1M9GA

Solution structure of g16a-mnei, a structural mutant of single chain monellin mnei
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
97
structure length
97
Chain Sequence
MGEWEIIDIGPFTQNLAKFAVDEENKIGQYGRLTFNKVIRPCMKKTIYENEGFREIKGYEYQLYVYASDKLFRADISEDYKTRGRKLLRFNGPVPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Monellin chain B and Monellin chain A
publication title The Mechanism of Interaction of Sweet Proteins with the T1R2-T1R3 Receptor: Evidence from the Solution Structure of G16A-MNEI
pubmed doi rcsb
source organism Dioscoreophyllum cumminsii
molecule tags Plant protein
total genus 18
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2002-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09200 Monellin Monellin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1m9gA00
1YVBI 4N6NB 2CH9A 4ZM8A 4IT7A 1A90A 1KWIA 1FA3A 3MWZA 3IMAB 5LC7A 3SVAA 3UL6A 1M9GA 4LZIA 1WNHA 3GAXA 4N6TA 3S67A 3UL5A 3K9MC 1DVDA 3LH4A 2KXGA 1GD3A 1N5HA 1N5PA 3QRDA 2OCTA 1PFPA 1LXEA 1R4CA 3KSED 3Q2PA 1IV7A 1STFI 4N6OB 5ELUA 1IV9A 4N6V0 2O9UX 5A0OB 3PYJA 1DVCA 5ELJA 1NB3I 1N9JA 1G96A 4N6UA 5EQLA 3NX0A 3L0RA 4N6LA 1MNLA 1A67A 4CCVA 2BO9B 1GD4A 1EQKA 3PXMA 1MOLA 1FUWA 1CYUA 3KFQC 4TX4A 5LC6A 3PS8A 4N6MA 2W9QA 4EYCA 1NB5I 1TIJA 1RN7A 1CEWI 1CYVA 2W9PA 1ROAA
chains in the Genus database with same CATH superfamily
3MYTA 1RGHA 2HMMB 4KFDA 4MMZB 1BSDA 4N6NB 1S723 2UUGC 1O7PB 3CCQ3 1W02A 1RCKA 3EBTA 2KAAA 2P38A 4QWTA 1GY7A 3UB1A 2OOVA 4ZM8A 4NREA 4IT7A 1SQWA 4MMXB 3G713 2GU1A 1GOYA 1FA3A 1RRLA 4GHOA 4N3VA 3IMAB 3EB8A 1OHOA 4O3VA 1PYLA 3UL6A 3H3HA 1BUJA 1BSCA 2E2UA 2BMQB 1SARA 1QAKA 2PNCA 3LMLA 4LZIA 1X1WA 2YFIB 1W2B2 3QK9A 1UI8A 2C4BA 1I3IA 3MG1A 3LZAA 4N6TA 3PZWA 3RNTA 3WODG 2QGUA 3EJVA 1YIT3 1CH0A 2HMNB 3LH4A 1Z1SA 1I8VA 4IIAA 1RGGA 1N5HA 1W00A 3STDA 1W6GA 5AIFA 2O3OA 5I97A 3NM2A 1OF5A 3I553 2OQEA 3FKAA 2CX0A 3GZXB 1YGEA 5IW9A 3HIIA 1FGOA 4HJLB 3MKIA 4HM3B 2D42A 2HMKB 4FCZA 3A5EA 5IEPA 2FXTA 3OWYA 2XEPA 1O7WB 1WMOA 3FG3A 1HZ1A 1V74A 4NPBA 1MGWA 2AADA 2E2VA 5IG3A 1BSEA 1K8A4 4N6OB 2XGLA 1FUSA 3MG2A 2RGQA 4KZ1A 1ASKA 1GOVA 2XR8B 1BRHA 4N6V0 3X3YA 5IENA 2CWUA 1BRKA 1SJWA 3F40A 4J8TA 1QMAA 1T5YA 2RNTA 3D3LA 3DGYA 2ZA4A 3ROBA 3CCS3 1DVCA 1BNSA 3ER7A 1AV4A 4JF8A 5ELJA 3ZFZA 3NV0B 3WA3A 3CD63 3N8BA 5JPUA 1RGEA 1HYFA 3B7CA 3NBBA 4R1KA 5JPPA 2UX0A 5EEOA 1FGTA 2FNQA 1Q7Y4 4WFOA 1MWTA 2F86B 2KF6A 5BU4A 2LYXA 2Q07A 2GEXA 1OHPA 3FH1A 1GSPA 2Z7AA 3L0RA 1B2ZA 1MNLA 1LNHA 2CW9A 2BO9B 1TRQA 5M18A 2F5WA 1B20A 1E3RA 1A2KA 2WOHA 4MJDA 3AGNA 3CCJ3 1VQO3 1RN4A 3LTCA 2BU4A 1TU5A 3GWRA 3ALAA 3G0KA 3LTDA 4RNTA 4HBRA 1EG9B 4KFFA 5IG4A 4HM8B 1JJ22 