1M9DC

X-ray crystal structure of cyclophilin a/hiv-1 ca n-terminal domain (1-146) o-type chimera complex.
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
146
structure length
146
Chain Sequence
PIVQNLQGQMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRTHPPAMGPLPPGQIREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cyclophilin A
publication title Structural insights into the catalytic mechanism of cyclophilin A
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase/viral protein
total genus 49
structure length 146
sequence length 146
chains with identical sequence D
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2002-07-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 1m9dC00
4U0CA 5HGNA 4LQWC 1P7NA 2XGUA 4U0EA 1EM9A 4XFYA 2M8PA 2LF4A 4DGEC 2X83A 1M9CC 4DGAC 1M9EC 4INBA 4WYMA 5HGLA 2M8NA 1M9XC 2X82A 1E6JP 3P05A 2EIAA 4J93A 2V4XA 3MGEA 4XRQA 4B4NA 4HTWA 1GWPA 5HGMA 4PH2A 4U0AA 1G03A 4XFZA 4U0DA 5HGKA 3BP9A 2X2DD 2PWOA 2PXRC 1AFVA 2M8LA 2PWMA 4PH0A 5JPAA 2WLVA 2GOLB 4U0FA 4XROA 1D1DA 2KGFA 4QNBA 4XFXA 4U0BA 2Y4ZA 1M9DC 1EIAA 2XDEA 1L6NA 3H4EA 4NX4C 1U7KA 4E91A 5HGOA 4PH3A 2JPRA 4E92A 3H47A 1M9FC 1AK4C 2XGVA 1QRJA 2GONA 2XGYA 2WLVB 1M9YC 3NTEA
chains in the Genus database with same CATH superfamily
4U0CA 5HGNA 4LQWC 1P7NA 2XGUA 4U0EA 1EM9A 4XFYA 2M8PA 2LF4A 4DGEC 2X83A 1M9CC 4DGAC 1M9EC 4INBA 4WYMA 5HGLA 2M8NA 1M9XC 2X82A 1E6JP 3P05A 2EIAA 4J93A 2V4XA 3MGEA 4XRQA 4B4NA 4HTWA 1GWPA 5HGMA 4PH2A 4U0AA 1G03A 4XFZA 4U0DA 5HGKA 3BP9A 2X2DD 2PWOA 2PXRC 1AFVA 2M8LA 2PWMA 4PH0A 5JPAA 2WLVA 2GOLB 4U0FA 4XROA 1D1DA 2KGFA 4QNBA 4XFXA 4U0BA 2Y4ZA 1M9DC 1EIAA 2XDEA 1L6NA 3H4EA 4NX4C 1U7KA 4E91A 5HGOA 4PH3A 2JPRA 4E92A 3H47A 1M9FC 1AK4C 2XGVA 1QRJA 2GONA 2XGYA 2WLVB 1M9YC 3NTEA
chains in the Genus database with same CATH topology
4U0CA 5HGNA 4LQWC 1P7NA 2XGUA 4U0EA 1EM9A 4XFYA 2M8PA 2LF4A 4DGEC 2X83A 1M9CC 4DGAC 1M9EC 4INBA 4WYMA 5HGLA 2M8NA 1M9XC 2X82A 1E6JP 3P05A 2EIAA 4J93A 2V4XA 3MGEA 4XRQA 4B4NA 4HTWA 1GWPA 5HGMA 4PH2A 4U0AA 1G03A 4XFZA 4U0DA 5HGKA 3BP9A 2X2DD 2PWOA 2PXRC 1AFVA 2M8LA 2PWMA 4PH0A 5JPAA 2WLVA 2GOLB 4U0FA 4XROA 1D1DA 2KGFA 4QNBA 4XFXA 4U0BA 2Y4ZA 1M9DC 1EIAA 2XDEA 1L6NA 3H4EA 4NX4C 1U7KA 4E91A 5HGOA 4PH3A 2JPRA 4E92A 3H47A 1M9FC 1AK4C 2XGVA 1QRJA 2GONA 2XGYA 2WLVB 1M9YC 3NTEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U0C