;  4BBS B;  2D9U A;  5D14 A;  2PZT A;  5M3F B;  1A2T A;  2CQA A;  3C2P A;  4C1N I;  4V19 0;  4FYD A;  4C56 C;  5F2D A;  1SDF A;  4UAI A;  2F0U A;  2F0L A;  1UUP A;  1WD1 A;  2HUG A;  2L11 A;  1OXU A;  4RGT A;  3TZU A;  2BCO A;  3A7A B;  1Q3L A;  2KVM A;  2WII B;  5FKA C;  3VYT A;  1CA5 A;  4BA1 I;  1LTR D;  4DAP A;  1PRT C;  4XQN A;  5E4W C;  1ICW A;  4EGV A;  2NZ1 D;  4JBW A;  1H9M A;  4CBV A;  1RJT A;  5HGT A;  1B9N A;  1TT2 A;  2F3V A;  1RHP A;  4QUF A;  2EOT A;  2JE6 I;  3AB9 A;  1DON A;  2ICE C;  4C3J B;  2F0M A;  2BOS A;  3MXP A;  2Y0S B;  1SYG A;  1U4L A;  3DHQ A;  2C9O A;  4LAA A;  1U9R A;  1E2V A;  3VR4 A;  2C5C A;  3P20 A;  1EYD A;  4DA2 A;  3D4W A;  1AEX A;  5E3F A;  5JPN C;  4PMB A;  1IW7 C;  3VA5 A;  3OOC A;  4WOR A;  5CMD A;  1QOH A;  1WCM B;  1SNP A;  1AN8 A;  1VDZ A;  1ILQ A;  2OF1 A;  5JVH 3;  2FIN B;  4G4K A;  1I6H B;  1BDO A;  3S9W A;  1BBX C;  5I2X A;  4YIJ A;  2Z1C A;  5E4X A;  5CV4 A;  1ENF A;  3K6O A;  1CM9 A;  2E76 C;  1JOR A;  1D1K A;  1RDP D;  2JEB I;  1BCP B;  5ELE A;  3VR3 A;  3OSO A;  1QB5 D;  4K2L A;  3L9A X;  2XIW A;  4MHE A;  2K32 A;  3OHX C;  3FKI B;  3C1E A;  2NTS A;  1D5X C;  3PIO 3;  1O78 A;  2PO4 A;  3OPO A;  3NXW A;  5CV5 A;  1SJH D;  1SFO B;  1B1Z A;  1O7L A;  3S2D B;  4CJ1 B;  1PRT B;  2MP1 A;  4RKL A;  5T1G A;  1I4R A;  2BE5 D;  1TS3 A;  5I9O A;  3KLR A;  3MWY W;  1WTX A;  5FLX E;  1QJO A;  5EBD A;  5IGF A;  2AWO A;  1LT5 D;  3HOV B;  4IUQ A;  3NK9 A;  3D8G A;  3M85 A;  2SEB D;  4DF7 A;  3M3Y B;  4BS9 A;  1LV9 A;  1NSN S;  1Y8O B;  2F0S A;  2R7Z B;  3DM1 A;  1QCB D;  3OW7 A;  3GQB A;  3URY A;  1SYB A;  1FR3 A;  1HXY D;  1RTO A;  1HA5 A;  4HTH A;  3D4R A;  3ND9 A;  2EZV A;  4HN7 A;  1SYE A;  1G2S A;  3RUZ A;  3H0G B;  4E6I A;  1CK1 A;  1F2M A;  5J39 A;  2R3Z A;  3DXJ C;  1STY A;  3K57 A;  3D31 A;  3T13 A;  3I4M B;  1JWM D;  2DY8 A;  1HFN A;  1LTI D;  2EY1 A;  1ML0 D;  4H13 C;  4XQJ A;  1BNZ A;  3C3L A;  4UDU C;  3DEO A;  3NTK A;  3GV3 A;  4CJ2 C;  3DWQ A;  4WFN 3;  1PZK D;  2Z8L