3D4AA 4H3UA 5AIIA 1X1YA 1UCIA 4GSPA 5IG5A 3X3XA 2XF3A 3CU3A 3ZG0A 1G0TA 3B8LA 2SBLA 4I4KA 1D6ZA 3PGBA 4FCJA 4N6MA 1MWRA 4LMIA 1NB5I 3EE1A 3JUPA 1X1UA 5CF1A 5CLKA 1N9EA 3GZBA 1Q40A 2P09A 3HI7A 3WA2X 1PY3A 1RN7A 2BMRB 4R9KA 5M19A 5HGRA 2CWTA 3KSPA 1KC84 3LT8A 4FCMA 4HM1B 1JBTA 1YVBI 1W01A 2A15A 3DZLA 3CXC2 1RCLA 2CFKA 3CCE3 3WHOA 1LQGC 2CK3H 2CH9A 2CHCA 1VQP3 1Q814 1A90A 6STDA 3SX1A 3N9HA 1JV2B 1Q864 1JBSA 3MWZA 4L8PA 3SOAA 1BRIA 1E3VA 3K0ZA 1OGXA 3RDEA 3SVAA 5KP1A 5FGOA 4U13A 1RDSA 1VQL3 1UGIA 1C7HA 3LXUX 4JRFA 3WOEB 3FSDA 1IQ8A 2W9PA 4XBTA 5HOHA 1JN5B 1WNHA 3GAXA 3KN4A 4FMBA 2ML6A 4LSOA 1F8NA 2P05A 1NJI4 3UL5A 3FF0A 3K9MC 1BNJA 2B24B 1LQMB 4EV2A 1DVDA 2XRXB 1YVSA 4KT3B 1GS3A 4RZMA 3IJEB 5AIHA 1LRAA 1Q42A 4OVMA 2OOVC 5DREA 3SYUA 3T0UA 4AKZA 1N5PA 3FG4A 3EHCA 3B4OA 2IYJA 2OCTA 1TTOA 4DKIA 3FLJA 1BRJA 3DXOA 3U1WA 1LXEA 2STDA 1HU9A 4HM0B 2RSXA 1FUTA 4HKVB 4BIRA 4WHAA 4LGQA 2V1LA 3DGOA 1BNFA 2MF7A 1IVWA 1YNVX 1O7HB 1O7MB 1UCLA 1CQSA 5M1AA 3S29A 1AVLA 1YI23 3Q3FA 3H51A 3SEDA 1IYYA 1BNIA 1KQS2 2BIRA 2GU3A 4BL3A 1G02A 4J9AA 1DMQA 1W7CA 3T8UA 2O9UX 5A0OB 4ORLA 1RSNA 1RNBA 7GSPA 1LNIA 4CJNA 1QJGA 1YIJ3 1MWSA 4FMAA 1I0VA 1N9JA 1NB3I 2I9WA 2CX1A 3WDGB 3BNCA 2AAEA 2YFLB 1IU7A 1W6YA 3LOYA 1SPUA 2PZVA 2Z6BA 3KZTA 1PU4A 3S28A 5EQLA 3NX0A 4L8OA 3LYGA 1NU3A 1IVUA 4J5KA 1IQXA 2HMOB 3CCM3 3ECFA 2Z77A 2CFGA 2JDIH 1A67A 8CHOA 1UW1A 3Q1CA 3D5IA 2IUJA 3FG1A 4RNZA 2BMOB 5AIGA 2R4IA 3D79A 2RCDA 3DGNA 1EQKA 1UCJA 5AYSC 3CPW2 1VQK3 4MEIA 2INXA 3J7Yd 1NO3A 1TJDA 3AMOA 3NM7A 3PXMA 3UJMA 3F14A 1BSBA 1CYUA 2RBIA 1I2FA 1A2VA 4WWUC 2K3DA 4O8SA 4WP5A 1BAOA 1V58A 2JQ5A 4HOHA 4XM4A 3WMDA 4ILFA 1OH0A 1RTUA 3DGMA 3AHWA 3VGNA 1GY6A 2W9QA 3BIRA 3VF1A 3X3ZA 1BNEA 3EC9A 1OCVA 3NBJA 2KCDA 3NHXA 3O8YA 1QAFA 4HM2B 1I2GA 4R9LA 4FMCA 1ZO2A 2GSPA 2UGIA 3MPHA 1R4YA 3F7XA 1RGAA 2CC3A 4K1VA 1OF5B 1ROAA 4H61A 3NXJA 2ZDJA 2L1SA 3OXAA 4RNYA 4EC6A 2W56A 3DMCA 1L5GB 1B2MA 3EF8A 3G16A 5IF6A 2OTL3 3V92A 1IVVA 4EBGA 2ZHXB 1KWIA 5IEOA 2Y73A 1BRNL 1JNQA 2BT3A 2CKFB 3DM8A 1K41A 5BIRA 4WYKA 2HMLB 3N54B 1M1XB 2YX9A 1ROVA 3LT9A 4XBYA 2H0IA 2WOFA 1N8R4 1DETA 3JVCA 2RFRA 4BU4A 1C54A 3NBRA 1D6UA 2W03A 3S67A 2P0XA 4R80A 4O02B 3CCL3 1QVG2 3F7SA 1TFOA 1DE3A 4HM5B 3CCV3 3CC43 1BRGA 3JUMA 1ULJB 2GXFA 3WR2A 3E99A 5GSPA 1E97A 1B27A 1UI7A 3SLUA 1JKGA 1PFPA 3Q90A 3HOHA 1B2XA 1K28A 4G1MB 4PEJA 5CF2A 5AI1A 1GY5A 1R4CA 4AKYA 7RNTA 1FYSA 1LOYA 1T3BA 5CK6A 1I0XA 3Q2PA 1AVKA 7STDA 8RNTA 3CMA3 1IV7A 4CPKA 2CG0A 1BNGA 3BLZA 3K63A 4K90B 2F99A 1VQN3 3X42A 2CFLA 3BNDA 2F4YA 3CCR3 2Y74A 3AHSA 3BB9A 3DGLA 1BOXA 3AGOA 1WTHA 3CPOA 1YHQ3 1M904 4HZBB 2B1XB 1YJ93 1RGLA 3G8ZA 5ELUA 1IV9A 3BNEA 4X2OA 5IERA 1RKYA 