1M9AA

Crystal structure of the 26 kda glutathione s-transferase from schistosoma japonicum complexed with s-hexylglutathione
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
216
structure length
216
Chain Sequence
b'MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione S-Transferase 26 kDa
publication title Characterization of the electrophile binding site and substrate binding mode of the 26-kDa glutathione S-transferase from Schistosoma japonicum
pubmed doi rcsb
source organism Schistosoma japonicum
molecule tags Transferase
total genus 69
structure length 216
sequence length 216
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2002-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 1m9aA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1m9aA01
3WD6A 4ECCA 2NPBA 4D73B 1ZGNA 2FLSA 1KEBA 2YN1A 5JCGA 1PA3A 2GGTA 1FB6A 1UN2A 1M2AA 2L6CA 3LJRA 4V2NA 2VL9A 2OACA 2HSMB 2H74A 1T3BA 3FZAA 3S9FA 3RPNA 4BPYA 4PURA 4RQRA 4LMWA 4G0IA 2GDRA 3I6AA 2RIIA 2K6VA 5L71A 3FRCA 4LLRA 3IK7A 1J08A 4KCEA 1WE0A 2GZPA 4ZB8A 4JRRA 2B1LA 4K2DA 1TI1A 1FG4A 2JL4A 3LSZA 3DVWA 3W6GA 4Q5QA 3DIEA 4ILFA 2WDUA 4HJMA 3ZZXA 5FWGA 1TK0B 1W89A 4RI6A 1JZOA 1PQNA 4NMUA 1TRUA 3KH9A 3LWAA 4G0LA 3F8UA 2ON5A 3APQA 1CQGA 1AQWA 2YJ7A 4LL4B 3EC3A 1M9AA 1MDIA 1O8WA 18GSA 2OJLA 5IMFA 1O73A 5IM9A 1RK4A 1XOBA 1LJRA 1XW5A 3ED3A 4DEJA 3TJGA 2AYTA 4KNDA 3HKRA 1WPIA 3MNGA 2MYGA 4WBJA 2OBKA 2YV9A 1UC7A 2N5BA 5GSTA 2R2JA 1VF2A 2H76A 6GSSA 1R7HA 2IMDA 4PUAA 3GL3A 3GUSA 4Q5RA 3IBHA 2TRXA 2JSZA 2X64A 3LYKA 1DE1A 3HY2A 2PWJA 2HFDA 1HNBA 1GSEA 1USBA 2MMOA 5IMVA 4ZL9A 1TKDB 3LG6A 1AC1A 2HRNA 3IRAA 4V2MA 1AXDA 1BX9A 1TTZA 1OC9A 3M9KA 4MJAA 3QPMA 5IO0A 3EURA 2MZCA 2N5FA 4G10A 4YAPA 3EU3A 5AIXA 1TK8B 4YAVA 2J23A 3IAM2 1SYXA 1U3AA 4D73A 2FCHA 1ST9A 2XPEA 2HSHA 2B7JA 2JU5A 2LUSA 5HFGA 2HSMA 2DJ1A 4IW9A 2GVPA 2V6KA 1FVKA 4V2LA 5J9CA 1TRVA 3I43A 1S3CA 1K0NA 4NV5A 5JWOB 3D5JA 1SJZA 3EWLA 1GWCA 1GLPA 3IDVA 1DSBA 4BA7A 5D73A 1BYEA 5B8BA 4BWSA 19GSA 4E8HA 4PNGA 3HCZA 3HJMA 2C3NA 3E3EA 2RUFA 3HZ4A 3KGKA 1A0FA 5H5RA 5EL8A 5ELGA 3FHKA 2UZ8A 3BJ5A 3GSSA 1U3IA 5IMAA 3CMIA 4NHZA 4G2EA 4KW6A 2OA7A 4F0CA 2GTUA 3IA1A 5J4UA 1TJDA 1WP0A 2K8VA 2L4QA 3LORA 1K0BA 3ERWA 4MMMA 4HUAA 5IOWA 4MZWA 2R4VA 4HJ2A 1NSWA 1C72A 1S3DA 1ZOFA 1FW1A 3GKKA 4KDYA 4POBA 2VLUA 2I1UA 1XWGA 2H01A 1JLWA 5CYYA 3DMLA 4AJ8A 2VLVA 1KBNA 1SYRA 3FZ4A 2V41A 1X5CA 3NIVA 2PGTA 2PPTA 5IMDA 1GTAA 3BBYA 6GSXA 1GNWA 1M2BA 3A3TA 3TKRA 1AQVA 4OMVA 1QXHA 2H1DA 2JZRA 3UVHA 4CHSA 2VL2C 1LU4A 2CZ2A 2LRTA 2C0GA 5EY6A 2HI7A 2LTKA 3IOSA 1NM3A 2JADA 3BCKA 3M9JA 1SK0A 4G9HA 3CTGA 2C3TA 3EMXA 2H19A 3TGZA 1X9WB 2PBJA 1ERTA 1XVQA 5F05A 2HSNB 3VPQA 1MEKA 3F4SA 2K8SA 1GTBA 3CSIA 1PKZA 2WGRA 4ML6A 2FD3A 2CVKA 3P8WA 2WZ9A 2LKUA 4MF7A 5KEJA 1H4OA 2X99A 2KHPA 4GQFA 5COHA 3F4RA 2D2ZA 3KP9A 4TR3A 3L9UA 2GZYA 4N30A 4JR6A 4KGIA 1EEJA 1JHBA 1GNEA 4F9ZA 3ZFLA 3TKSE 1K0CA 5DJLA 1Z6NA 2G0FA 4KB3A 2RM6A 2HNLA 2DSAA 1B4PA 3L4NA 2VL2A 5B7CA 3FZ9A 1IYHA 2F51A 3F0IA 3M8NA 2FWGA 4FH8A 4TR1B 3P90A 4GXZA 1EV4A 1HQOA 4EXJA 3Q74A 4I2TA 3F6FA 1O6JA 1O8XA 3ZREA 1U88A 4H86A 2VO4A 1A8LA 1QFNA 1JZRA 3JCML 2NDOA 4Q5FA 1HNCA 2GQKA 2FA4A 1T00A 1N8JA 4XIHA 4LL1B 5IPHA 3ZMLA 1WRYA 2HZFA 1XBSA 2LRNA 3IXRA 5E59A 5G1LA 1TW9A 3HVSA 4QQ7A 3ZITA 4GRFA 2YANA 4KDUA 4O92A 2CVDA 1URMA 2I81A 2VLTA 4GCIA 3O6TA 5E4WA 2VL3A 1G7EA 2PVOC 2YWOA 1X0RA 4O5RA 2B3SA 4XS6A 1N2AA 4F2IA 2H0GA 4G19A 5IQYA 1A8YA 3US3A 5FT3A 1F2EA 3GNJA 1WMJA 3KEBA 3HVXA 2XHFA 2H70A 2PUKC 4IVFA 1OC3A 3FR6A 1J0FA 1GSDA 5DJMA 2IWTA 3ZFBA 1I5GA 12GSA 3KXOA 5J9BA 4XHMA 3PPUA 2FY6A 3F9UA 3G7JA 2F9SA 5HQPA 2M46A 1XFLA 2JZSA 1RQMA 4EF0A 4AGSA 1SK1A 3VK9A 1EP7A 1TOFA 4Z7XA 4PTSA 1M9BA 2H66A 4KDXA 4RI7A 1KNGA 1YEXA 2DBCA 3HYPA 3VI5A 3GX8A 2FWHA 14GSA 2OE1A 3TJFA 1FO5A 2EIQA 2YPMA 4I97A 4IGJA 5G1KA 5ECLB 4GSTA 4EC0A 3M1GA 1PX6A 5FHIA 1PL1A 3TKSC 3GKNA 5ECMB 5C04A 4I8BA 2H6YA 5CRDA 2CZ3A 2HLSA 4XS4B 1VF3A 1SD9A 2CQ9A 3F3RA 1Z7RA 2LQQA 3ZTLA 1PN9A 2VOCA 1W4VA 4OWYA 2LV3A 2VAFA 4WETA 4TR1A 3MDKA 10GSA 2IMIA 1CQHA 2LSTA 4F0BA 5C00A 2ZUPA 4HEA2 2B1KA 2ZNMA 1ZCPA 4IP1A 5D9WA 1GUKA 1TK5B 1ZL9A 1TU7A 1VF4A 5DBQA 5IMZA 1YQ1A 2C0DA 5CAXA 4EO3A 1PKWA 1YF0A 4NPBA 4FYUA 2AJQB 5CRHA 2R5GA 3L78A 1BEDA 3Q18A 2GSRA 3DXBA 5KN3A 2L6DA 4MH3A 1BQ7A 2VCZA 2O87A 1V98A 1FAAA 1WWJA 1PL2A 4USSA 3ZLPA 3RHCA 5ECQB 4IBPA 1F6MC 4XCSA 4PUFC 3GKXA 2H6ZA 4G0KA 5AGYA 4Q5NA 2L5OA 3KP8A 3O76A 3TUEA 4EDYA 2BTOT 1ZMAA 3WYWA 1AW9A 3GV1A 1R5PA 2HT9A 2P5RA 1XIYA 3PGTA 2A2SA 5F8BA 2O7KA 6GSUA 4ZB9A 4EUYA 2NBSA 4WF5A 1Z6MA 5JWQB 1V57A 5D9XA 5HR0A 3NOFA 1LBKA 1ON4A 2H75A 5G31A 1EP8A 4QL9A 2VD1A 1TI3A 4YQUA 3P2AA 5CO3A 3FR3A 1GSUA 1SKRB 1A23A 3R2QA 3APOA 3KZQA 2QC7A 2YWIA 1YJ6A 5J5NA 16GSA 4KX4A 1WOUA 3CSJA 3CRTA 2I4AA 1ERVA 2XC2A 1XVWA 2DJKA 2FHEA 4MJBA 4ZBDA 4IQAA 4HQSA 1M2DA 2C1YA 3IPZA 5DALB 2FWFA 1GH2A 5ECNB 2VIMA 5F07A 4MABA 2H0IA 4XS4A 4KAEA 2YOIA 4BVXA 3R3EA 3FKFA 5IIZA 2I3YA 2ZCTA 1AUCA 5JCUA 3DGQA 1XWCA 5B6NA 2IIYA 2YZHA 4L5LA 5IMCA 3J7Yb 5HR3A 1K0DA 3BCIA 4IELA 5EPFA 4ML1A 2VCQA 5DQSA 4K6XA 1X9MB 3LQ7A 2WS2A 4L0WA 1QK8A 3ZVJD 3A2XA 1Z3EA 2VCWA 4EL1A 4ULXA 4IQ1A 1TDIA 3ZVJA 2GLRA 1XWKA 3PR8A 3VWVA 3TCOA 3WGDA 22GSA 1PRXA 1YEPA 5CNWA 5IPGA 4MZBA 4TVEA 1GUMA 3J7Yk 3UBKA 1JFUA 5G2ZA 3QFAC 1F3AA 5LD0A 1K3LA 3EMPA 4MJCA 3CSHA 2HZEB 3Q6OA 4PXOA 3C73A 3BD2A 5CREA 1R4WA 4XRAA 2H1GA 1GULA 1GSSA 1YZXA 5D93A 2LQOA 1XOAA 1RW1A 4WXTA 3WT2A 4OFMA 3Q19A 3MAKA 3UOMA 3VWUA 1FB0A 2RLIA 4MDCA 3C8EA 3TJKA 6GSVA 4GQCA 4POMA 3HJPA 2YCDA 2GSTA 2G2QA 3P7XA 4ECIA 4TR4A 4I2UA 5J41A 3CXGA 2YNXA 2EC4A 2B5EA 2IFQB 1FHEA 4X0XA 3TDGA 3FK8A 2M80A 3HXSA 2ON7A 2XPDA 4V1Ap 5ECKB 3DD3A 4YQMA 1XWBA 1OKDA 2WB9A 4LMVA 2MMZA 3TOTA 3TRPA 4DVCA 2EIOA 2KLXA 2ALBA 3QMXA 1XWAA 3C1SA 2OE3A 1S3AA 3KM6A 3MWHA 3ZYWA 1ZYEA 4X1UA 1EWXA 3LXTA 2H0HA 4ZXGA 2K18A 3KJYA 3TKPA 5DALA 2YJHA 5HR2A 3A5WA 17GSA 4YQVA 2NTOA 2E2GA 2C3QA 1WJKA 2AV4A 3QCPA 2FNOA 3A2WA 1Q4JA 2A4VA 3VPTA 1OE8A 5EVOA 2CA8A 2H30A 3PH9A 3W8JA 1OKTA 4OFTA 1GSQA 3DRNA 3TRQA 1MD3A 2YV7A 4TXOA 1PSQA 1X5EA 3HZ8A 2X8HA 4O7HA 3RAZA 5BMUA 2X8GA 1GSFA 2JSYA 2H72A 1H75A 4P3YB 3E9JB 4HS1A 4J56E 3DYRA 4N11A 4AJ7A 4I5QA 2XBQA 3KTLA 1EOGA 2H73A 2LRCA 1DUGA 4K0GA 4N10A 1FVJA 2DIZA 1GSYA 3H79A 2VCVA 6GSWA 2V32A 3GH9A 5H5QA 5GAPD 3IHQA 3H4KA 2HZEA 3I9V2 2GT5A 3ME8A 4DSSB 3GA4A 4ECJA 4FYBA 4JBBA 4PQHA 1EOHA 4K0NA 1B9YC 2RM5A 3UARA 6GSYA 3F4TA 3F63A 1A24A 1GTIA 3KMOA 2IMFA 4MPGA 1Y25A 3D21A 4PNFA 2BJXA 1EEMA 2DMMA 4POLA 1THOA 3UAPA 1B9XC 4NWYA 2LNTA 1XW9A 3LEFA 3ERGA 3TJBA 2OE0A 1AIUA 4TW5A 4HZ4A 5DCGA 4K8MA 3IR4A 1M7TA 1E2YA 3IAS2 2IFQA 4HI7A 3D4TA 1NHYA 2DJ3A 5A4UA 4BWQA 1Y6EA 4ACSA 3VFIA 1U87A 4N0VA 1WIKA 2RUEA 4BL7B 1Z7PA 2HYXA 3ISOA 2C8UA 1V58A 2GZZA 3EYTA 9GSSA 4JZQA 5IO2A 1SD8A 3GL5A 3FYGA 1Z5YE 2YWNA 2FGXA 1T8EB 4OD7A 2MMAA 4J57E 3GH6A 4HU9A 1B48A 1OE7A 2C4JA 2MMNA 4F03A 1F3BA 1R5AA 1TRSA 3E0UA 2QSIA 1PX7A 4TOPA 3LYPA 4KSOA 2O85A 1TRWA 1MD4A 3WGEA 3KCMA 3V1WA 2YZUA 1K3YA 5D8IA 3HJOA 4WKWA 1K0MA 2QGVA 1M0UA 5H5SA 3RHBA 2CV4A 4MF6A 2F8AA 1R26A 3NZNA 4XRDA 4BVXB 1XZOA 3VWXA 1OVNA 2XBIA 1SU9A 3CTFA 3A2VA 2VCTA 4MJEA 1SL0B 2V1MA 3LXZA 2VUPA 5DCHA 4PGTA 3IV4A 2JACA 2KP2A 2DJ2A 2HXKA 5J3RA 2O89A 20GSA 4GLTA 4BVYB 3C7MA 3C1RA 4XTSA 3HD5A 2I9HA 2B5XA 2C80A 2KP1A 1XPVA 2H8LA 3DVXA 2IMEA 3VURA 2LJRA 3QAWA 1XXUA 2P0GA 2VD0A 4YH2A 1JZDA 11GSA 1J9BA 2L5LA 5HFIA 4DSSA 4DSRA 4WR5A 3TKSA 4ZL8A 4CDOA 1T7PB 5ELAA 4IJIA 1YKCA 4MP4A 3TRXA 4TR0A 2GQLA 3QAGA 1PGTA 2WCIA 2EIRA 3UBLA 3CBUA 4K7IA 2R3XA 5G30A 4OO4A 4K9ZA 2P31A 2CAQA 4F82A 3H93A 1KTEA 2PMTA 2VM1A 4RUVA 2F8FA 2FA8A 4TRXA 3SWLA 4EKZA 5IOXA 1X9SB 4FO5A 3ZIVA 1SKWB 5DAKB 1ZZYA 5A5KA 4ID0A 2DJJA 3EU4A 4JU5A 2YWMA 2PN8A 4EVMA 5ENUA 1F9MA 1B4QA 1MTCA 5JCWA 4OCFA 3DEXA 4BL7A 1DBYA 5F06A 2E2MA 3VLNA 3GHAA 3RDWA 5LNKe 1K3OA 3GTUB 1M99A 2HRKB 2WFCA 4IHUA 1UA5A 1A2JA 1F37A 3EVIA 5CRWA 3ERFA 1O81A 4O32A 3DKSA 3VI7A 5KN0A 2BMXA 3GSTA 4DSQA 4TXVA 1QGVA 2LJKA 1SENA 3HVVA 3U6VA 4HDEA 2WJUA 1EGOA 4IKHA 2B5YA 2C0EA 2GS3A 3CRUA 2J9HA 2MBSA 4WF4A 3HDCA 5ABRA 3IC4A 3TOUA 1HYUA 5D9TA 4GSSA 4E8EA 4POKA 1YY7A 3FR9A 2VM2A 1K0OA 1THXA 4JEDA 4KH7A 4TXOB 1NHOA 5ID2B 5D96A 3H8QA 4AF2A 3IE3A 3F6DA 4FIWA 4BVYA 5DVBA 5B6MA 4KE3A 4OFNA 2H1BA 4XS1A 4PQIA 1T4YA 5ECSA 3W8SA 2P5QA 3VWWA 4NXIA 2AB6A 4KA0A 2L57A 2LS5A 4MK3A 2E7PA 3KD0A 3D4MA 1BAYA 3GYKA 4MZCA 5DQYA 5GSSA 5GAND 2IPAA 3C71A 3G9BA 1SL2B 1SKSB 3TJJA 3GX0A 1SJIA 3U5RE 1VRSD 3QFBC 2H1AA 1K0AA 5LCZA 3D0ZA 1EZKA 1MDJA 3KIJA 2DIYA 2DC5A 4GSNA 2IJYA 2N5AA 1B8XA 2REMA 3ZMKA 3D22A 4TKYA 4IN0A 2R37A 3N5OA 1G0TA 3ME7A 1A2LA 2Z9SA 5B8AA 3L0HA 4J2FA 1OAZA 3RPPA 4KF9A 5KN1A 2WULA 1GLQA 2OADA 2A2RA 3IK9A 1FOVA 1ZYQB 1UVZA 5DAKA 1GL8A 4HQZA 4IJ3A 3QDNA 2PU9C 3EE2A 1SK2A 3GFKA 1AAZA 1HNAA 4ZILA 5CP1A 4EDZA 5INYA 1GP1A 4OO5A 1BG5A 3LGCA 2QKEA 3TKQA 5CRGA 4V1Ag 4ZB6A 1XCCA 2PERA 3ZIJA 2FUG2 2HSYA 5ECIB 5A4VA 2TIRA 4KSMA 3GTUA 2HRKA 2M72A 3CYNA 4MH2A 4ISDA 4WEYA 2KOKA 3KH7A 2CT6A 4WBRD 4FQUA 1XW6A 1V40A 3FEUA 4GF0A 3DWVA 3O3TA 3KTBA 5KN2A 2HQTA 1IYIA 3L9VA 2HE3A 4OCEA 4ZBAA 2C0FA 1GUHA 1YF1A 1TXXA 13GSA 2HRAA 4TN8A 3UL3A 1I9DA 2H71A 2GT6A 3TB2A 4ECBA 1ABAA 4JR4A 2B6MA 4EE0A 4ZL7A 4IP6A 3EINA 3LFLA 1G7OA 1NW2A 2CX4A 6GSTA 1QMVA 1G6WA 3UVTA 1T1VA 3APSA 5GZZB 1Z9HA 2WRTA 5ID2A 3K8NA 2GSQA 2L4CA 5ECHB 4AJ6A 5ECRB 2V6OA 1DE2A 5ECOB 4HZ2A 1V2AA 2AAWA 2YP6A 3GURA 3G7IA 1ERUA 3BOAA 4KUNA 1U6TA 2E0QA 1Q98A 2V2GA 1E6BA 3FZ5A 4NHWA 4QL7A 4PQ1A 2IMKA 4K7OA 4N0ZA 1GRXA 1EV9A 3WT1A 4K1FA 4X43A 2IN3A 2LJAA 2LEGA 3ZRDA 4MA9A 1SL1B 1A0RP 4MLYA 4LA1A 2R6KA 3F3QA 2LNSA 5HR1A 5G5FA 2K9FA 1QQ2A 2OBIA 3MSZA 1X5DA 1ACVA 1VF1A 2KUCA 3KMNA 1MDKA 5ECPB 2IL3A 2FWEA 1HD2A 1SJ6A 4HOJA 1G6YA 2O8VB 5F0GA 2CX3A 5AN1A 4KCAA 3G7YA 2GSSA 4MCUA 1A2MA 1ILOA 3I69A 4ZBBA 2H6XA 3FY7A 2GQMA 1QUWA 3GKMA 4RQXA 3QAVA 2X8CA 3IC8A 4GTUA 3N9JA 2NVLA 3H1NA 2AHEA 4I6XA 1YDKA 3ZL5A 1OC8A 3QOUA 1BJXA 5HFKA 2B7KA 3SBCA 4IS0A 1AQXA 2F3MA 5DDLA 1O7UA 4L8EA 1ML6A 1V9WA 3D6IA 2CAIA 3GRXA 4WR4A 2TRCP 1OYJA 1GTUA 4NV2A 5AIVA 4L0UA 4MPFA 3M0FA 2ES7A 4PX1A 5G5EA 3HA9A 3UJ1A 2HRFA 2DJ0A 3UEMA 1PMTA 5D9VA 2CVBA 3RBTA 4FYCA 3QD9A 3M3MA 4JE1A 7GSSA 1T4ZA 2JZTA 3AY8A 3FW2A 3PINA 2VCXA 4MF5A 5AISA 2L59A 2DMLA 4ZIJA 4GWRA 1EGRA 3GIXA 4L5OA 3GMFA 4NAXA 4K7NA 1VGLA 2AUVA 8GSSA 1TU8A 1YKAA 1ERWA 1TP9A 4HU7A 3L9SA 1O85A 5JWRB 2PVQA 2OKAA 3WGXA 1OC9B 2DLXA 1JZWA 5A4WA 4CW9A 1JLVA 3UIWA 3HHVA 2MBTA 3QR6A 1PD21 3GN3A 3OR5A 3UMAA
