1M90G

Co-crystal structure of cca-phe-caproic acid-biotin and sparsomycin bound to the 50s ribosomal subunit
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
172
structure length
172
Chain Sequence
b'PRVELEIPEDVDAEQDHLDITVEGDNGSVTRRLWYPDIDVSVDGDTVVIESDEDNAKTMSTIGTFQSHIENMFHGVTEGWEYGMEVFYSHFPMQVNVEGDEVVIENFLGEKAPRRTTIHGDTDVEIDGEELTVSGPDIEAVGQTAADIEQLTRINDKDVRVFQDGVYITRKP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RRNA
publication title Structural insights into peptide bond formation.
pubmed doi rcsb
molecule tags Ribosome
total genus 38
structure length 172
sequence length 172
ec nomenclature
pdb deposition date 2002-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00347 Ribosomal_L6 Ribosomal protein L6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.930.12 Alpha Beta Alpha-Beta Complex Outer Surface Protein A; domain 3 Ribosomal protein L6, alpha-beta domain 1m90G01
3.90.930.12 Alpha Beta Alpha-Beta Complex Outer Surface Protein A; domain 3 Ribosomal protein L6, alpha-beta domain 1m90G02
1YIJE 5GAEG 3CCSE 1KQSE 1Q82G 1VQOE 1VQ4E 1Q86G 3I55E 5GAGG 1S72E 1YJ9E 1M90G 3CCVE 1VQME 1YITE 2CQLA 1VQLE 5DM6E 3CC2E 3CMEE 1Q81G 5GADG 1VQKE 1VQ8E 1VQ6E 1VQPE 1YI2E 1K73G 5JVHE 1K9MG 2QA4E 5H1SI 3CXCE 1M1KG 3CMAE 4U67E 2ZJRE 4WFAE 3CCQE 1YHQE 3CCME 3CC7E 3OW2E 3PIOE 4WFNE 4IO9E 1YJWE 3CCEE 2ZJPE 3J7ZG 3CF5E 1VQ7E 1Q7YG 1YJNE 3I56E 3CPWE 4WFBE 1QVFE 3CD6E 5HL7E 5JVGE 1KC8G 3CCJE 4IOCE 1QVGE 4UY8G 5AN9B 2OTJE 2ZJQE 5DM7E 3CCLE 3CCUE 1JJ2E 1W2BE 3CC4E 2QEXE 1K8AG 3G6EE 1NJIG 4WCEE 4WF9E 1VQ5E 3DLLE 1N8RG 1VQ9E 1KD1G 5GAHG 1VQNE 3CCRE 5MLCH 4IOAE 2OTLE 1RL6A 3PIPE 3G71E 3G4SE
chains in the Genus database with same CATH superfamily
1YIJE 2OY5O 2G8CO 5GAEG 3CCSE 2PI3O 1KQSE 1Q82G 2I5VO 1VQOE 2OY1O 1VQ4E 1Q86G 3I55E 5GAGG 2OYBO 1S72E 1YJ9E 1M90G 2OY7A 3CCVE 1VQME 2I5ZO 3IG9A 1YITE 2CQLA 1VQLE 5DM6E 3CC2E 3CMEE 1Q81G 5GADG 1VQKE 1VQ8E 1VQ6E 2HKDA 1VQPE 1YI2E 1K73G 5JVHE 1K9MG 2QA4E 5H1SI 3CXCE 1M1KG 3CMAE 4U67E 2ZJRE 5B2AO 1P4PA 2OL7A 4WFAE 3CCQE 1YHQE 2FKJA 3CCME 3CC7E 3OW2E 3PIOE 2AF5A 5B10O 3CKGA 4WFNE 2OY8A 4IO9E 