3OWSA 2C11A 2IA7A 2ZL8A 3F8HA 3HZPA 3PYJA 1QALA 4WYKB 2R41A 1Y4KA 1MGRA 3URPA 1B21A 3V99A 1LVNA 5G2GA 1SIIA 2IUKA 1U8CB 1U5OA 4FR9A 1Q40B 1IQYA 1G96A 1NNVA 2BHMA 3FGYA 2QA43 4N6UA 1O7NB 1GYBA 1TFKA 1YGWA 3WOFB 3U97A 1IK3A 1N8QA 1RRHA 4I5QA 4XDVA 3PCSA 3K7CA 5EVHA 1JZOA 1UUVB 3FF2A 4KVHA 5IG0A 4GB5A 1B3SA 2W0QA 3IPTA 3F9SA 2GBWB 4XDWA 2LQVA 1GMPA 1MOLA 3KIIA 1D6YA 2QIYA 1WQLB 1FUWA 1EEJA 2OQEC 3EN1B 4HM6B 4HM4B 3X40A 2GEYA 2Z76A 3B4PA 1QVF2 3CME3 1OUNA 3G6E3 1A2PA 1FGMA 4HM7B 4TX4A 2K0MA 5KP3A 1UUGB 1IT7A 1RJOA 3BU4A 3GSPA 4MMYB 3SXXA 4KFEA 2W2CA 3EBYA 3KKGA 4EYCA 1K9M4 3NV0A 1I3FA 3DH2A 1AR0A 4HYZA 6RNTA 2WGOA 4CDLA 1LOVA 1T2HA 1JB4A 3JUQA 1GOUA 3DUKA 4OK0A 4EW5A 5STDA 1CYVA 2XSOB 3CNMA 4HVNA 5DRVA 1LOWA 1W5ZA 1YJN3 3CCU3 2W6JH 1RNTA 1FZUA 4BTYA 4X2HA 5CXOA 3OW22 1VQ83 2CG1A 3D5GA 3EQQB 4XBXA 3DY5A 1RLSA 3V98A 2L4VA 1JZDA 2HMJB 4XB5A 1VQ73 1I70A 1RGKA 1ZX2A 2WO0A 1FGRA 1AQZA 1JRQA 3FCSB 5LC7A 2HOHA 9RNTA 1YJW3 1FW7A 1EKMA 1KSIA 1M9GA 3S5CA 1Q824 3I563 1BGSA 2H0HA 3RGRA 2CFDA 1W4NA 3NQZA 2QEX3 3OV4A 3OX9A 1VQ93 3I0YA 4EV5A 2F98A 2XSHB 3HK4A 3MHEA 3T8NA 1T2IA 4AEQA 5D83A 1I2EA 1DYUA 1S5AA 3A76A 1JB2A 3CC73 3NQYA 1UGHI 3EN8A 3UNLA 2OTJ3 3G4S3 1X1XA 2H0GA 2KXGA 1GD3A 3MG3A 4L7KA 3QRDA 3SOYA 5BVBA 1VQ53 3JUNA 2J8XB 1VQ63 4HZ9B 2XFTA 1BU4A 4K61A 1OHSA 2IY2A 1W6CA 4IPBA 1IT8A 1GMRA 3KSED 4J5GA 2KF5A 1M1K4 1JBRA 3KCHA 3GRDA 3D9RA 1RGCA 1UCKA 1W2ZA 4LEHA 4O2HA 5KP4A 3K5TA 3X41A 1VZZA 1IVXA 3CNXA 3NUVA 1EA2A 1Q9EA 1ZS7A 1STFI 1TUHA 2WGQA 1IDPA 2M7OA 1MWUA 3AMOB 1AY7A 1GMQA 1HKXA 5D81A 5JBSA 1STDA 1V57A 1ZGXA 4K1UA 3HIGA 5AEWB 1JN5A 1Q7HA 2OWPA 4RBNA 1K734 3EX9A 3GZRA 1ULIB 1FGQA 2C10A 1KD14 1LOXA 2F56A 2FGTA 2K54A 1J2BA 2KF4A 2XGNA 4BL2A 1DMNA 2E2TA 4STDA 5FW5A 1VQQA 2D1WA 1OPYA 1RGFA 3VSYA 3TDGA 3M8CA 4LYLB 3HX8A 1ISKA 1WMPA 2BNGA 3F8XA 5AYRB 4N6LA 3MSOA 3LTAA 2CFWA 2W56B 4CCVA 3ZG5A 4Q53A 4BTWA 1BIRA 1NWWA 5BXQA 1GD4A 1B2SA 1BANA 1TRPA 1WMNA 3FZWA 1RN1A 3S27A 1DMMA 4NHFA 1RMSA 1OACA 2XFSA 1EUIC 5AEUB 3OWUA 2KRTA 2YFJB 3KFQC 1VQM3 1RHLA 1OGZA 1B2UA 2W04A 1US1A 3GZYB 3KE7A 1O7GB 1SIHA 1TP6A 3PS8A 4HAAA 5LC6A 2P0MA 2ML5A 2IMJA 1BVIA 5TGNA 2MC8A 2KF3A 1BRSA 3LTBA 1BSAA 2CIUA 1UUWB 1TIJA 1BUQA 4R4KA 5G1LA 4FMDA 6GSPA 1JB5A 4GL6A 2XH9A 3JUOA 1UDII 1CEWI 5G1KA 1BNRA 3BNBA 5RNTA 1VQ43 5D82A 2SARA 4EXRA 3CC23 3PCRA 4BTXA 3RGAA 1NDOB 2F5MA 1JKGB 2GBXB 2CWVA 4OUQA
chains in the Genus database with same CATH topology