chains in the Genus database with same CATH superfamily
3WD6A 4ECCA 2NPBA 4D73B 1ZGNA 2FLSA 1KEBA 5A1NB 2YN1A 5JCGA 4PI2C 1PA3A 2GGTA 1FB6A 1UN2A 1M2AA 2L6CA 3LJRA 4V2NA 2VL9A 2OACA 2HSMB 2H74A 1T3BA 3FZAA 3S9FA 3RPNA 1PFOA 4Z2RA 4BPYA 4PURA 4RQRA 4LMWA 4G0IA 2GDRA 3I6AA 2RIIA 2K6VA 5L71A 3FRCA 4LLRA 3IK7A 4AKXB 1J08A 4KCEA 1WE0A 2GZPA 4ZB8A 4JRRA 1N25A 2B1LA 4K2DA 1TI1A 1FG4A 2JL4A 3LSZA 3DVWA 3W6GA 4Q5QA 3DIEA 4ILFA 2WDUA 4HJMA 3ZZXA 5FWGA 2UV8G 1TK0B 2O5VA 1W89A 4RI6A 1JZOA 1PQNA 4NMUA 1TRUA 3KH9A 3LWAA 4G0LA 4N3ZA 3F8UA 2ON5A 3APQA 1CQGA 1AQWA 2YJ7A 4LL4B 3EC3A 1M9AA 1MDIA 1O8WA 18GSA 2OJLA 5IMFA 1O73A 4YKFA 5IM9A 1RK4A 1XOBA 4BIKA 1LJRA 1XG8A 1XW5A 3ED3A 4DEJA 3TJGA 4K2XA 2AYTA 4KNDA 3HKRA 1WPIA 3MNGA 2MYGA 4WBJA 2OBKA 2YV9A 1UC7A 2N5BA 5GSTA 2R2JA 1VF2A 2H76A 6GSSA 1R7HA 2IMDA 4PUAA 3GL3A 3GUSA 4Q5RA 3IBHA 2TRXA 2JSZA 2X64A 3LYKA 1DE1A 3HY2A 2PWJA 2HFDA 1HNBA 1GSEA 1USBA 2MMOA 5IMVA 4ZL9A 1TKDB 3LG6A 1AC1A 2HRNA 3IRAA 4V2MA 1AXDA 1YVLA 1BX9A 1TTZA 1OC9A 3M9KA 4MJAA 3QPMA 5IO0A 3EURA 2MZCA 2N5FA 4G10A 4YAPA 3EU3A 5AIXA 1TK8B 4YAVA 2J23A 3IAM2 1SYXA 1U3AA 4D73A 2FCHA 1ST9A 2WW3A 2XPEA 2HSHA 2B7JA 2JU5A 2LUSA 5HFGA 2HSMA 2DJ1A 4IW9A 2GVPA 2V6KA 1FVKA 4V2LA 5J9CA 1TRVA 2X4AA 3I43A 1S3CA 1K0NA 4NV5A 5JWOB 3D5JA 1YEWC 1SJZA 3EWLA 1GWCA 1GLPA 3IDVA 1DSBA 4BA7A 5D73A 1BYEA 5B8BA 4BWSA 19GSA 4E8HA 4PNGA 3HCZA 3HJMA 2C3NA 3E3EA 2RUFA 3HZ4A 3KGKA 1A0FA 5H5RA 5EL8A 5ELGA 3FHKA 2UZ8A 3BJ5A 2VKZG 3GSSA 1U3IA 5IMAA 3CMIA 4NHZA 4G2EA 4KW6A 2WW2A 2OA7A 4F0CA 2O3EA 2GTUA 4AKHA 5J40A 3IA1A 5J4UA 1TJDA 1WP0A 2K8VA 2L4QA 3LORA 3ERWA 1K0BA 4MMMA 4HUAA 5IOWA 4MZWA 2R4VA 4HJ2A 1NSWA 1C72A 1S3DA 1ZOFA 1FW1A 3GKKA 4KDYA 4POBA 2VLUA 2I1UA 1XWGA 2H01A 1JLWA 5CYYA 3DMLA 4AJ8A 2VLVA 1KBNA 1SYRA 3FZ4A 2V41A 1X5CA 3NIVA 2PGTA 2PPTA 5IMDA 1GTAA 3BBYA 6GSXA 1GNWA 1M2BA 3A3TA 3TKRA 1AQVA 4OMVA 1QXHA 2H1DA 2JZRA 3UVHA 4CHSA 2VL2C 1LU4A 2CZ2A 2LRTA 2C0GA 5EY6A 1M3JA 2HI7A 2LTKA 3IOSA 1NM3A 4Z2UA 1BF5A 2JADA 3BCKA 3M9JA 1SK0A 4G9HA 3CTGA 2C3TA 3EMXA 2H19A 3TGZA 1X9WB 2PBJA 1ERTA 1XVQA 5F05A 2HSNB 3VPQA 1MEKA 3F4SA 2K8SA 1GTBA 3CSIA 1PKZA 2WGRA 4ML6A 2FD3A 2CVKA 3P8WA 2WZ9A 2LKUA 4MF7A 5KEJA 1H4OA 2X99A 2KHPA 4GQFA 4EIPA 5COHA 2DKIA 3F4RA 2D2ZA 3KP9A 4TR3A 3L9UA 2GZYA 4N30A 4K5RA 4JR6A 4KGIA 1EEJA 1JHBA 1GNEA 4F9ZA 3ZFLA 3TKSE 1K0CA 5DJLA 1Z6NA 2G0FA 4KB3A 2RM6A 2HNLA 2DSAA 1B4PA 3L4NA 2VL2A 5B7CA 3FZ9A 1IYHA 2F51A 3F0IA 3M8NA 2FWGA 4FH8A 4TR1B 3P90A 4GXZA 1EV4A 1HQOA 3CHXC 4EXJA 3Q74A 4I2TA 3F6FA 1O6JA 1O8XA 3ZREA 1U88A 4H86A 2VO4A 1A8LA 1QFNA 5J4VA 5A5HB 1JZRA 3JCML 2NDOA 4Q5FA 4O5UA 1HNCA 2GQKA 2FA4A 1T00A 1N8JA 4XIHA 4LL1B 5IPHA 3ZMLA 1WRYA 2HZFA 1XBSA 2LRNA 3IXRA 5E59A 5G1LA 1TW9A 3HVSA 4QQ7A 3ZITA 4GRFA 2YANA 4KDUA 4O92A 2CVDA 1URMA 2I81A 2VLTA 4GCIA 3O6TA 5E4WA 2VL3A 1G7EA 2PVOC 2YWOA 1X0RA 4O5RA 2B3SA 4XS6A 1N2AA 4F2IA 2H0GA 4G19A 5IQYA 1A8YA 3US3A 5FT3A 1F2EA 3GNJA 1WMJA 3KEBA 3HVXA 2XHFA 2H70A 2PUKC 4IVFA 1OC3A 3FR6A 2A4HA 1J0FA 1GSDA 5DJMA 2IWTA 3ZFBA 1I5GA 12GSA 3KXOA 5J9BA 4XHMA 3PPUA 2FY6A 3F9UA 3G7JA 2F9SA 5HQPA 2M46A 1XFLA 2JZSA 1RQMA 2WZSA 4AGSA 4EF0A 1SK1A 3VK9A 1EP7A 1TOFA 4Z7XA 4PTSA 1M9BA 2H66A 4KDXA 4RI7A 1KNGA 1YEXA 2A2PA 2DBCA 3HYPA 3VI5A 3GX8A 2FWHA 14GSA 2OE1A 2HSNA 3TJFA 1FO5A 2EIQA 2YPMA 4I97A 4IGJA 5G1KA 5ECLB 4GSTA 4EC0A 3M1GA 5J4YA 1PX6A 2X49A 5FHIA 5A34B 1PL1A 3TKSC 3GKNA 5ECMB 5C04A 4I8BA 2H6YA 5CRDA 2CZ3A 2HLSA 4XS4B 4ZB7A 1VF3A 1SD9A 2CQ9A 3F3RA 1Z7RA 2LQQA 3ZTLA 1PN9A 2VOCA 1W4VA 4OWYA 2LV3A 2VAFA 4WETA 4TR1A 3MDKA 10GSA 2IMIA 1CQHA 2LSTA 4F0BA 5C00A 3CWGA 2ZUPA 4HEA2 2B1KA 5A5HA 2ZNMA 1ZCPA 4IP1A 5D9WA 1GUKA 1TK5B 1ZL9A 1TU7A 1VF4A 5DBQA 5IMZA 1YQ1A 2C0DA 5CAXA 4EO3A 1PKWA 1YF0A 4NPBA 4FYUA 2AJQB 5CRHA 2R5GA 3L78A 1BEDA 3Q18A 2GSRA 3DXBA 5KN3A 2L6DA 4MH3A 3HVNA 5KOXA 5BRTA 1BQ7A 2VCZA 2O87A 1V98A 1FAAA 1WWJA 1PL2A 4USSA 3ZLPA 1S3RA 3RHCA 5ECQB 4IBPA 1F6MC 4ICYA 4XCSA 4PUFC 3RGBC 3GKXA 2H6ZA 1S4BP 4G0KA 5AGYA 4Q5NA 2L5OA 3KP8A 3O76A 3RFRC 2R0GA 3TUEA 4EDYA 2BTOT 1ZMAA 3WYWA 1AW9A 3GV1A 1R5PA 2HT9A 2P5RA 1XIYA 3PGTA 2A2SA 5F8BA 2O7KA 6GSUA 4ZB9A 4EUYA 2NBSA 4WF5A 1Z6MA 5JWQB 1V57A 5D9XA 5HR0A 3NOFA 1LBKA 1ON4A 2H75A 5G31A 1EP8A 4QL9A 2VD1A 1TI3A 4YQUA 3P2AA 5CO3A 3FR3A 1GSUA 1SKRB 1A23A 3R2QA 3APOA 3KZQA 2QC7A 2YWIA 1YJ6A 5J5NA 16GSA 4KX4A 1WOUA 3CSJA 3CRTA 2I4AA 1ERVA 2XC2A 1XVWA 2DJKA 2FHEA 3LW9A 4MJBA 4ZBDA 4IQAA 4HQSA 1M2DA 2C1YA 3IPZA 5DALB 2FWFA 1GH2A 5ECNB 2VIMA 5F07A 5A34A 4MABA 2QA2A 2H0IA 4XS4A 4KAEA 2YOIA 4BVXA 3R3EA 3FKFA 5IIZA 2I3YA 2ZCTA 1AUCA 5JCUA 3DGQA 1TXUA 1XWCA 5B6NA 2IIYA 2YZHA 4L5LA 5IMCA 3J7Yb 5HR3A 1K0DA 3BCIA 4IELA 5EPFA 4ML1A 2O36A 2VCQA 5DQSA 5BMUB 2WVZA 3HMJG 4K6XA 1X9MB 3LQ7A 2WS2A 4L0WA 1QK8A 3ZVJD 3A2XA 1Z3EA 2VCWA 4EL1A 4ULXA 4IQ1A 1TDIA 3ZVJA 2GLRA 1XWKA 4MNNA 3PR8A 3VWVA 3TCOA 3WGDA 22GSA 1PRXA 1YEPA 5CNWA 5IPGA 4PHZC 4MZBA 4TVEA 1GUMA 3J7Yk 3UBKA 1JFUA 5G2ZA 2H1LA 4E68A 3QFAC 1F3AA 1SVOA 1K3LA 5LD0A 3EMPA 4MJCA 1ZYNA 3CSHA 2HZEB 3Q6OA 4PXOA 3C73A 3BD2A 5CREA 1R4WA 4XRAA 2H1GA 1GULA 1GSSA 1YZXA 5D93A 2LQOA 1XOAA 2EFHA 1RW1A 4WXTA 3WT2A 4OFMA 3Q19A 3MAKA 3A5IA 3UOMA 3VWUA 1FB0A 2RLIA 4MDCA 3C8EA 3TJKA 6GSVA 4GQCA 4POMA 3HJPA 2YCDA 2GSTA 2G2QA 3P7XA 4ECIA 4TR4A 3MYDA 4I2UA 5J41A 3CXGA 2YNXA 4CY8A 2EC4A 2B5EA 2IFQB 1FHEA 4X0XA 3TDGA 3FK8A 2M80A 3HXSA 2ON7A 2XPDA 4V1Ap 5ECKB 3DD3A 4YQMA 1XWBA 1OKDA 2WB9A 4LMVA 2MMZA 3TOTA 3TRPA 4DVCA 2EIOA 2KLXA 2ALBA 3QMXA 1XWAA 3C1SA 2OE3A 1S3AA 3KM6A 3MWHA 3ZYWA 1ZYEA 4X1UA 1EWXA 3LXTA 2H0HA 4ZXGA 2K18A 3KJYA 3TKPA 5DALA 2YJHA 5HR2A 3A5WA 17GSA 4YQVA 2NTOA 2E2GA 3IHGA 2C3QA 1WJKA 2AV4A 3QCPA 2FNOA 3A2WA 1Q4JA 2A4VA 3VPTA 1OE8A 5KOWA 5EVOA 2CA8A 2H30A 3PH9A 3W8JA 1OKTA 4OFTA 1GSQA 3DRNA 3TRQA 1MD3A 2YV7A 4TXOA 1PSQA 1X5EA 3HZ8A 2X8HA 4O7HA 3RAZA 5BMUA 2X8GA 1GSFA 2JSYA 2H72A 1H75A 4P3YB 3E9JB 4HS1A 4J56E 3DYRA 4N11A 4AJ7A 4I5QA 2XBQA 3KTLA 1EOGA 2H73A 2LRCA 1DUGA 4K0GA 4N10A 1FVJA 2DIZA 1GSYA 3H79A 1PN0A 2VCVA 6GSWA 2V32A 3GH9A 5H5QA 5GAPD 3IHQA 3H4KA 2HZEA 3I9V2 2GT5A 3ME8A 4DSSB 3GA4A 4ECJA 4FYBA 4JBBA 4PQHA 1EOHA 4K0NA 1B9YC 2RM5A 3UARA 6GSYA 3F4TA 3F63A 4QMKA 1A24A 1GTIA 3KMOA 2IMFA 4MPGA 1Y25A 3D21A 4PNFA 2BJXA 1EEMA 2WVXB 2DMMA 4POLA 4FXYP 1THOA 3UAPA 1B9XC 4NWYA 2LNTA 1XW9A 3LEFA 3ERGA 3TJBA 2OE0A 1AIUA 4TW5A 4HZ4A 5DCGA 4K8MA 3IR4A 1M7TA 1E2YA 3IAS2 2IFQA 4HI7A 3D4TA 1NHYA 2DJ3A 5A4UA 4BWQA 1SVLA 1Y6EA 4ACSA 3VFIA 1U87A 3TU3B 4N0VA 1WIKA 2RUEA 4BL7B 1Z7PA 2HYXA 3ISOA 2C8UA 1V58A 2GZZA 3EYTA 9GSSA 4JZQA 5IO2A 1SD8A 3GL5A 3FYGA 1Z5YE 2YWNA 2FGXA 1T8EB 4OD7A 2MMAA 4J57E 4YKGA 3GH6A 4HU9A 1B48A 1OE7A 2C4JA 2MMNA 4F03A 1F3BA 1R5AA 4W66A 1TRSA 3E0UA 2QSIA 1PX7A 1Y1UA 4TOPA 4CY6A 3LYPA 4KSOA 2O85A 1TRWA 1MD4A 3WGEA 3KCMA 3V1WA 2YZUA 1K3YA 5D8IA 3HJOA 4WKWA 1K0MA 2QGVA 1M0UA 5H5SA 3RHBA 2CV4A 4MF6A 1BG1A 2F8AA 1R26A 3NZNA 4XRDA 4BVXB 1XZOA 3VWXA 1OVNA 2XBIA 3EPTA 1SU9A 3CTFA 3A2VA 2VCTA 4MJEA 1SL0B 2V1MA 3LXZA 4K5SA 2VUPA 5DCHA 4PGTA 3IV4A 2JACA 2KP2A 3FMWA 2DJ2A 2HXKA 5J3RA 2O89A 4Z2TA 20GSA 4GLTA 4BVYB 3C7MA 3C1RA 4XTSA 3HD5A 2I9HA 2B5XA 2C80A 2KP1A 1XPVA 2EFDA 2H8LA 3DVXA 2IMEA 3VURA 2LJRA 3QAWA 1XXUA 2EFCA 2P0GA 2VD0A 4YH2A 1JZDA 11GSA 1J9BA 2L5LA 5HFIA 4DSSA 4DSRA 4WR5A 3TKSA 4ZL8A 4CDOA 1T7PB 5ELAA 4IJIA 1YKCA 4MP4A 3TRXA 4TR0A 2GQLA 3QAGA 1PGTA 2WCIA 2EIRA 3UBLA 3CBUA 4K7IA 2R3XA 5G30A 4OO4A 4K9ZA 2P31A 2WVXA 2CAQA 4F82A 3H93A 1KTEA 2PMTA 2VM1A 4AKIA 4RUVA 2F8FA 2FA8A 4TRXA 3SWLA 4EKZA 5IOXA 1X9SB 4FO5A 3ZIVA 1SKWB 5DAKB 1ZZYA 5A5KA 4ID0A 2DJJA 3EU4A 4JU5A 2YWMA 2PN8A 4EVMA 5ENUA 1F9MA 1B4QA 1MTCA 5JCWA 4OCFA 3DEXA 4BL7A 1DBYA 5F06A 2E2MA 3VLNA 3GHAA 3RDWA 5LNKe 1K3OA 3GTUB 1M99A 2HRKB 2WFCA 4IHUA 1UA5A 1A2JA 1F37A 3EVIA 5CRWA 3ERFA 1O81A 4O32A 3DKSA 3VI7A 5KN0A 2BMXA 3GSTA 4DSQA 4TXVA 1QGVA 2LJKA 1SENA 3HVVA 3U6VA 4HDEA 2WJUA 1EGOA 4IKHA 2B5YA 2C0EA 2GS3A 3CRUA 2J9HA 2MBSA 4WF4A 4AKGA 3HDCA 5ABRA 3IC4A 3TOUA 1HYUA 5D9TA 4GSSA 4E8EA 4POKA 1YY7A 3FR9A 2VM2A 1K0OA 1THXA 4JEDA 4KH7A 4TXOB 1NHOA 5ID2B 5D96A 3H8QA 2DKHA 4AF2A 3IE3A 3F6DA 4AI6A 4BVYA 4FIWA 5DVBA 4KE3A 5B6MA 4OFNA 2H1BA 4XS1A 4PQIA 1T4YA 5ECSA 3W8SA 2P5QA 3VWWA 2WW0A 5A1NA 4NXIA 2AB6A 4KA0A 2L57A 2LS5A 4MK3A 2E7PA 3KD0A 3D4MA 1BAYA 3GYKA 4MZCA 5DQYA 5GSSA 5GAND 2IPAA 3C71A 3G9BA 1SL2B 1SKSB 3TJJA 3GX0A 1SJIA 1FOHA 3U5RE 1VRSD 3QFBC 2H1AA 1K0AA 5LCZA 3D0ZA 1EZKA 1MDJA 3KIJA 2DIYA 2DC5A 4GSNA 2IJYA 2REMA 2N5AA 1B8XA 3ZMKA 2R0PA 3D22A 4TKYA 4IN0A 2R37A 3N5OA 1G0TA 3ME7A 1A2LA 2Z9SA 5B8AA 3L0HA 4J2FA 1OAZA 3RPPA 4GDFA 4KF9A 5KN1A 2WULA 1GLQA 2OADA 2A2RA 3IK9A 1FOVA 1ZYQB 1UVZA 5DAKA 1GL8A 4HQZA 4IJ3A 3QDNA 2PU9C 4A5PA 3EE2A 1SK2A 3GFKA 1AAZA 1HNAA 4ZILA 5CP1A 4EDZA 2WW1A 5INYA 1GP1A 4OO5A 1BG5A 3LGCA 2QKEA 3TKQA 