1M8VA

Structure of pyrococcus abyssii sm protein in complex with a uridine heptamer
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
72
structure length
72
Chain Sequence
AERPLDVIHRSLDKDVLVILKKGFEFRGRLIGYDIHLNVVLADAEMIQDGEVVKRYGKIVIRGDNVLAISPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 5'-R(P*UP*UP*UP*UP*UP*UP*U)-3'
publication title Crystal Structure of Pyrococcus abyssii Sm core and its Complex with RNA: Common Features of RNA-binding in Archaea and Eukarya
pubmed doi rcsb
source organism Pyrococcus abyssi
molecule tags Rna binding protein/rna
total genus 15
structure length 72
sequence length 72
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N
ec nomenclature
pdb deposition date 2002-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1m8vA00
4J5YA 4RCCA 4XTZA 4M7DE 1U1SA 1LJOA 4XTYA 4QVCA 1KQ2A 2E10A 4XU2A 3JCMX 1B34A 4M77A 3JCMP 4C8QD 3JCMf 4X9DA 1Y96B 3BFMA 3V8JA 5LJ5d 2EJFA 5GAN5 4C8QA 4M7DD 4M77B 4M78C 4M7AB 3JB9G 5GMKi 4PJOB 5GAMe 3JB9F 2K57A 5LJ3f 1I8FA 4M7DA 4M77G 4PJOG 3RESA 1LOJA 3HFNA 4PJOF 4C92C 1HK9A 5GAN6 4A53A 3FJPA 4EMKB 4M7AF 2JN0A 4C8QG 4M7DB 4M7AE 3JCMd 4PJOE 2YLCA 5LJ5j 1N9SA 1KQ1A 4N0AA 4M7DG 4MMKA 5GANj 2DTOA 4XTUA 2DZ9A 2RD1A 5LJ3d 5GAOr 2VXFA 4Y91A 3JB9D 3JCMc 2E64A 3SWNB 4XTWA 5GAMg 2E65A 2EJ9A 4M77D 1Y96A 2RB6A 4M7AD 4M75C 5CAIA 4PJOD 1I81A 5GAN7 2VC8A 4M7AA 4PJOA 3RKWA 1HXDA 1WQ7A 3V7RA 3JCMb 5GAOm 2ZGWA 4C92F 5LJ3j 4XQ3A 4DQ2A 1M8VA 1U1TA 2I2LA 5GMKh 3HFOA 5DY9A 1WNLA 4C92E 1LNXA 4EMHA 4EMKA 2DEQA 3BY7A 4XU3A 1N9RA 4M7AG 4J6WA 2DKGA 1JBMA 5I21A 1X01A 3BDUA 5GAN3 1I5LA 3EFSA 2EWNA 4HT8A 2DTIA 5GAOl 3BW1A 4C8QC 5GANh 5GAOq 3SWNA 4M75F 3FB9A 5GAMf 4NL3A 5GMKe 3JB9H 4M78B 3EFRA 4JUVA 4M75E 4C92A 4F7UB 1I4K1 4A54A 4EMGA 3JCMh 1MGQA 3RUXA 2FYKA 4M78F 4F7UG 4C92B 3RKYA 4F7UF 5GMKm 3JCMQ 5LJ5e 4JRIA 2E41A 3JCMV 4N0AC 4M78E 1WPYA 1D3BB 3RIRA 4C92G 4F7UE 3INZA 5GANe 5GAN8 3GIBA 5GAMd 4XU1A 4MMLA 2CGHA 2DJZA 3JB9J 3HSBA 4WF2A 3VU3C 5GMKj 3JCMW 1JRIA 4JLIA 4M75A 4J6YA 2FB7A 3M4GA 3AHUA 1BIAA 4V2SA 2DXTA 3JCMe 3L1AA 1YCYA 5GMKl 4M77C 5GAN2 4M78D 4M7AC 2DVEA 3L2ZA 4M75B 1BIBA 5LJ5h 4XU0A 4PJOC 1H641 4NL2A 4HT9A 5GAOn 3QO3A 5GANf 4M78A 5GAOp 5GAMj 1M5Q1 4M75G 4F7UA 5LJ3e 5LJ5g 4C92D 4EMKC 1WQWA 5GAN4 3V8KA 4M7DC 4J6XA 5GANg 3V7SA 2DZCA 3FIFA 4M78G 1D3BA 4RCBA 4XTVA 4QVDA 2Y90A 4XTXA 3JB9I 4NOYA 3JCMJ 1B34B 2EAYA 2EJGA 3JCMg 5GANd 2RM4A 3SB2A 2HNIA 2QTXA 4OP0A 1TH7A 4HA8A 4PNOA 3SWNC 2RA2A 3QUIA 5LJ3h 3V8LA 4C8QB 4M77F 2E1HA 4M75D 3QHSA 3RERA 4JRKA 5LJ3g 2YHTA 3QSUA 2VXEA 4M77E 4X9CA 3V7CA 4C8QF 2YLBA 2DTHA 3PGGA 4C8QE 4M7DF 5LJ5f 3RKXA 2DXUA 5GAMh
chains in the Genus database with same CATH superfamily
4RCCA 3I5SA 3A5ZB 1UECA 2P0PA 3VS0A 1KQ2A 3OQ5A 4C5HA 4OGCA 2PQWA 3VV0A 1CSKA 2PVGB 2LNHB 1NM7A 5FW9A 3UATA 2DRKA 1QVGA 2BZ8A 5KE2A 1KQSP 2RHUA 4C92C 2BIVA 2QA4Q 4RTUA 4DBRA 1K8AR 3H0IA 4N0AA 3NMZC 1SHFA 3I56Q 2QXFA 2RD1A 4RG8A 2MAMA 4M77D 2LT1A 2COYA 2MWOA 4PJMA 4R56A 3CC2A 1MNEA 2EQMA 2K4YA 2RHZA 2E6NA 3EG0A 1QKXA 1Y07A 1YBYA 3WXMB 1QVPA 3BY7A 4KGXB 2ZPFB 4J6WA 2F2XA 2YUQA 4FW2A 1X01A 1I5LA 4QT7A 4HT8A 2C0IA 2X35A 3FB9A 3MKDA 5D6XA 4NL3A 3EHRA 3ZFJA 1MGQA 1UHFA 4QKUA 2QASA 3SD4A 4D8KA 3JB9J 1WJQA 3TQ7P 1BCOA 3M4GA 1Q86R 5DLOA 4A63B 3CC2T 1VQNA 3OBYA 4GBQA 3QO3A 1VQPT 1M5Q1 5LJ3e 2PUOB 1PCXA 2ZPHB 2O31A 4M7DC 1C6VX 2DE0X 2KAFA 2MF2A 4A4EA 1UDLA 2OTJQ 3S3OA 4PNOA 1WLPB 2GGRA 1TH7A 1U8RA 4C8QB 3O8VA 3VYHB 4LDXA 2LMJA 2L3RA 5LJ3g 1WGSA 2PVOB 1GFDA 2XIDA 1TTHB 3NTKA 4Z02A 2KY9A 3M0QA 3CBPA 3OW2A 1YI2Q 3I5RA 4KUDK 4XU2A 2FZCB 1YITA 1E6GA 3OYEA 1G83A 3QXEB 4LNPA 3OYYA 2YUPA 1MMAA 3DKMA 3CEYA 1LOJA 2Z0WA 5GAN6 1MMGA 1Z9ZA 3THKA 2AHJB 3ASKA 2W0ZA 5GANj 4IUUA 4QQDA 2G6FX 2J7IA 4C0ZA 1M8MA 1HXDA 2QEXT 3C12A 1RLQC 1YCSB 3CCVT 2LVMA 1V29B 2L8DA 2DEQA 1W6XA 2KYMA 1M3CA 1YITT 1WX6A 3G1JA 4DBFA 4ZN1A 4P5NA 3SWNA 2KBTA 1Q82U 1VYTA 3GOXA 5CK9A 4F7UB 9ATCB 2EYZA 2MYSA 5KE3A 4N0AC 2BE9B 2ZPGB 1K73R 1NLPC 1WHJA 3REBB 1K8AC 2DLPA 4JZ3A 1BIAA 3G71T 4FYWB 4DA4A 5KYXB 4E7JA 3OA6A 3OYDA 4HXJA 4KH0B 3C94A 4Y92A 1N5ZA 2K3YA 4C0DB 1X6GA 1ARKA 1PHTA 2MCNA 3CMAT 2KYBA 1M1GA 2NUZA 3I55Q 4XTYA 4RTZA 4FW1A 4XTZA 5CO7A 3VS7A 3EG9B 1EIFA 1SRLA 2LJ1A 3H0HA 2EGAA 2OTLQ 4JLGA 1M2VA 3NHNA 3FLGA 4PJOB 5GAMe 5LJ3f 1Q86C 3M54A 4M77G 2NYSA 4IIOA 2X4WA 3E1SA 4ZGJB 5DM7R 2P0QA 5GAMg 2E65A 1KQSA 4PFZA 2F2WA 2QQ9A 5GAN7 4M7AA 2PNIA 3CCUA 3CD6Q 1PM3A 1WZOA 2AK5A 5CCAA 3OMGA 1LNXA 1ZUYA 2QK0A 2GBQA 3VS2A 4AFQC 1NPRA 2RHXA 1T0JA 4FT4A 3J80E 1OZ3A 2PU9B 3JB9H 1QVFS 1QP2A 1SRMA 2ZPIB 4OGEA 4M78F 2P84A 2K3XA 4BE1A 3G6EA 2K6DA 5CKHA 2ROTA 3M0UA 4M75A 4O6JA 4LD9K 1SPKA 1VQMA 4BY6C 1K9MU 3TSZA 2DETA 2LJ3A 3CCUT 3VRYA 4HT9A 8ATCB 3M5AA 1R0CB 3CC4A 2ED0A 2RJCA 1WHLA 1RLPC 5FWCA 2J06A 1D3BA 2DFUA 2K5FA 1I5OB 1MMNA 2JZ2A 2RM4A 3SWNC 2LP5A 4FSSA 2IVWA 3EFOB 4JRKA 4F04B 5HCKA 1QVGS 1VQ8T 2MK5A 2DM1A 1QQJA 4PFPA 5FROA 4Z89A 3MEVA 1KFZA 5EC7A 3H41A 4JS4A 2BZXA 1B34A 1K73C 2KVQG 3JCMP 1VQMT 2DF6A 2XKOC 3E19A 3DB3A 1EX4A 1Y96B 2CT3A 3LWHA 2AIRB 4E2FB 5GMKi 2GNCA 1YJNQ 2IPOB 5KYUB 3CC4T 2GF7A 4ZGEB 1JU5C 4KRTA 1N8RR 2YUOA 1EFNA 2JW4A 3QYGB 5CQXA 1YIJA 2R58A 2RJFA 1Q7YR 1V1CA 1X2KA 2CUDA 1CKAA 3KXTA 4Y91A 4R0KA 4XTWA 1NG2A 3QPHA 1XQHA 3MPUB 2VC8A 2X4JA 4L59A 1WA7A 4EDUA 4AFSC 4J9FA 1YHQA 4HVUA 5DLQE 3CPWP 5AT1B 4X1VA 3CC2Q 2J6OA 3QBYA 2CZ1B 1X2QA 1VQPQ 2DTIA 3HPWA 3OMCA 3CC7A 4E7ZA 2AZSA 5GAMf 3CBOA 3L2WA 3MEUA 1UUEA 4CC2A 2JVVA 2NWMA 3TEEA 3TSWA 1WIEA 4Z8AA 1IXDA 2LT4A 1YIJT 4M78E 5GAN8 1AWXA 1KC8R 2E3IA 3GBQA 5GAN2 5GMKl 2FPDA 4M78D 2NUTB 4OMOA 4M7AC 2LRQA 3QKJA 1H641 4NL2A 1NE8A 1PKTA 2RNAA 5J26A 5GANf 3X28B 2FVUA 2O9VA 2VVKA 1OX9A 1YHQT 1BK2A 4GLMA 4BI8B 1XTDA 4RG2A 2K79A 1FX7A 2Y90A 2AT1B 4BACA 2EJGA 2QQRA 3CXCS 3S6WA 4DEXA 1RABB 3QHSA 3RERA 2O4XB 5J39A 2RH2A 2G3RA 2OJ2A 2YLBA 1RAGB 2CSIA 3CCEQ 1AWOA 1BI1A 4MDWA 2YSQA 2E10A 2O01E 5FRMA 1YFNA 2QEXQ 1RAFB 2LNVA 1VQ4A 3CCVQ 3QZ5B 2FO0A 1ABOA 2XICA 2JUFA 4A4HA 2EW3A 1YITQ 3TREA 5D7UA 1OOTA 3A8OB 1M9SA 1Z9QA 3EGUA 4FL6A 3CCQA 1RAAB 1AZEA 1G8XA 2CP6A 3RKWA 2WSCE 4E7HA 1HD3A 2RO0A 4HVVA 2HQHA 2Y4XA 3DLMA 3HFOA 1XOVA 3URGA 3G71Q 4L6V5 1P92A 4BE0A 1M90U 2ZPBB 1NJIR 3EGDA 5IAYA 2DL4A 3PIPA 1VQ4T 1JO8A 1LCKA 1NYFA 5GMKe 1TS9A 4DBHA 3C0CA 1QCFA 2YRVA 4FYXB 1W2BP 4C5EA 2CP5A 4A54A 1ZX6A 2RF0A 1YJWA 5GMKm 2CP0A 3ZEHA 3JCMV 2CS7A 4QW2A 4OMQA 3CMAQ 1N8RC 3CCQT 4V2SA 2CH4A 1Q7YC 2EVRA 3PFSA 4HCZA 1WXTA 4M77C 5IT9E 1OV3A 3GLXA 1UTIA 3AT1B 1IRXA 2M0OA 2RQRA 4CRIA 5KCHA 2F69A 2DBKA 2RJDA 4QVDA 4NOYA 4D8DA 4OP0A 3JCMX 3UA6A 2HKNA 1S72Q 4M75D 3EG3A 4C8QF 4FT2A 1HYOA 5KYYB 1UJ0A 1YJWT 5L8RE 1ACMB 2VUBA 3EG9A 1RAIB 1VQ7A 1QVFA 2V26A 2XD0A 2DL8A 4J5YA 2YUNA 4KGZB 3CPFA 2L0AA 1UGPB 