3MYTA 2HMMB 4KFDA 4MMZB 4N6NB 1S723 1O7PB 3CCQ3 1W02A 3EBTA 4QWTA 2P38A 1GY7A 3UB1A 2OOVA 4ZM8A 4NREA 4IT7A 1SQWA 4MMXB 3G713 2GU1A 1FA3A 1RRLA 4N3VA 3IMAB 3EB8A 1OHOA 4O3VA 3UL6A 3H3HA 2E2UA 2BMQB 4LZIA 1QAKA 2PNCA 3LMLA 1W2B2 2YFIB 3QK9A 1UI8A 3MG1A 3LZAA 4N6TA 3PZWA 3WODG 2QGUA 3EJVA 1YIT3 2HMNB 3LH4A 1Z1SA 4IIAA 1N5HA 1W00A 3STDA 1W6GA 5AIFA 2O3OA 5I97A 3NM2A 1OF5A 3I553 2OQEA 3FKAA 3GZXB 1YGEA 5IW9A 3HIIA 1FGOA 4HJLB 3MKIA 4HM3B 2D42A 2HMKB 4FCZA 5IEPA 2FXTA 3OWYA 2XEPA 1O7WB 1WMOA 3FG3A 1V74A 2E2VA 5IG3A 1K8A4 4N6OB 2XGLA 3MG2A 2RGQA 4KZ1A 1ASKA 2XR8B 4N6V0 3X3YA 5IENA 2CWUA 1SJWA 3F40A 4J8TA 3CD63 1QMAA 1T5YA 3ROBA 3D3LA 3CCS3 1DVCA 3ER7A 1AV4A 4JF8A 5ELJA 3WA3A 3NV0B 3N8BA 5JPUA 3NBBA 3B7CA 4R1KA 5JPPA 2UX0A 5EEOA 1FGTA 2FNQA 1Q7Y4 4WFOA 2F86B 2LYXA 2Q07A 2GEXA 1OHPA 3FH1A 2Z7AA 3L0RA 1MNLA 1LNHA 2CW9A 2BO9B 2WOHA 1E3RA 1A2KA 4MJDA 3CCJ3 1VQO3 3LTCA 1TU5A 3GWRA 3ALAA 3G0KA 3LTDA 4HBRA 1EG9B 4KFFA 5IG4A 4HM8B 1JJ22 4H3UA 5AIIA 5IG5A 3X3XA 2XF3A 3CU3A 3B8LA 2SBLA 4I4KA 1D6ZA 3PGBA 4FCJA 4N6MA 4LMIA 1NB5I 3EE1A 3JUPA 5CF1A 5CLKA 1N9EA 3GZBA 1Q40A 2P09A 3HI7A 3WA2X 1RN7A 2BMRB 4R9KA 5HGRA 2CWTA 3KSPA 1KC84 3LT8A 4FCMA 4HM1B 1YVBI 1W01A 2A15A 3DZLA 3CXC2 2CFKA 3CCE3 1JKGB 2CK3H 2CH9A 2CHCA 1VQP3 1Q814 1A90A 6STDA 3SX1A 3N9HA 1JV2B 1Q864 3MWZA 4L8PA 3SOAA 3K0ZA 1E3VA 3RDEA 1OGXA 3SVAA 5KP1A 1VQL3 5FGOA 4U13A 1C7HA 3LXUX 4JRFA 3WOEB 3FSDA 1IQ8A 4XBTA 1JN5B 1WNHA 3GAXA 3KN4A 4FMBA 2ML6A 4LSOA 1F8NA 2P05A 1NJI4 3UL5A 3FF0A 3K9MC 4EV2A 2B24B 1DVDA 2XRXB 1GS3A 4RZMA 3IJEB 5AIHA 1Q42A 4OVMA 5DREA 2OOVC 3T0UA 4AKZA 1N5PA 3FG4A 3EHCA 3B4OA 2OCTA 3FLJA 3DXOA 3U1WA 1LXEA 2STDA 1HU9A 4HM0B 2RSXA 4HKVB 4WHAA 4LGQA 2V1LA 3DGOA 2MF7A 1IVWA 1O7HB 1O7MB 1CQSA 3S29A 1YI23 1AVLA 3H51A 3SEDA 1KQS2 2GU3A 4J9AA 1DMQA 1W7CA 3T8UA 2O9UX 5A0OB 4ORLA 1YIJ3 1QJGA 4FMAA 1N9JA 1NB3I 2I9WA 3WDGB 3BNCA 2YFLB 1IU7A 1W6YA 3LOYA 1SPUA 2PZVA 2Z6BA 3KZTA 1PU4A 3S28A 5EQLA 3NX0A 4L8OA 3LYGA 1NU3A 1IVUA 3CCM3 1IQXA 2HMOB 3ECFA 2Z77A 2CFGA 2JDIH 1A67A 8CHOA 1UW1A 3Q1CA 2IUJA 3FG1A 4RNZA 2BMOB 5AIGA 2R4IA 2RCDA 3DGNA 1EQKA 5AYSC 3CPW2 1VQK3 4MEIA 2INXA 3J7Yd 1NO3A 3PXMA 3AMOA 3NM7A 3UJMA 3F14A 1CYUA 4WWUC 1A2VA 4O8SA 4WP5A 2JQ5A 4XM4A 3WMDA 1OH0A 3DGMA 3VGNA 3VF1A 1GY6A 2W9QA 3X3ZA 4EYCA 3O8YA 3EC9A 1OCVA 3NBJA 2KCDA 3NHXA 1QAFA 4HM2B 4R9LA 4FMCA 1ZO2A 3MPHA 3F7XA 4K1VA 2CC3A 1OF5B 1ROAA 4H61A 3NXJA 2ZDJA 3OXAA 4RNYA 4EC6A 2W56A 3DMCA 1L5GB 3EF8A 3G16A 5IF6A 2OTL3 3V92A 1IVVA 4EBGA 1KWIA 5IEOA 2Y73A 1JNQA 2BT3A 2CKFB 3DM8A 1K41A 4WYKA 2HMLB 3N54B 1M1XB 2YX9A 1ROVA 3LT9A 4XBYA 2WOFA 1N8R4 3JVCA 2RFRA 3NBRA 1D6UA 2W03A 3S67A 2P0XA 4R80A 4O02B 3CCL3 1QVG2 3F7SA 1TFOA 4HM5B 3CCV3 3CC43 3JUMA 1ULJB 2GXFA 3E99A 1E97A 1UI7A 3SLUA 1JKGA 1PFPA 3Q90A 4G1MB 1K28A 4PEJA 5CF2A 5AI1A 1GY5A 1R4CA 4AKYA 5CK6A 3Q2PA 1AVKA 7STDA 3CMA3 1IV7A 2CG0A 3BLZA 1VQN3 3K63A 4K90B 2F99A 3X42A 