5CRGA 4V1Ag 4ZB6A 1SVMA 1XCCA 2PERA 3ZIJA 2FUG2 2HSYA 5ECIB 5A4VA 2TIRA 4KSMA 3GTUA 2HRKA 2M72A 1M3IA 3CYNA 4MH2A 4ISDA 4WEYA 2KOKA 3KH7A 2CT6A 4WBRD 4FQUA 1XW6A 1V40A 3FEUA 4GF0A 3DWVA 3O3TA 3KTBA 5KN2A 2HQTA 1IYIA 3L9VA 2HE3A 4OCEA 4ZBAA 2C0FA 4O5QA 1GUHA 4EIQA 1YF1A 1TXXA 13GSA 2HRAA 4TN8A 3UL3A 1I9DA 2H71A 2GT6A 3TB2A 4ECBA 1ABAA 4JR4A 2B6MA 4EE0A 4ZL7A 4IP6A 3EINA 3LFLA 1G7OA 1NW2A 2CX4A 6GSTA 1QMVA 1G6WA 3UVTA 1T1VA 3APSA 5GZZB 1Z9HA 2WRTA 5ID2A 3K8NA 2GSQA 2L4CA 5ECHB 4AJ6A 5ECRB 2V6OA 1DE2A 5ECOB 4HZ2A 1V2AA 2AAWA 2YP6A 3GURA 3G7IA 1ERUA 3BOAA 4KUNA 1U6TA 2E0QA 1Q98A 2V2GA 1E6BA 3FZ5A 4NHWA 4QL7A 4PQ1A 2IMKA 4K7OA 4N0ZA 1GRXA 5J47A 1EV9A 3WT1A 4K1FA 4X43A 2EFEA 2IN3A 2LJAA 2LEGA 3ZRDA 4MA9A 1SL1B 1A0RP 4MLYA 4LA1A 2R6KA 3F3QA 2LNSA 5HR1A 5G5FA 4PI0C 2K9FA 1QQ2A 2OBIA 3MSZA 1X5DA 2QA1A 1ACVA 1VF1A 2KUCA 3KMNA 1MDKA 5ECPB 2IL3A 2FWEA 1HD2A 1SJ6A 4HOJA 1G6YA 2O8VB 5F0GA 2CX3A 5AN1A 4KCAA 3G7YA 2GSSA 4MCUA 1A2MA 1ILOA 3I69A 4ZBBA 2H6XA 3FY7A 2GQMA 1QUWA 3GKMA 4X4JA 4RQXA 3QAVA 2X8CA 3IC8A 4GTUA 3N9JA 2R0CA 2NVLA 3H1NA 2AHEA 4I6XA 1YDKA 3ZL5A 1OC8A 3QOUA 1BJXA 5HFKA 2B7KA 3SBCA 4IS0A 1AQXA 2F3MA 5DDLA 3CQFA 1O7UA 4L8EA 1ML6A 1V9WA 3D6IA 2CAIA 3GRXA 4WR4A 2TRCP 1OYJA 1ZYPA 2WVYA 1GTUA 4NV2A 5AIVA 4L0UA 4MPFA 3MIXA 3M0FA 2ES7A 4PX1A 5G5EA 3HA9A 3UJ1A 2HRFA 2DJ0A 3UEMA 1PMTA 5D9VA 2CVBA 3RBTA 4FYCA 3QD9A 3M3MA 4JE1A 7GSSA 1T4ZA 2JZTA 3AY8A 3FW2A 3PINA 2VCXA 4MF5A 5AISA 2L59A 2DMLA 4ZIJA 4GWRA 1EGRA 3GIXA 4L5OA 3GMFA 4NAXA 4K7NA 1VGLA 2AUVA 8GSSA 1TU8A 1YKAA 1ERWA 1TP9A 4HU7A 3L9SA 1O85A 4G01A 5JWRB 2PVQA 4HSCX 2OT3A 2OKAA 3WGXA 1OC9B 2DLXA 1JZWA 5A4WA 4CW9A 1JLVA 3UIWA 3HHVA 2MBTA 3QR6A 1PD21 3GN3A 3OR5A 1I1IP 3UMAA
chains in the Genus database with same CATH topology
3WD6A 4ECCA 2NPBA 4D73B 1ZGNA 2FLSA 1KEBA 5A1NB 2YN1A 5JCGA 1PA3A 2GGTA 1FB6A 1UN2A 1M2AA 2L6CA 3LJRA 4V2NA 2VL9A 2OACA 2HSMB 2H74A 1T3BA 3FZAA 3S9FA 3RPNA 4Z2RA 4BPYA 4PURA 4RQRA 4LMWA 4G0IA 2GDRA 3I6AA 2RIIA 2K6VA 5L71A 3FRCA 4LLRA 3IK7A 4AKXB 1J08A 4KCEA 1WE0A 2GZPA 4ZB8A 4JRRA 1N25A 2B1LA 4K2DA 1TI1A 1FG4A 2JL4A 3LSZA 3DVWA 3W6GA 4Q5QA 3DIEA 4ILFA 2WDUA 4HJMA 3ZZXA 5FWGA 2UV8G 1TK0B 2O5VA 1W89A 4RI6A 1JZOA 1PQNA 4NMUA 1TRUA 3KH9A 3LWAA 4G0LA 4N3ZA 3F8UA 2ON5A 3APQA 1CQGA 1AQWA 2YJ7A 4LL4B 3EC3A 1M9AA 1MDIA 1O8WA 18GSA 2OJLA 5IMFA 1O73A 4YKFA 5IM9A 1RK4A 1XOBA 1LJRA 1XW5A 3ED3A 4DEJA 3TJGA 4K2XA 2AYTA 4KNDA 3HKRA 1WPIA 3MNGA 2MYGA 4WBJA 2OBKA 2YV9A 1UC7A 2N5BA 5GSTA 2R2JA 1VF2A 2H76A 6GSSA 1R7HA 2IMDA 4PUAA 3GL3A 3GUSA 4Q5RA 3IBHA 2TRXA 2JSZA 2X64A 3LYKA 1DE1A 3HY2A 2PWJA 2HFDA 1HNBA 1GSEA 1USBA 2MMOA 5IMVA 4ZL9A 1TKDB 3LG6A 1AC1A 2HRNA 3IRAA 4V2MA 1AXDA 1YVLA 1BX9A 1TTZA 1OC9A 3M9KA 4MJAA 3QPMA 5IO0A 3EURA 2MZCA 2N5FA 4G10A 4YAPA 3EU3A 5AIXA 1TK8B 4YAVA 2J23A 3IAM2 1SYXA 1U3AA 4D73A 2FCHA 1ST9A 2XPEA 2HSHA 2B7JA 2JU5A 2LUSA 5HFGA 2HSMA 2DJ1A 4IW9A 2GVPA 2V6KA 1FVKA 4V2LA 5J9CA 1TRVA 2X4AA 3I43A 1S3CA 1K0NA 4NV5A 5JWOB 3D5JA 1SJZA 3EWLA 1GWCA 1GLPA 3IDVA 1DSBA 4BA7A 5D73A 1BYEA 5B8BA 4BWSA 19GSA 4E8HA 4PNGA 3HCZA 3HJMA 2C3NA 3E3EA 2RUFA 3HZ4A 3KGKA 1A0FA 5H5RA 5EL8A 5ELGA 3FHKA 2UZ8A 3BJ5A 2VKZG 3GSSA 1U3IA 5IMAA 3CMIA 4NHZA 4G2EA 4KW6A 2OA7A 4F0CA 2GTUA 4AKHA 5J40A 3IA1A 5J4UA 1TJDA 1WP0A 2K8VA 2L4QA 3LORA 1K0BA 3ERWA 4MMMA 4HUAA 5IOWA 4MZWA 2R4VA 4HJ2A 1NSWA 1C72A 1S3DA 1ZOFA 1FW1A 3GKKA 4KDYA 4POBA 2VLUA 2I1UA 1XWGA 2H01A 1JLWA 5CYYA 3DMLA 4AJ8A 2VLVA 1KBNA 1SYRA 3FZ4A 2V41A 1X5CA 3NIVA 2PGTA 2PPTA 5IMDA 1GTAA 3BBYA 6GSXA 1GNWA 1M2BA 3A3TA 3TKRA 1AQVA 4OMVA 1QXHA 2H1DA 2JZRA 3UVHA 4CHSA 2VL2C 1LU4A 2CZ2A 2LRTA 2C0GA 5EY6A 2HI7A 2LTKA 3IOSA 1NM3A 4Z2UA 1BF5A 2JADA 3BCKA 3M9JA 1SK0A 4G9HA 3CTGA 2C3TA 3EMXA 2H19A 3TGZA 1X9WB 2PBJA 1ERTA 1XVQA 5F05A 2HSNB 3VPQA 1MEKA 3F4SA 2K8SA 1GTBA 3CSIA 1PKZA 2WGRA 4ML6A 2FD3A 2CVKA 3P8WA 2WZ9A 2LKUA 4MF7A 5KEJA 1H4OA 2X99A 2KHPA 4GQFA 4EIPA 5COHA 2DKIA 3F4RA 2D2ZA 3KP9A 4TR3A 3L9UA 2GZYA 4N30A 4K5RA 4JR6A 4KGIA 1EEJA 1JHBA 1GNEA 4F9ZA 3ZFLA 3TKSE 1K0CA 5DJLA 1Z6NA 2G0FA 4KB3A 2RM6A 2HNLA 2DSAA 1B4PA 3L4NA 2VL2A 5B7CA 3FZ9A 1IYHA 2F51A 3F0IA 3M8NA 2FWGA 4FH8A 4TR1B 3P90A 4GXZA 1EV4A 1HQOA 4EXJA 3Q74A 4I2TA 3F6FA 1O6JA 1O8XA 3ZREA 1U88A 4H86A 2VO4A 1A8LA 1QFNA 5J4VA 5A5HB 1JZRA 3JCML 2NDOA 4Q5FA 4O5UA 1HNCA 2GQKA 2FA4A 1T00A 1N8JA 4XIHA 4LL1B 5IPHA 3ZMLA 1WRYA 2HZFA 1XBSA 2LRNA 3IXRA 5E59A 5G1LA 1TW9A 3HVSA 4QQ7A 3ZITA 4GRFA 2YANA 4KDUA 4O92A 2CVDA 1URMA 2I81A 2VLTA 4GCIA 3O6TA 5E4WA 2VL3A 1G7EA 2PVOC 2YWOA 1X0RA 4O5RA 2B3SA 4XS6A 1N2AA 4F2IA 2H0GA 4G19A 5IQYA 1A8YA 3US3A 5FT3A 1F2EA 3GNJA 1WMJA 3KEBA 3HVXA 2XHFA 2H70A 2PUKC 4IVFA 1OC3A 3FR6A 2A4HA 1J0FA 1GSDA 5DJMA 2IWTA 3ZFBA 1I5GA 12GSA 3KXOA 5J9BA 4XHMA 3PPUA 2FY6A 3F9UA 3G7JA 2F9SA 5HQPA 2M46A 1XFLA 2JZSA 1RQMA 4EF0A 4AGSA 1SK1A 3VK9A 1EP7A 1TOFA 4Z7XA 4PTSA 1M9BA 2H66A 4KDXA 4RI7A 1KNGA 1YEXA 2A2PA 2DBCA 3HYPA 3VI5A 3GX8A 2FWHA 14GSA 2OE1A 2HSNA 3TJFA 1FO5A 2EIQA 2YPMA 4I97A 4IGJA 5G1KA 5ECLB 4GSTA 4EC0A 3M1GA 5J4YA 1PX6A 2X49A 5FHIA 5A34B 1PL1A 3TKSC 3GKNA 5ECMB 5C04A 4I8BA 2H6YA 5CRDA 2CZ3A 2HLSA 4XS4B 4ZB7A 1VF3A 1SD9A 2CQ9A 3F3RA 1Z7RA 2LQQA 3ZTLA 1PN9A 2VOCA 1W4VA 4OWYA 2LV3A 2VAFA 4WETA 4TR1A 3MDKA 10GSA 2IMIA 1CQHA 2LSTA 4F0BA 5C00A 3CWGA 2ZUPA 4HEA2 2B1KA 5A5HA 2ZNMA 1ZCPA 4IP1A 5D9WA 1GUKA 1TK5B 1ZL9A 1TU7A 1VF4A 5DBQA 5IMZA 1YQ1A 2C0DA 5CAXA 4EO3A 1PKWA 1YF0A 4NPBA 4FYUA 2AJQB 5CRHA 2R5GA 3L78A 1BEDA 3Q18A 2GSRA 3DXBA 5KN3A 2L6DA 4MH3A 5KOXA 5BRTA 1BQ7A 2VCZA 2O87A 1V98A 1FAAA 1WWJA 1PL2A 4USSA 3ZLPA 3RHCA 5ECQB 4IBPA 1F6MC 4ICYA 4XCSA 4PUFC 3GKXA 2H6ZA 4G0KA 5AGYA 4Q5NA 2L5OA 3KP8A 3O76A 2R0GA 3TUEA 4EDYA 2BTOT 1ZMAA 3WYWA 1AW9A 3GV1A 1R5PA 2HT9A 2P5RA 1XIYA 3PGTA 2A2SA 5F8BA 2O7KA 6GSUA 4ZB9A 4EUYA 2NBSA 4WF5A 1Z6MA 5JWQB 1V57A 5D9XA 5HR0A 3NOFA 1LBKA 1ON4A 2H75A 5G31A 1EP8A 4QL9A 2VD1A 1TI3A 4YQUA 3P2AA 5CO3A 3FR3A 1GSUA 1SKRB 1A23A 3R2QA 3APOA 3KZQA 2QC7A 2YWIA 1YJ6A 5J5NA 16GSA 4KX4A 1WOUA 3CSJA 3CRTA 2I4AA 1ERVA 2XC2A 1XVWA 2DJKA 2FHEA 3LW9A 4MJBA 4ZBDA 4IQAA 4HQSA 1M2DA 2C1YA 3IPZA 5DALB 2FWFA 1GH2A 5ECNB 2VIMA 5F07A 5A34A 4MABA 2QA2A 2H0IA 4XS4A 4KAEA 2YOIA 4BVXA 3R3EA 3FKFA 5IIZA 2I3YA 2ZCTA 1AUCA 5JCUA 3DGQA 1TXUA 1XWCA 5B6NA 2IIYA 2YZHA 4L5LA 5IMCA 3J7Yb 5HR3A 1K0DA 3BCIA 4IELA 5EPFA 4ML1A 2VCQA 5DQSA 5BMUB 3HMJG 4K6XA 1X9MB 3LQ7A 2WS2A 4L0WA 1QK8A 3ZVJD 3A2XA 1Z3EA 2VCWA 4EL1A 4ULXA 4IQ1A 1TDIA 3ZVJA 2GLRA 1XWKA 4MNNA 3PR8A 3VWVA 3TCOA 3WGDA 22GSA 1PRXA 1YEPA 5CNWA 5IPGA 4MZBA 4TVEA 1GUMA 3J7Yk 3UBKA 1JFUA 5G2ZA 2H1LA 4E68A 3QFAC 1F3AA 1SVOA 1K3LA 5LD0A 3EMPA 4MJCA 1ZYNA 3CSHA 2HZEB 3Q6OA 4PXOA 3C73A 3BD2A 5CREA 1R4WA 4XRAA 2H1GA 1GULA 1GSSA 1YZXA 5D93A 2LQOA 1XOAA 2EFHA 1RW1A 4WXTA 3WT2A 4OFMA 3Q19A 3MAKA 3A5IA 3UOMA 3VWUA 1FB0A 2RLIA 4MDCA 3C8EA 3TJKA 6GSVA 4GQCA 4POMA 3HJPA 2YCDA 2GSTA 2G2QA 3P7XA 4ECIA 4TR4A 3MYDA 4I2UA 5J41A 3CXGA 2YNXA 4CY8A 2EC4A 2B5EA 2IFQB 1FHEA 4X0XA 3TDGA 3FK8A 2M80A 3HXSA 2ON7A 2XPDA 4V1Ap 5ECKB 3DD3A 4YQMA 1XWBA 1OKDA 2WB9A 4LMVA 2MMZA 3TOTA 3TRPA 4DVCA 2EIOA 2KLXA 2ALBA 3QMXA 1XWAA 3C1SA 2OE3A 1S3AA 3KM6A 3MWHA 3ZYWA 1ZYEA 4X1UA 1EWXA 3LXTA 2H0HA 4ZXGA 2K18A 3KJYA 3TKPA 5DALA 2YJHA 5HR2A 3A5WA 17GSA 4YQVA 2NTOA 2E2GA 3IHGA 2C3QA 1WJKA 2AV4A 3QCPA 2FNOA 3A2WA 1Q4JA 2A4VA 3VPTA 1OE8A 5KOWA 5EVOA 2CA8A 2H30A 3PH9A 3W8JA 1OKTA 4OFTA 1GSQA 3DRNA 3TRQA 1MD3A 2YV7A 4TXOA 1PSQA 1X5EA 3HZ8A 2X8HA 4O7HA 3RAZA 5BMUA 2X8GA 1GSFA 2JSYA 2H72A 1H75A 4P3YB 3E9JB 4HS1A 4J56E 3DYRA 4N11A 4AJ7A 4I5QA 2XBQA 3KTLA 1EOGA 2H73A 2LRCA 1DUGA 4K0GA 4N10A 1FVJA 2DIZA 1GSYA 3H79A 1PN0A 2VCVA 6GSWA 2V32A 3GH9A 5H5QA 5GAPD 3IHQA 3H4KA 2HZEA 3I9V2 2GT5A 3ME8A 4DSSB 3GA4A 4ECJA 4FYBA 4JBBA 4PQHA 1EOHA 4K0NA 1B9YC 2RM5A 3UARA 6GSYA 3F4TA 3F63A 4QMKA 1A24A 1GTIA 3KMOA 2IMFA 4MPGA 1Y25A 3D21A 4PNFA 2BJXA 1EEMA 2DMMA 4POLA 1THOA 3UAPA 1B9XC 4NWYA 2LNTA 1XW9A 3LEFA 3ERGA 3TJBA 2OE0A 1AIUA 4TW5A 4HZ4A 5DCGA 4K8MA 3IR4A 1M7TA 1E2YA 3IAS2 2IFQA 4HI7A 3D4TA 1NHYA 2DJ3A 5A4UA 4BWQA 1SVLA 1Y6EA 4ACSA 3VFIA 1U87A 3TU3B 4N0VA 1WIKA 2RUEA 4BL7B 1Z7PA 2HYXA 3ISOA 2C8UA 1V58A 2GZZA 3EYTA 9GSSA 4JZQA 5IO2A 1SD8A 3GL5A 3FYGA 1Z5YE 2YWNA 2FGXA 1T8EB 4OD7A 2MMAA 4J57E 4YKGA 3GH6A 4HU9A 1B48A 1OE7A 2C4JA 2MMNA 4F03A 1F3BA 1R5AA 4W66A 1TRSA 3E0UA 2QSIA 1PX7A 1Y1UA 4TOPA 4CY6A 3LYPA 4KSOA 2O85A 1TRWA 1MD4A 3WGEA 3KCMA 3V1WA 2YZUA 1K3YA 5D8IA 3HJOA 4WKWA 1K0MA 2QGVA 1M0UA 5H5SA 3RHBA 2CV4A 4MF6A 1BG1A 2F8AA 1R26A 3NZNA 4XRDA 4BVXB 1XZOA 3VWXA 1OVNA 2XBIA 3EPTA 1SU9A 3CTFA 3A2VA 2VCTA 4MJEA 1SL0B 2V1MA 3LXZA 4K5SA 2VUPA 5DCHA 4PGTA 3IV4A 2JACA 2KP2A 3FMWA 2DJ2A 2HXKA 5J3RA 2O89A 4Z2TA 20GSA 4GLTA 4BVYB 3C7MA 3C1RA 4XTSA 3HD5A 2I9HA 2B5XA 2C80A 2KP1A 1XPVA 2EFDA 2H8LA 3DVXA 2IMEA 3VURA 2LJRA 3QAWA 1XXUA 2EFCA 2P0GA 2VD0A 4YH2A 1JZDA 11GSA 1J9BA 2L5LA 5HFIA 4DSSA 4DSRA 4WR5A 3TKSA 4ZL8A 4CDOA 1T7PB 5ELAA 4IJIA 1YKCA 4MP4A 3TRXA 4TR0A 2GQLA 3QAGA 1PGTA 2WCIA 2EIRA 3UBLA 3CBUA 4K7IA 2R3XA 5G30A 4OO4A 4K9ZA 2P31A 2CAQA 4F82A 3H93A 1KTEA 2PMTA 2VM1A 4AKIA 4RUVA 2F8FA 2FA8A 4TRXA 3SWLA 4EKZA 5IOXA 1X9SB 4FO5A 3ZIVA 1SKWB 5DAKB 1ZZYA 5A5KA 4ID0A 2DJJA 3EU4A 4JU5A 2YWMA 2PN8A 4EVMA 5ENUA 1F9MA 1B4QA 1MTCA 5JCWA 4OCFA 3DEXA 4BL7A 1DBYA 5F06A 2E2MA 3VLNA 3GHAA 3RDWA 5LNKe 1K3OA 3GTUB 1M99A 2HRKB 2WFCA 4IHUA 1UA5A 1A2JA 1F37A 3EVIA 5CRWA 3ERFA 1O81A 4O32A 3DKSA 3VI7A 5KN0A 2BMXA 3GSTA 4DSQA 4TXVA 1QGVA 2LJKA 1SENA 3HVVA 3U6VA 4HDEA 2WJUA 1EGOA 4IKHA 2B5YA 2C0EA 2GS3A 3CRUA 2J9HA 2MBSA 4WF4A 4AKGA 3HDCA 5ABRA 3IC4A 3TOUA 1HYUA 5D9TA 4GSSA 4E8EA 4POKA 1YY7A 3FR9A 2VM2A 1K0OA 1THXA 4JEDA 4KH7A 4TXOB 1NHOA 5ID2B 5D96A 