A;  3SK5 A;  4IFD G;  2X6L A;  2EJG C;  5C6A A;  5C4X B;  2L12 A;  4PNY A;  3D4D A;  1LAB A;  1HPC A;  1I4G A;  4XT1 B;  2F0N A;  3HKZ B;  1Y69 U;  4TKO B;  2H1E A;  2PCF B;  1EZ8 A;  3EJI A;  1CZW A;  1IYV A;  5EPJ A;  3D6C A;  2K6A A;  4O1N A;  1VMP A;  2CW0 D;  2EJF C;  3I4L A;  3V05 A;  1TWC B;  1JCK B;  5COR A;  4X3T A;  5DM6 3;  2EVB A;  1RD9 D;  1S4Z A;  1XXG A;  4B9W A;  4V0B A;  2MGS A;  3QOL A;  4J8Q A;  3I73 A;  1LT4 D;  3VR6 A;  2MUY A;  1WTR A;  4XYO A;  4A3F B;  5EKK A;  3QG1 A;  4IQZ A;  2JA5 B;  1PDQ A;  2JP1 A;  4ZAI A;  2K28 A;  4RHR A;  1PXU A;  4ZYS A;  2L4N A;  1TKW B;  2Z4I A;  1VMC A;  4IN3 A;  4CJ0 B;  1OXV A;  2AQ1 B;  2KQ3 A;  1T5X D;  1PTO D;  2NWG A;  2L1B A;  4IFD H;  1ENC A;  5IIF A;  1I6V C;  3MA2 B;  4FF3 A;  1JIC A;  2WKC A;  1D6E C;  1A3T A;  2PYK A;  2QCP X;  3MHB A;  3RZD B;  1K83 B;  2WAC A;  1TR5 A;  2EE1 A;  1X3P A;  3T4A C;  3T16 A;  2Z4H A;  5FLX L;  3EVQ A;  5C4H A;  4NP5 A;  1F2Z A;  1PZI D;  2Q8R E;  1IHZ A;  3GP7 A;  3TP8 A;  1TY2 A;  5FK9 C;  1PLF A;  5EGT A;  1LAC A;  3A8K E;  4RCO A;  2L55 A;  3VYU A;  1EIG A;  1ESR A;  1IW7 D;  1OXS C;  4XTC S;  5CYU A;  3V96 A;  2JA6 B;  2Q8I B;  2ICI A;  2E74 C;  3HZX A;  1H9K A;  2V4D A;  3S1Q B;  3HOW B;  3E5S A;  4KY5 A;  4N9T A;  1CT1 D;  4BY1 B;  2I46 A;  1TS2 A;  5CV9 A;  3NE5 B;  3TN2 A;  4CKC A;  2XWJ B;  3J7A F;  3L3O C;  1DJR D;  1FYC A;  1TY0 A;  3A8I E;  4KKT A;  5EPK A;  3VR2 A;  2K5D A;  1G2T A;  5K36 H;  3NBH A;  5KND A;  4NW2 A;  1I4H A;  4N9P A;  4IUT A;  2EYL A;  1TII D;  1SE3 A;  4KKS A;  1MBY A;  3SE0 A;  5D65 A;  5M5Y B;  3PUV A;  2B8F A;  1G91 A;  4XDX A;  1JC7 A;  5I4D A;  3X3M A;  5DEH A;  1GUT A;  2NVQ B;  3QWN A;  2ENB A;  3BDC A;  3DWP A;  3G6J B;  3I8Z A;  1IL8 A;  1LO5 D;  4B9X A;  3K59 A;  1WD0 A;  4BA2 I;  2XRQ D;  1SNC A;  1KDB A;  3I91 A;  5J22 A;  1BF4 A;  1PYW D;  3KBX A;  3O13 A;  4R8I A;  4U68 A;  4CHT B;  2ZT9 C;  4WRD A;  2EPB A;  3NPP A;  3TP7 A;  1WTV A;  4KK7 A;  1HA6 A;  1CQF A;  1TS4 A;  