1M9CC

X-ray crystal structure of cyclophilin a/hiv-1 ca n-terminal domain (1-146) m-type complex.
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
146
structure length
146
Chain Sequence
PIVQNLQGQMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cyclophilin A
publication title Structural insights into the catalytic mechanism of cyclophilin A
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase/viral protein
total genus 49
structure length 146
sequence length 146
chains with identical sequence D
ec nomenclature
pdb deposition date 2002-07-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 1m9cC00
4E92A 1M9XC 4U0EA 2GONA 2Y4ZA 1G03A 1P7NA 4PH3A 1M9CC 5HGNA 4WYMA 2WLVB 2M8NA 4U0FA 1EIAA 3P05A 2EIAA 1M9YC 2X83A 3MGEA 1D1DA 4PH2A 1AFVA 4U0CA 4XFXA 4U0AA 2V4XA 1AK4C 2X2DD 1U7KA 2XGYA 4NX4C 2KGFA 1M9EC 3NTEA 1EM9A 4XRQA 1QRJA 5HGKA 1GWPA 2JPRA 1M9DC 2M8PA 4PH0A 4B4NA 2XGVA 4U0DA 5HGOA 4XFZA 3H4EA 2LF4A 3BP9A 4XROA 5HGMA 4E91A 4QNBA 4U0BA 4J93A 2PXRC 2XDEA 2PWOA 2XGUA 4DGAC 4DGEC 4INBA 4HTWA 2M8LA 2PWMA 1M9FC 2WLVA 2X82A 3H47A 1E6JP 4LQWC 1L6NA 4XFYA 2GOLB 5JPAA 5HGLA
chains in the Genus database with same CATH superfamily
4E92A 1M9XC 4U0EA 2GONA 2Y4ZA 1G03A 1P7NA 4PH3A 1M9CC 5HGNA 4WYMA 2WLVB 2M8NA 4U0FA 1EIAA 3P05A 2EIAA 1M9YC 2X83A 3MGEA 1D1DA 4PH2A 1AFVA 4U0CA 4XFXA 4U0AA 2V4XA 1AK4C 2X2DD 1U7KA 2XGYA 4NX4C 2KGFA 1M9EC 3NTEA 1EM9A 4XRQA 1QRJA 5HGKA 1GWPA 2JPRA 1M9DC 2M8PA 4PH0A 4B4NA 2XGVA 4U0DA 5HGOA 4XFZA 3H4EA 2LF4A 3BP9A 4XROA 5HGMA 4E91A 4QNBA 4U0BA 4J93A 2PXRC 2XDEA 2PWOA 2XGUA 4DGAC 4DGEC 4INBA 4HTWA 2M8LA 2PWMA 1M9FC 2WLVA 2X82A 3H47A 1E6JP 4LQWC 1L6NA 4XFYA 2GOLB 5JPAA 5HGLA
chains in the Genus database with same CATH topology
4E92A 1M9XC 4U0EA 2GONA 2Y4ZA 1G03A 1P7NA 4PH3A 1M9CC 5HGNA 4WYMA 2WLVB 2M8NA 4U0FA 1EIAA 3P05A 2EIAA 1M9YC 2X83A 3MGEA 1D1DA 4PH2A 1AFVA 4U0CA 4XFXA 4U0AA 2V4XA 1AK4C 2X2DD 1U7KA 2XGYA 4NX4C 2KGFA 1M9EC 3NTEA 1EM9A 4XRQA 1QRJA 5HGKA 1GWPA 2JPRA 1M9DC 2M8PA 4PH0A 4B4NA 2XGVA 4U0DA 5HGOA 4XFZA 3H4EA 2LF4A 3BP9A 4XROA 5HGMA 4E91A 4QNBA 4U0BA 4J93A 2PXRC 2XDEA 2PWOA 2XGUA 4DGAC 4DGEC 4INBA 4HTWA 2M8LA 2PWMA 1M9FC 2WLVA 2X82A 3H47A 1E6JP 4LQWC 1L6NA 4XFYA 2GOLB 5JPAA 5HGLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4E92 A;  1M9X C;  4U0E A;  2GON A;  2Y4Z A;  