3H8QA 2DKHA 4AF2A 3IE3A 3F6DA 4AI6A 4BVYA 4FIWA 5DVBA 4KE3A 5B6MA 4OFNA 2H1BA 4XS1A 4PQIA 1T4YA 5ECSA 3W8SA 2P5QA 3VWWA 5A1NA 4NXIA 2AB6A 4KA0A 2L57A 2LS5A 4MK3A 2E7PA 3KD0A 3D4MA 1BAYA 3GYKA 4MZCA 5DQYA 5GSSA 5GAND 2IPAA 3C71A 3G9BA 1SL2B 1SKSB 3TJJA 3GX0A 1SJIA 1FOHA 3U5RE 1VRSD 3QFBC 2H1AA 1K0AA 5LCZA 3D0ZA 1EZKA 1MDJA 3KIJA 2DIYA 2DC5A 4GSNA 2IJYA 2REMA 2N5AA 1B8XA 3ZMKA 2R0PA 3D22A 4TKYA 4IN0A 2R37A 3N5OA 1G0TA 3ME7A 1A2LA 2Z9SA 5B8AA 3L0HA 4J2FA 1OAZA 3RPPA 4GDFA 4KF9A 5KN1A 2WULA 1GLQA 2OADA 2A2RA 3IK9A 1FOVA 1ZYQB 1UVZA 5DAKA 1GL8A 4HQZA 4IJ3A 3QDNA 2PU9C 4A5PA 3EE2A 1SK2A 3GFKA 1AAZA 1HNAA 4ZILA 5CP1A 4EDZA 5INYA 1GP1A 4OO5A 1BG5A 3LGCA 2QKEA 3TKQA 5CRGA 4V1Ag 4ZB6A 1SVMA 1XCCA 2PERA 3ZIJA 2FUG2 2HSYA 5ECIB 5A4VA 2TIRA 4KSMA 3GTUA 2HRKA 2M72A 3CYNA 4MH2A 4ISDA 4WEYA 2KOKA 3KH7A 2CT6A 4WBRD 4FQUA 1XW6A 1V40A 3FEUA 4GF0A 3DWVA 3O3TA 3KTBA 5KN2A 2HQTA 1IYIA 3L9VA 2HE3A 4OCEA 4ZBAA 2C0FA 4O5QA 1GUHA 4EIQA 1YF1A 1TXXA 13GSA 2HRAA 4TN8A 3UL3A 1I9DA 2H71A 2GT6A 3TB2A 4ECBA 1ABAA 4JR4A 2B6MA 4EE0A 4ZL7A 4IP6A 3EINA 3LFLA 1G7OA 1NW2A 2CX4A 6GSTA 1QMVA 1G6WA 3UVTA 1T1VA 3APSA 5GZZB 1Z9HA 2WRTA 5ID2A 3K8NA 2GSQA 2L4CA 5ECHB 4AJ6A 5ECRB 2V6OA 1DE2A 5ECOB 4HZ2A 1V2AA 2AAWA 2YP6A 3GURA 3G7IA 1ERUA 3BOAA 4KUNA 1U6TA 2E0QA 1Q98A 2V2GA 1E6BA 3FZ5A 4NHWA 4QL7A 4PQ1A 2IMKA 4K7OA 4N0ZA 1GRXA 5J47A 1EV9A 3WT1A 4K1FA 4X43A 2EFEA 2IN3A 2LJAA 2LEGA 3ZRDA 4MA9A 1SL1B 1A0RP 4MLYA 4LA1A 2R6KA 3F3QA 2LNSA 5HR1A 5G5FA 2K9FA 1QQ2A 2OBIA 3MSZA 1X5DA 2QA1A 1ACVA 1VF1A 2KUCA 3KMNA 1MDKA 5ECPB 2IL3A 2FWEA 1HD2A 1SJ6A 4HOJA 1G6YA 2O8VB 5F0GA 2CX3A 5AN1A 4KCAA 3G7YA 2GSSA 4MCUA 1A2MA 1ILOA 3I69A 4ZBBA 2H6XA 3FY7A 2GQMA 1QUWA 3GKMA 4X4JA 4RQXA 3QAVA 2X8CA 3IC8A 4GTUA 3N9JA 2R0CA 2NVLA 3H1NA 2AHEA 4I6XA 1YDKA 3ZL5A 1OC8A 3QOUA 1BJXA 5HFKA 2B7KA 3SBCA 4IS0A 1AQXA 2F3MA 5DDLA 1O7UA 4L8EA 1ML6A 1V9WA 3D6IA 2CAIA 3GRXA 4WR4A 2TRCP 1OYJA 1ZYPA 1GTUA 4NV2A 5AIVA 4L0UA 4MPFA 3MIXA 3M0FA 2ES7A 4PX1A 5G5EA 3HA9A 3UJ1A 2HRFA 2DJ0A 3UEMA 1PMTA 5D9VA 2CVBA 3RBTA 4FYCA 3QD9A 3M3MA 4JE1A 7GSSA 1T4ZA 2JZTA 3AY8A 3FW2A 3PINA 2VCXA 4MF5A 5AISA 2L59A 2DMLA 4ZIJA 4GWRA 1EGRA 3GIXA 4L5OA 3GMFA 4NAXA 4K7NA 1VGLA 2AUVA 8GSSA 1TU8A 1YKAA 1ERWA 1TP9A 4HU7A 3L9SA 1O85A 4G01A 5JWRB 2PVQA 2OT3A 2OKAA 3WGXA 1OC9B 2DLXA 1JZWA 5A4WA 4CW9A 1JLVA 3UIWA 3HHVA 2MBTA 3QR6A 1PD21 3GN3A 3OR5A 3UMAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WD6 A;  4ECC A;  2NPB A;  4D73 B;  1ZGN A;  2FLS A;  1KEB A;  2YN1 A;  5JCG A;  1PA3 A;  2GGT A;  1FB6 A;  1UN2 A;  1M2A A;  2L6C A;  3LJR A;  4V2N A;  2VL9 A;  2OAC A;  2HSM B;  2H74 A;  1T3B A;  3FZA A;  3S9F A;  3RPN A;  4BPY A;  4PUR A;  4RQR A;  4LMW A;  4G0I A;  2GDR A;  3I6A A;  2RII A;  2K6V A;  5L71 A;  3FRC A;  4LLR A;  3IK7 A;  1J08 A;  4KCE A;  1WE0 A;  2GZP A;  4ZB8 A;  4JRR A;  2B1L A;  4K2D A;  1TI1 A;  1FG4 A;  2JL4 A;  3LSZ A;  3DVW A;  3W6G A;  4Q5Q A;  3DIE A;  4ILF A;  2WDU A;  4HJM A;  3ZZX A;  5FWG A;  1TK0 B;  1W89 A;  4RI6 A;  1JZO A;  1PQN A;  4NMU A;  1TRU A;  3KH9 A;  3LWA A;  4G0L A;  3F8U A;  2ON5 A;  3APQ A;  1CQG A;  1AQW A;  2YJ7 A;  4LL4 B;  3EC3 A;  1M9A A;  1MDI A;  1O8W A;  18GS A;  2OJL A;  5IMF A;  1O73 A;  5IM9 A;  1RK4 A;  1XOB A;  1LJR A;  1XW5 A;  3ED3 A;  4DEJ A;  3TJG A;  2AYT A;  4KND A;  3HKR A;  1WPI A;  3MNG A;  2MYG A;  4WBJ A;  2OBK A;  2YV9 A;  1UC7 A;  2N5B A;  5GST A;  2R2J A;  1VF2 A;  2H76 A;  6GSS A;  1R7H A;  2IMD A;  4PUA A;  3GL3 A;  3GUS A;  4Q5R A;  3IBH A;  2TRX A;  2JSZ A;  2X64 A;  3LYK A;  1DE1 A;  3HY2 A;  2PWJ A;  2HFD A;  1HNB A;  1GSE A;  1USB A;  2MMO A;  5IMV A;  4ZL9 A;  1TKD B;  3LG6 A;  1AC1 A;  2HRN A;  3IRA A;  4V2M A;  1AXD A;  1BX9 A;  1TTZ A;  1OC9 A;  3M9K A;  4MJA A;  3QPM A;  5IO0 A;  3EUR A;  2MZC A;  2N5F A;  4G10 A;  4YAP A;  3EU3 A;  5AIX A;  1TK8 B;  4YAV A;  2J23 A;  3IAM 2;  1SYX A;  1U3A A;  4D73 A;  2FCH A;  1ST9 A;  2XPE A;  2HSH A;  2B7J A;  2JU5 A;  2LUS A;  5HFG A;  2HSM A;  2DJ1 A;  4IW9 A;  2GVP A;  2V6K A;  1FVK A;  4V2L A;  5J9C A;  1TRV A;  3I43 A;  1S3C A;  1K0N A;  4NV5 A;  5JWO B;  3D5J A;  1SJZ A;  3EWL A;  1GWC A;  1GLP A;  3IDV A;  1DSB A;  4BA7 A;  5D73 A;  1BYE A;  5B8B A;  4BWS A;  19GS A;  4E8H A;  4PNG A;  3HCZ A;  3HJM A;  2C3N A;  3E3E A;  2RUF A;  3HZ4 A;  3KGK A;  1A0F A;  5H5R A;  5EL8 A;  5ELG A;  3FHK A;  2UZ8 A;  3BJ5 A;  3GSS A;  1U3I A;  5IMA A;  3CMI A;  4NHZ A;  4G2E A;  4KW6 A;  2OA7 A;  4F0C A;  2GTU A;  3IA1 A;  5J4U A;  1TJD A;  1WP0 A;  2K8V A;  2L4Q A;  3LOR A;  1K0B A;  3ERW A;  4MMM A;  4HUA A;  5IOW A;  4MZW A;  2R4V A;  4HJ2 A;  1NSW A;  1C72 A;  1S3D A;  1ZOF A;  1FW1 A;  3GKK A;  4KDY A;  4POB A;  2VLU A;  2I1U A;  1XWG A;  2H01 A;  1JLW A;  5CYY A;  3DML A;  4AJ8 A;  2VLV A;  1KBN A;  1SYR A;  3FZ4 A;  2V41 A;  1X5C A;  3NIV A;  2PGT A;  2PPT A;  5IMD A;  1GTA A;  3BBY A;  6GSX A;  1GNW A;  1M2B A;  3A3T A;  3TKR A;  1AQV A;  4OMV A;  1QXH A;  2H1D A;  2JZR A;  3UVH A;  4CHS A;  2VL2 C;  1LU4 A;  2CZ2 A;  2LRT A;  2C0G A;  5EY6 A;  2HI7 A;  2LTK A;  3IOS A;  1NM3 A;  2JAD A;  3BCK A;  3M9J A;  1SK0 A;  4G9H A;  3CTG A;  2C3T A;  3EMX A;  2H19 A;  3TGZ A;  1X9W B;  2PBJ A;  1ERT A;  1XVQ A;  5F05 A;  2HSN B;  3VPQ A;  1MEK A;  3F4S A;  2K8S A;  1GTB A;  3CSI A;  1PKZ A;  2WGR A;  4ML6 A;  2FD3 A;  2CVK A;  3P8W A;  2WZ9 A;  2LKU A;  4MF7 A;  5KEJ A;  1H4O A;  2X99 A;  2KHP A;  4GQF A;  5COH A;  3F4R A;  2D2Z A;  3KP9 A;  4TR3 A;  3L9U A;  2GZY A;  4N30 A;  4JR6 A;  4KGI A;  1EEJ A;  1JHB A;  1GNE A;  4F9Z A;  3ZFL A;  3TKS E;  1K0C A;  5DJL A;  1Z6N A;  2G0F A;  4KB3 A;  2RM6 A;  2HNL A;  2DSA A;  1B4P A;  3L4N A;  2VL2 A;  5B7C A;  3FZ9 A;  1IYH A;  2F51 A;  3F0I A;  3M8N A;  2FWG A;  4FH8 A;  4TR1 B;  3P90 A;  4GXZ A;  1EV4 A;  1HQO A;  4EXJ A;  3Q74 A;  4I2T A;  3F6F A;  1O6J A;  1O8X A;  3ZRE A;  1U88 A;  4H86 A;  2VO4 A;  1A8L A;  1QFN A;  1JZR A;  3JCM L;  2NDO A;  4Q5F A;  1HNC A;  2GQK A;  2FA4 A;  1T00 A;  1N8J A;  4XIH A;  4LL1 B;  5IPH A;  3ZML A;  1WRY A;  2HZF A;  1XBS A;  2LRN A;  3IXR A;  5E59 A;  5G1L A;  1TW9 A;  3HVS A;  4QQ7 A;  3ZIT A;  4GRF A;  2YAN A;  4KDU A;  4O92 A;  2CVD A;  1URM A;  2I81 A;  2VLT A;  4GCI A;  3O6T A;  5E4W A;  2VL3 A;  1G7E A;  2PVO C;  2YWO A;  1X0R A;  4O5R A;  2B3S A;  4XS6 A;  1N2A A;  4F2I A;  2H0G A;  4G19 A;  5IQY A;  1A8Y A;  3US3 A;  5FT3 A;  1F2E A;  3GNJ A;  1WMJ A;  3KEB A;  3HVX A;  2XHF A;  2H70 A;  2PUK C;  4IVF A;  1OC3 A;  3FR6 A;  1J0F A;  1GSD A;  5DJM A;  2IWT A;  3ZFB A;  1I5G A;  12GS A;  3KXO A;  5J9B A;  4XHM A;  3PPU A;  2FY6 A;  3F9U A;  3G7J A;  2F9S A;  5HQP A;  2M46 A;  1XFL A;  2JZS A;  1RQM A;  4EF0 A;  4AGS A;  1SK1 A;  3VK9 A;  1EP7 A;  1TOF A;  4Z7X A;  4PTS A;  1M9B A;  2H66 A;  4KDX A;  4RI7 A;  1KNG A;  1YEX A;  2DBC A;  3HYP A;  3VI5 A;  3GX8 A;  2FWH A;  14GS A;  2OE1 A;  3TJF A;  1FO5 A;  2EIQ A;  2YPM A;  4I97 A;  4IGJ A;  5G1K A;  5ECL B;  4GST A;  4EC0 A;  3M1G A;  1PX6 A;  5FHI A;  1PL1 A;  3TKS C;  3GKN A;  5ECM B;  5C04 A;  4I8B A;  2H6Y A;  5CRD A;  2CZ3 A;  2HLS A;  4XS4 B;  1VF3 A;  1SD9 A;  2CQ9 A;  3F3R A;  1Z7R A;  2LQQ A;  3ZTL A;  1PN9 A;  2VOC A;  1W4V A;  4OWY A;  2LV3 A;  2VAF A;  4WET A;  4TR1 A;  3MDK A;  10GS A;  2IMI A;  1CQH A;  2LST A;  4F0B A;  5C00 A;  2ZUP A;  4HEA 2;  2B1K A;  2ZNM A;  1ZCP A;  4IP1 A;  5D9W A;  1GUK A;  1TK5 B;  1ZL9 A;  1TU7 A;  1VF4 A;  5DBQ A;  5IMZ A;  1YQ1 A;  2C0D A;  5CAX A;  4EO3 A;  1PKW A;  1YF0 A;  4NPB A;  4FYU A;  2AJQ B;  5CRH A;  2R5G A;  3L78 A;  1BED A;  3Q18 A;  2GSR A;  3DXB A;  5KN3 A;  2L6D A;  4MH3 A;  1BQ7 A;  2VCZ A;  2O87 A;  1V98 A;  1FAA A;  1WWJ A;  1PL2 A;  4USS A;  3ZLP A;  3RHC A;  5ECQ B;  4IBP A;  1F6M C;  4XCS A;  4PUF C;  3GKX A;  2H6Z A;  4G0K A;  5AGY A;  4Q5N A;  2L5O A;  3KP8 A;  3O76 A;  3TUE A;  4EDY A;  2BTO T;  1ZMA A;  3WYW A;  1AW9 A;  3GV1 A;  1R5P A;  2HT9 A;  2P5R A;  1XIY A;  3PGT A;  2A2S A;  5F8B A;  2O7K A;  6GSU A;  4ZB9 A;  4EUY A;  2NBS A;  4WF5 A;  1Z6M A;  5JWQ B;  1V57 A;  5D9X A;  5HR0 A;  3NOF A;  1LBK A;  1ON4 A;  2H75 A;  5G31 A;  1EP8 A;  4QL9 A;  2VD1 A;  1TI3 A;  4YQU A;  3P2A A;  5CO3 A;  3FR3 A;  1GSU A;  1SKR B;  1A23 A;  3R2Q A;  3APO A;  3KZQ A;  2QC7 A;  2YWI A;  1YJ6 A;  5J5N A;  16GS A;  4KX4 A;  1WOU A;  3CSJ A;  3CRT A;  2I4A A;  1ERV A;  2XC2 A;  1XVW A;  2DJK A;  2FHE A;  4MJB A;  4ZBD A;  4IQA A;  4HQS A;  1M2D A;  2C1Y A;  3IPZ A;  5DAL B;  2FWF A;  1GH2 A;  5ECN B;  2VIM A;  5F07 A;  4MAB A;  2H0I A;  4XS4 A;  4KAE A;  2YOI A;  4BVX A;  3R3E A;  3FKF A;  5IIZ A;  2I3Y A;  2ZCT A;  1AUC A;  5JCU A;  3DGQ A;  1XWC A;  5B6N A;  2IIY A;  2YZH A;  4L5L A;  5IMC A;  3J7Y b;  5HR3 A;  1K0D A;  3BCI A;  4IEL A;  5EPF A;  4ML1 A;  2VCQ A;  5DQS A;  4K6X A;  1X9M B;  3LQ7 A;  2WS2 A;  4L0W A;  1QK8 A;  3ZVJ D;  3A2X A;  1Z3E A;  2VCW A;  4EL1 A;  4ULX A;  4IQ1 A;  1TDI A;  3ZVJ A;  2GLR A;  1XWK A;  3PR8 A;  3VWV A;  3TCO A;  3WGD A;  22GS A;  1PRX A;  1YEP A;  5CNW A;  5IPG A;  4MZB A;  4TVE A;  1GUM A;  3J7Y k;  3UBK A;  1JFU A;  5G2Z A;  3QFA C;  1F3A A;  5LD0 A;  1K3L A;  3EMP A;  4MJC A;  3CSH A;  2HZE B;  3Q6O A;  4PXO A;  3C73 A;  3BD2 A;  5CRE A;  1R4W A;  4XRA A;  2H1G A;  1GUL A;  1GSS A;  1YZX A;  5D93 A;  2LQO A;  1XOA A;  1RW1 A;  4WXT A;  3WT2 A;  4OFM A;  3Q19 A;  3MAK A;  3UOM A;  3VWU A;  1FB0 A;  2RLI A;  4MDC A;  3C8E A;  3TJK A;  6GSV A;  4GQC A;  4POM A;  3HJP A;  2YCD A;  2GST A;  2G2Q A;  3P7X A;  4ECI A;  4TR4 A;  4I2U A;  