3BZD B;  4EQP A;  1V1P B;  1LLR D;  4OIJ A;  5JEA H;  1HUM A;  1SBB B;  4C3H G;  1SSO A;  2Q8T A;  4OL7 A;  3MVV A;  1OXX K;  4QUC A;  3IL8 A;  3NQI A;  1V1O A;  3AU7 A;  2XNA C;  4FF4 A;  2GA4 B;  4A93 B;  1MSH A;  5LL6 S;  3TP5 A;  2EYP A;  1OO9 B;  2A73 B;  4KHV A;  1EEF D;  3BVM A;  4OGQ C;  1A2U A;  1BO0 A;  5KNB A;  1JWS D;  3RLF A;  1TWG B;  2D62 A;  2EXZ A;  4C1N K;  4I65 A;  2F0Q A;  3N6R A;  2K1B A;  1JWU D;  4RGN A;  1BCP C;  4KV6 A;  1PZJ D;  2K05 A;  3GTL B;  4H0L C;  1STE A;  2RSO A;  1TVX A;  4HR7 B;  3QO2 A;  1KLU D;  4DFA A;  4A3E B;  4DK0 A;  4HSP A;  4IUR A;  4ABN A;  2JA7 B;  3PO2 B;  1JE4 A;  1H9J A;  2I07 B;  4RKB A;  3M4Y A;  3IFD A;  5CBA E;  1WTO A;  1WTP A;  3H6M A;  2LFN A;  3NUC A;  3PUW A;  1CHQ D;  3K5M A;  1LTS D;  3MFY A;  4NKL A;  2WP8 J;  2NUC A;  1NCV A;  2PQE A;  1M8A A;  3Q22 A;  1GUW A;  4LK1 C;  1SAP A;  4Z9C B;  3OWE B;  1BR9 A;  1JOO A;  2K5Q A;  2MPM A;  2A68 C;  5JVG 3;  2KCN A;  4OO1 G;  2MJ8 A;  5CC4 A;  1TU2 B;  4C3I G;  3J7Y W;  2F4I A;  2WKD A;  2WV6 D;  3PV0 A;  2A6H C;  5K5P A;  2QIL A;  1STN A;  1MSG A;  2F0V A;  4L63 B;  5DNF A;  4DAV A;  3NQT A;  4R9W A;  1IYU A;  2N55 A;  4FVM A;  3TBI B;  3BVZ A;  3T56 B;  5JOB A;  3GTP B;  1SMY C;  5C0X G;  1YNJ D;  4ODG A;  1WTQ A;  3MC0 B;  3GTJ B;  4HMI A;  2B8G A;  1B4O A;  1ZEQ X;  2A5H A;  2O2L D;  3IAY A;  3BYT B;  5ISR A;  2LKV A;  2F1M A;  4XXE A;  3CHB D;  1RKN A;  3S1M B;  3GTO B;  5LHY 1;  3MEH A;  2TMP A;  4DK1 A;  4HCS A;  4OO1 H;  2AUK A;  1SNM A;  3S15 B;  4A3K B;  4MN3 A;  1ET6 A;  5IOC A;  3T51 B;  2NTT A;  3QB3 A;  1PTO B;  1DXM A;  2AUJ D;  2EY2 A;  3W3A A;  2F0J A;  1DCZ A;  1I3Q B;  2A69 C;  2OXP A;  1F2L A;  4KY7 A;  1H9S A;  4KMU C;  1ROD A;  3J80 E;  5CV8 A;  4RGM A;  1Q12 A;  4GZY C;  5EBC A;  1EL0 A;  1HRJ A;  4A3M B;  1SJE D;  1D5Z C;  4I7Z C;  5C0X H;  1Z6H A;  3SEB A;  1GHK A;  2OT2 A;  3HOY B;  3FMC A;  2F3W A;  1LTB D;  5KYL A;  2A6E D;  4KTA A;  2B2Y A;  4TQU S;  2RKS A;  1CQV A;  3Q0A A;  1SYD