2D0QB 2YT6A 2LQWA 2QGGA 1KQSS 1KC8C 3M53A 2J6KA 1NEBA 3JCMd 3VS4A 3FEOA 2CKKA 1Y71A 2DZ9A 1GXIE 1VQ5T 2VXFA 3GNGA 3EH1A 3LH0A 3CMEA 2EJ9A 1RI9A 4QQ6A 2L3SA 1M1KR 2ESWA 3G7ZA 4C92F 4BI4A 4XQ3A 3L42A 1G3SA 3QDRB 2RI3A 5FU6C 1N9RA 4PLIA 1QKWA 4OMFB 2SRCA 2D6FA 2LDMA 4KBMB 1Q81R 1KD1U 4QVZA 3WVEB 3HRTA 3R6NA 4JUVA 2ECZA 1IGUA 1ZSZB 2EYYA 4F7UF 3PE0A 1WPYA 4J9DA 2ZPEB 1M4ZA 5A0GA 1VQ8Q 3FDRA 3CMET 4JLIA 2CSQA 1OEBA 4YTLA 4PKCC 2KK4A 2PTKA 3L1AA 5IHIA 2IIMA 3NFCA 1JXMA 4XU0A 2X4YA 1ZA2B 1BU1A 2M16A 2RJEA 2FG0A 3E9GA 1BBZA 1PRMC 4PJNA 1VQMQ 2DA9A 2DILA 4RCBA 2KRMA 3UF4A 2LTOA 1YNZA 3CCMA 3OYJA 3V8LA 3CC4Q 4HA8A 3CCLA 1TUDA 1NJIC 3QIIA 4CC7A 1MUZA 1TOVA 3SEMA 1U5SA 4C8QE 4M7DF 3HL8A 5FLXE 3G4SA 3M55A 3VRZA 1G5VA 1RI0A 1UGVA 3M0TA 5FU7B 3I9QA 3EHQA 4B6MA 4C8QD 1SKUB 3F70A 5KYUA 2QQAA 2DVJA 2RHIA 3LLRA 3NGPA 5FRNA 5HY6A 4EIKA 2MPXC 3QZ9B 2ZCFB 4PJOF 3VKIA 1K0SA 4A53A 4EMKB 2O88A 1V76A 2YLCA 2DMOA 2VWFA 4Q5WA 1RL2A 5AYFA 2DTOA 3CCMT 5FWBA 2FRWA 1VOMA 3CCLT 3JCMc 2PUKB 4BD3A 4F17A 3VJPA 3CXCA 1YIJQ 1JXOA 1VQ6A 3TU4K 1AOJA 1VA7A 3G4ST 1VQNT 2B8AA 1WFWA 1X27A 4BUGA 4C92E 4EMHA 3OS1A 4JJBA 4XU3A 4M7AG 1D0YA 1IO6A 4N4HA 2XHCA 4AFUC 1Y57A 1UGSB 3IQLA 1D1CA 2OAWA 5GAOl 1YHQQ 2JOYA 2YRDA 3I35A 1E7OA 1FMVA 2H3JA 4C92B 1GCQA 4F7UE 3A1PA 4RKUE 2QG9B 1JJ2P 1O75A 1IHWA 4OVAA 1S1NA 4LXCA 3M0RA 4M78A 1K73U 2J6FA 4M75G 2KNBB 4RTWA 3CCRA 1VIEA 1FMKA 3TCJA 1M1KC 2DZCA 1X6OA 2KXCA 5HK3A 3J81E 1J3TA 2V1QA 2JM8A 2HNIA 4AMCA 1Q81C 3TVTA 1WDXA 1UG1A 1YWPA 3ZBDA 5EG2A 1JB0E 2VASA 1PRLC 5M9OA 5GAMh 4M7DE 1YJ9A 2KEAA 4ZGDB 2XDPA 2NUPA 1T3SA 3P8BB 3QDFA 1BYMA 2HSPA 4C5GA 4M7DD 2CH4W 3CCRT 1TU0B 2KRSA 3KFVA 4LDYA 4F16A 1VQKA 1QW1A 4M7DB 4PJOE 2ABLA 2XG8D 4MMKA 4IURA 2C06A 1GL5A 2E70A 1XJWB 4N4IA 4MZMA 4PJOD 4JPBW 1R8OB 1SSHA 3RMSA 5GAOm 3NTIA 2I2LA 2KGTA 3CCQQ 1YJ9T 2EGEA 4DOVA 2FEIA 2KI7A 4LDWA 1OZ2A 5CR2A 2LJ0A 2LX7A 3M59A 1I4K1 4OF1A 2ENMA 1VQKT 2QTVA 3M9QA 4FM4B 2OAUA 2K3BA 2X3XD 4JDSA 3X25B 5GANe 3U23A 3A8MB 4WF2A 2ED1A 3JCMW 2HCKA 2DPPB 3QJYA 2DXTA 1YJWQ 3FJ5A 1YCYA 4M4ZA 1PKSA 2HSEB 1OU9A 2EFIA 2KRNA 5HKCA 4J9BA 4CC3A 4J6XA 5GANg 4J7FA 4RTYA 2QA4A 2DO3A 1PC0A 1OU8A 2QTXA 3AHUA 2O9SA 5KYYA 5HK0A 2RK1A 4HCBA 4PJLA 3Q1JA 3LW5E 5CVIA 1VQ5Q 3E2UA 2HMAA 3N5BB 3MEWA 4IUPA 2JXBA 4PFOA 2LC4A 3OYMA 2M0YA 4M78C 1WHGA 5D6YA 4FSXA 4AFZC 1GRIA 1YWOA 3PVLA 5LJ5j 3H0FA 4LD6A 1QMCA 2O2OA 1VYUA 4ELZC 1KG1A 3MP1A 2A7YA 4J7IA 4UC4A 3G6ET 2R5MA 1K9MR 3E9FA 2GFAA 2KR3A 3OS2A 2QQSA 3CPWS 1Q7YU 1U1TA 2MOXA 5DY9A 4MDXA 2XI9A 2YXYA 3VS1A 3JV3A 2EYWA 5CKFA 1VUBA 2M1HA 4LDVA 2BUDA 1QP3A 3PMTA 2EQIA 1GFCA 2ROLA 2VGNA 4OMMA 3EFRA 2YWWA 3CCSA 2RHYA 4E7IA 2M51A 2MWPA 4F7UG 2AKLA 4VUBA 4JRIA 1AHJB 3PTAA 1UJYA 1D1AA 5I22A 1TUCA 1FYNA 4XU1A 1YI2A 5CKEA 2FB7A 3JCMe 2CDTA 3L2ZA 5LJ5h 2K5IA 3QWYA 1G3YA 3MHXA 2OI3A 1VQLA 5CKBA 2GQIA 1JJ2A 4IUVA 1KC8U 1BCMA 3V7SA 2I0NA 3HRSA 1M27C 1X6BA 4X34A 2M02A 3JCMg 2YDLA 1UE9A 2F2VA 5GMKj 2M9UA 1K1ZA 3MO8A 1N27A 3CCST 3QSUA 4X9CA 2HQXA 5IH2A 4KULA 2SEMA 3CCMQ 4KGVB 3OB9A 4FYYB 1WJSA 3CCLQ 3FRNA 4A4FA 1LJOA 3KUFA 4ATOA 4FCYA 4CI0C 2BE7D 5CIUA 2QGFB 3BFMA 3G4SQ 1VQNQ 4BY6B 4C8QA 3CC7T 1VQLT 4OB1B 4AG2C 4PJOG 3RESA 2CT4A 4LUEA 2MI6A 1OULA 2XDDA 2E6ZA 3RBBB 3SWNB 2KE9A 2GTJA 4M75C 2JTEA 2COWA 3HRUA 2CZ0B 1B3QA 3PT9A 3JCMb 1M8VA 5GMKh 4JJNK 1WNLA 3GF5A 4RTVA 5C6SA 2RI2A 2X3WD 4RUGA 2MIOA 1W2BS 1AEYA 3UDCA 4Y28E 5A0DA 2EQKA 4IIMA 2FL7A 4C92A 1ZHIA 1NJIU 1SF9A 2DJQA 3OW2P 1QWEA 2DYBA 1H8KA 3OY9A 2JMCA 1ZA1B 3HSBA 4J6YA 1KK7A 4KH1B 1PSFA 4ORZA 2HZYA 4JZ4A 4F7UA 3UPUA 1IREB 1WQWA 5CQYA 2BZYA 3PNWC 2CP2A 4BDZA 3OYFA 3NPFA 3OYNA 2HL3A 1ZLMA 4ZNXA 3CCRQ 3SB2A 1NYGA 3HP9A 1M2VB 3QUIA 1BKBA 3MJXA 4M77F 1PD1A 5KYXA 4PJJA 4F14A 4B9WA 5IXBA 2DNUA 2EQJA 2LQ8A 2FHDA 1MHNA 1QWFA 5J3BA 2E5QA 4LDUA 1TSFA 1I07A 2WSEE 1M90R 2DL7A 3M57A 3JCMf 4XK8E 2BKDN 2CYZB 1LVKA 2L3PA 4Z88A 1TWBA 4M7AB 2DIQA 3JB9F 2K57A 1OI1A 4M7DA 2YRCA 1C1AA 1ZQ1A 2KQWA 3SHWA 5KYWB 1HK9A 1I0CA 1X75C 3OS5A 4ZTJA 1N9SA 3NTHA 3RDVA 5L23A 4JJDA 6AT1B 1QCNA 3PIOA 3MEAA 3DB4A 1O9SA 2KDSA 4NS5A 2EGCA 2A08A 3EH2A 4DBQA 4PJOA 4ZTFA 3SFMA 5LJ3j 2QYZA 4DQ2A 5IXFA 4AG1C 2LCCA 3VS6A 4K11A 4OMPA 2GTOA 5I21A 2L89A 5GAN3 3EFSA 3ZL7C 4C8QC 4L5GA 3EAEA 1D1BA 1MV3A 1C0MA 5CKDA 2FYKA 1D0ZA 1Q81U 1K8AU 2RMOA 1D3BB 3RIRA 1VQ7T 2X9HA 3L2QA 3A98A 1B07A 1PD0A 1W4SA 1PWTA 3CCUQ 3CCJA 2VKNA 5GAOn 4KT0E 5GAOp 4HKEA 3LGLA 1YJNA 1WHMA 1E6HA 1HSQA 3CPWA 3OYIA 2HBWA 4M78G 2WACA 2PZ1A 1A0NB 1B34B 2DL5A 1SEMA 5LJ3h 2RPNA 2LZ6B 1T0HA 4JRQA 4M77E 3EGXB 1DJ7B 1UGQB 1Y0MA 3REAB 2HL5C 2QI2A 1MV0B 2V8JA 1ZUUA 3C95A 3G6EQ 1K76A 3VS3A 4QVCA 4PLLA 3LX7A 5I2MA 1Q86U 1KD1R 2RQUA 3CCJT 5LJ5d 1ABQA 1VQPA 3EFOA 3M4YA 2LX9A 4M77B 1IHVA 1Q95G 2E12A 2LCSA 1YJNT 1AZGB 1FMWA 2JMAA 4ELYC 4HCCA 2H3EB 3LGFA 4DOWA 2PVDB 1YP5A 2EYXA 4QQGA 2XU8A 4XTUA 3UT1A 3JB9D 1KIKA 3M56A 1GCPA 1Y96A 2RB6A 5CAIA 3LWIA 2EPDA 1SSFA 2KSSA 1RADB 1Y7XA 2DD5A 3HKSA 3OYHA 2DKGA 5LL6S 1JBMA 4C0DC 1OYXA 3R6OA 3OYKA 3GNFB 3BW1A 4MZPA 1M90C 3M0SA 4KUIA 1WXBA 2DAQA 2P4RA 3WVDB 1JJ2S 1NBEB 2RK2A 3CCEA 4J9IA 1SG5A 3CCSQ 3ER0A 1JRIA 4JJCA 1OPKA 4PJOC 2QEXA 1BI3A 3CCVA 5GAMj 1ZBJA 4C92D 2ZZDA 2DXCA 4J8OA 3S3MA 5FU6B 1K0XA 3CC7Q 2EAYA 1VQLQ 1R0BG 2EBPA 3JSCA 2QDYB 3ME9A 3A8LB 2VXEA 2NUTA 1W2BA 1AVZC 3RKXA 1VQ6T 1H92A 3CCET 1U1SA 3KBGA 2RQVA 4OB0B 3G71A 1IB8A 2E4HA 1FWZA 2QAZA 4FIBA 4IUQA 3L2VA 2KT8A 2O4XA 3QG1A 2BTTA 2W10A 4RTTA 3PVQA 1KQ1A 2E5KA 2A28A 2EKHA 3EGDB 5IN1A 1WI7A 2DD4A 3CMAA 4J9CA 4A4KA 1TXQA 1I81A 2KMTA 1WJRA 1VQ9A 5ECAA 1Q82R 3MP6A 3H8ZA 3QJ6A 3DLLA 1MMDA 4E7SA 1SHGA 2CP7A 1H3HA 1VQ4Q 5GAOq 5GANh 2X4XA 1RUWA 1UEBA 1KD1C 1S72A 2V1RA 4C0FA 2DBMA 2WSFE 4R55A 1VQOA 3RNJA 2A36A 4MMLA 2GFUA 2V8KA 3H6ZA 1UB4A 4E7LA 2HQEA 2KROA 1JQQA 1AWJA 2DXBA 2EYQA 2HD0A 4C5IA 1BIBA 3A8GB 2COZA 1VQ9T 4CC4B 4BI3A 7AT1B 2VB6A 2AKKA 2R5AA 3FIFA 4J9HA 3JCMJ 2DEUA 2VYTA 3OSVA 1VYVA 2XK0A 1YN8A 2HKQB 3O5ZA 2VGMA 3ULRB 4JS5A 1UHCA 3OSSC 1K9AA 2F5KA 3OBWA 1D09B 1S72T 3BDLA 4J83A 2ATCB 2R57A 1M3BA 2LQKA 4TVRA 5C0MA 1VQOT 3M58A 1ZBXA 2A37A 2H8HA 4ANJA 1M30A 4X9DA 1WHKA 1QLYA 2LQNA 5GAN5 3LH5A 5KYWA 3JB9G 3I56A 1I8FA 1TUGB 3HFNA 3PMIA 2JN0A 1KHCA 4C8QG 3OYBA 1RAEB 1W1FA 2C0TA 2D8HA 2DL3A 1RACB 3LYIA 1GCQC 2FZGB 5LJ3d 1CKBA 3GP8A 1R77A 4RMOA 1PNJA 1VQ8A 4A4GA 2DYIA 4B9XA 1VQ7Q 1WQ7A 1IZ6A 4FU6A 4GY5A 2Y4YA 3D7SB 3RMQA 3FC3A 5KCOA 2QA4T 4HVWA 3X26B 1RAHB 5A0LA 3I56T 4ME7A 4D6WA 4EMGA 3JCMh 2GCXA 3RUXA 1N8RU 2KT1A 1QVFP 2CP3A 3JCMQ 1ZSGA 4FYVB 2E41A 4PK4A 4C92G 2DX1A 2HDAA 1KSWA 1NLOC 3GPLA 3CMEQ 2OX7A 3UWNA 3JAME 3VS5A 2DVEA 2OTJA 2CZ6B 1LPLA 3V8KA 2K2VA 2V8IA 1ZSZA 5GJVB 3M0PA 2VV5A 3L2RA 3CCJQ 1Q82C 2K2MA 4OMLA 2DERA 3UA7A 4LUDA 2HBPA 3HTRA 2RA2A 3EGXA 1KHIA 2A3LA 3V7CA 