2CFLA 3BNDA 3CCR3 2Y74A 1YHQ3 3BB9A 3DGLA 3CPOA 1WTHA 1M904 4HZBB 2B1XB 1YJ93 3G8ZA 5ELUA 1IV9A 3BNEA 4X2OA 5IERA 1RKYA 3OWSA 2C11A 2IA7A 2ZL8A 3F8HA 3HZPA 3PYJA 1QALA 4WYKB 1Y4KA 3V99A 1LVNA 5G2GA 1SIIA 2IUKA 1U8CB 1U5OA 4FR9A 1Q40B 1IQYA 1G96A 2BHMA 3FGYA 2QA43 4N6UA 1O7NB 1GYBA 1TFKA 3WOFB 3U97A 1IK3A 1N8QA 1RRHA 4XDVA 3PCSA 3K7CA 5EVHA 1UUVB 3FF2A 4KVHA 5IG0A 4GB5A 2W0QA 3IPTA 3F9SA 2GBWB 4XDWA 2LQVA 1MOLA 3KIIA 1D6YA 2QIYA 1WQLB 1FUWA 2OQEC 1QVF2 3EN1B 4HM6B 4HM4B 3X40A 2GEYA 2Z76A 3B4PA 3CME3 1OUNA 3G6E3 1FGMA 4HM7B 4TX4A 2K0MA 5KP3A 1IT7A 1RJOA 4MMYB 3SXXA 4KFEA 2W2CA 3EBYA 3KKGA 1K9M4 3NV0A 4HYZA 1AR0A 2WGOA 4CDLA 1JB4A 3JUQA 3DUKA 4OK0A 5STDA 1CYVA 2XSOB 3CNMA 4HVNA 5DRVA 1W5ZA 1YJN3 3CCU3 2W6JH 4BTYA 4X2HA 5CXOA 3OW22 1VQ83 2CG1A 3EQQB 4XBXA 3DY5A 3V98A 2L4VA 2HMJB 4XB5A 1VQ73 2WO0A 1ZX2A 1FGRA 1JRQA 1YJW3 3FCSB 5LC7A 1EKMA 1KSIA 1M9GA 3S5CA 1Q824 3I563 3RGRA 2CFDA 1W4NA 3NQZA 2QEX3 3OV4A 3OX9A 1VQ93 3I0YA 4EV5A 2F98A 2XSHB 3HK4A 3MHEA 3T8NA 4AEQA 5D83A 1S5AA 1DYUA 3A76A 1JB2A 3CC73 3NQYA 3UNLA 3EN8A 2OTJ3 3G4S3 2KXGA 5BVBA 1GD3A 3MG3A 4L7KA 3QRDA 3SOYA 1VQ53 3JUNA 1VQ63 4HZ9B 2XFTA 4K61A 1OHSA 1W6CA 4IPBA 1IT8A 3KSED 1M1K4 4LEHA 3GRDA 3D9RA 4O2HA 5KP4A 1W2ZA 3K5TA 3X41A 1VZZA 1IVXA 3CNXA 3NUVA 1EA2A 1STFI 1TUHA 2WGQA 1IDPA 2M7OA 3AMOB 1HKXA 5D81A 5JBSA 1STDA 4K1UA 3HIGA 5AEWB 1JN5A 2OWPA 4RBNA 1K734 3EX9A 3GZRA 1ULIB 1FGQA 2C10A 1KD14 1LOXA 2K54A 2FGTA 1J2BA 2XGNA 1DMNA 2E2TA 4STDA 5FW5A 2D1WA 1OPYA 3VSYA 3TDGA 3M8CA 3HX8A 1ISKA 1WMPA 2BNGA 3F8XA 5AYRB 4N6LA 3MSOA 3LTAA 2CFWA 2W56B 4CCVA 4Q53A 4BTWA 1NWWA 5BXQA 1GD4A 1WMNA 3FZWA 3S27A 1DMMA 4NHFA 5AEUB 1OACA 2XFSA 3OWUA 2KRTA 2YFJB 3KFQC 1VQM3 1OGZA 2W04A 1US1A 3GZYB 3KE7A 1O7GB 1SIHA 1TP6A 3PS8A 5LC6A 2P0MA 2ML5A 2IMJA 5TGNA 2MC8A 3LTBA 2CIUA 1UUWB 1TIJA 1BUQA 4R4KA 4FMDA 1JB5A 4GL6A 2XH9A 3JUOA 1CEWI 3BNBA 1VQ43 5D82A 4EXRA 3CC23 3PCRA 4BTXA 3RGAA 1NDOB 2W9PA 2GBXB 2CWVA 4OUQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YVB I;  4N6N B;  2CH9 A;  4ZM8 A;  4IT7 A;  1A90 A;  1KWI A;  1FA3 A;  3MWZ A;  3IMA B;  5LC7 A;  3SVA A;  3UL6 A;  1M9G A;  4LZI A;  1WNH A;  3GAX A;  4N6T A;  3S67 A;  3UL5 A;  3K9M C;  1DVD A;  3LH4 A;  2KXG A;  1GD3 A;  1N5H A;  1N5P A;  3QRD A;  2OCT A;  1PFP A;  1LXE A;  1R4C A;  3KSE D;  3Q2P A;  1IV7 A;  1STF I;  4N6O B;  5ELU A;  1IV9 A;  4N6V 0;  2O9U X;  5A0O B;  3PYJ A;  1DVC A;  5ELJ A;  1NB3 I;  1N9J A;  1G96 A;  4N6U A;  5EQL A;  3NX0 A;  3L0R A;  4N6L A;  1MNL A;  1A67 A;  4CCV A;  2BO9 B;  1GD4 A;  1EQK A;  3PXM A;  1MOL A;  1FUW A;  1CYU A;  3KFQ C;  4TX4 A;  5LC6 A;  3PS8 A;  4N6M A;  2W9Q A;  4EYC A;  1NB5 I;  1TIJ A;  1RN7 A;  1CEW I;  1CYV A;  2W9P A;  1ROA A; 