5J41 A;  3CXG A;  2YNX A;  2EC4 A;  2B5E A;  2IFQ B;  1FHE A;  4X0X A;  3TDG A;  3FK8 A;  2M80 A;  3HXS A;  2ON7 A;  2XPD A;  4V1A p;  5ECK B;  3DD3 A;  4YQM A;  1XWB A;  1OKD A;  2WB9 A;  4LMV A;  2MMZ A;  3TOT A;  3TRP A;  4DVC A;  2EIO A;  2KLX A;  2ALB A;  3QMX A;  1XWA A;  3C1S A;  2OE3 A;  1S3A A;  3KM6 A;  3MWH A;  3ZYW A;  1ZYE A;  4X1U A;  1EWX A;  3LXT A;  2H0H A;  4ZXG A;  2K18 A;  3KJY A;  3TKP A;  5DAL A;  2YJH A;  5HR2 A;  3A5W A;  17GS A;  4YQV A;  2NTO A;  2E2G A;  2C3Q A;  1WJK A;  2AV4 A;  3QCP A;  2FNO A;  3A2W A;  1Q4J A;  2A4V A;  3VPT A;  1OE8 A;  5EVO A;  2CA8 A;  2H30 A;  3PH9 A;  3W8J A;  1OKT A;  4OFT A;  1GSQ A;  3DRN A;  3TRQ A;  1MD3 A;  2YV7 A;  4TXO A;  1PSQ A;  1X5E A;  3HZ8 A;  2X8H A;  4O7H A;  3RAZ A;  5BMU A;  2X8G A;  1GSF A;  2JSY A;  2H72 A;  1H75 A;  4P3Y B;  3E9J B;  4HS1 A;  4J56 E;  3DYR A;  4N11 A;  4AJ7 A;  4I5Q A;  2XBQ A;  3KTL A;  1EOG A;  2H73 A;  2LRC A;  1DUG A;  4K0G A;  4N10 A;  1FVJ A;  2DIZ A;  1GSY A;  3H79 A;  2VCV A;  6GSW A;  2V32 A;  3GH9 A;  5H5Q A;  5GAP D;  3IHQ A;  3H4K A;  2HZE A;  3I9V 2;  2GT5 A;  3ME8 A;  4DSS B;  3GA4 A;  4ECJ A;  4FYB A;  4JBB A;  4PQH A;  1EOH A;  4K0N A;  1B9Y C;  2RM5 A;  3UAR A;  6GSY A;  3F4T A;  3F63 A;  1A24 A;  1GTI A;  3KMO A;  2IMF A;  4MPG A;  1Y25 A;  3D21 A;  4PNF A;  2BJX A;  1EEM A;  2DMM A;  4POL A;  1THO A;  3UAP A;  1B9X C;  4NWY A;  2LNT A;  1XW9 A;  3LEF A;  3ERG A;  3TJB A;  2OE0 A;  1AIU A;  4TW5 A;  4HZ4 A;  5DCG A;  4K8M A;  3IR4 A;  1M7T A;  1E2Y A;  3IAS 2;  2IFQ A;  4HI7 A;  3D4T A;  1NHY A;  2DJ3 A;  5A4U A;  4BWQ A;  1Y6E A;  4ACS A;  3VFI A;  1U87 A;  4N0V A;  1WIK A;  2RUE A;  4BL7 B;  1Z7P A;  2HYX A;  3ISO A;  2C8U A;  1V58 A;  2GZZ A;  3EYT A;  9GSS A;  4JZQ A;  5IO2 A;  1SD8 A;  3GL5 A;  3FYG A;  1Z5Y E;  2YWN A;  2FGX A;  1T8E B;  4OD7 A;  2MMA A;  4J57 E;  3GH6 A;  4HU9 A;  1B48 A;  1OE7 A;  2C4J A;  2MMN A;  4F03 A;  1F3B A;  1R5A A;  1TRS A;  3E0U A;  2QSI A;  1PX7 A;  4TOP A;  3LYP A;  4KSO A;  2O85 A;  1TRW A;  1MD4 A;  3WGE A;  3KCM A;  3V1W A;  2YZU A;  1K3Y A;  5D8I A;  3HJO A;  4WKW A;  1K0M A;  2QGV A;  1M0U A;  5H5S A;  3RHB A;  2CV4 A;  4MF6 A;  2F8A A;  1R26 A;  3NZN A;  4XRD A;  4BVX B;  1XZO A;  3VWX A;  1OVN A;  2XBI A;  1SU9 A;  3CTF A;  3A2V A;  2VCT A;  4MJE A;  1SL0 B;  2V1M A;  3LXZ A;  2VUP A;  5DCH A;  4PGT A;  3IV4 A;  2JAC A;  2KP2 A;  2DJ2 A;  2HXK A;  5J3R A;  2O89 A;  20GS A;  4GLT A;  4BVY B;  3C7M A;  3C1R A;  4XTS A;  3HD5 A;  2I9H A;  2B5X A;  2C80 A;  2KP1 A;  1XPV A;  2H8L A;  3DVX A;  2IME A;  3VUR A;  2LJR A;  3QAW A;  1XXU A;  2P0G A;  2VD0 A;  4YH2 A;  1JZD A;  11GS A;  1J9B A;  2L5L A;  5HFI A;  4DSS A;  4DSR A;  4WR5 A;  3TKS A;  4ZL8 A;  4CDO A;  1T7P B;  5ELA A;  4IJI A;  1YKC A;  4MP4 A;  3TRX A;  4TR0 A;  2GQL A;  3QAG A;  1PGT A;  2WCI A;  2EIR A;  3UBL A;  3CBU A;  4K7I A;  2R3X A;  5G30 A;  4OO4 A;  4K9Z A;  2P31 A;  2CAQ A;  4F82 A;  3H93 A;  1KTE A;  2PMT A;  2VM1 A;  4RUV A;  2F8F A;  2FA8 A;  4TRX A;  3SWL A;  4EKZ A;  5IOX A;  1X9S B;  4FO5 A;  3ZIV A;  1SKW B;  5DAK B;  1ZZY A;  5A5K A;  4ID0 A;  2DJJ A;  3EU4 A;  4JU5 A;  2YWM A;  2PN8 A;  4EVM A;  5ENU A;  1F9M A;  1B4Q A;  1MTC A;  5JCW A;  4OCF A;  3DEX A;  4BL7 A;  1DBY A;  5F06 A;  2E2M A;  3VLN A;  3GHA A;  3RDW A;  5LNK e;  1K3O A;  3GTU B;  1M99 A;  2HRK B;  2WFC A;  4IHU A;  1UA5 A;  1A2J A;  1F37 A;  3EVI A;  5CRW A;  3ERF A;  1O81 A;  4O32 A;  3DKS A;  3VI7 A;  5KN0 A;  2BMX A;  3GST A;  4DSQ A;  4TXV A;  1QGV A;  2LJK A;  1SEN A;  3HVV A;  3U6V A;  4HDE A;  2WJU A;  1EGO A;  4IKH A;  2B5Y A;  2C0E A;  2GS3 A;  3CRU A;  2J9H A;  2MBS A;  4WF4 A;  3HDC A;  5ABR A;  3IC4 A;  3TOU A;  1HYU A;  5D9T A;  4GSS A;  4E8E A;  4POK A;  1YY7 A;  3FR9 A;  2VM2 A;  1K0O A;  1THX A;  4JED A;  4KH7 A;  4TXO B;  1NHO A;  5ID2 B;  5D96 A;  3H8Q A;  4AF2 A;  3IE3 A;  3F6D A;  4FIW A;  4BVY A;  5DVB A;  5B6M A;  4KE3 A;  4OFN A;  2H1B A;  4XS1 A;  4PQI A;  1T4Y A;  5ECS A;  3W8S A;  2P5Q A;  3VWW A;  4NXI A;  2AB6 A;  4KA0 A;  2L57 A;  2LS5 A;  4MK3 A;  2E7P A;  3KD0 A;  3D4M A;  1BAY A;  3GYK A;  4MZC A;  5DQY A;  5GSS A;  5GAN D;  2IPA A;  3C71 A;  3G9B A;  1SL2 B;  1SKS B;  3TJJ A;  3GX0 A;  1SJI A;  3U5R E;  1VRS D;  3QFB C;  2H1A A;  1K0A A;  5LCZ A;  3D0Z A;  1EZK A;  1MDJ A;  3KIJ A;  2DIY A;  2DC5 A;  4GSN A;  2IJY A;  2N5A A;  1B8X A;  2REM A;  3ZMK A;  3D22 A;  4TKY A;  4IN0 A;  2R37 A;  3N5O A;  1G0T A;  3ME7 A;  1A2L A;  2Z9S A;  5B8A A;  3L0H A;  4J2F A;  1OAZ A;  3RPP A;  4KF9 A;  5KN1 A;  2WUL A;  1GLQ A;  2OAD A;  2A2R A;  3IK9 A;  1FOV A;  1ZYQ B;  1UVZ A;  5DAK A;  1GL8 A;  4HQZ A;  4IJ3 A;  3QDN A;  2PU9 C;  3EE2 A;  1SK2 A;  3GFK A;  1AAZ A;  1HNA A;  4ZIL A;  5CP1 A;  4EDZ A;  5INY A;  1GP1 A;  4OO5 A;  1BG5 A;  3LGC A;  2QKE A;  3TKQ A;  5CRG A;  4V1A g;  4ZB6 A;  1XCC A;  2PER A;  3ZIJ A;  2FUG 2;  2HSY A;  5ECI B;  5A4V A;  2TIR A;  4KSM A;  3GTU A;  2HRK A;  2M72 A;  3CYN A;  4MH2 A;  4ISD A;  4WEY A;  2KOK A;  3KH7 A;  2CT6 A;  4WBR D;  4FQU A;  1XW6 A;  1V40 A;  3FEU A;  4GF0 A;  3DWV A;  3O3T A;  3KTB A;  5KN2 A;  2HQT A;  1IYI A;  3L9V A;  2HE3 A;  4OCE A;  4ZBA A;  2C0F A;  1GUH A;  1YF1 A;  1TXX A;  13GS A;  2HRA A;  4TN8 A;  3UL3 A;  1I9D A;  2H71 A;  2GT6 A;  3TB2 A;  4ECB A;  1ABA A;  4JR4 A;  2B6M A;  4EE0 A;  4ZL7 A;  4IP6 A;  3EIN A;  3LFL A;  1G7O A;  1NW2 A;  2CX4 A;  6GST A;  1QMV A;  1G6W A;  3UVT A;  1T1V A;  3APS A;  5GZZ B;  1Z9H A;  2WRT A;  5ID2 A;  3K8N A;  2GSQ A;  2L4C A;  5ECH B;  4AJ6 A;  5ECR B;  2V6O A;  1DE2 A;  5ECO B;  4HZ2 A;  1V2A A;  2AAW A;  2YP6 A;  3GUR A;  3G7I A;  1ERU A;  3BOA A;  4KUN A;  1U6T A;  2E0Q A;  1Q98 A;  2V2G A;  1E6B A;  3FZ5 A;  4NHW A;  4QL7 A;  4PQ1 A;  2IMK A;  4K7O A;  4N0Z A;  1GRX A;  1EV9 A;  3WT1 A;  4K1F A;  4X43 A;  2IN3 A;  2LJA A;  2LEG A;  3ZRD A;  4MA9 A;  1SL1 B;  1A0R P;  4MLY A;  4LA1 A;  2R6K A;  3F3Q A;  2LNS A;  5HR1 A;  5G5F A;  2K9F A;  1QQ2 A;  2OBI A;  3MSZ A;  1X5D A;  1ACV A;  1VF1 A;  2KUC A;  3KMN A;  1MDK A;  5ECP B;  2IL3 A;  2FWE A;  1HD2 A;  1SJ6 A;  4HOJ A;  1G6Y A;  2O8V B;  5F0G A;  2CX3 A;  5AN1 A;  4KCA A;  3G7Y A;  2GSS A;  4MCU A;  1A2M A;  1ILO A;  3I69 A;  4ZBB A;  2H6X A;  3FY7 A;  2GQM A;  1QUW A;  3GKM A;  4RQX A;  3QAV A;  2X8C A;  3IC8 A;  4GTU A;  3N9J A;  2NVL A;  3H1N A;  2AHE A;  4I6X A;  1YDK A;  3ZL5 A;  1OC8 A;  3QOU A;  1BJX A;  5HFK A;  2B7K A;  3SBC A;  4IS0 A;  1AQX A;  2F3M A;  5DDL A;  1O7U A;  4L8E A;  1ML6 A;  1V9W A;  3D6I A;  2CAI A;  3GRX A;  4WR4 A;  2TRC P;  1OYJ A;  1GTU A;  4NV2 A;  5AIV A;  4L0U A;  4MPF A;  3M0F A;  2ES7 A;  4PX1 A;  5G5E A;  3HA9 A;  3UJ1 A;  2HRF A;  2DJ0 A;  3UEM A;  1PMT A;  5D9V A;  2CVB A;  3RBT A;  4FYC A;  3QD9 A;  3M3M A;  4JE1 A;  7GSS A;  1T4Z A;  2JZT A;  3AY8 A;  3FW2 A;  3PIN A;  2VCX A;  4MF5 A;  5AIS A;  2L59 A;  2DML A;  4ZIJ A;  4GWR A;  1EGR A;  3GIX A;  4L5O A;  3GMF A;  4NAX A;  4K7N A;  1VGL A;  2AUV A;  8GSS A;  1TU8 A;  1YKA A;  1ERW A;  1TP9 A;  4HU7 A;  3L9S A;  1O85 A;  5JWR B;  2PVQ A;  2OKA A;  3WGX A;  1OC9 B;  2DLX A;  1JZW A;  5A4W A;  4CW9 A;  1JLV A;  3UIW A;  3HHV A;  2MBT A;  3QR6 A;  1PD2 1;  3GN3 A;  3OR5 A;  3UMA A; 
#chains in the Genus database with same CATH topology
 3WD6 A;  4ECC A;  2NPB A;  4D73 B;  1ZGN A;  2FLS A;  1KEB A;  5A1N B;  2YN1 A;  5JCG A;  4PI2 C;  1PA3 A;  2GGT A;  1FB6 A;  1UN2 A;  1M2A A;  2L6C A;  3LJR A;  4V2N A;  2VL9 A;  2OAC A;  2HSM B;  2H74 A;  1T3B A;  3FZA A;  3S9F A;  3RPN A;  1PFO A;  4Z2R A;  4BPY A;  4PUR A;  4RQR A;  4LMW A;  4G0I A;  2GDR A;  3I6A A;  2RII A;  2K6V A;  5L71 A;  3FRC A;  4LLR A;  3IK7 A;  4AKX B;  1J08 A;  4KCE A;  1WE0 A;  2GZP A;  4ZB8 A;  4JRR A;  1N25 A;  2B1L A;  4K2D A;  1TI1 A;  1FG4 A;  2JL4 A;  3LSZ A;  3DVW A;  3W6G A;  4Q5Q A;  3DIE A;  4ILF A;  2WDU A;  4HJM A;  3ZZX A;  5FWG A;  2UV8 G;  1TK0 B;  2O5V A;  1W89 A;  4RI6 A;  1JZO A;  1PQN A;  4NMU A;  1TRU A;  3KH9 A;  3LWA A;  4G0L A;  4N3Z A;  3F8U A;  2ON5 A;  3APQ A;  1CQG A;  1AQW A;  2YJ7 A;  4LL4 B;  3EC3 A;  1M9A A;  1MDI A;  1O8W A;  18GS A;  2OJL A;  5IMF A;  1O73 A;  4YKF A;  5IM9 A;  1RK4 A;  1XOB A;  4BIK A;  1LJR A;  1XG8 A;  1XW5 A;  3ED3 A;  4DEJ A;  3TJG A;  4K2X A;  2AYT A;  4KND A;  3HKR A;  1WPI A;  3MNG A;  2MYG A;  4WBJ A;  2OBK A;  2YV9 A;  1UC7 A;  2N5B A;  5GST A;  2R2J A;  1VF2 A;  2H76 A;  6GSS A;  1R7H A;  2IMD A;  4PUA A;  3GL3 A;  3GUS A;  4Q5R A;  3IBH A;  2TRX A;  2JSZ A;  2X64 A;  3LYK A;  1DE1 A;  3HY2 A;  2PWJ A;  2HFD A;  1HNB A;  1GSE A;  1USB A;  2MMO A;  5IMV A;  4ZL9 A;  1TKD B;  3LG6 A;  1AC1 A;  2HRN A;  3IRA A;  4V2M A;  1AXD A;  1YVL A;  1BX9 A;  1TTZ A;  1OC9 A;  3M9K A;  4MJA A;  3QPM A;  5IO0 A;  3EUR A;  2MZC A;  2N5F A;  4G10 A;  4YAP A;  3EU3 A;  5AIX A;  1TK8 B;  4YAV A;  2J23 A;  3IAM 2;  1SYX A;  1U3A A;  4D73 A;  2FCH A;  1ST9 A;  2WW3 A;  2XPE A;  2HSH A;  2B7J A;  2JU5 A;  2LUS A;  5HFG A;  2HSM A;  2DJ1 A;  4IW9 A;  2GVP A;  2V6K A;  1FVK A;  4V2L A;  5J9C A;  1TRV A;  2X4A A;  3I43 A;  1S3C A;  1K0N A;  4NV5 A;  5JWO B;  3D5J A;  1YEW C;  1SJZ A;  3EWL A;  1GWC A;  1GLP A;  3IDV A;  1DSB A;  4BA7 A;  5D73 A;  1BYE A;  5B8B A;  4BWS A;  19GS A;  4E8H A;  4PNG A;  3HCZ A;  3HJM A;  2C3N A;  3E3E A;  2RUF A;  3HZ4 A;  3KGK A;  1A0F A;  5H5R A;  5EL8 A;  5ELG A;  3FHK A;  2UZ8 A;  3BJ5 A;  2VKZ G;  3GSS A;  1U3I A;  5IMA A;  3CMI A;  4NHZ A;  4G2E A;  4KW6 A;  2WW2 A;  2OA7 