3MP8A 3CQTA 5IHNA 3S3NA 1QVGP 1NZ9A 2EIFA 4LE9A 3QYHB 1MNDA 4IUTA 4M77A 2P0KA 2JS0A 3V8JA 4RTXA 4GLKA 3OS0A 2OTJT 2C0OA 2B86A 2RN8A 3T9NA 2L2PA 2RQWA 4J9EA 2D0NA 2DK3A 4M7AF 2RQTA 3JRZA 1WXUA 4M7DG 2FPEA 5GAOr 8AT1B 3HHTB 1YI2T 1XNIA 2KXDA 4WTOB 1AD5A 1TG0A 3V7RA 2EKOA 1N6AA 3EG2A 4EMKA 1D0XA 1G2BA 1HJDA 1U06A 2CZ7B 1M1FA 4LN2A 3BDUA 2EWNA 2D9TA 4II1A 3L2UA 3C4SA 4M75F 2E3HA 4WCIA 1BI2A 4M78B 1WYXA 2F5TX 1F1BB 3OW2S 3RR6A 3RKYA 2JT4A 1GBQA 4BDYA 5LJ5e 2D8JA 3VUZA 3X20B 1JEGA 3P8DA 1EZZB 1ZUKA 4O5VA 5GAMd 2CGHA 2D1XA 4OMNA 1T3LA 4XAXB 1VQ6Q 2JS2A 2P4TA 5LJ5g 4OB2B 2J05A 5GJWB 1BI0A 3JB9I 2NUPB 4XTXA 1G3WA 2RI5A 2HAXA 5GANd 2A0FB 2JNGA 3I55A 5KYNA 3OYAA 4BE2A 3CXCP 2DIGA 1VIFA 2IG0A 3CBMA 1AWWA 2AZVA 2DTHA 3PGGA 1IGQA 2OTLA 2DXUA 2FPFA 1H3ZA 1U3OA 2L3QA 2EQUA 4JRPA 1OX8A 5I2SA 1K9MC 3A8HB 2ZAEA 3H9NA 3J7AF 2EJFA 2XMFA 4BB7A 1W70A 1ZSZC 3FJPA 2DRMA 2X51A 4EPCA 4M7AE 2FZKB 1M2OA 4AT1B 2JTMA 2F1LA 1OQKA 3CD6A 3OYGA 3I55T 4HCKA 1FXXA 2JM9A 2E64A 3VUBA 4M7AD 2K7AA 3OYCA 3EG1A 2NLUA 1UGRB 1NPPA 3SDZA 4DEYA 2OTLT 2ZGWA 1M3AA 2JJ9A 2K5LA 2CREA 1YJ9Q 4PL6A 2MMPA 5IHKA 1PG5B 1NEGA 4E6RA 3VYGA 1VQ9Q 1OPLA 4E7KA 4N4GA 4M75E 5D6WA 1WHHA 1VQKQ 1VQ5A 3GIBA 3INZA 5I11A 3CD6T 5FU7C 1BB9A 2QDLA 1G3TA 1UFFA 1QCOA 2DJZA 5A2QE 1AT1B 2FRYA 3VU3C 2GQVA 3BE3A 4IKFA 2L5QA 2QQBA 1VQOQ 4M75B 1M1KU 2LCLA 4ESRA 4EMKC 1GBRA 5GAN4 2K9GA 2JTFA 3OYLA 5KH6A 1PSEA 1X43A 4XTVA 2XDBA 2HEQA 4ZN3A 4OB3B 1KJWA 1X69A 2CUBA 4J9GA 3X24B 1I1JA 2E1HA 3META 4MZTA 3P8HA 4E47A 2YHTA 1K4US 4C0GA 1B7TA 5LJ5f 3QWXX 3MCAB
chains in the Genus database with same CATH topology
3N5BB 4RCCA 3A5ZB 1BI1A 1U1SA 2P0PA 3KBGA 4MDWA 4OB0B 3G71A 1KQ2A 3MEWA 4IUPA 2E10A 3OQ5A 4C5HA 1FWZA 4FIBA 2O01E 2LC4A 2PQWA 4OGCA 3VV0A 3OYMA 5FRMA 2OTJT 2PVGB 4IUQA 3L2VA 2LNVA 1VQ4A 3QZ5B 4M78C 1QVGA 2O4XA 2XICA 2JUFA 3QG1A 5D6YA 4A4HA 5KE2A 4FSXA 2RHUA 4C92C 2BIVA 3TREA 5LJ5j 1KQ1A 4N0AA 4LD6A 2QXFA 5IN1A 2RD1A 2DD4A 1KG1A 3A8OB 4ELZC 3CMAA 3MP1A 1M9SA 4RG8A 2A7YA 2MAMA 4FL6A 4J7IA 4UC4A 4A4KA 3CCQA 3G6ET 4M77D 2R5MA 2LT1A 2MWOA 3E9FA 4R56A 3CC2A 1I81A 2EQMA 2GFAA 2K4YA 2KMTA 3RKWA 3OS2A 2WSCE 2QQSA 1WJRA 4E7HA 2RHZA 3CPWS 1Q7YU 1VQ9A 2RO0A 2E6NA 1U1TA 2Y4XA 3DLMA 3HFOA 3MP6A 5DY9A 2XI9A 1YBYA 1XOVA 1Y07A 4MDXA 3H8ZA 1QVPA 3QJ6A 3BY7A 3URGA 3WXMB 2ZPFB 4L6V5 1P92A 4J6WA 3DLLA 4BE0A 1M90U 2ZPBB 5CKFA 1VUBA 1X01A 2M1HA 1I5LA 4HT8A 4LDVA 5IAYA 2X35A 2BUDA 5GANh 2X4XA 5GAOq 3PIPA 1QP3A 3PMTA 1VQ4T 1UEBA 3FB9A 5D6XA 4NL3A 5GMKe 2VGNA 1KD1C 3EFRA 3CCSA 1S72A 2YRVA 4C5EA 4A54A 2RHYA 3ZFJA 4E7IA 1MGQA 2MWPA 4C0FA 4F7UG 1YJWA 5GMKm 2WSFE 4VUBA 4JRIA 3ZEHA 1AHJB 3JCMV 4R55A 3PTAA 1VQOA 3SD4A 2CS7A 4QW2A 4XU1A 1N8RC 4MMLA 3JB9J 2GFUA 1WJQA 2V8KA 1UB4A 3H6ZA 2HQEA 3CCQT 5CKEA 4E7LA 1YI2A 2FB7A 3M4GA 4V2SA 2DXBA 2EYQA 2HD0A 4C5IA 5DLOA 1Q7YC 3PFSA 4HCZA 3JCMe 3CC2T 4M77C 3L2ZA 1BIBA 2K5IA 5LJ5h 1VQNA 3A8GB 3OBYA 1G3YA 3QO3A 5IT9E 1VQ9T 3MHXA 1VQPT 1M5Q1 3GLXA 5LJ3e 2PUOB 2ZPHB 1VQLA 2M0OA 5CKBA 4BI3A 1JJ2A 4IUVA 4CRIA 5KCHA 4M7DC 1KC8U 2F69A 3V7SA 2R5AA 3HRSA 3FIFA 2RJDA 2KAFA 2MF2A 4X34A 4A4EA 2VYTA 4QVDA 3JCMJ 3OSVA 4NOYA 2XK0A 3S3OA 3JCMg 2VGMA 4PNOA 5GMKj 4OP0A 1TH7A 2M9UA 3JCMX 4JS5A 3OSSC 1U8RA 3MO8A 3O8VA 4C8QB 2F5KA 3VYHB 3OBWA 4M75D 4LDXA 1N27A 3CCST 2L3RA 5LJ3g 1S72T 1WGSA 3QSUA 4X9CA 3BDLA 2HQXA 2PVOB 4J83A 4FT2A 4C8QF 4KULA 2R57A 1YJWT 5L8RE 2VUBA 1VQ7A 2LQKA 3OB9A 4TVRA 2XIDA 5C0MA 3M58A 3NTKA 1WJSA 1VQOT 1QVFA 2XD0A 4Z02A 1ZBXA 3FRNA 4J5YA 2KY9A 4A4FA 3CBPA 3CPFA 1LJOA 1UGPB 3KUFA 2D0QB 3OW2A 4KUDK 4ATOA 4XU2A 4CI0C 1YITA 5CIUA 4X9DA 3BFMA 3OYEA 3QXEB 5GAN5 4BY6B 4C8QA 1KQSS 1KC8C 3JB9G 3OYYA 3CC7T 3M53A 3I56A 1VQLT 3DKMA 1I8FA 3CEYA 4OB1B 4PJOG 3RESA 1LOJA 3HFNA 5GAN6 3PMIA 2MI6A 2JN0A 1KHCA 4C8QG 3OYBA 3JCMd 2AHJB 3ASKA 3FEOA 3LYIA 2XDDA 2CKKA 5GANj 4IUUA 1Y71A 2E6ZA 2DZ9A 4QQDA 5LJ3d 1VQ5T 2VXFA 1GXIE 3GNGA 3LH0A 3GP8A 3SWNB 4RMOA 3CMEA 1VQ8A 2EJ9A 4C0ZA 4M75C 4A4GA 3HRUA 2CZ0B 4QQ6A 3PT9A 4B9XA 1HXDA 1WQ7A 3G7ZA 1IZ6A 3JCMb 4C92F 4BI4A 2QEXT 4XQ3A 3L42A 3C12A 4FU6A 4GY5A 5GMKh 1G3SA 4JJNK 3CCVT 2LVMA 1WNLA 1M8VA 2Y4YA 2RI3A 1V29B 3GF5A 2L8DA 3QDRB 5FU6C 2DEQA 1N9RA 3RMQA 4PLIA 5C6SA 3FC3A 4OMFB 1YITT 2D6FA 2LDMA 4KBMB 2RI2A 5KCOA 1KD1U 2QA4T 4QVZA 4ZN1A 3WVEB 3X26B 1W2BS 4P5NA 3HRTA 3SWNA 3UDCA 1Q82U 4Y28E 5A0DA 3GOXA 5A0LA 3I56T 2EQKA 5CK9A 2FL7A 4C92A 4JUVA 4ME7A 1ZHIA 4F7UB 4D6WA 4EMGA 3JCMh 2GCXA 3RUXA 1N8RU 1NJIU 4F7UF 3JCMQ 5KE3A 2E41A 4N0AC 2ZPGB 1WPYA 4C92G 2ZPEB 1M4ZA 3OY9A 5A0GA 3GPLA 3HSBA 3FDRA 1K8AC 3CMET 4JLIA 3UWNA 3JAME 4J6YA 1BIAA 4YTLA 4PKCC 3G71T 2KK4A 4DA4A 3L1AA 3NFCA 4E7JA 2DVEA 1PSFA 4XU0A 2X4YA 3OA6A 2M16A 2OTJA 2CZ6B 4F7UA 3OYDA 2RJEA 3UPUA 1IREB 1WQWA 3C94A 5CQYA 2K2VA 2V8IA 3E9GA 3PNWC 3V8KA 4BDZA 3OYFA 2VV5A 3L2RA 2K3YA 3OYNA 4RCBA 1Q82C 2LTOA 4C0DB 3SB2A 2HBPA 3CCMA 3OYJA 3V8LA 3HP9A 4HA8A 2RA2A 3QUIA 3CCLA 1BKBA 4M77F 1NJIC 3CMAT 1KHIA 2A3LA 3QIIA 4B9WA 3V7CA 3MP8A 2EQJA 2LQ8A 1M1GA 4C8QE 4M7DF 2FHDA 1MHNA 3HL8A 5J3BA 3S3NA 5FLXE 3G4SA 4XTYA 1NZ9A 2E5QA 2EIFA 3M55A 4XTZA 5CO7A 4LDUA 1G5VA 3QYHB 1RI0A 1EIFA 5FU7B 2WSEE 4IUTA 3M57A 4M77A 2P0KA 4C8QD 4JLGA 3JCMf 4XK8E 3V8JA 2BKDN 2CYZB 3F70A 2QQAA 4GLKA 2RHIA 3FLGA 3LLRA 4M7AB 2DIQA 3OS0A 5FRNA 5GAMe 3JB9F 2K57A 5LJ3f 1OI1A 1Q86C 5HY6A 3T9NA 4M7DA 3M54A 4M77G 3QZ9B 2KQWA 1ZQ1A 2ZCFB 4M7AF 2DK3A 4PJOF 1HK9A 3VKIA 3JRZA 4A53A 4EMKB 1X75C 3OS5A 4ZTJA 2X4WA 3E1SA 2YLCA 1N9SA 3NTHA 4M7DG 4Q5WA 1RL2A 4ZGJB 5AYFA 5DM7R 2DTOA 3CCMT 5GAOr 3HHTB 3PIOA 3MEAA 3CCLT 3JCMc 2P0QA 2PUKB 3DB4A 1O9SA 5GAMg 2E65A 1YI2T 1KQSA 1XNIA 2KDSA 4NS5A 4BD3A 2QQ9A 3VJPA 5GAN7 3CXCA 1VQ6A 3TU4K 4M7AA 3CCUA 4PJOA 3V7RA 4ZTFA 2EKOA 3SFMA 5LJ3j 1N6AA 2B8AA 4DQ2A 3G4ST 1VQNT 5CCAA 3OMGA 4BUGA 1LNXA 2LCCA 4C92E 4EMHA 4EMKA 3OS1A 4XU3A 2CZ7B 4M7AG 1M1FA 1NPRA 4N4HA 5I21A 2XHCA 2L89A 3BDUA 1UGSB 5GAN3 3EFSA 2EWNA 2RHXA 2D9TA 4II1A 5GAOl 3L2UA 4C8QC 3C4SA 4FT4A 3J80E 4L5GA 2JOYA 3EAEA 4M75F 1OZ3A 2PU9B 1BI2A 3JB9H 4M78B 1QVFS 2F5TX 1QP2A 2ZPIB 4OGEA 5CKDA 3OW2S 2FYKA 2H3JA 4M78F 4C92B 3RKYA 1Q81U 4BDYA 5LJ5e 1K8AU 3VUZA 1D3BB 3RIRA 4F7UE 3X20B 1VQ7T 2K3XA 4RKUE 4BE1A 3P8DA 5GAMd 4O5VA 3L2QA 3G6EA 2CGHA 1O75A 5CKHA 4M75A 4O6JA 4LD9K 1W4SA 4XAXB 1VQMA 4BY6C 4PJOB 1K9MU 3CCJA 2P4TA 3CCUT 4HT9A 4OVAA 5GAOn 1K73U 4KT0E 4M78A 4HKEA 5GAOp 3M5AA 3LGLA 4M75G 3CCRA 5LJ5g 1YJNA 4OB2B 3CC4A 2RJCA 1VIEA 3TCJA 1M1KC 2DZCA 1X6OA 1BI0A 3OYIA 5HK3A 4M78G 3J81E 1D3BA 3CPWA 2WACA 3JB9I 4XTXA 1G3WA 2K5FA 1B34B 2RI5A 2HAXA 5GANd 2JZ2A 2RM4A 2HNIA 3SWNC 2JNGA 5LJ3h 3I55A 2IVWA 3OYAA 4BE2A 1Q81C 4JRKA 2DIGA 1VIFA 4JRQA 2IG0A 3CBMA 4M77E 1QVGS 1VQ8T 1DJ7B 1UGQB 3ZBDA 2DTHA 5EG2A 1JB0E 3PGGA 2OTLA 2QI2A 5FROA 2V8JA 2DXUA 3MEVA 5M9OA 5GAMh 