#chains in the Genus database with same CATH topology
 3MYT A;  1RGH A;  2HMM B;  4KFD A;  4MMZ B;  1BSD A;  4N6N B;  1S72 3;  2UUG C;  1O7P B;  3CCQ 3;  1W02 A;  1RCK A;  3EBT A;  2KAA A;  2P38 A;  4QWT A;  1GY7 A;  3UB1 A;  2OOV A;  4ZM8 A;  4NRE A;  4IT7 A;  1SQW A;  4MMX B;  3G71 3;  2GU1 A;  1GOY A;  1FA3 A;  1RRL A;  4GHO A;  4N3V A;  3IMA B;  3EB8 A;  1OHO A;  4O3V A;  1PYL A;  3UL6 A;  3H3H A;  1BUJ A;  1BSC A;  2E2U A;  2BMQ B;  1SAR A;  1QAK A;  2PNC A;  3LML A;  4LZI A;  1X1W A;  2YFI B;  1W2B 2;  3QK9 A;  1UI8 A;  2C4B A;  1I3I A;  3MG1 A;  3LZA A;  4N6T A;  3PZW A;  3RNT A;  3WOD G;  2QGU A;  3EJV A;  1YIT 3;  1CH0 A;  2HMN B;  3LH4 A;  1Z1S A;  1I8V A;  4IIA A;  1RGG A;  1N5H A;  1W00 A;  3STD A;  1W6G A;  5AIF A;  2O3O A;  5I97 A;  3NM2 A;  1OF5 A;  3I55 3;  2OQE A;  3FKA A;  2CX0 A;  3GZX B;  1YGE A;  5IW9 A;  3HII A;  1FGO A;  4HJL B;  3MKI A;  4HM3 B;  2D42 A;  2HMK B;  4FCZ A;  3A5E A;  5IEP A;  2FXT A;  3OWY A;  2XEP A;  1O7W B;  1WMO A;  3FG3 A;  1HZ1 A;  1V74 A;  4NPB A;  1MGW A;  2AAD A;  2E2V A;  5IG3 A;  1BSE A;  1K8A 4;  4N6O B;  2XGL A;  1FUS A;  3MG2 A;  2RGQ A;  4KZ1 A;  1ASK A;  1GOV A;  2XR8 B;  1BRH A;  4N6V 0;  3X3Y A;  5IEN A;  2CWU A;  1BRK A;  1SJW A;  3F40 A;  4J8T A;  1QMA A;  1T5Y A;  2RNT A;  3D3L A;  3DGY A;  2ZA4 A;  3ROB A;  3CCS 3;  1DVC A;  1BNS A;  3ER7 A;  1AV4 A;  4JF8 A;  5ELJ A;  3ZFZ A;  3NV0 B;  3WA3 A;  3CD6 3;  3N8B A;  5JPU A;  1RGE A;  1HYF A;  3B7C A;  3NBB A;  4R1K A;  5JPP A;  2UX0 A;  5EEO A;  1FGT A;  2FNQ A;  1Q7Y 4;  4WFO A;  1MWT A;  2F86 B;  2KF6 A;  5BU4 A;  2LYX A;  2Q07 A;  2GEX A;  1OHP A;  3FH1 A;  1GSP A;  2Z7A A;  3L0R A;  1B2Z A;  1MNL A;  1LNH A;  2CW9 A;  2BO9 B;  1TRQ A;  5M18 A;  2F5W A;  1B20 A;  1E3R A;  1A2K A;  2WOH A;  4MJD A;  3AGN A;  3CCJ 3;  1VQO 3;  1RN4 A;  3LTC A;  2BU4 A;  1TU5 A;  3GWR A;  3ALA A;  3G0K A;  3LTD A;  4RNT A;  4HBR A;  1EG9 B;  4KFF A;  5IG4 A;  4HM8 B;  1JJ2 2;  3D4A A;  4H3U A;  5AII A;  1X1Y A;  1UCI A;  4GSP A;  5IG5 A;  3X3X A;  2XF3 A;  3CU3 A;  3ZG0 A;  1G0T A;  3B8L A;  2SBL A;  4I4K A;  1D6Z A;  3PGB A;  4FCJ A;  4N6M A;  1MWR A;  4LMI A;  1NB5 I;  3EE1 A;  3JUP A;  1X1U A;  5CF1 A;  5CLK A;  1N9E A;  3GZB A;  1Q40 A;  2P09 A;  3HI7 A;  3WA2 X;  1PY3 A;  1RN7 A;  2BMR B;  4R9K A;  5M19 A;  5HGR A;  2CWT A;  3KSP A;  1KC8 4;  3LT8 A;  4FCM A;  4HM1 B;  1JBT A;  1YVB I;  1W01 A;  2A15 A;  3DZL A;  3CXC 2;  1RCL A;  2CFK A;  3CCE 3;  3WHO A;  1LQG C;  2CK3 H;  2CH9 A;  2CHC A;  1VQP 3;  1Q81 4;  1A90 A;  6STD A;  3SX1 A;  3N9H A;  1JV2 B;  1Q86 4;  