A;  4F0C A;  2O3E A;  2GTU A;  4AKH A;  5J40 A;  3IA1 A;  5J4U A;  1TJD A;  1WP0 A;  2K8V A;  2L4Q A;  3LOR A;  3ERW A;  1K0B A;  4MMM A;  4HUA A;  5IOW A;  4MZW A;  2R4V A;  4HJ2 A;  1NSW A;  1C72 A;  1S3D A;  1ZOF A;  1FW1 A;  3GKK A;  4KDY A;  4POB A;  2VLU A;  2I1U A;  1XWG A;  2H01 A;  1JLW A;  5CYY A;  3DML A;  4AJ8 A;  2VLV A;  1KBN A;  1SYR A;  3FZ4 A;  2V41 A;  1X5C A;  3NIV A;  2PGT A;  2PPT A;  5IMD A;  1GTA A;  3BBY A;  6GSX A;  1GNW A;  1M2B A;  3A3T A;  3TKR A;  1AQV A;  4OMV A;  1QXH A;  2H1D A;  2JZR A;  3UVH A;  4CHS A;  2VL2 C;  1LU4 A;  2CZ2 A;  2LRT A;  2C0G A;  5EY6 A;  1M3J A;  2HI7 A;  2LTK A;  3IOS A;  1NM3 A;  4Z2U A;  1BF5 A;  2JAD A;  3BCK A;  3M9J A;  1SK0 A;  4G9H A;  3CTG A;  2C3T A;  3EMX A;  2H19 A;  3TGZ A;  1X9W B;  2PBJ A;  1ERT A;  1XVQ A;  5F05 A;  2HSN B;  3VPQ A;  1MEK A;  3F4S A;  2K8S A;  1GTB A;  3CSI A;  1PKZ A;  2WGR A;  4ML6 A;  2FD3 A;  2CVK A;  3P8W A;  2WZ9 A;  2LKU A;  4MF7 A;  5KEJ A;  1H4O A;  2X99 A;  2KHP A;  4GQF A;  4EIP A;  5COH A;  2DKI A;  3F4R A;  2D2Z A;  3KP9 A;  4TR3 A;  3L9U A;  2GZY A;  4N30 A;  4K5R A;  4JR6 A;  4KGI A;  1EEJ A;  1JHB A;  1GNE A;  4F9Z A;  3ZFL A;  3TKS E;  1K0C A;  5DJL A;  1Z6N A;  2G0F A;  4KB3 A;  2RM6 A;  2HNL A;  2DSA A;  1B4P A;  3L4N A;  2VL2 A;  5B7C A;  3FZ9 A;  1IYH A;  2F51 A;  3F0I A;  3M8N A;  2FWG A;  4FH8 A;  4TR1 B;  3P90 A;  4GXZ A;  1EV4 A;  1HQO A;  3CHX C;  4EXJ A;  3Q74 A;  4I2T A;  3F6F A;  1O6J A;  1O8X A;  3ZRE A;  1U88 A;  4H86 A;  2VO4 A;  1A8L A;  1QFN A;  5J4V A;  5A5H B;  1JZR A;  3JCM L;  2NDO A;  4Q5F A;  4O5U A;  1HNC A;  2GQK A;  2FA4 A;  1T00 A;  1N8J A;  4XIH A;  4LL1 B;  5IPH A;  3ZML A;  1WRY A;  2HZF A;  1XBS A;  2LRN A;  3IXR A;  5E59 A;  5G1L A;  1TW9 A;  3HVS A;  4QQ7 A;  3ZIT A;  4GRF A;  2YAN A;  4KDU A;  4O92 A;  2CVD A;  1URM A;  2I81 A;  2VLT A;  4GCI A;  3O6T A;  5E4W A;  2VL3 A;  1G7E A;  2PVO C;  2YWO A;  1X0R A;  4O5R A;  2B3S A;  4XS6 A;  1N2A A;  4F2I A;  2H0G A;  4G19 A;  5IQY A;  1A8Y A;  3US3 A;  5FT3 A;  1F2E A;  3GNJ A;  1WMJ A;  3KEB A;  3HVX A;  2XHF A;  2H70 A;  2PUK C;  4IVF A;  1OC3 A;  3FR6 A;  2A4H A;  1J0F A;  1GSD A;  5DJM A;  2IWT A;  3ZFB A;  1I5G A;  12GS A;  3KXO A;  5J9B A;  4XHM A;  3PPU A;  2FY6 A;  3F9U A;  3G7J A;  2F9S A;  5HQP A;  2M46 A;  1XFL A;  2JZS A;  1RQM A;  2WZS A;  4AGS A;  4EF0 A;  1SK1 A;  3VK9 A;  1EP7 A;  1TOF A;  4Z7X A;  4PTS A;  1M9B A;  2H66 A;  4KDX A;  4RI7 A;  1KNG A;  1YEX A;  2A2P A;  2DBC A;  3HYP A;  3VI5 A;  3GX8 A;  2FWH A;  14GS A;  2OE1 A;  2HSN A;  3TJF A;  1FO5 A;  2EIQ A;  2YPM A;  4I97 A;  4IGJ A;  5G1K A;  5ECL B;  4GST A;  4EC0 A;  3M1G A;  5J4Y A;  1PX6 A;  2X49 A;  5FHI A;  5A34 B;  1PL1 A;  3TKS C;  3GKN A;  5ECM B;  5C04 A;  4I8B A;  2H6Y A;  5CRD A;  2CZ3 A;  2HLS A;  4XS4 B;  4ZB7 A;  1VF3 A;  1SD9 A;  2CQ9 A;  3F3R A;  1Z7R A;  2LQQ A;  3ZTL A;  1PN9 A;  2VOC A;  1W4V A;  4OWY A;  2LV3 A;  2VAF A;  4WET A;  4TR1 A;  3MDK A;  10GS A;  2IMI A;  1CQH A;  2LST A;  4F0B A;  5C00 A;  3CWG A;  2ZUP A;  4HEA 2;  2B1K A;  5A5H A;  2ZNM A;  1ZCP A;  4IP1 A;  5D9W A;  1GUK A;  1TK5 B;  1ZL9 A;  1TU7 A;  1VF4 A;  5DBQ A;  5IMZ A;  1YQ1 A;  2C0D A;  5CAX A;  4EO3 A;  1PKW A;  1YF0 A;  4NPB A;  4FYU A;  2AJQ B;  5CRH A;  2R5G A;  3L78 A;  1BED A;  3Q18 A;  2GSR A;  3DXB A;  5KN3 A;  2L6D A;  4MH3 A;  3HVN A;  5KOX A;  5BRT A;  1BQ7 A;  2VCZ A;  2O87 A;  1V98 A;  1FAA A;  1WWJ A;  1PL2 A;  4USS A;  3ZLP A;  1S3R A;  3RHC A;  5ECQ B;  4IBP A;  1F6M C;  4ICY A;  4XCS A;  4PUF C;  3RGB C;  3GKX A;  2H6Z A;  1S4B P;  4G0K A;  5AGY A;  4Q5N A;  2L5O A;  3KP8 A;  3O76 A;  3RFR C;  2R0G A;  3TUE A;  4EDY A;  2BTO T;  1ZMA A;  3WYW A;  1AW9 A;  3GV1 A;  1R5P A;  2HT9 A;  2P5R A;  1XIY A;  3PGT A;  2A2S A;  5F8B A;  2O7K A;  6GSU A;  4ZB9 A;  4EUY A;  2NBS A;  4WF5 A;  1Z6M A;  5JWQ B;  1V57 A;  5D9X A;  5HR0 A;  3NOF A;  1LBK A;  1ON4 A;  2H75 A;  5G31 A;  1EP8 A;  4QL9 A;  2VD1 A;  1TI3 A;  4YQU A;  3P2A A;  5CO3 A;  3FR3 A;  1GSU A;  1SKR B;  1A23 A;  3R2Q A;  3APO A;  3KZQ A;  2QC7 A;  2YWI A;  1YJ6 A;  5J5N A;  16GS A;  4KX4 A;  1WOU A;  3CSJ A;  3CRT A;  2I4A A;  1ERV A;  2XC2 A;  1XVW A;  2DJK A;  2FHE A;  3LW9 A;  4MJB A;  4ZBD A;  4IQA A;  4HQS A;  1M2D A;  2C1Y A;  3IPZ A;  5DAL B;  2FWF A;  1GH2 A;  5ECN B;  2VIM A;  5F07 A;  5A34 A;  4MAB A;  2QA2 A;  2H0I A;  4XS4 A;  4KAE A;  2YOI A;  4BVX A;  3R3E A;  3FKF A;  5IIZ A;  2I3Y A;  2ZCT A;  1AUC A;  5JCU A;  3DGQ A;  1TXU A;  1XWC A;  5B6N A;  2IIY A;  2YZH A;  4L5L A;  5IMC A;  3J7Y b;  5HR3 A;  1K0D A;  3BCI A;  4IEL A;  5EPF A;  4ML1 A;  2O36 A;  2VCQ A;  5DQS A;  5BMU B;  2WVZ A;  3HMJ G;  4K6X A;  1X9M B;  3LQ7 A;  2WS2 A;  4L0W A;  1QK8 A;  3ZVJ D;  3A2X A;  1Z3E A;  2VCW A;  4EL1 A;  4ULX A;  4IQ1 A;  1TDI A;  3ZVJ A;  2GLR A;  1XWK A;  4MNN A;  3PR8 A;  3VWV A;  3TCO A;  3WGD A;  22GS A;  1PRX A;  1YEP A;  5CNW A;  5IPG A;  4PHZ C;  4MZB A;  4TVE A;  1GUM A;  3J7Y k;  3UBK A;  1JFU A;  5G2Z A;  2H1L A;  4E68 A;  3QFA C;  1F3A A;  1SVO A;  1K3L A;  5LD0 A;  3EMP A;  4MJC A;  1ZYN A;  3CSH A;  2HZE B;  3Q6O A;  4PXO A;  3C73 A;  3BD2 A;  5CRE A;  1R4W A;  4XRA A;  2H1G A;  1GUL A;  1GSS A;  1YZX A;  5D93 A;  2LQO A;  1XOA A;  2EFH A;  1RW1 A;  4WXT A;  3WT2 A;  4OFM A;  3Q19 A;  3MAK A;  3A5I A;  3UOM A;  3VWU A;  1FB0 A;  2RLI A;  4MDC A;  3C8E A;  3TJK A;  6GSV A;  4GQC A;  4POM A;  3HJP A;  2YCD A;  2GST A;  2G2Q A;  3P7X A;  4ECI A;  4TR4 A;  3MYD A;  4I2U A;  5J41 A;  3CXG A;  2YNX A;  4CY8 A;  2EC4 A;  2B5E A;  2IFQ B;  1FHE A;  4X0X A;  3TDG A;  3FK8 A;  2M80 A;  3HXS A;  2ON7 A;  2XPD A;  4V1A p;  5ECK B;  3DD3 A;  4YQM A;  1XWB A;  1OKD A;  2WB9 A;  4LMV A;  2MMZ A;  3TOT A;  3TRP A;  4DVC A;  2EIO A;  2KLX A;  2ALB A;  3QMX A;  1XWA A;  3C1S A;  2OE3 A;  1S3A A;  3KM6 A;  3MWH A;  3ZYW A;  1ZYE A;  4X1U A;  1EWX A;  3LXT A;  2H0H A;  4ZXG A;  2K18 A;  3KJY A;  3TKP A;  5DAL A;  2YJH A;  5HR2 A;  3A5W A;  17GS A;  4YQV A;  2NTO A;  2E2G A;  3IHG A;  2C3Q A;  1WJK A;  2AV4 A;  3QCP A;  2FNO A;  3A2W A;  1Q4J A;  2A4V A;  3VPT A;  1OE8 A;  5KOW A;  5EVO A;  2CA8 A;  2H30 A;  3PH9 A;  3W8J A;  1OKT A;  4OFT A;  1GSQ A;  3DRN A;  3TRQ A;  1MD3 A;  2YV7 A;  4TXO A;  1PSQ A;  1X5E A;  3HZ8 A;  2X8H A;  4O7H A;  3RAZ A;  5BMU A;  2X8G A;  1GSF A;  2JSY A;  2H72 A;  1H75 A;  4P3Y B;  3E9J B;  4HS1 A;  4J56 E;  3DYR A;  4N11 A;  4AJ7 A;  4I5Q A;  2XBQ A;  3KTL A;  1EOG A;  2H73 A;  2LRC A;  1DUG A;  4K0G A;  4N10 A;  1FVJ A;  2DIZ A;  1GSY A;  3H79 A;  1PN0 A;  2VCV A;  6GSW A;  2V32 A;  3GH9 A;  5H5Q A;  5GAP D;  3IHQ A;  3H4K A;  2HZE A;  3I9V 2;  2GT5 A;  3ME8 A;  4DSS B;  3GA4 A;  4ECJ A;  4FYB A;  4JBB A;  4PQH A;  1EOH A;  4K0N A;  1B9Y C;  2RM5 A;  3UAR A;  6GSY A;  3F4T A;  3F63 A;  4QMK A;  1A24 A;  1GTI A;  3KMO A;  2IMF A;  4MPG A;  1Y25 A;  3D21 A;  4PNF A;  2BJX A;  1EEM A;  2WVX B;  2DMM A;  4POL A;  4FXY P;  1THO A;  3UAP A;  1B9X C;  4NWY A;  2LNT A;  1XW9 A;  3LEF A;  3ERG A;  3TJB A;  2OE0 A;  1AIU A;  4TW5 A;  4HZ4 A;  5DCG A;  4K8M A;  3IR4 A;  1M7T A;  1E2Y A;  3IAS 2;  2IFQ A;  4HI7 A;  3D4T A;  1NHY A;  2DJ3 A;  5A4U A;  4BWQ A;  1SVL A;  1Y6E A;  4ACS A;  3VFI A;  1U87 A;  3TU3 B;  4N0V A;  1WIK A;  2RUE A;  4BL7 B;  1Z7P A;  2HYX A;  3ISO A;  2C8U A;  1V58 A;  2GZZ A;  3EYT A;  9GSS A;  4JZQ A;  5IO2 A;  1SD8 A;  3GL5 A;  3FYG A;  1Z5Y E;  2YWN A;  2FGX A;  1T8E B;  4OD7 A;  2MMA A;  4J57 E;  4YKG A;  3GH6 A;  4HU9 A;  1B48 A;  1OE7 A;  2C4J A;  2MMN A;  4F03 A;  1F3B A;  1R5A A;  4W66 A;  1TRS A;  3E0U A;  2QSI A;  1PX7 A;  1Y1U A;  4TOP A;  4CY6 A;  3LYP A;  4KSO A;  2O85 A;  1TRW A;  1MD4 A;  3WGE A;  3KCM A;  3V1W A;  2YZU A;  1K3Y A;  5D8I A;  3HJO A;  4WKW A;  1K0M A;  2QGV A;  1M0U A;  5H5S A;  3RHB A;  2CV4 A;  4MF6 A;  1BG1 A;  2F8A A;  1R26 A;  3NZN A;  4XRD A;  4BVX B;  1XZO A;  3VWX A;  1OVN A;  2XBI A;  3EPT A;  1SU9 A;  3CTF A;  3A2V A;  2VCT A;  4MJE A;  1SL0 B;  2V1M A;  3LXZ A;  4K5S A;  2VUP A;  5DCH A;  4PGT A;  3IV4 A;  2JAC A;  2KP2 A;  3FMW A;  2DJ2 A;  2HXK A;  5J3R A;  2O89 A;  4Z2T A;  20GS A;  4GLT A;  4BVY B;  3C7M A;  3C1R A;  4XTS A;  3HD5 A;  2I9H A;  2B5X A;  2C80 A;  2KP1 A;  1XPV A;  2EFD A;  2H8L A;  3DVX A;  2IME A;  3VUR A;  2LJR A;  3QAW A;  1XXU A;  2EFC A;  2P0G A;  2VD0 A;  4YH2 A;  1JZD A;  11GS A;  1J9B A;  2L5L A;  5HFI A;  4DSS A;  4DSR A;  4WR5 A;  3TKS A;  4ZL8 A;  4CDO A;  1T7P B;  5ELA A;  4IJI A;  1YKC A;  4MP4 A;  3TRX A;  4TR0 A;  2GQL A;  3QAG A;  1PGT A;  2WCI A;  2EIR A;  3UBL A;  3CBU A;  4K7I A;  2R3X A;  5G30 A;  4OO4 A;  4K9Z A;  2P31 A;  2WVX A;  2CAQ A;  4F82 A;  3H93 A;  1KTE A;  2PMT A;  2VM1 A;  4AKI A;  4RUV A;  2F8F A;  2FA8 A;  4TRX A;  3SWL A;  4EKZ A;  5IOX A;  1X9S B;  4FO5 A;  3ZIV A;  1SKW B;  5DAK B;  1ZZY A;  5A5K A;  4ID0 A;  2DJJ A;  3EU4 A;  4JU5 A;  2YWM A;  2PN8 A;  4EVM A;  5ENU A;  1F9M A;  1B4Q A;  1MTC A;  5JCW A;  4OCF A;  3DEX A;  4BL7 A;  1DBY A;  5F06 A;  2E2M A;  3VLN A;  3GHA A;  3RDW A;  5LNK e;  1K3O A;  3GTU B;  1M99 A;  2HRK B;  2WFC A;  4IHU A;  1UA5 A;  1A2J A;  1F37 A;  3EVI A;  5CRW A;  3ERF A;  1O81 A;  4O32 A;  3DKS A;  3VI7 A;  5KN0 A;  2BMX A;  3GST A;  4DSQ A;  4TXV A;  1QGV A;  2LJK A;  1SEN A;  3HVV A;  3U6V A;  4HDE A;  2WJU A;  1EGO A;  4IKH A;  2B5Y A;  2C0E A;  2GS3 A;  3CRU A;  2J9H A;  2MBS A;  4WF4 A;  4AKG A;  3HDC A;  5ABR A;  3IC4 A;  3TOU A;  1HYU A;  5D9T A;  4GSS A;  4E8E A;  