1YJWE 3CCEE 2ZJPE 2OL6O 3J7ZG 3CF5E 1VQ7E 3CKFA 1Q7YG 1YJNE 3I56E 3CPWE 4WFBE 3AUMO 1QVFE 3CD6E 5HL7E 5JVGE 1KC8G 3CCJE 4IOCE 1QVGE 3EC5A 4UY8G 1OSPO 2FKGA 5AN9B 2OL8O 2OTJE 2ZJQE 1FJ1E 5DM7E 3CCLE 3CCUE 5B11O 3IGEA 1JJ2E 1W2BE 3CC4E 2QEXE 1K8AG 3G6EE 1NJIG 4WCEE 4WF9E 1VQ5E 5B3MO 3DLLE 1N8RG 1VQ9E 1KD1G 5GAHG 1VQNE 3CCRE 5MLCH 4IOAE 2OTLE 1RL6A 3PIPE 1RJLC 3G71E 3G4SE
chains in the Genus database with same CATH topology
1YIJE 5GAEG 3CCSE 1KQSE 1Q82G 1VQOE 1VQ4E 1Q86G 3I55E 5GAGG 1S72E 1YJ9E 1M90G 3CCVE 1VQME 1YITE 2CQLA 1VQLE 5DM6E 3CC2E 3CMEE 1Q81G 5GADG 1VQKE 1VQ8E 1VQ6E 1VQPE 1YI2E 1K73G 5JVHE 1K9MG 2QA4E 5H1SI 3CXCE 1M1KG 3CMAE 4U67E 2ZJRE 4WFAE 3CCQE 1YHQE 3CCME 3CC7E 3OW2E 3PIOE 4WFNE 4IO9E 1YJWE 3CCEE 2ZJPE 3J7ZG 3CF5E 1VQ7E 1Q7YG 1YJNE 3I56E 3CPWE 4WFBE 1QVFE 3CD6E 5HL7E 5JVGE 1KC8G 3CCJE 4IOCE 1QVGE 4UY8G 5AN9B 2OTJE 2ZJQE 5DM7E 3CCLE 3CCUE 1JJ2E 1W2BE 3CC4E 2QEXE 1K8AG 3G6EE 1NJIG 4WCEE 4WF9E 1VQ5E 3DLLE 1N8RG 1VQ9E 1KD1G 5GAHG 1VQNE 3CCRE 5MLCH 4IOAE 2OTLE 1RL6A 3PIPE 3G71E 3G4SE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YIJ E;  5GAE G;  3CCS E;  1KQS E;  1Q82 G;  1VQO E;  1VQ4 E;  1Q86 G;  3I55 E;  5GAG G;  1S72 E;  1YJ9 E;  1M90 G;  3CCV E;  1VQM E;  1YIT E;  2CQL A;  1VQL E;  5DM6 E;  3CC2 E;  3CME E;  1Q81 G;  5GAD G;  1VQK E;  1VQ8 E;  1VQ6 E;  1VQP E;  1YI2 E;  1K73 G;  5JVH E;  1K9M G;  2QA4 E;  5H1S I;  3CXC E;  1M1K G;  3CMA E;  4U67 E;  2ZJR E;  4WFA E;  3CCQ E;  1YHQ E;  3CCM E;  3CC7 E;  3OW2 E;  3PIO E;  4WFN E;  4IO9 E;  1YJW E;  3CCE E;  2ZJP E;  3J7Z G;  3CF5 E;  1VQ7 E;  1Q7Y G;  1YJN E;  3I56 E;  3CPW E;  4WFB E;  1QVF E;  3CD6 E;  5HL7 E;  5JVG E;  1KC8 G;  3CCJ E;  4IOC E;  1QVG E;  4UY8 G;  5AN9 B;  2OTJ E;  2ZJQ E;  5DM7 E;  3CCL E;  3CCU E;  1JJ2 E;  1W2B E;  3CC4 E;  2QEX E;  1K8A G;  3G6E E;  1NJI G;  4WCE E;  4WF9 E;  1VQ5 E;  3DLL E;  1N8R G;  1VQ9 E;  1KD1 G;  5GAH G;  1VQN E;  3CCR E;  5MLC H;  4IOA E;  2OTL E;  1RL6 A;  3PIP E;  3G71 E;  3G4S E; 
#chains in the Genus database with same CATH topology