1JBS A;  3MWZ A;  4L8P A;  3SOA A;  1BRI A;  1E3V A;  3K0Z A;  1OGX A;  3RDE A;  3SVA A;  5KP1 A;  5FGO A;  4U13 A;  1RDS A;  1VQL 3;  1UGI A;  1C7H A;  3LXU X;  4JRF A;  3WOE B;  3FSD A;  1IQ8 A;  2W9P A;  4XBT A;  5HOH A;  1JN5 B;  1WNH A;  3GAX A;  3KN4 A;  4FMB A;  2ML6 A;  4LSO A;  1F8N A;  2P05 A;  1NJI 4;  3UL5 A;  3FF0 A;  3K9M C;  1BNJ A;  2B24 B;  1LQM B;  4EV2 A;  1DVD A;  2XRX B;  1YVS A;  4KT3 B;  1GS3 A;  4RZM A;  3IJE B;  5AIH A;  1LRA A;  1Q42 A;  4OVM A;  2OOV C;  5DRE A;  3SYU A;  3T0U A;  4AKZ A;  1N5P A;  3FG4 A;  3EHC A;  3B4O A;  2IYJ A;  2OCT A;  1TTO A;  4DKI A;  3FLJ A;  1BRJ A;  3DXO A;  3U1W A;  1LXE A;  2STD A;  1HU9 A;  4HM0 B;  2RSX A;  1FUT A;  4HKV B;  4BIR A;  4WHA A;  4LGQ A;  2V1L A;  3DGO A;  1BNF A;  2MF7 A;  1IVW A;  1YNV X;  1O7H B;  1O7M B;  1UCL A;  1CQS A;  5M1A A;  3S29 A;  1AVL A;  1YI2 3;  3Q3F A;  3H51 A;  3SED A;  1IYY A;  1BNI A;  1KQS 2;  2BIR A;  2GU3 A;  4BL3 A;  1G02 A;  4J9A A;  1DMQ A;  1W7C A;  3T8U A;  2O9U X;  5A0O B;  4ORL A;  1RSN A;  1RNB A;  7GSP A;  1LNI A;  4CJN A;  1QJG A;  1YIJ 3;  1MWS A;  4FMA A;  1I0V A;  1N9J A;  1NB3 I;  2I9W A;  2CX1 A;  3WDG B;  3BNC A;  2AAE A;  2YFL B;  1IU7 A;  1W6Y A;  3LOY A;  1SPU A;  2PZV A;  2Z6B A;  3KZT A;  1PU4 A;  3S28 A;  5EQL A;  3NX0 A;  4L8O A;  3LYG A;  1NU3 A;  1IVU A;  4J5K A;  1IQX A;  2HMO B;  3CCM 3;  3ECF A;  2Z77 A;  2CFG A;  2JDI H;  1A67 A;  8CHO A;  1UW1 A;  3Q1C A;  3D5I A;  2IUJ A;  3FG1 A;  4RNZ A;  2BMO B;  5AIG A;  2R4I A;  3D79 A;  2RCD A;  3DGN A;  1EQK A;  1UCJ A;  5AYS C;  3CPW 2;  1VQK 3;  4MEI A;  2INX A;  3J7Y d;  1NO3 A;  1TJD A;  3AMO A;  3NM7 A;  3PXM A;  3UJM A;  3F14 A;  1BSB A;  1CYU A;  2RBI A;  1I2F A;  1A2V A;  4WWU C;  2K3D A;  4O8S A;  4WP5 A;  1BAO A;  1V58 A;  2JQ5 A;  4HOH A;  4XM4 A;  3WMD A;  4ILF A;  1OH0 A;  1RTU A;  3DGM A;  3AHW A;  3VGN A;  1GY6 A;  2W9Q A;  3BIR A;  3VF1 A;  3X3Z A;  1BNE A;  3EC9 A;  1OCV A;  3NBJ A;  2KCD A;  3NHX A;  3O8Y A;  1QAF A;  4HM2 B;  1I2G A;  4R9L A;  4FMC A;  1ZO2 A;  2GSP A;  2UGI A;  3MPH A;  1R4Y A;  3F7X A;  1RGA A;  2CC3 A;  4K1V A;  1OF5 B;  1ROA A;  4H61 A;  3NXJ A;  2ZDJ A;  2L1S A;  3OXA A;  4RNY A;  4EC6 A;  2W56 A;  3DMC A;  1L5G B;  1B2M A;  3EF8 A;  3G16 A;  5IF6 A;  2OTL 3;  3V92 A;  1IVV A;  4EBG A;  2ZHX B;  1KWI A;  5IEO A;  2Y73 A;  1BRN L;  1JNQ A;  2BT3 A;  2CKF B;  3DM8 A;  1K41 A;  5BIR A;  4WYK A;  2HML B;  3N54 B;  1M1X B;  2YX9 A;  1ROV A;  3LT9 A;  4XBY A;  2H0I A;  2WOF A;  1N8R 4;  1DET A;  3JVC A;  2RFR A;  4BU4 A;  1C54 A;  3NBR A;  1D6U A;  2W03 A;  3S67 A;  2P0X A;  4R80 A;  4O02 B;  3CCL 3;  1QVG 2;  