4POK A;  1YY7 A;  3FR9 A;  2VM2 A;  1K0O A;  1THX A;  4JED A;  4KH7 A;  4TXO B;  1NHO A;  5ID2 B;  5D96 A;  3H8Q A;  2DKH A;  4AF2 A;  3IE3 A;  3F6D A;  4AI6 A;  4BVY A;  4FIW A;  5DVB A;  4KE3 A;  5B6M A;  4OFN A;  2H1B A;  4XS1 A;  4PQI A;  1T4Y A;  5ECS A;  3W8S A;  2P5Q A;  3VWW A;  2WW0 A;  5A1N A;  4NXI A;  2AB6 A;  4KA0 A;  2L57 A;  2LS5 A;  4MK3 A;  2E7P A;  3KD0 A;  3D4M A;  1BAY A;  3GYK A;  4MZC A;  5DQY A;  5GSS A;  5GAN D;  2IPA A;  3C71 A;  3G9B A;  1SL2 B;  1SKS B;  3TJJ A;  3GX0 A;  1SJI A;  1FOH A;  3U5R E;  1VRS D;  3QFB C;  2H1A A;  1K0A A;  5LCZ A;  3D0Z A;  1EZK A;  1MDJ A;  3KIJ A;  2DIY A;  2DC5 A;  4GSN A;  2IJY A;  2REM A;  2N5A A;  1B8X A;  3ZMK A;  2R0P A;  3D22 A;  4TKY A;  4IN0 A;  2R37 A;  3N5O A;  1G0T A;  3ME7 A;  1A2L A;  2Z9S A;  5B8A A;  3L0H A;  4J2F A;  1OAZ A;  3RPP A;  4GDF A;  4KF9 A;  5KN1 A;  2WUL A;  1GLQ A;  2OAD A;  2A2R A;  3IK9 A;  1FOV A;  1ZYQ B;  1UVZ A;  5DAK A;  1GL8 A;  4HQZ A;  4IJ3 A;  3QDN A;  2PU9 C;  4A5P A;  3EE2 A;  1SK2 A;  3GFK A;  1AAZ A;  1HNA A;  4ZIL A;  5CP1 A;  4EDZ A;  2WW1 A;  5INY A;  1GP1 A;  4OO5 A;  1BG5 A;  3LGC A;  2QKE A;  3TKQ A;  5CRG A;  4V1A g;  4ZB6 A;  1SVM A;  1XCC A;  2PER A;  3ZIJ A;  2FUG 2;  2HSY A;  5ECI B;  5A4V A;  2TIR A;  4KSM A;  3GTU A;  2HRK A;  2M72 A;  1M3I A;  3CYN A;  4MH2 A;  4ISD A;  4WEY A;  2KOK A;  3KH7 A;  2CT6 A;  4WBR D;  4FQU A;  1XW6 A;  1V40 A;  3FEU A;  4GF0 A;  3DWV A;  3O3T A;  3KTB A;  5KN2 A;  2HQT A;  1IYI A;  3L9V A;  2HE3 A;  4OCE A;  4ZBA A;  2C0F A;  4O5Q A;  1GUH A;  4EIQ A;  1YF1 A;  1TXX A;  13GS A;  2HRA A;  4TN8 A;  3UL3 A;  1I9D A;  2H71 A;  2GT6 A;  3TB2 A;  4ECB A;  1ABA A;  4JR4 A;  2B6M A;  4EE0 A;  4ZL7 A;  4IP6 A;  3EIN A;  3LFL A;  1G7O A;  1NW2 A;  2CX4 A;  6GST A;  1QMV A;  1G6W A;  3UVT A;  1T1V A;  3APS A;  5GZZ B;  1Z9H A;  2WRT A;  5ID2 A;  3K8N A;  2GSQ A;  2L4C A;  5ECH B;  4AJ6 A;  5ECR B;  2V6O A;  1DE2 A;  5ECO B;  4HZ2 A;  1V2A A;  2AAW A;  2YP6 A;  3GUR A;  3G7I A;  1ERU A;  3BOA A;  4KUN A;  1U6T A;  2E0Q A;  1Q98 A;  2V2G A;  1E6B A;  3FZ5 A;  4NHW A;  4QL7 A;  4PQ1 A;  2IMK A;  4K7O A;  4N0Z A;  1GRX A;  5J47 A;  1EV9 A;  3WT1 A;  4K1F A;  4X43 A;  2EFE A;  2IN3 A;  2LJA A;  2LEG A;  3ZRD A;  4MA9 A;  1SL1 B;  1A0R P;  4MLY A;  4LA1 A;  2R6K A;  3F3Q A;  2LNS A;  5HR1 A;  5G5F A;  4PI0 C;  2K9F A;  1QQ2 A;  2OBI A;  3MSZ A;  1X5D A;  2QA1 A;  1ACV A;  1VF1 A;  2KUC A;  3KMN A;  1MDK A;  5ECP B;  2IL3 A;  2FWE A;  1HD2 A;  1SJ6 A;  4HOJ A;  1G6Y A;  2O8V B;  5F0G A;  2CX3 A;  5AN1 A;  4KCA A;  3G7Y A;  2GSS A;  4MCU A;  1A2M A;  1ILO A;  3I69 A;  4ZBB A;  2H6X A;  3FY7 A;  2GQM A;  1QUW A;  3GKM A;  4X4J A;  4RQX A;  3QAV A;  2X8C A;  3IC8 A;  4GTU A;  3N9J A;  2R0C A;  2NVL A;  3H1N A;  2AHE A;  4I6X A;  1YDK A;  3ZL5 A;  1OC8 A;  3QOU A;  1BJX A;  5HFK A;  2B7K A;  3SBC A;  4IS0 A;  1AQX A;  2F3M A;  5DDL A;  3CQF A;  1O7U A;  4L8E A;  1ML6 A;  1V9W A;  3D6I A;  2CAI A;  3GRX A;  4WR4 A;  2TRC P;  1OYJ A;  1ZYP A;  2WVY A;  1GTU A;  4NV2 A;  5AIV A;  4L0U A;  4MPF A;  3MIX A;  3M0F A;  2ES7 A;  4PX1 A;  5G5E A;  3HA9 A;  3UJ1 A;  2HRF A;  2DJ0 A;  3UEM A;  1PMT A;  5D9V A;  2CVB A;  3RBT A;  4FYC A;  3QD9 A;  3M3M A;  4JE1 A;  7GSS A;  1T4Z A;  2JZT A;  3AY8 A;  3FW2 A;  3PIN A;  2VCX A;  4MF5 A;  5AIS A;  2L59 A;  2DML A;  4ZIJ A;  4GWR A;  1EGR A;  3GIX A;  4L5O A;  3GMF A;  4NAX A;  4K7N A;  1VGL A;  2AUV A;  8GSS A;  1TU8 A;  1YKA A;  1ERW A;  1TP9 A;  4HU7 A;  3L9S A;  1O85 A;  4G01 A;  5JWR B;  2PVQ A;  4HSC X;  2OT3 A;  2OKA A;  3WGX A;  1OC9 B;  2DLX A;  1JZW A;  5A4W A;  4CW9 A;  1JLV A;  3UIW A;  3HHV A;  2MBT A;  3QR6 A;  1PD2 1;  3GN3 A;  3OR5 A;  1I1I P;  3UMA A; 
#chains in the Genus database with same CATH homology
 3WD6 A;  4ECC A;  2NPB A;  4D73 B;  1ZGN A;  2FLS A;  1KEB A;  5A1N B;  2YN1 A;  5JCG A;  1PA3 A;  2GGT A;  1FB6 A;  1UN2 A;  1M2A A;  2L6C A;  3LJR A;  4V2N A;  2VL9 A;  2OAC A;  2HSM B;  2H74 A;  1T3B A;  3FZA A;  3S9F A;  3RPN A;  4Z2R A;  4BPY A;  4PUR A;  4RQR A;  4LMW A;  4G0I A;  2GDR A;  3I6A A;  2RII A;  2K6V A;  5L71 A;  3FRC A;  4LLR A;  3IK7 A;  4AKX B;  1J08 A;  4KCE A;  1WE0 A;  2GZP A;  4ZB8 A;  4JRR A;  1N25 A;  2B1L A;  4K2D A;  1TI1 A;  1FG4 A;  2JL4 A;  3LSZ A;  3DVW A;  3W6G A;  4Q5Q A;  3DIE A;  4ILF A;  2WDU A;  4HJM A;  3ZZX A;  5FWG A;  2UV8 G;  1TK0 B;  2O5V A;  1W89 A;  4RI6 A;  1JZO A;  1PQN A;  4NMU A;  1TRU A;  3KH9 A;  3LWA A;  4G0L A;  4N3Z A;  3F8U A;  2ON5 A;  3APQ A;  1CQG A;  1AQW A;  2YJ7 A;  4LL4 B;  3EC3 A;  1M9A A;  1MDI A;  1O8W A;  18GS A;  2OJL A;  5IMF A;  1O73 A;  4YKF A;  5IM9 A;  1RK4 A;  1XOB A;  1LJR A;  1XW5 A;  3ED3 A;  4DEJ A;  3TJG A;  4K2X A;  2AYT A;  4KND A;  3HKR A;  1WPI A;  3MNG A;  2MYG A;  4WBJ A;  2OBK A;  2YV9 A;  1UC7 A;  2N5B A;  5GST A;  2R2J A;  1VF2 A;  2H76 A;  6GSS A;  1R7H A;  2IMD A;  4PUA A;  3GL3 A;  3GUS A;  4Q5R A;  3IBH A;  2TRX A;  2JSZ A;  2X64 A;  3LYK A;  1DE1 A;  3HY2 A;  2PWJ A;  2HFD A;  1HNB A;  1GSE A;  1USB A;  2MMO A;  5IMV A;  4ZL9 A;  1TKD B;  3LG6 A;  1AC1 A;  2HRN A;  3IRA A;  4V2M A;  1AXD A;  1YVL A;  1BX9 A;  1TTZ A;  1OC9 A;  3M9K A;  4MJA A;  3QPM A;  5IO0 A;  3EUR A;  2MZC A;  2N5F A;  4G10 A;  4YAP A;  3EU3 A;  5AIX A;  1TK8 B;  4YAV A;  2J23 A;  3IAM 2;  1SYX A;  1U3A A;  4D73 A;  2FCH A;  1ST9 A;  2XPE A;  2HSH A;  2B7J A;  2JU5 A;  2LUS A;  5HFG A;  2HSM A;  2DJ1 A;  4IW9 A;  2GVP A;  2V6K A;  1FVK A;  4V2L A;  5J9C A;  1TRV A;  2X4A A;  3I43 A;  1S3C A;  1K0N A;  4NV5 A;  5JWO B;  3D5J A;  1SJZ A;  3EWL A;  1GWC A;  1GLP A;  3IDV A;  1DSB A;  4BA7 A;  5D73 A;  1BYE A;  5B8B A;  4BWS A;  19GS A;  4E8H A;  4PNG A;  3HCZ A;  3HJM A;  2C3N A;  3E3E A;  2RUF A;  3HZ4 A;  3KGK A;  1A0F A;  5H5R A;  5EL8 A;  5ELG A;  3FHK A;  2UZ8 A;  3BJ5 A;  2VKZ G;  3GSS A;  1U3I A;  5IMA A;  3CMI A;  4NHZ A;  4G2E A;  4KW6 A;  2OA7 A;  4F0C A;  2GTU A;  4AKH A;  5J40 A;  3IA1 A;  5J4U A;  1TJD A;  1WP0 A;  2K8V A;  2L4Q A;  3LOR A;  1K0B A;  3ERW A;  4MMM A;  4HUA A;  5IOW A;  4MZW A;  2R4V A;  4HJ2 A;  1NSW A;  1C72 A;  1S3D A;  1ZOF A;  1FW1 A;  3GKK A;  4KDY A;  4POB A;  2VLU A;  2I1U A;  1XWG A;  2H01 A;  1JLW A;  5CYY A;  3DML A;  4AJ8 A;  2VLV A;  1KBN A;  1SYR A;  3FZ4 A;  2V41 A;  1X5C A;  3NIV A;  2PGT A;  2PPT A;  5IMD A;  1GTA A;  3BBY A;  6GSX A;  1GNW A;  1M2B A;  3A3T A;  3TKR A;  1AQV A;  4OMV A;  1QXH A;  2H1D A;  2JZR A;  3UVH A;  4CHS A;  2VL2 C;  1LU4 A;  2CZ2 A;  2LRT A;  2C0G A;  5EY6 A;  2HI7 A;  2LTK A;  3IOS A;  1NM3 A;  4Z2U A;  1BF5 A;  2JAD A;  3BCK A;  3M9J A;  1SK0 A;  4G9H A;  3CTG A;  2C3T A;  3EMX A;  2H19 A;  3TGZ A;  1X9W B;  2PBJ A;  1ERT A;  1XVQ A;  5F05 A;  2HSN B;  3VPQ A;  1MEK A;  3F4S A;  2K8S A;  1GTB A;  3CSI A;  1PKZ A;  2WGR A;  4ML6 A;  2FD3 A;  2CVK A;  3P8W A;  2WZ9 A;  2LKU A;  4MF7 A;  5KEJ A;  1H4O A;  2X99 A;  2KHP A;  4GQF A;  4EIP A;  5COH A;  2DKI A;  3F4R A;  2D2Z A;  3KP9 A;  4TR3 A;  3L9U A;  2GZY A;  4N30 A;  4K5R A;  4JR6 A;  4KGI A;  1EEJ A;  1JHB A;  1GNE A;  4F9Z A;  3ZFL A;  3TKS E;  1K0C A;  5DJL A;  1Z6N A;  2G0F A;  4KB3 A;  2RM6 A;  2HNL A;  2DSA A;  1B4P A;  3L4N A;  2VL2 A;  5B7C A;  3FZ9 A;  1IYH A;  2F51 A;  3F0I A;  3M8N A;  2FWG A;  4FH8 A;  4TR1 B;  3P90 A;  4GXZ A;  1EV4 A;  1HQO A;  4EXJ A;  3Q74 A;  4I2T A;  3F6F A;  1O6J A;  1O8X A;  3ZRE A;  1U88 A;  4H86 A;  2VO4 A;  1A8L A;  1QFN A;  5J4V A;  5A5H B;  1JZR A;  3JCM L;  2NDO A;  4Q5F A;  4O5U A;  1HNC A;  2GQK A;  2FA4 A;  1T00 A;  1N8J A;  4XIH A;  4LL1 B;  5IPH A;  3ZML A;  1WRY A;  2HZF A;  1XBS A;  2LRN A;  3IXR A;  5E59 A;  5G1L A;  1TW9 A;  3HVS A;  4QQ7 A;  3ZIT A;  4GRF A;  2YAN A;  4KDU A;  4O92 A;  2CVD A;  1URM A;  2I81 A;  2VLT A;  4GCI A;  3O6T A;  5E4W A;  2VL3 A;  1G7E A;  2PVO C;  2YWO A;  1X0R A;  4O5R A;  2B3S A;  4XS6 A;  1N2A A;  4F2I A;  2H0G A;  4G19 A;  5IQY A;  1A8Y A;  3US3 A;  5FT3 A;  1F2E A;  3GNJ A;  1WMJ A;  3KEB A;  3HVX A;  2XHF A;  2H70 A;  2PUK C;  4IVF A;  1OC3 A;  3FR6 A;  2A4H A;  1J0F A;  1GSD A;  5DJM A;  2IWT A;  3ZFB A;  1I5G A;  12GS A;  3KXO A;  5J9B A;  4XHM A;  3PPU A;  2FY6 A;  3F9U A;  3G7J A;  2F9S A;  5HQP A;  2M46 A;  1XFL A;  2JZS A;  1RQM A;  4EF0 A;  4AGS A;  1SK1 A;  3VK9 A;  1EP7 A;  1TOF A;  4Z7X A;  4PTS A;  1M9B A;  2H66 A;  4KDX A;  4RI7 A;  1KNG A;  1YEX A;  2A2P A;  2DBC A;  3HYP A;  3VI5 A;  3GX8 A;  2FWH A;  14GS A;  2OE1 A;  2HSN A;  3TJF A;  1FO5 A;  2EIQ A;  2YPM A;  4I97 A;  4IGJ A;  5G1K A;  5ECL B;  4GST A;  4EC0 A;  3M1G A;  5J4Y A;  1PX6 A;  2X49 A;  5FHI A;  5A34 B;  1PL1 A;  3TKS C;  3GKN A;  5ECM B;  5C04 A;  4I8B A;  2H6Y A;  5CRD A;  2CZ3 A;  2HLS A;  4XS4 B;  4ZB7 A;  1VF3 A;  1SD9 A;  2CQ9 A;  3F3R A;  1Z7R A;  2LQQ A;  3ZTL A;  1PN9 A;  2VOC A;  1W4V A;  4OWY A;  2LV3 A;  2VAF A;  4WET A;  4TR1 A;  3MDK A;  10GS A;  2IMI A;  1CQH A;  2LST A;  4F0B A;  5C00 A;  3CWG A;  2ZUP A;  4HEA 2;  2B1K A;  5A5H A;  2ZNM A;  1ZCP A;  4IP1 A;  5D9W A;  1GUK A;  1TK5 B;  1ZL9 A;  1TU7 A;  1VF4 A;  5DBQ A;  5IMZ A;  1YQ1 A;  2C0D A;  5CAX A;  4EO3 A;  1PKW A;  1YF0 A;  4NPB A;  4FYU A;  2AJQ B;  5CRH A;  2R5G A;  3L78 A;  1BED A;  3Q18 A;  2GSR A;  3DXB A;  5KN3 A;  2L6D A;  4MH3 A;  5KOX A;  5BRT A;  1BQ7 A;  2VCZ A;  2O87 A;  1V98 A;  1FAA A;  1WWJ A;  1PL2 A;  4USS A;  3ZLP A;  3RHC A;  5ECQ B;  4IBP A;  1F6M C;  4ICY A;  4XCS A;  4PUF C;  3GKX A;  2H6Z A;  4G0K A;  5AGY A;  4Q5N A;  2L5O A;  3KP8 A;  