1M9DC

X-ray crystal structure of cyclophilin a/hiv-1 ca n-terminal domain (1-146) o-type chimera complex.
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
146
structure length
146
Chain Sequence
b'PIVQNLQGQMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRTHPPAMGPLPPGQIREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cyclophilin A
publication title Structural insights into the catalytic mechanism of cyclophilin A
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase/viral protein
total genus 49
structure length 146
sequence length 146
chains with identical sequence D
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2002-07-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 1m9dC00
5JPAA 1M9FC 2X2DD 2XDEA 1L6NA 3H47A 2XGYA 3BP9A 1AK4C 4U0FA 4E92A 2X82A 3P05A 2WLVA 1M9CC 1E6JP 1EIAA 4LQWC 2PXRC 4U0AA 4U0DA 4NX4C 2M8NA 4B4NA 5HGNA 4DGEC 3MGEA 1M9EC 4PH3A 1EM9A 2PWMA 5HGKA 1G03A 2X83A 2PWOA 4HTWA 1GWPA 4DGAC 4J93A 2M8LA 4XFXA 4U0CA 2V4XA 1AFVA 4XROA 1D1DA 2M8PA 5HGMA 4E91A 2WLVB 2XGVA 2GONA 4XFYA 2Y4ZA 2KGFA 5HGOA 4QNBA 2EIAA 2LF4A 3NTEA 1QRJA 1P7NA 1M9XC 4INBA 5HGLA 2GOLB 2JPRA 4U0EA 4U0BA 2XGUA 1M9DC 3H4EA 4PH2A 1M9YC 4XFZA 4XRQA 4WYMA 1U7KA 4PH0A
chains in the Genus database with same CATH superfamily
5JPAA 1M9FC 2X2DD 2XDEA 1L6NA 3H47A 2XGYA 3BP9A 1AK4C 4U0FA 4E92A 2X82A 3P05A 2WLVA 1M9CC 1E6JP 1EIAA 4LQWC 2PXRC 4U0AA 4U0DA 4NX4C 2M8NA 4B4NA 5HGNA 4DGEC 3MGEA 1M9EC 4PH3A 1EM9A 2PWMA 5HGKA 1G03A 2X83A 2PWOA 4HTWA 1GWPA 4DGAC 4J93A 2M8LA 4XFXA 4U0CA 2V4XA 1AFVA 4XROA 1D1DA 2M8PA 5HGMA 4E91A 2WLVB 2XGVA 2GONA 4XFYA 2Y4ZA 2KGFA 5HGOA 4QNBA 2EIAA 2LF4A 3NTEA 1QRJA 1P7NA 1M9XC 4INBA 5HGLA 2GOLB 2JPRA 4U0EA 4U0BA 2XGUA 1M9DC 3H4EA 4PH2A 1M9YC 4XFZA 4XRQA 4WYMA 1U7KA 4PH0A
chains in the Genus database with same CATH topology
5JPAA 1M9FC 2X2DD 2XDEA 1L6NA 3H47A 2XGYA 3BP9A 1AK4C 4U0FA 4E92A 2X82A 3P05A 2WLVA 1M9CC 1E6JP 1EIAA 4LQWC 2PXRC 4U0AA 4U0DA 4NX4C 2M8NA 4B4NA 5HGNA 4DGEC 3MGEA 1M9EC 4PH3A 1EM9A 2PWMA 5HGKA 1G03A 2X83A 2PWOA 4HTWA 1GWPA 4DGAC 4J93A 2M8LA 4XFXA 4U0CA 2V4XA 1AFVA 4XROA 1D1DA 2M8PA 5HGMA 4E91A 2WLVB 2XGVA 2GONA 4XFYA 2Y4ZA 2KGFA 5HGOA 4QNBA 2EIAA 2LF4A 3NTEA 1QRJA 1P7NA 1M9XC 4INBA 5HGLA 2GOLB 2JPRA 4U0EA 4U0BA 2XGUA 1M9DC 3H4EA 4PH2A 1M9YC 4XFZA 4XRQA 4WYMA 1U7KA 4PH0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JPA