1H3ZA 4M7DE 1YJ9A 3C95A 2EQUA 4JRPA 4JS4A 4QVCA 5I2SA 4PLLA 1K9MC 3A8HB 3LX7A 4ZGDB 2XDPA 5I2MA 3P8BB 1B34A 1Q86U 2KVQG 1K73C 3JCMP 1VQMT 2XKOC 1BYMA 3E19A 3DB3A 1Y96B 4C5GA 3CCJT 3J7AF 5LJ5d 2EJFA 1VQPA 4M7DD 4BB7A 3M4YA 2LX9A 4M77B 3LWHA 5GMKi 2E12A 3CCRT 1YJNT 3CC4T 2GF7A 4ZGEB 4ELYC 4HCCA 3FJPA 3LGFA 4LDYA 2PVDB 1QW1A 4DOWA 1VQKA 4M7DB 4EPCA 4M7AE 4PJOE 4QQGA 3QYGB 2JTMA 5CQXA 1YIJA 2R58A 2RJFA 2XG8D 2XU8A 4MMKA 3CD6A 4IURA 4XTUA 2C06A 3OYGA 3KXTA 3I55T 4Y91A 1FXXA 3UT1A 3JB9D 2E64A 3M56A 4XTWA 2E70A 3VUBA 1Y96A 2RB6A 3QPHA 4N4IA 4MZMA 1XQHA 5CAIA 3OYCA 4M7AD 4PJOD 1R8OB 2NLUA 2VC8A 3LWIA 1UGRB 2X4JA 1NPPA 1SSFA 4L59A 3SDZA 2OTLT 3RMSA 2ZGWA 4EDUA 2KSSA 5GAOm 1YHQA 3NTIA 2K5LA 2I2LA 4PL6A 1Y7XA 1YJ9T 2MMPA 5DLQE 2DD5A 3HKSA 4DOVA 2DKGA 3QBYA 1JBMA 5LL6S 2CZ1B 4C0DC 3OYHA 3VYGA 1OYXA 3R6OA 3OYKA 3GNFB 2DTIA 3HPWA 3BW1A 3OMCA 4LDWA 1OZ2A 3CC7A 4MZPA 1M90C 5GAMf 4E7KA 3CBOA 4N4GA 4KUIA 5CR2A 4M75E 5D6WA 3L2WA 2DAQA 3M59A 1I4K1 3MEUA 4OF1A 2JVVA 1VQKT 3TEEA 3M9QA 3WVDB 1JJ2S 4FM4B 2OAUA 2LT4A 1YIJT 4M78E 2RK2A 3CCEA 1VQ5A 4JDSA 3GIBA 3INZA 3X25B 5GANe 5FU7C 5GAN8 3CD6T 1G3TA 3A8MB 2DJZA 3ER0A 5A2QE 4WF2A 3VU3C 3JCMW 2GQVA 1JRIA 4IKFA 2DPPB 3QJYA 2DXTA 2L5QA 2QQBA 3RERA 5GAN2 1YCYA 5GMKl 4M78D 4M7AC 4PJOC 4M75B 2LRQA 2QEXA 3QKJA 1H641 4NL2A 1NE8A 5J26A 1BI3A 5GANf 3CCVA 1M1KU 3X28B 5GAMj 2FVUA 2LCLA 1YHQT 4C92D 2EFIA 4EMKC 5HKCA 2ZZDA 4BI8B 2DXCA 5GAN4 1XTDA 4J6XA 5GANg 4J7FA 2JTFA 4J8OA 4RG2A 3OYLA 5KH6A 1PSEA 3S3MA 5FU6B 2QA4A 1FX7A 2DO3A 4XTVA 2Y90A 4BACA 2XDBA 2EAYA 2EJGA 4OB3B 3X24B 4ZN3A 2QQRA 3CXCS 2QTXA 3S6WA 3AHUA 2E1HA 3JSCA 2RK1A 3QHSA 3META 5HK0A 2QDYB 3ME9A 2O4XB 3P8HA 4MZTA 4E47A 2YHTA 3A8LB 2RH2A 2VXEA 5J39A 4HCBA 2G3RA 3Q1JA 2YLBA 1W2BA 4C0GA 3LW5E 5CVIA 5LJ5f 3RKXA 1VQ6T 3CCET 3MCAB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J5Y A;  4RCC A;  4XTZ A;  4M7D E;  1U1S A;  1LJO A;  4XTY A;  4QVC A;  1KQ2 A;  2E10 A;  4XU2 A;  3JCM X;  1B34 A;  4M77 A;  3JCM P;  4C8Q D;  3JCM f;  4X9D A;  1Y96 B;  3BFM A;  3V8J A;  5LJ5 d;  2EJF A;  5GAN 5;  4C8Q A;  4M7D D;  4M77 B;  4M78 C;  4M7A B;  3JB9 G;  5GMK i;  4PJO B;  5GAM e;  3JB9 F;  2K57 A;  5LJ3 f;  1I8F A;  4M7D A;  4M77 G;  4PJO G;  3RES A;  1LOJ A;  3HFN A;  4PJO F;  4C92 C;  1HK9 A;  5GAN 6;  4A53 A;  3FJP A;  4EMK B;  4M7A F;  2JN0 A;  4C8Q G;  4M7D B;  4M7A E;  3JCM d;  4PJO E;  2YLC A;  5LJ5 j;  1N9S A;  1KQ1 A;  4N0A A;  4M7D G;  4MMK A;  5GAN j;  2DTO A;  4XTU A;  2DZ9 A;  2RD1 A;  5LJ3 d;  5GAO r;  2VXF A;  4Y91 A;  3JB9 D;  3JCM c;  2E64 A;  3SWN B;  4XTW A;  5GAM g;  2E65 A;  2EJ9 A;  4M77 D;  1Y96 A;  2RB6 A;  4M7A D;  4M75 C;  5CAI A;  4PJO D;  1I81 A;  5GAN 7;  2VC8 A;  4M7A A;  4PJO A;  3RKW A;  1HXD A;  1WQ7 A;  3V7R A;  3JCM b;  5GAO m;  2ZGW A;  4C92 F;  5LJ3 j;  4XQ3 A;  4DQ2 A;  1M8V A;  1U1T A;  2I2L A;  5GMK h;  3HFO A;  5DY9 A;  1WNL A;  4C92 E;  1LNX A;  4EMH A;  4EMK A;  2DEQ A;  3BY7 A;  4XU3 A;  1N9R A;  4M7A G;  4J6W A;  2DKG A;  1JBM A;  5I21 A;  1X01 A;  3BDU A;  5GAN 3;  1I5L A;  3EFS A;  2EWN A;  4HT8 A;  2DTI A;  5GAO l;  3BW1 A;  4C8Q C;  5GAN h;  5GAO q;  3SWN A;  4M75 F;  3FB9 A;  5GAM f;  4NL3 A;  5GMK e;  3JB9 H;  4M78 B;  3EFR A;  4JUV A;  4M75 E;  4C92 A;  4F7U B;  1I4K 1;  4A54 A;  4EMG A;  3JCM h;  1MGQ A;  3RUX A;  2FYK A;  4M78 F;  4F7U G;  4C92 B;  3RKY A;  4F7U F;  5GMK m;  3JCM Q;  5LJ5 e;  4JRI A;  2E41 A;  3JCM V;  4N0A C;  4M78 E;  1WPY A;  1D3B B;  3RIR A;  4C92 G;  4F7U E;  3INZ A;  5GAN e;  5GAN 8;  3GIB A;  5GAM d;  4XU1 A;  4MML A;  2CGH A;  2DJZ A;  3JB9 J;  3HSB A;  4WF2 A;  3VU3 C;  5GMK j;  3JCM W;  1JRI A;  4JLI A;  4M75 A;  4J6Y A;  2FB7 A;  3M4G A;  3AHU A;  1BIA A;  4V2S A;  2DXT A;  3JCM e;  3L1A A;  1YCY A;  5GMK l;  4M77 C;  5GAN 2;  4M78 D;  4M7A C;  2DVE A;  3L2Z A;  4M75 B;  1BIB A;  5LJ5 h;  4XU0 A;  4PJO C;  1H64 1;  4NL2 A;  4HT9 A;  5GAO n;  3QO3 A;  5GAN f;  4M78 A;  5GAO p;  5GAM j;  1M5Q 1;  4M75 G;  4F7U A;  5LJ3 e;  5LJ5 g;  4C92 D;  4EMK C;  1WQW A;  5GAN 4;  3V8K A;  4M7D C;  4J6X A;  5GAN g;  3V7S A;  2DZC A;  3FIF A;  4M78 G;  1D3B A;  4RCB A;  4XTV A;  4QVD A;  2Y90 A;  4XTX A;  3JB9 I;  4NOY A;  3JCM J;  1B34 B;  2EAY A;  2EJG A;  3JCM g;  5GAN d;  2RM4 A;  3SB2 A;  2HNI A;  2QTX A;  4OP0 A;  1TH7 A;  4HA8 A;  4PNO A;  3SWN C;  2RA2 A;  3QUI A;  5LJ3 h;  3V8L A;  4C8Q B;  4M77 F;  2E1H A;  4M75 D;  3QHS A;  3RER A;  4JRK A;  5LJ3 g;  2YHT A;  3QSU A;  2VXE A;  4M77 E;  4X9C A;  3V7C A;  4C8Q F;  2YLB A;  2DTH A;  3PGG A;  4C8Q E;  4M7D F;  5LJ5 f;  3RKX A;  2DXU A;  5GAM h; 
#chains in the Genus database with same CATH topology
 4RCC A;  3I5S A;  3A5Z B;  1UEC A;  2P0P A;  3VS0 A;  1KQ2 A;  3OQ5 A;  4C5H A;  4OGC A;  2PQW A;  3VV0 A;  1CSK A;  2PVG B;  2LNH B;  1NM7 A;  5FW9 A;  3UAT A;  2DRK A;  1QVG A;  2BZ8 A;  5KE2 A;  1KQS P;  2RHU A;  4C92 C;  2BIV A;  2QA4 Q;  4RTU A;  4DBR A;  1K8A R;  3H0I A;  4N0A A;  3NMZ C;  1SHF A;  3I56 Q;  2QXF A;  2RD1 A;  4RG8 A;  2MAM A;  4M77 D;  2LT1 A;  2COY A;  2MWO A;  4PJM A;  4R56 A;  3CC2 A;  1MNE A;  2EQM A;  2K4Y A;  2RHZ A;  2E6N A;  3EG0 A;  1QKX A;  1Y07 A;  1YBY A;  3WXM B;  1QVP A;  3BY7 A;  4KGX B;  2ZPF B;  4J6W A;  2F2X A;  2YUQ A;  4FW2 A;  1X01 A;  1I5L A;  4QT7 A;  4HT8 A;  2C0I A;  2X35 A;  3FB9 A;  3MKD A;  5D6X A;  4NL3 A;  3EHR A;  3ZFJ A;  1MGQ A;  1UHF A;  4QKU A;  2QAS A;  3SD4 A;  4D8K A;  3JB9 J;  1WJQ A;  3TQ7 P;  1BCO A;  3M4G A;  1Q86 R;  5DLO A;  4A63 B;  3CC2 T;  1VQN A;  3OBY A;  4GBQ A;  3QO3 A;  1VQP T;  1M5Q 1;  5LJ3 e;  2PUO B;  1PCX A;  2ZPH B;  2O31 A;  4M7D C;  1C6V X;  2DE0 X;  2KAF A;  2MF2 A;  4A4E A;  1UDL A;  2OTJ Q;  3S3O A;  4PNO A;  1WLP B;  2GGR A;  1TH7 A;  1U8R A;  4C8Q B;  3O8V A;  3VYH B;  4LDX A;  2LMJ A;  2L3R A;  5LJ3 g;  1WGS A;  2PVO B;  1GFD A;  2XID A;  1TTH B;  3NTK A;  4Z02 A;  2KY9 A;  3M0Q A;  3CBP A;  3OW2 A;  1YI2 Q;  3I5R A;  4KUD K;  4XU2 A;  2FZC B;  1YIT A;  1E6G A;  3OYE A;  1G83 A;  3QXE B;  4LNP A;  3OYY A;  2YUP A;  1MMA A;  3DKM A;  3CEY A;  1LOJ A;  2Z0W A;  5GAN 6;  1MMG A;  1Z9Z A;  3THK A;  2AHJ B;  3ASK A;  2W0Z A;  5GAN j;  4IUU A;  4QQD A;  2G6F X;  2J7I A;  4C0Z A;  1M8M A;  1HXD A;  2QEX T;  3C12 A;  1RLQ C;  1YCS B;  3CCV T;  2LVM A;  1V29 B;  2L8D A;  2DEQ A;  1W6X A;  2KYM A;  1M3C A;  1YIT T;  1WX6 A;  3G1J A;  4DBF A;  4ZN1 A;  4P5N A;  3SWN A;  2KBT A;  1Q82 U;  1VYT A;  3GOX A;  5CK9 A;  4F7U B;  9ATC B;  2EYZ A;  2MYS A;  5KE3 A;  4N0A C;  2BE9 B;  2ZPG B;  1K73 R;  1NLP C;  1WHJ A;  3REB B;  1K8A C;  2DLP A;  4JZ3 A;  1BIA A;  3G71 T;  4FYW B;  4DA4 A;  5KYX B;  4E7J A;  3OA6 A;  3OYD A;  4HXJ A;  4KH0 