1M9EC

X-ray crystal structure of cyclophilin a/hiv-1 ca n-terminal domain (1-146) m-type h87a complex.
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
146
structure length
146
Chain Sequence
b'PIVQNLQGQMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVAAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cyclophilin A
publication title Structural insights into the catalytic mechanism of cyclophilin A
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase/viral protein
total genus 50
structure length 146
sequence length 146
chains with identical sequence D
ec nomenclature
pdb deposition date 2002-07-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 1m9eC00
3H47A 4U0CA 4U0AA 1U7KA 3BP9A 5HGOA 2GONA 4DGAC 1G03A 1M9DC 4XFXA 2XGVA 2PWOA 4E92A 4XRQA 1P7NA 5HGLA 2V4XA 2XDEA 5HGMA 4INBA 2X83A 2XGYA 4NX4C 5HGNA 3P05A 3NTEA 1EIAA 2WLVB 2X82A 4DGEC 1QRJA 4WYMA 4XROA 2XGUA 4XFZA 1M9CC 5HGKA 1M9XC 4B4NA 1M9FC 1EM9A 2JPRA 2M8NA 4XFYA 1AFVA 1L6NA 3H4EA 2KGFA 2EIAA 2M8PA 2PXRC 4E91A 4PH0A 4U0BA 4LQWC 3MGEA 1GWPA 1D1DA 4HTWA 2M8LA 2X2DD 1M9YC 4U0FA 2LF4A 4PH3A 4PH2A 1AK4C 2PWMA 5JPAA 1E6JP 4QNBA 2Y4ZA 4U0DA 2GOLB 1M9EC 4J93A 2WLVA 4U0EA
chains in the Genus database with same CATH superfamily
3H47A 4U0CA 4U0AA 1U7KA 3BP9A 5HGOA 2GONA 4DGAC 1G03A 1M9DC 4XFXA 2XGVA 2PWOA 4E92A 4XRQA 1P7NA 5HGLA 2V4XA 2XDEA 5HGMA 4INBA 2X83A 2XGYA 4NX4C 5HGNA 3P05A 3NTEA 1EIAA 2WLVB 2X82A 4DGEC 1QRJA 4WYMA 4XROA 2XGUA 4XFZA 1M9CC 5HGKA 1M9XC 4B4NA 1M9FC 1EM9A 2JPRA 2M8NA 4XFYA 1AFVA 1L6NA 3H4EA 2KGFA 2EIAA 2M8PA 2PXRC 4E91A 4PH0A 4U0BA 4LQWC 3MGEA 1GWPA 1D1DA 4HTWA 2M8LA 2X2DD 1M9YC 4U0FA 2LF4A 4PH3A 4PH2A 1AK4C 2PWMA 5JPAA 1E6JP 4QNBA 2Y4ZA 4U0DA 2GOLB 1M9EC 4J93A 2WLVA 4U0EA
chains in the Genus database with same CATH topology
3H47A 4U0CA 4U0AA 1U7KA 3BP9A 5HGOA 2GONA 4DGAC 1G03A 1M9DC 4XFXA 2XGVA 2PWOA 4E92A 4XRQA 1P7NA 5HGLA 2V4XA 2XDEA 5HGMA 4INBA 2X83A 2XGYA 4NX4C 5HGNA 3P05A 3NTEA 1EIAA 2WLVB 2X82A 4DGEC 1QRJA 4WYMA 4XROA 2XGUA 4XFZA 1M9CC 5HGKA 1M9XC 4B4NA 1M9FC 1EM9A 2JPRA 2M8NA 4XFYA 1AFVA 1L6NA 3H4EA 2KGFA 2EIAA 2M8PA 2PXRC 4E91A 4PH0A 4U0BA 4LQWC 3MGEA 1GWPA 1D1DA 4HTWA 2M8LA 2X2DD 1M9YC 4U0FA 2LF4A 4PH3A 4PH2A 1AK4C 2PWMA 5JPAA 1E6JP 4QNBA 2Y4ZA 4U0DA 2GOLB 1M9EC 4J93A 2WLVA 4U0EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H47 A;  4U0C