A;  5HGN A;  4LQW C;  1P7N A;  2XGU A;  4U0E A;  1EM9 A;  4XFY A;  2M8P A;  2LF4 A;  4DGE C;  2X83 A;  1M9C C;  4DGA C;  1M9E C;  4INB A;  4WYM A;  5HGL A;  2M8N A;  1M9X C;  2X82 A;  1E6J P;  3P05 A;  2EIA A;  4J93 A;  2V4X A;  3MGE A;  4XRQ A;  4B4N A;  4HTW A;  1GWP A;  5HGM A;  4PH2 A;  4U0A A;  1G03 A;  4XFZ A;  4U0D A;  5HGK A;  3BP9 A;  2X2D D;  2PWO A;  2PXR C;  1AFV A;  2M8L A;  2PWM A;  4PH0 A;  5JPA A;  2WLV A;  2GOL B;  4U0F A;  4XRO A;  1D1D A;  2KGF A;  4QNB A;  4XFX A;  4U0B A;  2Y4Z A;  1M9D C;  1EIA A;  2XDE A;  1L6N A;  3H4E A;  4NX4 C;  1U7K A;  4E91 A;  5HGO A;  4PH3 A;  2JPR A;  4E92 A;  3H47 A;  1M9F C;  1AK4 C;  2XGV A;  1QRJ A;  2GON A;  2XGY A;  2WLV B;  1M9Y C;  3NTE A; 
#chains in the Genus database with same CATH topology
 4U0C A;  5HGN A;  4LQW C;  1P7N A;  2XGU A;  4U0E A;  1EM9 A;  4XFY A;  2M8P A;  2LF4 A;  4DGE C;  2X83 A;  1M9C C;  4DGA C;  1M9E C;  4INB A;  4WYM A;  5HGL A;  2M8N A;  1M9X C;  2X82 A;  1E6J P;  3P05 A;  2EIA A;  4J93 A;  2V4X A;  3MGE A;  4XRQ A;  4B4N A;  4HTW A;  1GWP A;  5HGM A;  4PH2 A;  4U0A A;  1G03 A;  4XFZ A;  4U0D A;  5HGK A;  3BP9 A;  2X2D D;  2PWO A;  2PXR C;  1AFV A;  2M8L A;  2PWM A;  4PH0 A;  5JPA A;  2WLV A;  2GOL B;  4U0F A;  4XRO A;  1D1D A;  2KGF A;  4QNB A;  4XFX A;  4U0B A;  2Y4Z A;  1M9D C;  1EIA A;  2XDE A;  1L6N A;  3H4E A;  4NX4 C;  1U7K A;  4E91 A;  5HGO A;  4PH3 A;  2JPR A;  4E92 A;  3H47 A;  1M9F C;  1AK4 C;  2XGV A;  1QRJ A;  2GON A;  2XGY A;  2WLV B;  1M9Y C;  3NTE A; 
#chains in the Genus database with same CATH homology
 4U0C A;  5HGN A;  4LQW C;  1P7N A;  2XGU A;  4U0E A;  1EM9 A;  4XFY A;  2M8P A;  2LF4 A;  4DGE C;  2X83 A;  1M9C C;  4DGA C;  1M9E C;  4INB A;  4WYM A;  5HGL A;  2M8N A;  1M9X C;  2X82 A;  1E6J P;  3P05 A;  2EIA A;  4J93 A;  2V4X A;  3MGE A;  4XRQ A;  4B4N A;  4HTW A;  1GWP A;  5HGM A;  4PH2 A;  4U0A A;  1G03 A;  4XFZ A;  4U0D A;  5HGK A;  3BP9 A;  2X2D D;  2PWO A;  2PXR C;  1AFV A;  2M8L A;  2PWM A;  4PH0 A;  5JPA A;  2WLV A;  2GOL B;  4U0F A;  4XRO A;  1D1D A;  2KGF A;  4QNB A;  4XFX A;  4U0B A;  2Y4Z A;  1M9D C;  1EIA A;  2XDE A;  1L6N A;  3H4E A;  4NX4 C;  1U7K A;  4E91 A;  5HGO A;  4PH3 A;  2JPR A;  4E92 A;  3H47 A;  1M9F C;  1AK4 C;  2XGV A;  1QRJ A;  2GON A;  2XGY A;  2WLV B;  1M9Y C;  3NTE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...