B;  3C94 A;  4Y92 A;  1N5Z A;  2K3Y A;  4C0D B;  1X6G A;  1ARK A;  1PHT A;  2MCN A;  3CMA T;  2KYB A;  1M1G A;  2NUZ A;  3I55 Q;  4XTY A;  4RTZ A;  4FW1 A;  4XTZ A;  5CO7 A;  3VS7 A;  3EG9 B;  1EIF A;  1SRL A;  2LJ1 A;  3H0H A;  2EGA A;  2OTL Q;  4JLG A;  1M2V A;  3NHN A;  3FLG A;  4PJO B;  5GAM e;  5LJ3 f;  1Q86 C;  3M54 A;  4M77 G;  2NYS A;  4IIO A;  2X4W A;  3E1S A;  4ZGJ B;  5DM7 R;  2P0Q A;  5GAM g;  2E65 A;  1KQS A;  4PFZ A;  2F2W A;  2QQ9 A;  5GAN 7;  4M7A A;  2PNI A;  3CCU A;  3CD6 Q;  1PM3 A;  1WZO A;  2AK5 A;  5CCA A;  3OMG A;  1LNX A;  1ZUY A;  2QK0 A;  2GBQ A;  3VS2 A;  4AFQ C;  1NPR A;  2RHX A;  1T0J A;  4FT4 A;  3J80 E;  1OZ3 A;  2PU9 B;  3JB9 H;  1QVF S;  1QP2 A;  1SRM A;  2ZPI B;  4OGE A;  4M78 F;  2P84 A;  2K3X A;  4BE1 A;  3G6E A;  2K6D A;  5CKH A;  2ROT A;  3M0U A;  4M75 A;  4O6J A;  4LD9 K;  1SPK A;  1VQM A;  4BY6 C;  1K9M U;  3TSZ A;  2DET A;  2LJ3 A;  3CCU T;  3VRY A;  4HT9 A;  8ATC B;  3M5A A;  1R0C B;  3CC4 A;  2ED0 A;  2RJC A;  1WHL A;  1RLP C;  5FWC A;  2J06 A;  1D3B A;  2DFU A;  2K5F A;  1I5O B;  1MMN A;  2JZ2 A;  2RM4 A;  3SWN C;  2LP5 A;  4FSS A;  2IVW A;  3EFO B;  4JRK A;  4F04 B;  5HCK A;  1QVG S;  1VQ8 T;  2MK5 A;  2DM1 A;  1QQJ A;  4PFP A;  5FRO A;  4Z89 A;  3MEV A;  1KFZ A;  5EC7 A;  3H41 A;  4JS4 A;  2BZX A;  1B34 A;  1K73 C;  2KVQ G;  3JCM P;  1VQM T;  2DF6 A;  2XKO C;  3E19 A;  3DB3 A;  1EX4 A;  1Y96 B;  2CT3 A;  3LWH A;  2AIR B;  4E2F B;  5GMK i;  2GNC A;  1YJN Q;  2IPO B;  5KYU B;  3CC4 T;  2GF7 A;  4ZGE B;  1JU5 C;  4KRT A;  1N8R R;  2YUO A;  1EFN A;  2JW4 A;  3QYG B;  5CQX A;  1YIJ A;  2R58 A;  2RJF A;  1Q7Y R;  1V1C A;  1X2K A;  2CUD A;  1CKA A;  3KXT A;  4Y91 A;  4R0K A;  4XTW A;  1NG2 A;  3QPH A;  1XQH A;  3MPU B;  2VC8 A;  2X4J A;  4L59 A;  1WA7 A;  4EDU A;  4AFS C;  4J9F A;  1YHQ A;  4HVU A;  5DLQ E;  3CPW P;  5AT1 B;  4X1V A;  3CC2 Q;  2J6O A;  3QBY A;  2CZ1 B;  1X2Q A;  1VQP Q;  2DTI A;  3HPW A;  3OMC A;  3CC7 A;  4E7Z A;  2AZS A;  5GAM f;  3CBO A;  3L2W A;  3MEU A;  1UUE A;  4CC2 A;  2JVV A;  2NWM A;  3TEE A;  3TSW A;  1WIE A;  4Z8A A;  1IXD A;  2LT4 A;  1YIJ T;  4M78 E;  5GAN 8;  1AWX A;  1KC8 R;  2E3I A;  3GBQ A;  5GAN 2;  5GMK l;  2FPD A;  4M78 D;  2NUT B;  4OMO A;  4M7A C;  2LRQ A;  3QKJ A;  1H64 1;  4NL2 A;  1NE8 A;  1PKT A;  2RNA A;  5J26 A;  5GAN f;  3X28 B;  2FVU A;  2O9V A;  2VVK A;  1OX9 A;  1YHQ T;  1BK2 A;  4GLM A;  4BI8 B;  1XTD A;  4RG2 A;  2K79 A;  1FX7 A;  2Y90 A;  2AT1 B;  4BAC A;  2EJG A;  2QQR A;  3CXC S;  3S6W A;  4DEX A;  1RAB B;  3QHS A;  3RER A;  2O4X B;  5J39 A;  2RH2 A;  2G3R A;  2OJ2 A;  2YLB A;  1RAG B;  2CSI A;  3CCE Q;  1AWO A;  1BI1 A;  4MDW A;  2YSQ A;  2E10 A;  2O01 E;  5FRM A;  1YFN A;  2QEX Q;  1RAF B;  2LNV A;  1VQ4 A;  3CCV Q;  3QZ5 B;  2FO0 A;  1ABO A;  2XIC A;  2JUF A;  4A4H A;  2EW3 A;  1YIT Q;  3TRE A;  5D7U A;  1OOT A;  3A8O B;  1M9S A;  1Z9Q A;  3EGU A;  4FL6 A;  3CCQ A;  1RAA B;  1AZE A;  1G8X A;  2CP6 A;  3RKW A;  2WSC E;  4E7H A;  1HD3 A;  2RO0 A;  4HVV A;  2HQH A;  2Y4X A;  3DLM A;  3HFO A;  1XOV A;  3URG A;  3G71 Q;  4L6V 5;  1P92 A;  4BE0 A;  1M90 U;  2ZPB B;  1NJI R;  3EGD A;  5IAY A;  2DL4 A;  3PIP A;  1VQ4 T;  1JO8 A;  1LCK A;  1NYF A;  5GMK e;  1TS9 A;  4DBH A;  3C0C A;  1QCF A;  2YRV A;  4FYX B;  1W2B P;  4C5E A;  2CP5 A;  4A54 A;  1ZX6 A;  2RF0 A;  1YJW A;  5GMK m;  2CP0 A;  3ZEH A;  3JCM V;  2CS7 A;  4QW2 A;  4OMQ A;  3CMA Q;  1N8R C;  3CCQ T;  4V2S A;  2CH4 A;  1Q7Y C;  2EVR A;  3PFS A;  4HCZ A;  1WXT A;  4M77 C;  5IT9 E;  1OV3 A;  3GLX A;  1UTI A;  3AT1 B;  1IRX A;  2M0O A;  2RQR A;  4CRI A;  5KCH A;  2F69 A;  2DBK A;  2RJD A;  4QVD A;  4NOY A;  4D8D A;  4OP0 A;  3JCM X;  3UA6 A;  2HKN A;  1S72 Q;  4M75 D;  3EG3 A;  4C8Q F;  4FT2 A;  1HYO A;  5KYY B;  1UJ0 A;  1YJW T;  5L8R E;  1ACM B;  2VUB A;  3EG9 A;  1RAI B;  1VQ7 A;  1QVF A;  2V26 A;  2XD0 A;  2DL8 A;  4J5Y A;  2YUN A;  4KGZ B;  3CPF A;  2L0A A;  1UGP B;  2D0Q B;  2YT6 A;  2LQW A;  2QGG A;  1KQS S;  1KC8 C;  3M53 A;  2J6K A;  1NEB A;  3JCM d;  3VS4 A;  3FEO A;  2CKK A;  1Y71 A;  2DZ9 A;  1GXI E;  1VQ5 T;  2VXF A;  3GNG A;  3EH1 A;  3LH0 A;  3CME A;  2EJ9 A;  1RI9 A;  4QQ6 A;  2L3S A;  1M1K R;  2ESW A;  3G7Z A;  4C92 F;  4BI4 A;  4XQ3 A;  3L42 A;  1G3S A;  3QDR B;  2RI3 A;  5FU6 C;  1N9R A;  4PLI A;  1QKW A;  4OMF B;  2SRC A;  2D6F A;  2LDM A;  4KBM B;  1Q81 R;  1KD1 U;  4QVZ A;  3WVE B;  3HRT A;  3R6N A;  4JUV A;  2ECZ A;  1IGU A;  1ZSZ B;  2EYY A;  4F7U F;  3PE0 A;  1WPY A;  4J9D A;  2ZPE B;  1M4Z A;  5A0G A;  1VQ8 Q;  3FDR A;  3CME T;  4JLI A;  2CSQ A;  1OEB A;  4YTL A;  4PKC C;  2KK4 A;  2PTK A;  3L1A A;  5IHI A;  2IIM A;  3NFC A;  1JXM A;  4XU0 A;  2X4Y A;  1ZA2 B;  1BU1 A;  2M16 A;  2RJE A;  2FG0 A;  3E9G A;  1BBZ A;  1PRM C;  4PJN A;  1VQM Q;  2DA9 A;  2DIL A;  4RCB A;  2KRM A;  3UF4 A;  2LTO A;  1YNZ A;  3CCM A;  3OYJ A;  3V8L A;  3CC4 Q;  4HA8 A;  3CCL A;  1TUD A;  1NJI C;  3QII A;  4CC7 A;  1MUZ A;  1TOV A;  3SEM A;  1U5S A;  4C8Q E;  4M7D F;  3HL8 A;  5FLX E;  3G4S A;  3M55 A;  3VRZ A;  1G5V A;  1RI0 A;  1UGV A;  3M0T A;  5FU7 B;  3I9Q A;  3EHQ A;  4B6M A;  4C8Q D;  1SKU B;  3F70 A;  5KYU A;  2QQA A;  2DVJ A;  2RHI A;  3LLR A;  3NGP A;  5FRN A;  5HY6 A;  4EIK A;  2MPX C;  3QZ9 B;  2ZCF B;  4PJO F;  3VKI A;  1K0S A;  4A53 A;  4EMK B;  2O88 A;  1V76 A;  2YLC A;  2DMO A;  2VWF A;  4Q5W A;  1RL2 A;  5AYF A;  2DTO A;  3CCM T;  5FWB A;  2FRW A;  1VOM A;  3CCL T;  3JCM c;  2PUK B;  4BD3 A;  4F17 A;  3VJP A;  3CXC A;  1YIJ Q;  1JXO A;  1VQ6 A;  3TU4 K;  1AOJ A;  1VA7 A;  3G4S T;  1VQN T;  2B8A A;  1WFW A;  1X27 A;  4BUG A;  4C92 E;  4EMH A;  3OS1 A;  4JJB A;  4XU3 A;  4M7A G;  1D0Y A;  1IO6 A;  4N4H A;  2XHC A;  4AFU C;  1Y57 A;  1UGS B;  3IQL A;  1D1C A;  2OAW A;  5GAO l;  1YHQ Q;  2JOY A;  2YRD A;  3I35 A;  1E7O A;  1FMV A;  2H3J A;  4C92 B;  1GCQ A;  4F7U E;  3A1P A;  4RKU E;  2QG9 B;  1JJ2 P;  1O75 A;  1IHW A;  4OVA A;  1S1N A;  4LXC A;  3M0R A;  4M78 A;  1K73 U;  2J6F A;  4M75 G;  2KNB B;  4RTW A;  3CCR A;  1VIE A;  1FMK A;  3TCJ A;  1M1K C;  2DZC A;  1X6O A;  2KXC A;  5HK3 A;  3J81 E;  1J3T A;  2V1Q A;  2JM8 A;  2HNI A;  4AMC A;  1Q81 C;  3TVT A;  1WDX A;  1UG1 A;  1YWP A;  3ZBD A;  5EG2 A;  1JB0 E;  2VAS A;  1PRL C;  5M9O A;  5GAM h;  4M7D E;  1YJ9 A;  2KEA A;  4ZGD B;  2XDP A;  2NUP A;  1T3S A;  3P8B B;  3QDF A;  1BYM A;  2HSP A;  4C5G A;  4M7D D;  2CH4 W;  3CCR T;  1TU0 B;  2KRS A;  3KFV A;  4LDY A;  4F16 A;  1VQK A;  1QW1 A;  4M7D B;  4PJO E;  2ABL A;  2XG8 D;  4MMK A;  4IUR A;  2C06 A;  1GL5 A;  2E70 A;  1XJW B;  4N4I A;  4MZM A;  4PJO D;  4JPB W;  1R8O B;  1SSH A;  3RMS A;  5GAO m;  3NTI A;  2I2L A;  2KGT A;  