A;  4U0A A;  1U7K A;  3BP9 A;  5HGO A;  2GON A;  4DGA C;  1G03 A;  1M9D C;  4XFX A;  2XGV A;  2PWO A;  4E92 A;  4XRQ A;  1P7N A;  5HGL A;  2V4X A;  2XDE A;  5HGM A;  4INB A;  2X83 A;  2XGY A;  4NX4 C;  5HGN A;  3P05 A;  3NTE A;  1EIA A;  2WLV B;  2X82 A;  4DGE C;  1QRJ A;  4WYM A;  4XRO A;  2XGU A;  4XFZ A;  1M9C C;  5HGK A;  1M9X C;  4B4N A;  1M9F C;  1EM9 A;  2JPR A;  2M8N A;  4XFY A;  1AFV A;  1L6N A;  3H4E A;  2KGF A;  2EIA A;  2M8P A;  2PXR C;  4E91 A;  4PH0 A;  4U0B A;  4LQW C;  3MGE A;  1GWP A;  1D1D A;  4HTW A;  2M8L A;  2X2D D;  1M9Y C;  4U0F A;  2LF4 A;  4PH3 A;  4PH2 A;  1AK4 C;  2PWM A;  5JPA A;  1E6J P;  4QNB A;  2Y4Z A;  4U0D A;  2GOL B;  1M9E C;  4J93 A;  2WLV A;  4U0E A; 
#chains in the Genus database with same CATH topology
 3H47 A;  4U0C A;  4U0A A;  1U7K A;  3BP9 A;  5HGO A;  2GON A;  4DGA C;  1G03 A;  1M9D C;  4XFX A;  2XGV A;  2PWO A;  4E92 A;  4XRQ A;  1P7N A;  5HGL A;  2V4X A;  2XDE A;  5HGM A;  4INB A;  2X83 A;  2XGY A;  4NX4 C;  5HGN A;  3P05 A;  3NTE A;  1EIA A;  2WLV B;  2X82 A;  4DGE C;  1QRJ A;  4WYM A;  4XRO A;  2XGU A;  4XFZ A;  1M9C C;  5HGK A;  1M9X C;  4B4N A;  1M9F C;  1EM9 A;  2JPR A;  2M8N A;  4XFY A;  1AFV A;  1L6N A;  3H4E A;  2KGF A;  2EIA A;  2M8P A;  2PXR C;  4E91 A;  4PH0 A;  4U0B A;  4LQW C;  3MGE A;  1GWP A;  1D1D A;  4HTW A;  2M8L A;  2X2D D;  1M9Y C;  4U0F A;  2LF4 A;  4PH3 A;  4PH2 A;  1AK4 C;  2PWM A;  5JPA A;  1E6J P;  4QNB A;  2Y4Z A;  4U0D A;  2GOL B;  1M9E C;  4J93 A;  2WLV A;  4U0E A; 
#chains in the Genus database with same CATH homology
 3H47 A;  4U0C A;  4U0A A;  1U7K A;  3BP9 A;  5HGO A;  2GON A;  4DGA C;  1G03 A;  1M9D C;  4XFX A;  2XGV A;  2PWO A;  4E92 A;  4XRQ A;  1P7N A;  5HGL A;  2V4X A;  2XDE A;  5HGM A;  4INB A;  2X83 A;  2XGY A;  4NX4 C;  5HGN A;  3P05 A;  3NTE A;  1EIA A;  2WLV B;  2X82 A;  4DGE C;  1QRJ A;  4WYM A;  4XRO A;  2XGU A;  4XFZ A;  1M9C C;  5HGK A;  1M9X C;  4B4N A;  1M9F C;  1EM9 A;  2JPR A;  2M8N A;  4XFY A;  1AFV A;  1L6N A;  3H4E A;  2KGF A;  2EIA A;  2M8P A;  2PXR C;  4E91 A;  4PH0 A;  4U0B A;  4LQW C;  3MGE A;  1GWP A;  1D1D A;  4HTW A;  2M8L A;  2X2D D;  1M9Y C;  4U0F A;  2LF4 A;  4PH3 A;  4PH2 A;  1AK4 C;  2PWM A;  5JPA A;  1E6J P;  4QNB A;  2Y4Z A;  4U0D A;  2GOL B;  1M9E C;  4J93 A;  2WLV A;  4U0E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...