3O76 A;  2R0G A;  3TUE A;  4EDY A;  2BTO T;  1ZMA A;  3WYW A;  1AW9 A;  3GV1 A;  1R5P A;  2HT9 A;  2P5R A;  1XIY A;  3PGT A;  2A2S A;  5F8B A;  2O7K A;  6GSU A;  4ZB9 A;  4EUY A;  2NBS A;  4WF5 A;  1Z6M A;  5JWQ B;  1V57 A;  5D9X A;  5HR0 A;  3NOF A;  1LBK A;  1ON4 A;  2H75 A;  5G31 A;  1EP8 A;  4QL9 A;  2VD1 A;  1TI3 A;  4YQU A;  3P2A A;  5CO3 A;  3FR3 A;  1GSU A;  1SKR B;  1A23 A;  3R2Q A;  3APO A;  3KZQ A;  2QC7 A;  2YWI A;  1YJ6 A;  5J5N A;  16GS A;  4KX4 A;  1WOU A;  3CSJ A;  3CRT A;  2I4A A;  1ERV A;  2XC2 A;  1XVW A;  2DJK A;  2FHE A;  3LW9 A;  4MJB A;  4ZBD A;  4IQA A;  4HQS A;  1M2D A;  2C1Y A;  3IPZ A;  5DAL B;  2FWF A;  1GH2 A;  5ECN B;  2VIM A;  5F07 A;  5A34 A;  4MAB A;  2QA2 A;  2H0I A;  4XS4 A;  4KAE A;  2YOI A;  4BVX A;  3R3E A;  3FKF A;  5IIZ A;  2I3Y A;  2ZCT A;  1AUC A;  5JCU A;  3DGQ A;  1TXU A;  1XWC A;  5B6N A;  2IIY A;  2YZH A;  4L5L A;  5IMC A;  3J7Y b;  5HR3 A;  1K0D A;  3BCI A;  4IEL A;  5EPF A;  4ML1 A;  2VCQ A;  5DQS A;  5BMU B;  3HMJ G;  4K6X A;  1X9M B;  3LQ7 A;  2WS2 A;  4L0W A;  1QK8 A;  3ZVJ D;  3A2X A;  1Z3E A;  2VCW A;  4EL1 A;  4ULX A;  4IQ1 A;  1TDI A;  3ZVJ A;  2GLR A;  1XWK A;  4MNN A;  3PR8 A;  3VWV A;  3TCO A;  3WGD A;  22GS A;  1PRX A;  1YEP A;  5CNW A;  5IPG A;  4MZB A;  4TVE A;  1GUM A;  3J7Y k;  3UBK A;  1JFU A;  5G2Z A;  2H1L A;  4E68 A;  3QFA C;  1F3A A;  1SVO A;  1K3L A;  5LD0 A;  3EMP A;  4MJC A;  1ZYN A;  3CSH A;  2HZE B;  3Q6O A;  4PXO A;  3C73 A;  3BD2 A;  5CRE A;  1R4W A;  4XRA A;  2H1G A;  1GUL A;  1GSS A;  1YZX A;  5D93 A;  2LQO A;  1XOA A;  2EFH A;  1RW1 A;  4WXT A;  3WT2 A;  4OFM A;  3Q19 A;  3MAK A;  3A5I A;  3UOM A;  3VWU A;  1FB0 A;  2RLI A;  4MDC A;  3C8E A;  3TJK A;  6GSV A;  4GQC A;  4POM A;  3HJP A;  2YCD A;  2GST A;  2G2Q A;  3P7X A;  4ECI A;  4TR4 A;  3MYD A;  4I2U A;  5J41 A;  3CXG A;  2YNX A;  4CY8 A;  2EC4 A;  2B5E A;  2IFQ B;  1FHE A;  4X0X A;  3TDG A;  3FK8 A;  2M80 A;  3HXS A;  2ON7 A;  2XPD A;  4V1A p;  5ECK B;  3DD3 A;  4YQM A;  1XWB A;  1OKD A;  2WB9 A;  4LMV A;  2MMZ A;  3TOT A;  3TRP A;  4DVC A;  2EIO A;  2KLX A;  2ALB A;  3QMX A;  1XWA A;  3C1S A;  2OE3 A;  1S3A A;  3KM6 A;  3MWH A;  3ZYW A;  1ZYE A;  4X1U A;  1EWX A;  3LXT A;  2H0H A;  4ZXG A;  2K18 A;  3KJY A;  3TKP A;  5DAL A;  2YJH A;  5HR2 A;  3A5W A;  17GS A;  4YQV A;  2NTO A;  2E2G A;  3IHG A;  2C3Q A;  1WJK A;  2AV4 A;  3QCP A;  2FNO A;  3A2W A;  1Q4J A;  2A4V A;  3VPT A;  1OE8 A;  5KOW A;  5EVO A;  2CA8 A;  2H30 A;  3PH9 A;  3W8J A;  1OKT A;  4OFT A;  1GSQ A;  3DRN A;  3TRQ A;  1MD3 A;  2YV7 A;  4TXO A;  1PSQ A;  1X5E A;  3HZ8 A;  2X8H A;  4O7H A;  3RAZ A;  5BMU A;  2X8G A;  1GSF A;  2JSY A;  2H72 A;  1H75 A;  4P3Y B;  3E9J B;  4HS1 A;  4J56 E;  3DYR A;  4N11 A;  4AJ7 A;  4I5Q A;  2XBQ A;  3KTL A;  1EOG A;  2H73 A;  2LRC A;  1DUG A;  4K0G A;  4N10 A;  1FVJ A;  2DIZ A;  1GSY A;  3H79 A;  1PN0 A;  2VCV A;  6GSW A;  2V32 A;  3GH9 A;  5H5Q A;  5GAP D;  3IHQ A;  3H4K A;  2HZE A;  3I9V 2;  2GT5 A;  3ME8 A;  4DSS B;  3GA4 A;  4ECJ A;  4FYB A;  4JBB A;  4PQH A;  1EOH A;  4K0N A;  1B9Y C;  2RM5 A;  3UAR A;  6GSY A;  3F4T A;  3F63 A;  4QMK A;  1A24 A;  1GTI A;  3KMO A;  2IMF A;  4MPG A;  1Y25 A;  3D21 A;  4PNF A;  2BJX A;  1EEM A;  2DMM A;  4POL A;  1THO A;  3UAP A;  1B9X C;  4NWY A;  2LNT A;  1XW9 A;  3LEF A;  3ERG A;  3TJB A;  2OE0 A;  1AIU A;  4TW5 A;  4HZ4 A;  5DCG A;  4K8M A;  3IR4 A;  1M7T A;  1E2Y A;  3IAS 2;  2IFQ A;  4HI7 A;  3D4T A;  1NHY A;  2DJ3 A;  5A4U A;  4BWQ A;  1SVL A;  1Y6E A;  4ACS A;  3VFI A;  1U87 A;  3TU3 B;  4N0V A;  1WIK A;  2RUE A;  4BL7 B;  1Z7P A;  2HYX A;  3ISO A;  2C8U A;  1V58 A;  2GZZ A;  3EYT A;  9GSS A;  4JZQ A;  5IO2 A;  1SD8 A;  3GL5 A;  3FYG A;  1Z5Y E;  2YWN A;  2FGX A;  1T8E B;  4OD7 A;  2MMA A;  4J57 E;  4YKG A;  3GH6 A;  4HU9 A;  1B48 A;  1OE7 A;  2C4J A;  2MMN A;  4F03 A;  1F3B A;  1R5A A;  4W66 A;  1TRS A;  3E0U A;  2QSI A;  1PX7 A;  1Y1U A;  4TOP A;  4CY6 A;  3LYP A;  4KSO A;  2O85 A;  1TRW A;  1MD4 A;  3WGE A;  3KCM A;  3V1W A;  2YZU A;  1K3Y A;  5D8I A;  3HJO A;  4WKW A;  1K0M A;  2QGV A;  1M0U A;  5H5S A;  3RHB A;  2CV4 A;  4MF6 A;  1BG1 A;  2F8A A;  1R26 A;  3NZN A;  4XRD A;  4BVX B;  1XZO A;  3VWX A;  1OVN A;  2XBI A;  3EPT A;  1SU9 A;  3CTF A;  3A2V A;  2VCT A;  4MJE A;  1SL0 B;  2V1M A;  3LXZ A;  4K5S A;  2VUP A;  5DCH A;  4PGT A;  3IV4 A;  2JAC A;  2KP2 A;  3FMW A;  2DJ2 A;  2HXK A;  5J3R A;  2O89 A;  4Z2T A;  20GS A;  4GLT A;  4BVY B;  3C7M A;  3C1R A;  4XTS A;  3HD5 A;  2I9H A;  2B5X A;  2C80 A;  2KP1 A;  1XPV A;  2EFD A;  2H8L A;  3DVX A;  2IME A;  3VUR A;  2LJR A;  3QAW A;  1XXU A;  2EFC A;  2P0G A;  2VD0 A;  4YH2 A;  1JZD A;  11GS A;  1J9B A;  2L5L A;  5HFI A;  4DSS A;  4DSR A;  4WR5 A;  3TKS A;  4ZL8 A;  4CDO A;  1T7P B;  5ELA A;  4IJI A;  1YKC A;  4MP4 A;  3TRX A;  4TR0 A;  2GQL A;  3QAG A;  1PGT A;  2WCI A;  2EIR A;  3UBL A;  3CBU A;  4K7I A;  2R3X A;  5G30 A;  4OO4 A;  4K9Z A;  2P31 A;  2CAQ A;  4F82 A;  3H93 A;  1KTE A;  2PMT A;  2VM1 A;  4AKI A;  4RUV A;  2F8F A;  2FA8 A;  4TRX A;  3SWL A;  4EKZ A;  5IOX A;  1X9S B;  4FO5 A;  3ZIV A;  1SKW B;  5DAK B;  1ZZY A;  5A5K A;  4ID0 A;  2DJJ A;  3EU4 A;  4JU5 A;  2YWM A;  2PN8 A;  4EVM A;  5ENU A;  1F9M A;  1B4Q A;  1MTC A;  5JCW A;  4OCF A;  3DEX A;  4BL7 A;  1DBY A;  5F06 A;  2E2M A;  3VLN A;  3GHA A;  3RDW A;  5LNK e;  1K3O A;  3GTU B;  1M99 A;  2HRK B;  2WFC A;  4IHU A;  1UA5 A;  1A2J A;  1F37 A;  3EVI A;  5CRW A;  3ERF A;  1O81 A;  4O32 A;  3DKS A;  3VI7 A;  5KN0 A;  2BMX A;  3GST A;  4DSQ A;  4TXV A;  1QGV A;  2LJK A;  1SEN A;  3HVV A;  3U6V A;  4HDE A;  2WJU A;  1EGO A;  4IKH A;  2B5Y A;  2C0E A;  2GS3 A;  3CRU A;  2J9H A;  2MBS A;  4WF4 A;  4AKG A;  3HDC A;  5ABR A;  3IC4 A;  3TOU A;  1HYU A;  5D9T A;  4GSS A;  4E8E A;  4POK A;  1YY7 A;  3FR9 A;  2VM2 A;  1K0O A;  1THX A;  4JED A;  4KH7 A;  4TXO B;  1NHO A;  5ID2 B;  5D96 A;  3H8Q A;  2DKH A;  4AF2 A;  3IE3 A;  3F6D A;  4AI6 A;  4BVY A;  4FIW A;  5DVB A;  4KE3 A;  5B6M A;  4OFN A;  2H1B A;  4XS1 A;  4PQI A;  1T4Y A;  5ECS A;  3W8S A;  2P5Q A;  3VWW A;  5A1N A;  4NXI A;  2AB6 A;  4KA0 A;  2L57 A;  2LS5 A;  4MK3 A;  2E7P A;  3KD0 A;  3D4M A;  1BAY A;  3GYK A;  4MZC A;  5DQY A;  5GSS A;  5GAN D;  2IPA A;  3C71 A;  3G9B A;  1SL2 B;  1SKS B;  3TJJ A;  3GX0 A;  1SJI A;  1FOH A;  3U5R E;  1VRS D;  3QFB C;  2H1A A;  1K0A A;  5LCZ A;  3D0Z A;  1EZK A;  1MDJ A;  3KIJ A;  2DIY A;  2DC5 A;  4GSN A;  2IJY A;  2REM A;  2N5A A;  1B8X A;  3ZMK A;  2R0P A;  3D22 A;  4TKY A;  4IN0 A;  2R37 A;  3N5O A;  1G0T A;  3ME7 A;  1A2L A;  2Z9S A;  5B8A A;  3L0H A;  4J2F A;  1OAZ A;  3RPP A;  4GDF A;  4KF9 A;  5KN1 A;  2WUL A;  1GLQ A;  2OAD A;  2A2R A;  3IK9 A;  1FOV A;  1ZYQ B;  1UVZ A;  5DAK A;  1GL8 A;  4HQZ A;  4IJ3 A;  3QDN A;  2PU9 C;  4A5P A;  3EE2 A;  1SK2 A;  3GFK A;  1AAZ A;  1HNA A;  4ZIL A;  5CP1 A;  4EDZ A;  5INY A;  1GP1 A;  4OO5 A;  1BG5 A;  3LGC A;  2QKE A;  3TKQ A;  5CRG A;  4V1A g;  4ZB6 A;  1SVM A;  1XCC A;  2PER A;  3ZIJ A;  2FUG 2;  2HSY A;  5ECI B;  5A4V A;  2TIR A;  4KSM A;  3GTU A;  2HRK A;  2M72 A;  3CYN A;  4MH2 A;  4ISD A;  4WEY A;  2KOK A;  3KH7 A;  2CT6 A;  4WBR D;  4FQU A;  1XW6 A;  1V40 A;  3FEU A;  4GF0 A;  3DWV A;  3O3T A;  3KTB A;  5KN2 A;  2HQT A;  1IYI A;  3L9V A;  2HE3 A;  4OCE A;  4ZBA A;  2C0F A;  4O5Q A;  1GUH A;  4EIQ A;  1YF1 A;  1TXX A;  13GS A;  2HRA A;  4TN8 A;  3UL3 A;  1I9D A;  2H71 A;  2GT6 A;  3TB2 A;  4ECB A;  1ABA A;  4JR4 A;  2B6M A;  4EE0 A;  4ZL7 A;  4IP6 A;  3EIN A;  3LFL A;  1G7O A;  1NW2 A;  2CX4 A;  6GST A;  1QMV A;  1G6W A;  3UVT A;  1T1V A;  3APS A;  5GZZ B;  1Z9H A;  2WRT A;  5ID2 A;  3K8N A;  2GSQ A;  2L4C A;  5ECH B;  4AJ6 A;  5ECR B;  2V6O A;  1DE2 A;  5ECO B;  4HZ2 A;  1V2A A;  2AAW A;  2YP6 A;  3GUR A;  3G7I A;  1ERU A;  3BOA A;  4KUN A;  1U6T A;  2E0Q A;  1Q98 A;  2V2G A;  1E6B A;  3FZ5 A;  4NHW A;  4QL7 A;  4PQ1 A;  2IMK A;  4K7O A;  4N0Z A;  1GRX A;  5J47 A;  1EV9 A;  3WT1 A;  4K1F A;  4X43 A;  2EFE A;  2IN3 A;  2LJA A;  2LEG A;  3ZRD A;  4MA9 A;  1SL1 B;  1A0R P;  4MLY A;  4LA1 A;  2R6K A;  3F3Q A;  2LNS A;  5HR1 A;  5G5F A;  2K9F A;  1QQ2 A;  2OBI A;  3MSZ A;  1X5D A;  2QA1 A;  1ACV A;  1VF1 A;  2KUC A;  3KMN A;  1MDK A;  5ECP B;  2IL3 A;  2FWE A;  1HD2 A;  1SJ6 A;  4HOJ A;  1G6Y A;  2O8V B;  5F0G A;  2CX3 A;  5AN1 A;  4KCA A;  3G7Y A;  2GSS A;  4MCU A;  1A2M A;  1ILO A;  3I69 A;  4ZBB A;  2H6X A;  3FY7 A;  2GQM A;  1QUW A;  3GKM A;  4X4J A;  4RQX A;  3QAV A;  2X8C A;  3IC8 A;  4GTU A;  3N9J A;  2R0C A;  2NVL A;  3H1N A;  2AHE A;  4I6X A;  1YDK A;  3ZL5 A;  1OC8 A;  3QOU A;  1BJX A;  5HFK A;  2B7K A;  3SBC A;  4IS0 A;  1AQX A;  2F3M A;  5DDL A;  1O7U A;  4L8E A;  1ML6 A;  1V9W A;  3D6I A;  2CAI A;  3GRX A;  4WR4 A;  2TRC P;  1OYJ A;  1ZYP A;  1GTU A;  4NV2 A;  5AIV A;  4L0U A;  4MPF A;  3MIX A;  3M0F A;  2ES7 A;  4PX1 A;  5G5E A;  3HA9 A;  3UJ1 A;  2HRF A;  2DJ0 A;  3UEM A;  1PMT A;  5D9V A;  2CVB A;  3RBT A;  4FYC A;  3QD9 A;  3M3M A;  4JE1 A;  7GSS A;  1T4Z A;  2JZT A;  3AY8 A;  3FW2 A;  3PIN A;  2VCX A;  4MF5 A;  5AIS A;  2L59 A;  2DML A;  4ZIJ A;  4GWR A;  1EGR A;  3GIX A;  4L5O A;  3GMF A;  4NAX A;  4K7N A;  1VGL A;  2AUV A;  8GSS A;  1TU8 A;  1YKA A;  1ERW A;  1TP9 A;  4HU7 A;  3L9S A;  1O85 A;  4G01 A;  5JWR B;  2PVQ A;  2OT3 A;  2OKA A;  3WGX A;  1OC9 B;  2DLX A;  1JZW A;  5A4W A;  4CW9 A;  1JLV A;  3UIW A;  3HHV A;  2MBT A;  3QR6 A;  1PD2 1;  3GN3 A;  3OR5 A;  3UMA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...