3CCQ Q;  1YJ9 T;  2EGE A;  4DOV A;  2FEI A;  2KI7 A;  4LDW A;  1OZ2 A;  5CR2 A;  2LJ0 A;  2LX7 A;  3M59 A;  1I4K 1;  4OF1 A;  2ENM A;  1VQK T;  2QTV A;  3M9Q A;  4FM4 B;  2OAU A;  2K3B A;  2X3X D;  4JDS A;  3X25 B;  5GAN e;  3U23 A;  3A8M B;  4WF2 A;  2ED1 A;  3JCM W;  2HCK A;  2DPP B;  3QJY A;  2DXT A;  1YJW Q;  3FJ5 A;  1YCY A;  4M4Z A;  1PKS A;  2HSE B;  1OU9 A;  2EFI A;  2KRN A;  5HKC A;  4J9B A;  4CC3 A;  4J6X A;  5GAN g;  4J7F A;  4RTY A;  2QA4 A;  2DO3 A;  1PC0 A;  1OU8 A;  2QTX A;  3AHU A;  2O9S A;  5KYY A;  5HK0 A;  2RK1 A;  4HCB A;  4PJL A;  3Q1J A;  3LW5 E;  5CVI A;  1VQ5 Q;  3E2U A;  2HMA A;  3N5B B;  3MEW A;  4IUP A;  2JXB A;  4PFO A;  2LC4 A;  3OYM A;  2M0Y A;  4M78 C;  1WHG A;  5D6Y A;  4FSX A;  4AFZ C;  1GRI A;  1YWO A;  3PVL A;  5LJ5 j;  3H0F A;  4LD6 A;  1QMC A;  2O2O A;  1VYU A;  4ELZ C;  1KG1 A;  3MP1 A;  2A7Y A;  4J7I A;  4UC4 A;  3G6E T;  2R5M A;  1K9M R;  3E9F A;  2GFA A;  2KR3 A;  3OS2 A;  2QQS A;  3CPW S;  1Q7Y U;  1U1T A;  2MOX A;  5DY9 A;  4MDX A;  2XI9 A;  2YXY A;  3VS1 A;  3JV3 A;  2EYW A;  5CKF A;  1VUB A;  2M1H A;  4LDV A;  2BUD A;  1QP3 A;  3PMT A;  2EQI A;  1GFC A;  2ROL A;  2VGN A;  4OMM A;  3EFR A;  2YWW A;  3CCS A;  2RHY A;  4E7I A;  2M51 A;  2MWP A;  4F7U G;  2AKL A;  4VUB A;  4JRI A;  1AHJ B;  3PTA A;  1UJY A;  1D1A A;  5I22 A;  1TUC A;  1FYN A;  4XU1 A;  1YI2 A;  5CKE A;  2FB7 A;  3JCM e;  2CDT A;  3L2Z A;  5LJ5 h;  2K5I A;  3QWY A;  1G3Y A;  3MHX A;  2OI3 A;  1VQL A;  5CKB A;  2GQI A;  1JJ2 A;  4IUV A;  1KC8 U;  1BCM A;  3V7S A;  2I0N A;  3HRS A;  1M27 C;  1X6B A;  4X34 A;  2M02 A;  3JCM g;  2YDL A;  1UE9 A;  2F2V A;  5GMK j;  2M9U A;  1K1Z A;  3MO8 A;  1N27 A;  3CCS T;  3QSU A;  4X9C A;  2HQX A;  5IH2 A;  4KUL A;  2SEM A;  3CCM Q;  4KGV B;  3OB9 A;  4FYY B;  1WJS A;  3CCL Q;  3FRN A;  4A4F A;  1LJO A;  3KUF A;  4ATO A;  4FCY A;  4CI0 C;  2BE7 D;  5CIU A;  2QGF B;  3BFM A;  3G4S Q;  1VQN Q;  4BY6 B;  4C8Q A;  3CC7 T;  1VQL T;  4OB1 B;  4AG2 C;  4PJO G;  3RES A;  2CT4 A;  4LUE A;  2MI6 A;  1OUL A;  2XDD A;  2E6Z A;  3RBB B;  3SWN B;  2KE9 A;  2GTJ A;  4M75 C;  2JTE A;  2COW A;  3HRU A;  2CZ0 B;  1B3Q A;  3PT9 A;  3JCM b;  1M8V A;  5GMK h;  4JJN K;  1WNL A;  3GF5 A;  4RTV A;  5C6S A;  2RI2 A;  2X3W D;  4RUG A;  2MIO A;  1W2B S;  1AEY A;  3UDC A;  4Y28 E;  5A0D A;  2EQK A;  4IIM A;  2FL7 A;  4C92 A;  1ZHI A;  1NJI U;  1SF9 A;  2DJQ A;  3OW2 P;  1QWE A;  2DYB A;  1H8K A;  3OY9 A;  2JMC A;  1ZA1 B;  3HSB A;  4J6Y A;  1KK7 A;  4KH1 B;  1PSF A;  4ORZ A;  2HZY A;  4JZ4 A;  4F7U A;  3UPU A;  1IRE B;  1WQW A;  5CQY A;  2BZY A;  3PNW C;  2CP2 A;  4BDZ A;  3OYF A;  3NPF A;  3OYN A;  2HL3 A;  1ZLM A;  4ZNX A;  3CCR Q;  3SB2 A;  1NYG A;  3HP9 A;  1M2V B;  3QUI A;  1BKB A;  3MJX A;  4M77 F;  1PD1 A;  5KYX A;  4PJJ A;  4F14 A;  4B9W A;  5IXB A;  2DNU A;  2EQJ A;  2LQ8 A;  2FHD A;  1MHN A;  1QWF A;  5J3B A;  2E5Q A;  4LDU A;  1TSF A;  1I07 A;  2WSE E;  1M90 R;  2DL7 A;  3M57 A;  3JCM f;  4XK8 E;  2BKD N;  2CYZ B;  1LVK A;  2L3P A;  4Z88 A;  1TWB A;  4M7A B;  2DIQ A;  3JB9 F;  2K57 A;  1OI1 A;  4M7D A;  2YRC A;  1C1A A;  1ZQ1 A;  2KQW A;  3SHW A;  5KYW B;  1HK9 A;  1I0C A;  1X75 C;  3OS5 A;  4ZTJ A;  1N9S A;  3NTH A;  3RDV A;  5L23 A;  4JJD A;  6AT1 B;  1QCN A;  3PIO A;  3MEA A;  3DB4 A;  1O9S A;  2KDS A;  4NS5 A;  2EGC A;  2A08 A;  3EH2 A;  4DBQ A;  4PJO A;  4ZTF A;  3SFM A;  5LJ3 j;  2QYZ A;  4DQ2 A;  5IXF A;  4AG1 C;  2LCC A;  3VS6 A;  4K11 A;  4OMP A;  2GTO A;  5I21 A;  2L89 A;  5GAN 3;  3EFS A;  3ZL7 C;  4C8Q C;  4L5G A;  3EAE A;  1D1B A;  1MV3 A;  1C0M A;  5CKD A;  2FYK A;  1D0Z A;  1Q81 U;  1K8A U;  2RMO A;  1D3B B;  3RIR A;  1VQ7 T;  2X9H A;  3L2Q A;  3A98 A;  1B07 A;  1PD0 A;  1W4S A;  1PWT A;  3CCU Q;  3CCJ A;  2VKN A;  5GAO n;  4KT0 E;  5GAO p;  4HKE A;  3LGL A;  1YJN A;  1WHM A;  1E6H A;  1HSQ A;  3CPW A;  3OYI A;  2HBW A;  4M78 G;  2WAC A;  2PZ1 A;  1A0N B;  1B34 B;  2DL5 A;  1SEM A;  5LJ3 h;  2RPN A;  2LZ6 B;  1T0H A;  4JRQ A;  4M77 E;  3EGX B;  1DJ7 B;  1UGQ B;  1Y0M A;  3REA B;  2HL5 C;  2QI2 A;  1MV0 B;  2V8J A;  1ZUU A;  3C95 A;  3G6E Q;  1K76 A;  3VS3 A;  4QVC A;  4PLL A;  3LX7 A;  5I2M A;  1Q86 U;  1KD1 R;  2RQU A;  3CCJ T;  5LJ5 d;  1ABQ A;  1VQP A;  3EFO A;  3M4Y A;  2LX9 A;  4M77 B;  1IHV A;  1Q95 G;  2E12 A;  2LCS A;  1YJN T;  1AZG B;  1FMW A;  2JMA A;  4ELY C;  4HCC A;  2H3E B;  3LGF A;  4DOW A;  2PVD B;  1YP5 A;  2EYX A;  4QQG A;  2XU8 A;  4XTU A;  3UT1 A;  3JB9 D;  1KIK A;  3M56 A;  1GCP A;  1Y96 A;  2RB6 A;  5CAI A;  3LWI A;  2EPD A;  1SSF A;  2KSS A;  1RAD B;  1Y7X A;  2DD5 A;  3HKS A;  3OYH A;  2DKG A;  5LL6 S;  1JBM A;  4C0D C;  1OYX A;  3R6O A;  3OYK A;  3GNF B;  3BW1 A;  4MZP A;  1M90 C;  3M0S A;  4KUI A;  1WXB A;  2DAQ A;  2P4R A;  3WVD B;  1JJ2 S;  1NBE B;  2RK2 A;  3CCE A;  4J9I A;  1SG5 A;  3CCS Q;  3ER0 A;  1JRI A;  4JJC A;  1OPK A;  4PJO C;  2QEX A;  1BI3 A;  3CCV A;  5GAM j;  1ZBJ A;  4C92 D;  2ZZD A;  2DXC A;  4J8O A;  3S3M A;  5FU6 B;  1K0X A;  3CC7 Q;  2EAY A;  1VQL Q;  1R0B G;  2EBP A;  3JSC A;  2QDY B;  3ME9 A;  3A8L B;  2VXE A;  2NUT A;  1W2B A;  1AVZ C;  3RKX A;  1VQ6 T;  1H92 A;  3CCE T;  1U1S A;  3KBG A;  2RQV A;  4OB0 B;  3G71 A;  1IB8 A;  2E4H A;  1FWZ A;  2QAZ A;  4FIB A;  4IUQ A;  3L2V A;  2KT8 A;  2O4X A;  3QG1 A;  2BTT A;  2W10 A;  4RTT A;  3PVQ A;  1KQ1 A;  2E5K A;  2A28 A;  2EKH A;  3EGD B;  5IN1 A;  1WI7 A;  2DD4 A;  3CMA A;  4J9C A;  4A4K A;  1TXQ A;  1I81 A;  2KMT A;  1WJR A;  1VQ9 A;  5ECA A;  1Q82 R;  3MP6 A;  3H8Z A;  3QJ6 A;  3DLL A;  1MMD A;  4E7S A;  1SHG A;  2CP7 A;  1H3H A;  1VQ4 Q;  5GAO q;  5GAN h;  2X4X A;  1RUW A;  1UEB A;  1KD1 C;  1S72 A;  2V1R A;  4C0F A;  2DBM A;  2WSF E;  4R55 A;  1VQO A;  3RNJ A;  2A36 A;  4MML A;  2GFU A;  2V8K A;  3H6Z A;  1UB4 A;  4E7L A;  2HQE A;  2KRO A;  1JQQ A;  1AWJ A;  2DXB A;  2EYQ A;  2HD0 A;  4C5I A;  1BIB A;  3A8G B;  2COZ A;  1VQ9 T;  4CC4 B;  4BI3 A;  7AT1 B;  2VB6 A;  2AKK A;  2R5A A;  3FIF A;  4J9H A;  3JCM J;  2DEU A;  2VYT A;  3OSV A;  1VYV A;  2XK0 A;  1YN8 A;  2HKQ B;  3O5Z A;  2VGM A;  3ULR B;  4JS5 A;  1UHC A;  3OSS C;  1K9A A;  2F5K A;  3OBW A;  1D09 B;  1S72 T;  3BDL A;  4J83 A;  2ATC B;  2R57 A;  1M3B A;  2LQK A;  4TVR A;  5C0M A;  1VQO T;  3M58 A;  1ZBX A;  2A37 A;  2H8H A;  4ANJ A;  1M30 A;  4X9D A;  1WHK A;  1QLY A;  2LQN A;  5GAN 5;  3LH5 A;  5KYW A;  3JB9 G;  3I56 A;  1I8F A;  1TUG B;  3HFN A;  3PMI A;  2JN0 A;  1KHC A;  4C8Q G;  3OYB A;  1RAE B;  1W1F A;  2C0T A;  2D8H A;  2DL3 A;  1RAC B;  3LYI A;  1GCQ C;  2FZG B;  5LJ3 d;  1CKB A;  3GP8 A;  1R77 A;  4RMO A;  1PNJ A;  1VQ8 A;  4A4G A;  2DYI A;  4B9X A;  1VQ7 Q;  1WQ7 A;  1IZ6 A;  4FU6 