1M9DC

X-ray crystal structure of cyclophilin a/hiv-1 ca n-terminal domain (1-146) o-type chimera complex.
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
146
structure length
146
Chain Sequence
b'PIVQNLQGQMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRTHPPAMGPLPPGQIREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights into the catalytic mechanism of cyclophilin A
pubmed doi rcsb
molecule keywords Cyclophilin A
source organism Homo sapiens
molecule tags Isomerase/viral protein
total genus 49
structure length 146
sequence length 146
chains with identical sequence D
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2002-07-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 1m9dC00
2KGFA 2V4XA 2PWOA 2M8LA 4E91A 5HGNA 1EM9A 1M9DC 2GOLB 4PH0A 4U0AA 1M9EC 4PH2A 4INBA 2XGVA 2WLVA 3H4EA 2M8PA 1L6NA 2JPRA 1P7NA 4NX4C 4DGEC 3NTEA 1U7KA 1M9CC 1M9FC 4XFYA 3P05A 1M9XC 2LF4A 4LQWC 4DGAC 2Y4ZA 5HGLA 2X2DD 4XROA 4U0BA 1D1DA 2WLVB 2X83A 4HTWA 4E92A 1EIAA 4QNBA 1M9YC 4XFZA 4U0FA 2M8NA 2PWMA 2PXRC 4U0CA 1AK4C 4U0DA 1AFVA 5HGKA 4B4NA 5JPAA 2XGUA 1E6JP 2XGYA 4XRQA 1GWPA 3H47A 1QRJA 4PH3A 2GONA 5HGOA 3MGEA 1G03A 2XDEA 4J93A 2X82A 2EIAA 5HGMA 3BP9A 4XFXA 4U0EA 4WYMA
chains in the Genus database with same CATH superfamily
2KGFA 2V4XA 2PWOA 2M8LA 4E91A 5HGNA 1EM9A 1M9DC 2GOLB 4PH0A 4U0AA 1M9EC 4PH2A 4INBA 2XGVA 2WLVA 3H4EA 2M8PA 1L6NA 2JPRA 1P7NA 4NX4C 4DGEC 3NTEA 1U7KA 1M9CC 1M9FC 4XFYA 3P05A 1M9XC 2LF4A 4LQWC 4DGAC 2Y4ZA 5HGLA 2X2DD 4XROA 4U0BA 1D1DA 2WLVB 2X83A 4HTWA 4E92A 1EIAA 4QNBA 1M9YC 4XFZA 4U0FA 2M8NA 2PWMA 2PXRC 4U0CA 1AK4C 4U0DA 1AFVA 5HGKA 4B4NA 5JPAA 2XGUA 1E6JP 2XGYA 4XRQA 1GWPA 3H47A 1QRJA 4PH3A 2GONA 5HGOA 3MGEA 1G03A 2XDEA 4J93A 2X82A 2EIAA 5HGMA 3BP9A 4XFXA 4U0EA 4WYMA
chains in the Genus database with same CATH topology
2KGFA 2V4XA 2PWOA 2M8LA 4E91A 5HGNA 1EM9A 1M9DC 2GOLB 4PH0A 4U0AA 1M9EC 4PH2A 4INBA 2XGVA 2WLVA 3H4EA 2M8PA 1L6NA 2JPRA 1P7NA 4NX4C 4DGEC 3NTEA 1U7KA 1M9CC 1M9FC 4XFYA 3P05A 1M9XC 2LF4A 4LQWC 4DGAC 2Y4ZA 5HGLA 2X2DD 4XROA 4U0BA 1D1DA 2WLVB 2X83A 4HTWA 4E92A 1EIAA 4QNBA 1M9YC 4XFZA 4U0FA 2M8NA 2PWMA 2PXRC 4U0CA 1AK4C 4U0DA 1AFVA 5HGKA 4B4NA 5JPAA 2XGUA 1E6JP 2XGYA 4XRQA 1GWPA 3H47A 1QRJA 4PH3A 2GONA 5HGOA 3MGEA 1G03A 2XDEA 4J93A 2X82A 2EIAA 5HGMA 3BP9A 4XFXA 4U0EA 4WYMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KGF