1G03 A;  1P7N A;  4PH3 A;  1M9C C;  5HGN A;  4WYM A;  2WLV B;  2M8N A;  4U0F A;  1EIA A;  3P05 A;  2EIA A;  1M9Y C;  2X83 A;  3MGE A;  1D1D A;  4PH2 A;  1AFV A;  4U0C A;  4XFX A;  4U0A A;  2V4X A;  1AK4 C;  2X2D D;  1U7K A;  2XGY A;  4NX4 C;  2KGF A;  1M9E C;  3NTE A;  1EM9 A;  4XRQ A;  1QRJ A;  5HGK A;  1GWP A;  2JPR A;  1M9D C;  2M8P A;  4PH0 A;  4B4N A;  2XGV A;  4U0D A;  5HGO A;  4XFZ A;  3H4E A;  2LF4 A;  3BP9 A;  4XRO A;  5HGM A;  4E91 A;  4QNB A;  4U0B A;  4J93 A;  2PXR C;  2XDE A;  2PWO A;  2XGU A;  4DGA C;  4DGE C;  4INB A;  4HTW A;  2M8L A;  2PWM A;  1M9F C;  2WLV A;  2X82 A;  3H47 A;  1E6J P;  4LQW C;  1L6N A;  4XFY A;  2GOL B;  5JPA A;  5HGL A; 
#chains in the Genus database with same CATH topology
 4E92 A;  1M9X C;  4U0E A;  2GON A;  2Y4Z A;  1G03 A;  1P7N A;  4PH3 A;  1M9C C;  5HGN A;  4WYM A;  2WLV B;  2M8N A;  4U0F A;  1EIA A;  3P05 A;  2EIA A;  1M9Y C;  2X83 A;  3MGE A;  1D1D A;  4PH2 A;  1AFV A;  4U0C A;  4XFX A;  4U0A A;  2V4X A;  1AK4 C;  2X2D D;  1U7K A;  2XGY A;  4NX4 C;  2KGF A;  1M9E C;  3NTE A;  1EM9 A;  4XRQ A;  1QRJ A;  5HGK A;  1GWP A;  2JPR A;  1M9D C;  2M8P A;  4PH0 A;  4B4N A;  2XGV A;  4U0D A;  5HGO A;  4XFZ A;  3H4E A;  2LF4 A;  3BP9 A;  4XRO A;  5HGM A;  4E91 A;  4QNB A;  4U0B A;  4J93 A;  2PXR C;  2XDE A;  2PWO A;  2XGU A;  4DGA C;  4DGE C;  4INB A;  4HTW A;  2M8L A;  2PWM A;  1M9F C;  2WLV A;  2X82 A;  3H47 A;  1E6J P;  4LQW C;  1L6N A;  4XFY A;  2GOL B;  5JPA A;  5HGL A; 
#chains in the Genus database with same CATH homology
 4E92 A;  1M9X C;  4U0E A;  2GON A;  2Y4Z A;  1G03 A;  1P7N A;  4PH3 A;  1M9C C;  5HGN A;  4WYM A;  2WLV B;  2M8N A;  4U0F A;  1EIA A;  3P05 A;  2EIA A;  1M9Y C;  2X83 A;  3MGE A;  1D1D A;  4PH2 A;  1AFV A;  4U0C A;  4XFX A;  4U0A A;  2V4X A;  1AK4 C;  2X2D D;  1U7K A;  2XGY A;  4NX4 C;  2KGF A;  1M9E C;  3NTE A;  1EM9 A;  4XRQ A;  1QRJ A;  5HGK A;  1GWP A;  2JPR A;  1M9D C;  2M8P A;  4PH0 A;  4B4N A;  2XGV A;  4U0D A;  5HGO A;  4XFZ A;  3H4E A;  2LF4 A;  3BP9 A;  4XRO A;  5HGM A;  4E91 A;  4QNB A;  4U0B A;  4J93 A;  2PXR C;  2XDE A;  2PWO A;  2XGU A;  4DGA C;  4DGE C;  4INB A;  4HTW A;  2M8L A;  2PWM A;  1M9F C;  2WLV A;  2X82 A;  3H47 A;  1E6J P;  4LQW C;  1L6N A;  4XFY A;  2GOL B;  5JPA A;  5HGL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...