A;  4GY5 A;  2Y4Y A;  3D7S B;  3RMQ A;  3FC3 A;  5KCO A;  2QA4 T;  4HVW A;  3X26 B;  1RAH B;  5A0L A;  3I56 T;  4ME7 A;  4D6W A;  4EMG A;  3JCM h;  2GCX A;  3RUX A;  1N8R U;  2KT1 A;  1QVF P;  2CP3 A;  3JCM Q;  1ZSG A;  4FYV B;  2E41 A;  4PK4 A;  4C92 G;  2DX1 A;  2HDA A;  1KSW A;  1NLO C;  3GPL A;  3CME Q;  2OX7 A;  3UWN A;  3JAM E;  3VS5 A;  2DVE A;  2OTJ A;  2CZ6 B;  1LPL A;  3V8K A;  2K2V A;  2V8I A;  1ZSZ A;  5GJV B;  3M0P A;  2VV5 A;  3L2R A;  3CCJ Q;  1Q82 C;  2K2M A;  4OML A;  2DER A;  3UA7 A;  4LUD A;  2HBP A;  3HTR A;  2RA2 A;  3EGX A;  1KHI A;  2A3L A;  3V7C A;  3MP8 A;  3CQT A;  5IHN A;  3S3N A;  1QVG P;  1NZ9 A;  2EIF A;  4LE9 A;  3QYH B;  1MND A;  4IUT A;  4M77 A;  2P0K A;  2JS0 A;  3V8J A;  4RTX A;  4GLK A;  3OS0 A;  2OTJ T;  2C0O A;  2B86 A;  2RN8 A;  3T9N A;  2L2P A;  2RQW A;  4J9E A;  2D0N A;  2DK3 A;  4M7A F;  2RQT A;  3JRZ A;  1WXU A;  4M7D G;  2FPE A;  5GAO r;  8AT1 B;  3HHT B;  1YI2 T;  1XNI A;  2KXD A;  4WTO B;  1AD5 A;  1TG0 A;  3V7R A;  2EKO A;  1N6A A;  3EG2 A;  4EMK A;  1D0X A;  1G2B A;  1HJD A;  1U06 A;  2CZ7 B;  1M1F A;  4LN2 A;  3BDU A;  2EWN A;  2D9T A;  4II1 A;  3L2U A;  3C4S A;  4M75 F;  2E3H A;  4WCI A;  1BI2 A;  4M78 B;  1WYX A;  2F5T X;  1F1B B;  3OW2 S;  3RR6 A;  3RKY A;  2JT4 A;  1GBQ A;  4BDY A;  5LJ5 e;  2D8J A;  3VUZ A;  3X20 B;  1JEG A;  3P8D A;  1EZZ B;  1ZUK A;  4O5V A;  5GAM d;  2CGH A;  2D1X A;  4OMN A;  1T3L A;  4XAX B;  1VQ6 Q;  2JS2 A;  2P4T A;  5LJ5 g;  4OB2 B;  2J05 A;  5GJW B;  1BI0 A;  3JB9 I;  2NUP B;  4XTX A;  1G3W A;  2RI5 A;  2HAX A;  5GAN d;  2A0F B;  2JNG A;  3I55 A;  5KYN A;  3OYA A;  4BE2 A;  3CXC P;  2DIG A;  1VIF A;  2IG0 A;  3CBM A;  1AWW A;  2AZV A;  2DTH A;  3PGG A;  1IGQ A;  2OTL A;  2DXU A;  2FPF A;  1H3Z A;  1U3O A;  2L3Q A;  2EQU A;  4JRP A;  1OX8 A;  5I2S A;  1K9M C;  3A8H B;  2ZAE A;  3H9N A;  3J7A F;  2EJF A;  2XMF A;  4BB7 A;  1W70 A;  1ZSZ C;  3FJP A;  2DRM A;  2X51 A;  4EPC A;  4M7A E;  2FZK B;  1M2O A;  4AT1 B;  2JTM A;  2F1L A;  1OQK A;  3CD6 A;  3OYG A;  3I55 T;  4HCK A;  1FXX A;  2JM9 A;  2E64 A;  3VUB A;  4M7A D;  2K7A A;  3OYC A;  3EG1 A;  2NLU A;  1UGR B;  1NPP A;  3SDZ A;  4DEY A;  2OTL T;  2ZGW A;  1M3A A;  2JJ9 A;  2K5L A;  2CRE A;  1YJ9 Q;  4PL6 A;  2MMP A;  5IHK A;  1PG5 B;  1NEG A;  4E6R A;  3VYG A;  1VQ9 Q;  1OPL A;  4E7K A;  4N4G A;  4M75 E;  5D6W A;  1WHH A;  1VQK Q;  1VQ5 A;  3GIB A;  3INZ A;  5I11 A;  3CD6 T;  5FU7 C;  1BB9 A;  2QDL A;  1G3T A;  1UFF A;  1QCO A;  2DJZ A;  5A2Q E;  1AT1 B;  2FRY A;  3VU3 C;  2GQV A;  3BE3 A;  4IKF A;  2L5Q A;  2QQB A;  1VQO Q;  4M75 B;  1M1K U;  2LCL A;  4ESR A;  4EMK C;  1GBR A;  5GAN 4;  2K9G A;  2JTF A;  3OYL A;  5KH6 A;  1PSE A;  1X43 A;  4XTV A;  2XDB A;  2HEQ A;  4ZN3 A;  4OB3 B;  1KJW A;  1X69 A;  2CUB A;  4J9G A;  3X24 B;  1I1J A;  2E1H A;  3MET A;  4MZT A;  3P8H A;  4E47 A;  2YHT A;  1K4U S;  4C0G A;  1B7T A;  5LJ5 f;  3QWX X;  3MCA B; 
#chains in the Genus database with same CATH homology
 3N5B B;  4RCC A;  3A5Z B;  1BI1 A;  1U1S A;  2P0P A;  3KBG A;  4MDW A;  4OB0 B;  3G71 A;  1KQ2 A;  3MEW A;  4IUP A;  2E10 A;  3OQ5 A;  4C5H A;  1FWZ A;  4FIB A;  2O01 E;  2LC4 A;  2PQW A;  4OGC A;  3VV0 A;  3OYM A;  5FRM A;  2OTJ T;  2PVG B;  4IUQ A;  3L2V A;  2LNV A;  1VQ4 A;  3QZ5 B;  4M78 C;  1QVG A;  2O4X A;  2XIC A;  2JUF A;  3QG1 A;  5D6Y A;  4A4H A;  5KE2 A;  4FSX A;  2RHU A;  4C92 C;  2BIV A;  3TRE A;  5LJ5 j;  1KQ1 A;  4N0A A;  4LD6 A;  2QXF A;  5IN1 A;  2RD1 A;  2DD4 A;  1KG1 A;  3A8O B;  4ELZ C;  3CMA A;  3MP1 A;  1M9S A;  4RG8 A;  2A7Y A;  2MAM A;  4FL6 A;  4J7I A;  4UC4 A;  4A4K A;  3CCQ A;  3G6E T;  4M77 D;  2R5M A;  2LT1 A;  2MWO A;  3E9F A;  4R56 A;  3CC2 A;  1I81 A;  2EQM A;  2GFA A;  2K4Y A;  2KMT A;  3RKW A;  3OS2 A;  2WSC E;  2QQS A;  1WJR A;  4E7H A;  2RHZ A;  3CPW S;  1Q7Y U;  1VQ9 A;  2RO0 A;  2E6N A;  1U1T A;  2Y4X A;  3DLM A;  3HFO A;  3MP6 A;  5DY9 A;  2XI9 A;  1YBY A;  1XOV A;  1Y07 A;  4MDX A;  3H8Z A;  1QVP A;  3QJ6 A;  3BY7 A;  3URG A;  3WXM B;  2ZPF B;  4L6V 5;  1P92 A;  4J6W A;  3DLL A;  4BE0 A;  1M90 U;  2ZPB B;  5CKF A;  1VUB A;  1X01 A;  2M1H A;  1I5L A;  4HT8 A;  4LDV A;  5IAY A;  2X35 A;  2BUD A;  5GAN h;  2X4X A;  5GAO q;  3PIP A;  1QP3 A;  3PMT A;  1VQ4 T;  1UEB A;  3FB9 A;  5D6X A;  4NL3 A;  5GMK e;  2VGN A;  1KD1 C;  3EFR A;  3CCS A;  1S72 A;  2YRV A;  4C5E A;  4A54 A;  2RHY A;  3ZFJ A;  4E7I A;  1MGQ A;  2MWP A;  4C0F A;  4F7U G;  1YJW A;  5GMK m;  2WSF E;  4VUB A;  4JRI A;  3ZEH A;  1AHJ B;  3JCM V;  4R55 A;  3PTA A;  1VQO A;  3SD4 A;  2CS7 A;  4QW2 A;  4XU1 A;  1N8R C;  4MML A;  3JB9 J;  2GFU A;  1WJQ A;  2V8K A;  1UB4 A;  3H6Z A;  2HQE A;  3CCQ T;  5CKE A;  4E7L A;  1YI2 A;  2FB7 A;  3M4G A;  4V2S A;  2DXB A;  2EYQ A;  2HD0 A;  4C5I A;  5DLO A;  1Q7Y C;  3PFS A;  4HCZ A;  3JCM e;  3CC2 T;  4M77 C;  3L2Z A;  1BIB A;  2K5I A;  5LJ5 h;  1VQN A;  3A8G B;  3OBY A;  1G3Y A;  3QO3 A;  5IT9 E;  1VQ9 T;  3MHX A;  1VQP T;  1M5Q 1;  3GLX A;  5LJ3 e;  2PUO B;  2ZPH B;  1VQL A;  2M0O A;  5CKB A;  4BI3 A;  1JJ2 A;  4IUV A;  4CRI A;  5KCH A;  4M7D C;  1KC8 U;  2F69 A;  3V7S A;  2R5A A;  3HRS A;  3FIF A;  2RJD A;  2KAF A;  2MF2 A;  4X34 A;  4A4E A;  2VYT A;  4QVD A;  3JCM J;  3OSV A;  4NOY A;  2XK0 A;  3S3O A;  3JCM g;  2VGM A;  4PNO A;  5GMK j;  4OP0 A;  1TH7 A;  2M9U A;  3JCM X;  4JS5 A;  3OSS C;  1U8R A;  3MO8 A;  3O8V A;  4C8Q B;  2F5K A;  3VYH B;  3OBW A;  4M75 D;  4LDX A;  1N27 A;  3CCS T;  2L3R A;  5LJ3 g;  1S72 T;  1WGS A;  3QSU A;  4X9C A;  3BDL A;  2HQX A;  2PVO B;  4J83 A;  4FT2 A;  4C8Q F;  4KUL A;  2R57 A;  1YJW T;  5L8R E;  2VUB A;  1VQ7 A;  2LQK A;  3OB9 A;  4TVR A;  2XID A;  5C0M A;  3M58 A;  3NTK A;  1WJS A;  1VQO T;  1QVF A;  2XD0 A;  4Z02 A;  1ZBX A;  3FRN A;  4J5Y A;  2KY9 A;  4A4F A;  3CBP A;  3CPF A;  1LJO A;  1UGP B;  3KUF A;  2D0Q B;  3OW2 A;  4KUD K;  4ATO A;  4XU2 A;  4CI0 C;  1YIT A;  5CIU A;  4X9D A;  3BFM A;  3OYE A;  3QXE B;  5GAN 5;  4BY6 B;  4C8Q A;  1KQS S;  1KC8 C;  3JB9 G;  3OYY A;  3CC7 T;  3M53 A;  3I56 A;  1VQL T;  3DKM A;  1I8F A;  3CEY A;  4OB1 B;  4PJO G;  3RES A;  1LOJ A;  3HFN A;  5GAN 6;  3PMI A;  2MI6 A;  2JN0 A;  1KHC A;  4C8Q G;  3OYB A;  3JCM d;  2AHJ B;  3ASK A;  3FEO A;  3LYI A;  2XDD A;  2CKK A;  5GAN j;  4IUU A;  1Y71 A;  2E6Z A;  2DZ9 A;  4QQD A;  5LJ3 d;  1VQ5 T;  2VXF A;  1GXI E;  3GNG A;  3LH0 A;  3GP8 A;  3SWN B;  4RMO A;  3CME A;  1VQ8 A;  2EJ9 A;  4C0Z A;  4M75 C;  4A4G A;  3HRU A;  2CZ0 B;  4QQ6 A;  3PT9 A;  4B9X A;  1HXD A;  1WQ7 A;  3G7Z A;  1IZ6 A;  3JCM b;  4C92 F;  4BI4 A;  2QEX T;  4XQ3 A;  3L42 A;  3C12 A;  4FU6 A;  4GY5 A;  5GMK h;  1G3S A;  4JJN K;  3CCV T;  2LVM