1M9DC

X-ray crystal structure of cyclophilin a/hiv-1 ca n-terminal domain (1-146) o-type chimera complex.
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
146
structure length
146
Chain Sequence
PIVQNLQGQMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRTHPPAMGPLPPGQIREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights into the catalytic mechanism of cyclophilin A
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase/viral protein
molecule keywords Cyclophilin A
total genus 49
structure length 146
sequence length 146
chains with identical sequence D
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2002-07-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 1m9dC00
1E6JP 1M9FC 2WLVB 5JPAA 1AFVA 1QRJA 5HGNA 2GOLB 4NX4C 4E91A 4PH3A 4B4NA 4QNBA 4U0CA 4PH0A 2M8PA 2V4XA 2EIAA 5HGMA 4DGAC 2X82A 1M9EC 2WLVA 1G03A 1M9YC 2GONA 2X83A 2Y4ZA 4J93A 4DGEC 4U0FA 4U0EA 2JPRA 4XROA 4XFYA 2M8NA 1P7NA 3NTEA 1U7KA 2PWMA 1M9DC 1M9XC 3MGEA 3P05A 4INBA 4XFXA 4WYMA 3H4EA 5HGOA 1M9CC 4XFZA 1EM9A 5HGLA 4XRQA 4HTWA 4U0DA 1GWPA 3H47A 2LF4A 1EIAA 4E92A 4U0AA 1AK4C 2PWOA 2XDEA 5HGKA 2XGUA 2XGYA 1L6NA 2X2DD 2XGVA 3BP9A 2KGFA 4PH2A 4U0BA 2M8LA 4LQWC 1D1DA 2PXRC
chains in the Genus database with same CATH superfamily
1E6JP 1M9FC 2WLVB 5JPAA 1AFVA 1QRJA 5HGNA 2GOLB 4NX4C 4E91A 4PH3A 4B4NA 4QNBA 4U0CA 4PH0A 2M8PA 2V4XA 2EIAA 5HGMA 4DGAC 2X82A 1M9EC 2WLVA 1G03A 1M9YC 2GONA 2X83A 2Y4ZA 4J93A 4DGEC 4U0FA 4U0EA 2JPRA 4XROA 4XFYA 2M8NA 1P7NA 3NTEA 1U7KA 2PWMA 1M9DC 1M9XC 3MGEA 3P05A 4INBA 4XFXA 4WYMA 3H4EA 5HGOA 1M9CC 4XFZA 1EM9A 5HGLA 4XRQA 4HTWA 4U0DA 1GWPA 3H47A 2LF4A 1EIAA 4E92A 4U0AA 1AK4C 2PWOA 2XDEA 5HGKA 2XGUA 2XGYA 1L6NA 2X2DD 2XGVA 3BP9A 2KGFA 4PH2A 4U0BA 2M8LA 4LQWC 1D1DA 2PXRC
chains in the Genus database with same CATH topology
1E6JP 1M9FC 2WLVB 5JPAA 1AFVA 1QRJA 5HGNA 2GOLB 4NX4C 4E91A 4PH3A 4B4NA 4QNBA 4U0CA 4PH0A 2M8PA 2V4XA 2EIAA 5HGMA 4DGAC 2X82A 1M9EC 2WLVA 1G03A 1M9YC 2GONA 2X83A 2Y4ZA 4J93A 4DGEC 4U0FA 4U0EA 2JPRA 4XROA 4XFYA 2M8NA 1P7NA 3NTEA 1U7KA 2PWMA 1M9DC 1M9XC 3MGEA 3P05A 4INBA 4XFXA 4WYMA 3H4EA 5HGOA 1M9CC 4XFZA 1EM9A 5HGLA 4XRQA 4HTWA 4U0DA 1GWPA 3H47A 2LF4A 1EIAA 4E92A 4U0AA 1AK4C 2PWOA 2XDEA 5HGKA 2XGUA 2XGYA 1L6NA 2X2DD 2XGVA 3BP9A 2KGFA 4PH2A 4U0BA 2M8LA 4LQWC 1D1DA 2PXRC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E6J