A;  2V4X A;  2PWO A;  2M8L A;  4E91 A;  5HGN A;  1EM9 A;  1M9D C;  2GOL B;  4PH0 A;  4U0A A;  1M9E C;  4PH2 A;  4INB A;  2XGV A;  2WLV A;  3H4E A;  2M8P A;  1L6N A;  2JPR A;  1P7N A;  4NX4 C;  4DGE C;  3NTE A;  1U7K A;  1M9C C;  1M9F C;  4XFY A;  3P05 A;  1M9X C;  2LF4 A;  4LQW C;  4DGA C;  2Y4Z A;  5HGL A;  2X2D D;  4XRO A;  4U0B A;  1D1D A;  2WLV B;  2X83 A;  4HTW A;  4E92 A;  1EIA A;  4QNB A;  1M9Y C;  4XFZ A;  4U0F A;  2M8N A;  2PWM A;  2PXR C;  4U0C A;  1AK4 C;  4U0D A;  1AFV A;  5HGK A;  4B4N A;  5JPA A;  2XGU A;  1E6J P;  2XGY A;  4XRQ A;  1GWP A;  3H47 A;  1QRJ A;  4PH3 A;  2GON A;  5HGO A;  3MGE A;  1G03 A;  2XDE A;  4J93 A;  2X82 A;  2EIA A;  5HGM A;  3BP9 A;  4XFX A;  4U0E A;  4WYM A; 
#chains in the Genus database with same CATH topology
 2KGF A;  2V4X A;  2PWO A;  2M8L A;  4E91 A;  5HGN A;  1EM9 A;  1M9D C;  2GOL B;  4PH0 A;  4U0A A;  1M9E C;  4PH2 A;  4INB A;  2XGV A;  2WLV A;  3H4E A;  2M8P A;  1L6N A;  2JPR A;  1P7N A;  4NX4 C;  4DGE C;  3NTE A;  1U7K A;  1M9C C;  1M9F C;  4XFY A;  3P05 A;  1M9X C;  2LF4 A;  4LQW C;  4DGA C;  2Y4Z A;  5HGL A;  2X2D D;  4XRO A;  4U0B A;  1D1D A;  2WLV B;  2X83 A;  4HTW A;  4E92 A;  1EIA A;  4QNB A;  1M9Y C;  4XFZ A;  4U0F A;  2M8N A;  2PWM A;  2PXR C;  4U0C A;  1AK4 C;  4U0D A;  1AFV A;  5HGK A;  4B4N A;  5JPA A;  2XGU A;  1E6J P;  2XGY A;  4XRQ A;  1GWP A;  3H47 A;  1QRJ A;  4PH3 A;  2GON A;  5HGO A;  3MGE A;  1G03 A;  2XDE A;  4J93 A;  2X82 A;  2EIA A;  5HGM A;  3BP9 A;  4XFX A;  4U0E A;  4WYM A; 
#chains in the Genus database with same CATH homology
 2KGF A;  2V4X A;  2PWO A;  2M8L A;  4E91 A;  5HGN A;  1EM9 A;  1M9D C;  2GOL B;  4PH0 A;  4U0A A;  1M9E C;  4PH2 A;  4INB A;  2XGV A;  2WLV A;  3H4E A;  2M8P A;  1L6N A;  2JPR A;  1P7N A;  4NX4 C;  4DGE C;  3NTE A;  1U7K A;  1M9C C;  1M9F C;  4XFY A;  3P05 A;  1M9X C;  2LF4 A;  4LQW C;  4DGA C;  2Y4Z A;  5HGL A;  2X2D D;  4XRO A;  4U0B A;  1D1D A;  2WLV B;  2X83 A;  4HTW A;  4E92 A;  1EIA A;  4QNB A;  1M9Y C;  4XFZ A;  4U0F A;  2M8N A;  2PWM A;  2PXR C;  4U0C A;  1AK4 C;  4U0D A;  1AFV A;  5HGK A;  4B4N A;  5JPA A;  2XGU A;  1E6J P;  2XGY A;  4XRQ A;  1GWP A;  3H47 A;  1QRJ A;  4PH3 A;  2GON A;  5HGO A;  3MGE A;  1G03 A;  2XDE A;  4J93 A;  2X82 A;  2EIA A;  5HGM A;  3BP9 A;  4XFX A;  4U0E A;  4WYM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...