A;  1M9F C;  2X2D D;  2XDE A;  1L6N A;  3H47 A;  2XGY A;  3BP9 A;  1AK4 C;  4U0F A;  4E92 A;  2X82 A;  3P05 A;  2WLV A;  1M9C C;  1E6J P;  1EIA A;  4LQW C;  2PXR C;  4U0A A;  4U0D A;  4NX4 C;  2M8N A;  4B4N A;  5HGN A;  4DGE C;  3MGE A;  1M9E C;  4PH3 A;  1EM9 A;  2PWM A;  5HGK A;  1G03 A;  2X83 A;  2PWO A;  4HTW A;  1GWP A;  4DGA C;  4J93 A;  2M8L A;  4XFX A;  4U0C A;  2V4X A;  1AFV A;  4XRO A;  1D1D A;  2M8P A;  5HGM A;  4E91 A;  2WLV B;  2XGV A;  2GON A;  4XFY A;  2Y4Z A;  2KGF A;  5HGO A;  4QNB A;  2EIA A;  2LF4 A;  3NTE A;  1QRJ A;  1P7N A;  1M9X C;  4INB A;  5HGL A;  2GOL B;  2JPR A;  4U0E A;  4U0B A;  2XGU A;  1M9D C;  3H4E A;  4PH2 A;  1M9Y C;  4XFZ A;  4XRQ A;  4WYM A;  1U7K A;  4PH0 A; 
#chains in the Genus database with same CATH topology
 5JPA A;  1M9F C;  2X2D D;  2XDE A;  1L6N A;  3H47 A;  2XGY A;  3BP9 A;  1AK4 C;  4U0F A;  4E92 A;  2X82 A;  3P05 A;  2WLV A;  1M9C C;  1E6J P;  1EIA A;  4LQW C;  2PXR C;  4U0A A;  4U0D A;  4NX4 C;  2M8N A;  4B4N A;  5HGN A;  4DGE C;  3MGE A;  1M9E C;  4PH3 A;  1EM9 A;  2PWM A;  5HGK A;  1G03 A;  2X83 A;  2PWO A;  4HTW A;  1GWP A;  4DGA C;  4J93 A;  2M8L A;  4XFX A;  4U0C A;  2V4X A;  1AFV A;  4XRO A;  1D1D A;  2M8P A;  5HGM A;  4E91 A;  2WLV B;  2XGV A;  2GON A;  4XFY A;  2Y4Z A;  2KGF A;  5HGO A;  4QNB A;  2EIA A;  2LF4 A;  3NTE A;  1QRJ A;  1P7N A;  1M9X C;  4INB A;  5HGL A;  2GOL B;  2JPR A;  4U0E A;  4U0B A;  2XGU A;  1M9D C;  3H4E A;  4PH2 A;  1M9Y C;  4XFZ A;  4XRQ A;  4WYM A;  1U7K A;  4PH0 A; 
#chains in the Genus database with same CATH homology
 5JPA A;  1M9F C;  2X2D D;  2XDE A;  1L6N A;  3H47 A;  2XGY A;  3BP9 A;  1AK4 C;  4U0F A;  4E92 A;  2X82 A;  3P05 A;  2WLV A;  1M9C C;  1E6J P;  1EIA A;  4LQW C;  2PXR C;  4U0A A;  4U0D A;  4NX4 C;  2M8N A;  4B4N A;  5HGN A;  4DGE C;  3MGE A;  1M9E C;  4PH3 A;  1EM9 A;  2PWM A;  5HGK A;  1G03 A;  2X83 A;  2PWO A;  4HTW A;  1GWP A;  4DGA C;  4J93 A;  2M8L A;  4XFX A;  4U0C A;  2V4X A;  1AFV A;  4XRO A;  1D1D A;  2M8P A;  5HGM A;  4E91 A;  2WLV B;  2XGV A;  2GON A;  4XFY A;  2Y4Z A;  2KGF A;  5HGO A;  4QNB A;  2EIA A;  2LF4 A;  3NTE A;  1QRJ A;  1P7N A;  1M9X C;  4INB A;  5HGL A;  2GOL B;  2JPR A;  4U0E A;  4U0B A;  2XGU A;  1M9D C;  3H4E A;  4PH2 A;  1M9Y C;  4XFZ A;  4XRQ A;  4WYM A;  1U7K A;  4PH0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...