A;  2B2U A;  4QB4 A;  1H9R A;  4F7X A;  4KD3 A;  2AQ3 B;  1EY8 A;  2PPB C;  4FXG C;  3RZO B;  4G7H C;  2KJX A;  1Y8P B;  2EJM A;  4X3U A;  2F03 A;  4G7Z C;  5D3D A;  5BN4 A;  1GUG A;  4XYQ A;  2F0P A;  2IX3 A;  4BY7 B;  5D3I B;  2IW3 A;  1GJX A;  2KEC A;  4IUP A;  5IGD A;  4TRD A;  1QNU A;  3OMG A;  2LS0 1;  2KEE A;  3NP8 A;  2L5T A;  4ZRZ A;  5FO8 B;  2RSN A;  2K04 A;  1SEB D;  1XWE A;  5KGU A;  3CU7 A;  4F87 A;  3TME A;  2VXW A;  1UNS A;  2F0F A;  4A3B B;  3GTK B;  4C3J G;  3KLS X;  4K5W A;  1KDC A;  1DYQ A;  4IFD I;  1HQM C;  1FNW A;  4IFD J;  5CGK A;  2JSO A;  2KUM A;  5C5M A;  1D5M C;  1ONL A;  4RGO S;  3HRZ C;  3K5L A;  1G29 1;  5IGE A;  3NHH A;  5IT9 E;  1K8O A;  2HCI A;  3DWA A;  1PRT F;  3QJY A;  5EQ0 A;  2B2W A;  2NBF A;  1PFN A;  3OIQ A;  4RWS C;  2F0H A;  2B2V A;  1BQQ T;  1EEI D;  5NUC A;  2FHT A;  3PUY A;  2YU9 B;  4X3S A;  4IZ8 A;  2L0C A;  3P75 A;  4A3J B;  1PRT D;  1C8C A;  3BVG A;  4K2K A;  3SHL A;  3MTS A;  3ITP A;  2PNR C;  4ZLT F;  1E2W A;  3OMC A;  3H3V C;  1QWY A;  5K36 G;  3R2I A;  3NWS A;  1EQT A;  3M7G A;  3VYS A;  1F9Q A;  1KAB A;  2JYO A;  1U4R A;  2YYZ A;  4PV1 C;  1TQO A;  3KBG A;  2AWN A;  5ELD A;  1STH A;  4FO2 A;  3T53 B;  4NMZ A;  1KAA A;  3IFT A;  3PO3 B;  1TWF B;  5C3X A;  4G7O C;  1F2Y A;  1B9M A;  1C4Q A;  3HGB A;  4ZUI A;  1AW7 A;  1ZKO A;  2XSC A;  4LJZ C;  2QF7 A;  3MXG A;  2RDG A;  3HEJ A;  1U4P A;  3J81 E;  2L9H A;  1ESF A;  2A68 D;  3LNN A;  3NTH A;  2PW5 A;  4DGZ A;  3I72 A;  2BDN A;  2EY6 A;  2K33 A;  2IT1 A;  3MAQ A;  4Y7N B;  1NAP A;  1QIL A;  2K5W A;  3R8B A;  3G7L A;  2ZXR A;  1ENA A;  4K14 A;  3BDL A;  3D6W A;  2CHB D;  1XTC D;  1WVL A;  3GTG B;  4O42 A;  2R93 B;  2IJ0 A;  2ID0 A;  1RTN A;  2NYZ D;  4PMC A;  1S5B D;  1BUV T;  1R4P B;  4XIG S;  5JEA G;  4M1U B;  1GUO A;  2M2L A;  4OIK A;  4OHJ A;  2RDF A;  4L6T B;  3BG3 A;  1EOT A;  1QE6 A;  2NB0 A;  3U9S A;  1SYF A;  1EY5 A;  3EQL C;  3PUZ A;  3CRK C;  1AZQ A;  1E2Z A;  3TSS A;  1D1I A;  4FP5 D;  4A3D B;  2SNM A;  