 1YIJ E;  2OY5 O;  2G8C O;  5GAE G;  3CCS E;  2PI3 O;  1KQS E;  1Q82 G;  2I5V O;  1VQO E;  2OY1 O;  1VQ4 E;  1Q86 G;  3I55 E;  5GAG G;  2OYB O;  1S72 E;  1YJ9 E;  1M90 G;  2OY7 A;  3CCV E;  1VQM E;  2I5Z O;  3IG9 A;  1YIT E;  2CQL A;  1VQL E;  5DM6 E;  3CC2 E;  3CME E;  1Q81 G;  5GAD G;  1VQK E;  1VQ8 E;  1VQ6 E;  2HKD A;  1VQP E;  1YI2 E;  1K73 G;  5JVH E;  1K9M G;  2QA4 E;  5H1S I;  3CXC E;  1M1K G;  3CMA E;  4U67 E;  2ZJR E;  5B2A O;  1P4P A;  2OL7 A;  4WFA E;  3CCQ E;  1YHQ E;  2FKJ A;  3CCM E;  3CC7 E;  3OW2 E;  3PIO E;  2AF5 A;  5B10 O;  3CKG A;  4WFN E;  2OY8 A;  4IO9 E;  1YJW E;  3CCE E;  2ZJP E;  2OL6 O;  3J7Z G;  3CF5 E;  1VQ7 E;  3CKF A;  1Q7Y G;  1YJN E;  3I56 E;  3CPW E;  4WFB E;  3AUM O;  1QVF E;  3CD6 E;  5HL7 E;  5JVG E;  1KC8 G;  3CCJ E;  4IOC E;  1QVG E;  3EC5 A;  4UY8 G;  1OSP O;  2FKG A;  5AN9 B;  2OL8 O;  2OTJ E;  2ZJQ E;  1FJ1 E;  5DM7 E;  3CCL E;  3CCU E;  5B11 O;  3IGE A;  1JJ2 E;  1W2B E;  3CC4 E;  2QEX E;  1K8A G;  3G6E E;  1NJI G;  4WCE E;  4WF9 E;  1VQ5 E;  5B3M O;  3DLL E;  1N8R G;  1VQ9 E;  1KD1 G;  5GAH G;  1VQN E;  3CCR E;  5MLC H;  4IOA E;  2OTL E;  1RL6 A;  3PIP E;  1RJL C;  3G71 E;  3G4S E; 
#chains in the Genus database with same CATH homology
 1YIJ E;  5GAE G;  3CCS E;  1KQS E;  1Q82 G;  1VQO E;  1VQ4 E;  1Q86 G;  3I55 E;  5GAG G;  1S72 E;  1YJ9 E;  1M90 G;  3CCV E;  1VQM E;  1YIT E;  2CQL A;  1VQL E;  5DM6 E;  3CC2 E;  3CME E;  1Q81 G;  5GAD G;  1VQK E;  1VQ8 E;  1VQ6 E;  1VQP E;  1YI2 E;  1K73 G;  5JVH E;  1K9M G;  2QA4 E;  5H1S I;  3CXC E;  1M1K G;  3CMA E;  4U67 E;  2ZJR E;  4WFA E;  3CCQ E;  1YHQ E;  3CCM E;  3CC7 E;  3OW2 E;  3PIO E;  4WFN E;  4IO9 E;  1YJW E;  3CCE E;  2ZJP E;  3J7Z G;  3CF5 E;  1VQ7 E;  1Q7Y G;  1YJN E;  3I56 E;  3CPW E;  4WFB E;  1QVF E;  3CD6 E;  5HL7 E;  5JVG E;  1KC8 G;  3CCJ E;  4IOC E;  1QVG E;  4UY8 G;  5AN9 B;  2OTJ E;  2ZJQ E;  5DM7 E;  3CCL E;  3CCU E;  1JJ2 E;  1W2B E;  3CC4 E;  2QEX E;  1K8A G;  3G6E E;  1NJI G;  4WCE E;  4WF9 E;  1VQ5 E;  3DLL E;  1N8R G;  1VQ9 E;  1KD1 G;  5GAH G;  1VQN E;  3CCR E;  5MLC H;  4IOA E;  2OTL E;  1RL6 A;  3PIP E;  3G71 E;  3G4S E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...