P;  1M9F C;  2WLV B;  5JPA A;  1AFV A;  1QRJ A;  5HGN A;  2GOL B;  4NX4 C;  4E91 A;  4PH3 A;  4B4N A;  4QNB A;  4U0C A;  4PH0 A;  2M8P A;  2V4X A;  2EIA A;  5HGM A;  4DGA C;  2X82 A;  1M9E C;  2WLV A;  1G03 A;  1M9Y C;  2GON A;  2X83 A;  2Y4Z A;  4J93 A;  4DGE C;  4U0F A;  4U0E A;  2JPR A;  4XRO A;  4XFY A;  2M8N A;  1P7N A;  3NTE A;  1U7K A;  2PWM A;  1M9D C;  1M9X C;  3MGE A;  3P05 A;  4INB A;  4XFX A;  4WYM A;  3H4E A;  5HGO A;  1M9C C;  4XFZ A;  1EM9 A;  5HGL A;  4XRQ A;  4HTW A;  4U0D A;  1GWP A;  3H47 A;  2LF4 A;  1EIA A;  4E92 A;  4U0A A;  1AK4 C;  2PWO A;  2XDE A;  5HGK A;  2XGU A;  2XGY A;  1L6N A;  2X2D D;  2XGV A;  3BP9 A;  2KGF A;  4PH2 A;  4U0B A;  2M8L A;  4LQW C;  1D1D A;  2PXR C; 
#chains in the Genus database with same CATH topology
 1E6J P;  1M9F C;  2WLV B;  5JPA A;  1AFV A;  1QRJ A;  5HGN A;  2GOL B;  4NX4 C;  4E91 A;  4PH3 A;  4B4N A;  4QNB A;  4U0C A;  4PH0 A;  2M8P A;  2V4X A;  2EIA A;  5HGM A;  4DGA C;  2X82 A;  1M9E C;  2WLV A;  1G03 A;  1M9Y C;  2GON A;  2X83 A;  2Y4Z A;  4J93 A;  4DGE C;  4U0F A;  4U0E A;  2JPR A;  4XRO A;  4XFY A;  2M8N A;  1P7N A;  3NTE A;  1U7K A;  2PWM A;  1M9D C;  1M9X C;  3MGE A;  3P05 A;  4INB A;  4XFX A;  4WYM A;  3H4E A;  5HGO A;  1M9C C;  4XFZ A;  1EM9 A;  5HGL A;  4XRQ A;  4HTW A;  4U0D A;  1GWP A;  3H47 A;  2LF4 A;  1EIA A;  4E92 A;  4U0A A;  1AK4 C;  2PWO A;  2XDE A;  5HGK A;  2XGU A;  2XGY A;  1L6N A;  2X2D D;  2XGV A;  3BP9 A;  2KGF A;  4PH2 A;  4U0B A;  2M8L A;  4LQW C;  1D1D A;  2PXR C; 
#chains in the Genus database with same CATH homology
 1E6J P;  1M9F C;  2WLV B;  5JPA A;  1AFV A;  1QRJ A;  5HGN A;  2GOL B;  4NX4 C;  4E91 A;  4PH3 A;  4B4N A;  4QNB A;  4U0C A;  4PH0 A;  2M8P A;  2V4X A;  2EIA A;  5HGM A;  4DGA C;  2X82 A;  1M9E C;  2WLV A;  1G03 A;  1M9Y C;  2GON A;  2X83 A;  2Y4Z A;  4J93 A;  4DGE C;  4U0F A;  4U0E A;  2JPR A;  4XRO A;  4XFY A;  2M8N A;  1P7N A;  3NTE A;  1U7K A;  2PWM A;  1M9D C;  1M9X C;  3MGE A;  3P05 A;  4INB A;  4XFX A;  4WYM A;  3H4E A;  5HGO A;  1M9C C;  4XFZ A;  1EM9 A;  5HGL A;  4XRQ A;  4HTW A;  4U0D A;  1GWP A;  3H47 A;  2LF4 A;  1EIA A;  4E92 A;  4U0A A;  1AK4 C;  2PWO A;  2XDE A;  5HGK A;  2XGU A;  2XGY A;  1L6N A;  2X2D D;  2XGV A;  3BP9 A;  2KGF A;  4PH2 A;  4U0B A;  2M8L A;  4LQW C;  1D1D A;  2PXR C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...