4JK1 C;  2E2I B;  1A15 A;  2VB2 X;  3A7L A;  5EPL A;  5FO9 B;  1PMR A;  3HS0 C;  4XQQ A;  5C4Z A;  3DUZ A;  3ONA B;  4EQO A;  1NR2 A;  4EQN A;  2BE5 C;  3VA7 A;  2E2J B;  4BWG B;  2WIN B;  3I90 A;  1ZYR C;  5HUR A;  4CGY B;  1EFI D;  3SK6 A;  3A55 A;  5JEA J;  3P7J A;  1V8Q A;  3ERO A;  4DNR B;  1TS5 A;  2LY7 A;  1EYA A;  3R93 A;  1I4P A;  3OIP A;  1I50 B;  4KI0 A;  1OXT A;  1L0Y B;  3K58 A;  2A69 D;  2NN6 G;  5IT9 L;  1HTL D;  5CV7 A;  2EYM A;  3F2U A;  1MI2 A;  1DD2 A;  4RCN A;  2VNU D;  3HOX B;  4IUN A;  1JB3 A;  3TP6 A;  3HOZ B;  1C48 A;  1Q90 A;  4HAE A;  2F0T A;  1M4V A;  4QF4 A;  3TDQ A;  2F0G A;  3BYY B;  2B2T C;  2B63 B;  1HQR D;  3R3O A;  3MXU A;  3S1N B;  3DEP A;  4EVO A;  3GTM B;  5M5W B;  4DNT B;  1VCI A;  2CVR A;  4KN4 C;  2KCC A;  2XVS A;  4ZUJ A;  5FO7 B;  1W6J A;  4DN4 M;  2WB1 B;  3Q23 A;  1Y1W B;  3J81 L;  3S17 B;  3GO5 A;  2JEA I;  5J1Z A;  1STA A;  2KHS A;  5ELB A;  3TZD A;  3GTQ B;  1B50 A;  2EDG A;  1CTM A;  2FJ2 A;  2EYO A;  1F9R A;  2NN6 H;  2PMZ B;  1DOK A;  3ND8 A;  1MD2 D;  1X3Q A;  5C44 B;  3A8J E;  3C46 A;  1S5F D;  1F77 A;  2ZXP A;  5IOD A;  1T5E A;  1LT3 D;  2O5I C;  3SDZ A;  2B39 A;  3S16 B;  1O7Z A;  1GUS A;  2R61 A;  1GHJ A;  3M7N A;  1DOM A;  1WTW A;  5C5L A;  3KK7 A;  1PTO C;  3FEW X;  5M9O A;  1L0X B;  4K6D A;  4FNF A;  2X6G A;  1ILP A;  5C3W A;  1FGB D;  3I70 A;  3PUX A;  3FDT A;  1EY7 A;  3QIA A;  1KLG D;  3HG9 A;  3EA6 A;  4K5V A;  1VF7 A;  4ZKB B;  1F9P A;  5I6Y A;  1CHP D;  5DAU A;  5EJW A;  4IUU A;  2QEJ C;  5KRU A;  1EIH A;  1JR0 D;  3U9O A;  3W2D A;  2TSS A;  2ZXO A;  3PIP 3;  5COY A;  3P1H A;  5A2Q E;  4ME5 A;  2AQ2 B;  1NR4 A;  1ZXT A;  1CFM A;  4QIW B;  1I4Q A;  3DMU A;  1DM0 B;  4HED A;  5I2Y A;  4Q0F A;  2K01 A;  3K7A B;  4CKE A;  1QG7 A;  3K5N A;  1STG A;  3EFX D;  2VUM B;  1ET9 A;  1TWA B;  5IGG A;  4H44 C;  1HFG A;  4LMQ D;  4K8I A;  1YNN C;  3D3R A;  2EYJ A;  2J0T D;  1O7Y A;  4OO1 I;  2F0W A;  1BXT A;  4BBR B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...