A;  1WNL A;  1M8V A;  2Y4Y A;  2RI3 A;  1V29 B;  3GF5 A;  2L8D A;  3QDR B;  5FU6 C;  2DEQ A;  1N9R A;  3RMQ A;  4PLI A;  5C6S A;  3FC3 A;  4OMF B;  1YIT T;  2D6F A;  2LDM A;  4KBM B;  2RI2 A;  5KCO A;  1KD1 U;  2QA4 T;  4QVZ A;  4ZN1 A;  3WVE B;  3X26 B;  1W2B S;  4P5N A;  3HRT A;  3SWN A;  3UDC A;  1Q82 U;  4Y28 E;  5A0D A;  3GOX A;  5A0L A;  3I56 T;  2EQK A;  5CK9 A;  2FL7 A;  4C92 A;  4JUV A;  4ME7 A;  1ZHI A;  4F7U B;  4D6W A;  4EMG A;  3JCM h;  2GCX A;  3RUX A;  1N8R U;  1NJI U;  4F7U F;  3JCM Q;  5KE3 A;  2E41 A;  4N0A C;  2ZPG B;  1WPY A;  4C92 G;  2ZPE B;  1M4Z A;  3OY9 A;  5A0G A;  3GPL A;  3HSB A;  3FDR A;  1K8A C;  3CME T;  4JLI A;  3UWN A;  3JAM E;  4J6Y A;  1BIA A;  4YTL A;  4PKC C;  3G71 T;  2KK4 A;  4DA4 A;  3L1A A;  3NFC A;  4E7J A;  2DVE A;  1PSF A;  4XU0 A;  2X4Y A;  3OA6 A;  2M16 A;  2OTJ A;  2CZ6 B;  4F7U A;  3OYD A;  2RJE A;  3UPU A;  1IRE B;  1WQW A;  3C94 A;  5CQY A;  2K2V A;  2V8I A;  3E9G A;  3PNW C;  3V8K A;  4BDZ A;  3OYF A;  2VV5 A;  3L2R A;  2K3Y A;  3OYN A;  4RCB A;  1Q82 C;  2LTO A;  4C0D B;  3SB2 A;  2HBP A;  3CCM A;  3OYJ A;  3V8L A;  3HP9 A;  4HA8 A;  2RA2 A;  3QUI A;  3CCL A;  1BKB A;  4M77 F;  1NJI C;  3CMA T;  1KHI A;  2A3L A;  3QII A;  4B9W A;  3V7C A;  3MP8 A;  2EQJ A;  2LQ8 A;  1M1G A;  4C8Q E;  4M7D F;  2FHD A;  1MHN A;  3HL8 A;  5J3B A;  3S3N A;  5FLX E;  3G4S A;  4XTY A;  1NZ9 A;  2E5Q A;  2EIF A;  3M55 A;  4XTZ A;  5CO7 A;  4LDU A;  1G5V A;  3QYH B;  1RI0 A;  1EIF A;  5FU7 B;  2WSE E;  4IUT A;  3M57 A;  4M77 A;  2P0K A;  4C8Q D;  4JLG A;  3JCM f;  4XK8 E;  3V8J A;  2BKD N;  2CYZ B;  3F70 A;  2QQA A;  4GLK A;  2RHI A;  3FLG A;  3LLR A;  4M7A B;  2DIQ A;  3OS0 A;  5FRN A;  5GAM e;  3JB9 F;  2K57 A;  5LJ3 f;  1OI1 A;  1Q86 C;  5HY6 A;  3T9N A;  4M7D A;  3M54 A;  4M77 G;  3QZ9 B;  2KQW A;  1ZQ1 A;  2ZCF B;  4M7A F;  2DK3 A;  4PJO F;  1HK9 A;  3VKI A;  3JRZ A;  4A53 A;  4EMK B;  1X75 C;  3OS5 A;  4ZTJ A;  2X4W A;  3E1S A;  2YLC A;  1N9S A;  3NTH A;  4M7D G;  4Q5W A;  1RL2 A;  4ZGJ B;  5AYF A;  5DM7 R;  2DTO A;  3CCM T;  5GAO r;  3HHT B;  3PIO A;  3MEA A;  3CCL T;  3JCM c;  2P0Q A;  2PUK B;  3DB4 A;  1O9S A;  5GAM g;  2E65 A;  1YI2 T;  1KQS A;  1XNI A;  2KDS A;  4NS5 A;  4BD3 A;  2QQ9 A;  3VJP A;  5GAN 7;  3CXC A;  1VQ6 A;  3TU4 K;  4M7A A;  3CCU A;  4PJO A;  3V7R A;  4ZTF A;  2EKO A;  3SFM A;  5LJ3 j;  1N6A A;  2B8A A;  4DQ2 A;  3G4S T;  1VQN T;  5CCA A;  3OMG A;  4BUG A;  1LNX A;  2LCC A;  4C92 E;  4EMH A;  4EMK A;  3OS1 A;  4XU3 A;  2CZ7 B;  4M7A G;  1M1F A;  1NPR A;  4N4H A;  5I21 A;  2XHC A;  2L89 A;  3BDU A;  1UGS B;  5GAN 3;  3EFS A;  2EWN A;  2RHX A;  2D9T A;  4II1 A;  5GAO l;  3L2U A;  4C8Q C;  3C4S A;  4FT4 A;  3J80 E;  4L5G A;  2JOY A;  3EAE A;  4M75 F;  1OZ3 A;  2PU9 B;  1BI2 A;  3JB9 H;  4M78 B;  1QVF S;  2F5T X;  1QP2 A;  2ZPI B;  4OGE A;  5CKD A;  3OW2 S;  2FYK A;  2H3J A;  4M78 F;  4C92 B;  3RKY A;  1Q81 U;  4BDY A;  5LJ5 e;  1K8A U;  3VUZ A;  1D3B B;  3RIR A;  4F7U E;  3X20 B;  1VQ7 T;  2K3X A;  4RKU E;  4BE1 A;  3P8D A;  5GAM d;  4O5V A;  3L2Q A;  3G6E A;  2CGH A;  1O75 A;  5CKH A;  4M75 A;  4O6J A;  4LD9 K;  1W4S A;  4XAX B;  1VQM A;  4BY6 C;  4PJO B;  1K9M U;  3CCJ A;  2P4T A;  3CCU T;  4HT9 A;  4OVA A;  5GAO n;  1K73 U;  4KT0 E;  4M78 A;  4HKE A;  5GAO p;  3M5A A;  3LGL A;  4M75 G;  3CCR A;  5LJ5 g;  1YJN A;  4OB2 B;  3CC4 A;  2RJC A;  1VIE A;  3TCJ A;  1M1K C;  2DZC A;  1X6O A;  1BI0 A;  3OYI A;  5HK3 A;  4M78 G;  3J81 E;  1D3B A;  3CPW A;  2WAC A;  3JB9 I;  4XTX A;  1G3W A;  2K5F A;  1B34 B;  2RI5 A;  2HAX A;  5GAN d;  2JZ2 A;  2RM4 A;  2HNI A;  3SWN C;  2JNG A;  5LJ3 h;  3I55 A;  2IVW A;  3OYA A;  4BE2 A;  1Q81 C;  4JRK A;  2DIG A;  1VIF A;  4JRQ A;  2IG0 A;  3CBM A;  4M77 E;  1QVG S;  1VQ8 T;  1DJ7 B;  1UGQ B;  3ZBD A;  2DTH A;  5EG2 A;  1JB0 E;  3PGG A;  2OTL A;  2QI2 A;  5FRO A;  2V8J A;  2DXU A;  3MEV A;  5M9O A;  5GAM h;  1H3Z A;  4M7D E;  1YJ9 A;  3C95 A;  2EQU A;  4JRP A;  4JS4 A;  4QVC A;  5I2S A;  4PLL A;  1K9M C;  3A8H B;  3LX7 A;  4ZGD B;  2XDP A;  5I2M A;  3P8B B;  1B34 A;  1Q86 U;  2KVQ G;  1K73 C;  3JCM P;  1VQM T;  2XKO C;  1BYM A;  3E19 A;  3DB3 A;  1Y96 B;  4C5G A;  3CCJ T;  3J7A F;  5LJ5 d;  2EJF A;  1VQP A;  4M7D D;  4BB7 A;  3M4Y A;  2LX9 A;  4M77 B;  3LWH A;  5GMK i;  2E12 A;  3CCR T;  1YJN T;  3CC4 T;  2GF7 A;  4ZGE B;  4ELY C;  4HCC A;  3FJP A;  3LGF A;  4LDY A;  2PVD B;  1QW1 A;  4DOW A;  1VQK A;  4M7D B;  4EPC A;  4M7A E;  4PJO E;  4QQG A;  3QYG B;  2JTM A;  5CQX A;  1YIJ A;  2R58 A;  2RJF A;  2XG8 D;  2XU8 A;  4MMK A;  3CD6 A;  4IUR A;  4XTU A;  2C06 A;  3OYG A;  3KXT A;  3I55 T;  4Y91 A;  1FXX A;  3UT1 A;  3JB9 D;  2E64 A;  3M56 A;  4XTW A;  2E70 A;  3VUB A;  1Y96 A;  2RB6 A;  3QPH A;  4N4I A;  4MZM A;  1XQH A;  5CAI A;  3OYC A;  4M7A D;  4PJO D;  1R8O B;  2NLU A;  2VC8 A;  3LWI A;  1UGR B;  2X4J A;  1NPP A;  1SSF A;  4L59 A;  3SDZ A;  2OTL T;  3RMS A;  2ZGW A;  4EDU A;  2KSS A;  5GAO m;  1YHQ A;  3NTI A;  2K5L A;  2I2L A;  4PL6 A;  1Y7X A;  1YJ9 T;  2MMP A;  5DLQ E;  2DD5 A;  3HKS A;  4DOV A;  2DKG A;  3QBY A;  1JBM A;  5LL6 S;  2CZ1 B;  4C0D C;  3OYH A;  3VYG A;  1OYX A;  3R6O A;  3OYK A;  3GNF B;  2DTI A;  3HPW A;  3BW1 A;  3OMC A;  4LDW A;  1OZ2 A;  3CC7 A;  4MZP A;  1M90 C;  5GAM f;  4E7K A;  3CBO A;  4N4G A;  4KUI A;  5CR2 A;  4M75 E;  5D6W A;  3L2W A;  2DAQ A;  3M59 A;  1I4K 1;  3MEU A;  4OF1 A;  2JVV A;  1VQK T;  3TEE A;  3M9Q A;  3WVD B;  1JJ2 S;  4FM4 B;  2OAU A;  2LT4 A;  1YIJ T;  4M78 E;  2RK2 A;  3CCE A;  1VQ5 A;  4JDS A;  3GIB A;  3INZ A;  3X25 B;  5GAN e;  5FU7 C;  5GAN 8;  3CD6 T;  1G3T A;  3A8M B;  2DJZ A;  3ER0 A;  5A2Q E;  4WF2 A;  3VU3 C;  3JCM W;  2GQV A;  1JRI A;  4IKF A;  2DPP B;  3QJY A;  2DXT A;  2L5Q A;  2QQB A;  3RER A;  5GAN 2;  1YCY A;  5GMK l;  4M78 D;  4M7A C;  4PJO C;  4M75 B;  2LRQ A;  2QEX A;  3QKJ A;  1H64 1;  4NL2 A;  1NE8 A;  5J26 A;  1BI3 A;  5GAN f;  3CCV A;  1M1K U;  3X28 B;  5GAM j;  2FVU A;  2LCL A;  1YHQ T;  4C92 D;  2EFI A;  4EMK C;  5HKC A;  2ZZD A;  4BI8 B;  2DXC A;  5GAN 4;  1XTD A;  4J6X A;  5GAN g;  4J7F A;  2JTF A;  4J8O A;  4RG2 A;  3OYL A;  5KH6 A;  1PSE A;  3S3M A;  5FU6 B;  2QA4 A;  1FX7 A;  2DO3 A;  4XTV A;  2Y90 A;  4BAC A;  2XDB A;  2EAY A;  2EJG A;  4OB3 B;  3X24 B;  4ZN3 A;  2QQR A;  3CXC S;  2QTX A;  3S6W A;  3AHU A;  2E1H A;  3JSC A;  2RK1 A;  3QHS A;  3MET A;  5HK0 A;  2QDY B;  3ME9 A;  2O4X B;  3P8H A;  4MZT A;  4E47 A;  2YHT A;  3A8L B;  2RH2 A;  2VXE A;  5J39 A;  4HCB A;  2G3R A;  3Q1J A;  2YLB A;  1W2B A;  4C0G A;  3LW5 E;  5CVI A;  5LJ5 f;  3RKX A;  1VQ6 T;  3CCE T;  3MCA B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...