3F7S A;  1TFO A;  1DE3 A;  4HM5 B;  3CCV 3;  3CC4 3;  1BRG A;  3JUM A;  1ULJ B;  2GXF A;  3WR2 A;  3E99 A;  5GSP A;  1E97 A;  1B27 A;  1UI7 A;  3SLU A;  1JKG A;  1PFP A;  3Q90 A;  3HOH A;  1B2X A;  1K28 A;  4G1M B;  4PEJ A;  5CF2 A;  5AI1 A;  1GY5 A;  1R4C A;  4AKY A;  7RNT A;  1FYS A;  1LOY A;  1T3B A;  5CK6 A;  1I0X A;  3Q2P A;  1AVK A;  7STD A;  8RNT A;  3CMA 3;  1IV7 A;  4CPK A;  2CG0 A;  1BNG A;  3BLZ A;  3K63 A;  4K90 B;  2F99 A;  1VQN 3;  3X42 A;  2CFL A;  3BND A;  2F4Y A;  3CCR 3;  2Y74 A;  3AHS A;  3BB9 A;  3DGL A;  1BOX A;  3AGO A;  1WTH A;  3CPO A;  1YHQ 3;  1M90 4;  4HZB B;  2B1X B;  1YJ9 3;  1RGL A;  3G8Z A;  5ELU A;  1IV9 A;  3BNE A;  4X2O A;  5IER A;  1RKY A;  3OWS A;  2C11 A;  2IA7 A;  2ZL8 A;  3F8H A;  3HZP A;  3PYJ A;  1QAL A;  4WYK B;  2R41 A;  1Y4K A;  1MGR A;  3URP A;  1B21 A;  3V99 A;  1LVN A;  5G2G A;  1SII A;  2IUK A;  1U8C B;  1U5O A;  4FR9 A;  1Q40 B;  1IQY A;  1G96 A;  1NNV A;  2BHM A;  3FGY A;  2QA4 3;  4N6U A;  1O7N B;  1GYB A;  1TFK A;  1YGW A;  3WOF B;  3U97 A;  1IK3 A;  1N8Q A;  1RRH A;  4I5Q A;  4XDV A;  3PCS A;  3K7C A;  5EVH A;  1JZO A;  1UUV B;  3FF2 A;  4KVH A;  5IG0 A;  4GB5 A;  1B3S A;  2W0Q A;  3IPT A;  3F9S A;  2GBW B;  4XDW A;  2LQV A;  1GMP A;  1MOL A;  3KII A;  1D6Y A;  2QIY A;  1WQL B;  1FUW A;  1EEJ A;  2OQE C;  3EN1 B;  4HM6 B;  4HM4 B;  3X40 A;  2GEY A;  2Z76 A;  3B4P A;  1QVF 2;  3CME 3;  1OUN A;  3G6E 3;  1A2P A;  1FGM A;  4HM7 B;  4TX4 A;  2K0M A;  5KP3 A;  1UUG B;  1IT7 A;  1RJO A;  3BU4 A;  3GSP A;  4MMY B;  3SXX A;  4KFE A;  2W2C A;  3EBY A;  3KKG A;  4EYC A;  1K9M 4;  3NV0 A;  1I3F A;  3DH2 A;  1AR0 A;  4HYZ A;  6RNT A;  2WGO A;  4CDL A;  1LOV A;  1T2H A;  1JB4 A;  3JUQ A;  1GOU A;  3DUK A;  4OK0 A;  4EW5 A;  5STD A;  1CYV A;  2XSO B;  3CNM A;  4HVN A;  5DRV A;  1LOW A;  1W5Z A;  1YJN 3;  3CCU 3;  2W6J H;  1RNT A;  1FZU A;  4BTY A;  4X2H A;  5CXO A;  3OW2 2;  1VQ8 3;  2CG1 A;  3D5G A;  3EQQ B;  4XBX A;  3DY5 A;  1RLS A;  3V98 A;  2L4V A;  1JZD A;  2HMJ B;  4XB5 A;  1VQ7 3;  1I70 A;  1RGK A;  1ZX2 A;  2WO0 A;  1FGR A;  1AQZ A;  1JRQ A;  3FCS B;  5LC7 A;  2HOH A;  9RNT A;  1YJW 3;  1FW7 A;  1EKM A;  1KSI A;  1M9G A;  3S5C A;  1Q82 4;  3I56 3;  1BGS A;  2H0H A;  3RGR A;  2CFD A;  1W4N A;  3NQZ A;  2QEX 3;  3OV4 A;  3OX9 A;  1VQ9 3;  3I0Y A;  4EV5 A;  2F98 A;  2XSH B;  3HK4 A;  3MHE A;  3T8N A;  1T2I A;  4AEQ A;  5D83 A;  1I2E A;  1DYU A;  1S5A A;  3A76 A;  1JB2 A;  3CC7 3;  3NQY A;  1UGH I;  3EN8 A;  3UNL A;  2OTJ 3;  3G4S 3;  1X1X A;  2H0G A;  2KXG A;  1GD3 A;  3MG3 A;  4L7K A;  3QRD A;  3SOY A;  5BVB A;  1VQ5 3;  3JUN A;  2J8X B;  1VQ6 3;  4HZ9 B;  2XFT A;  1BU4 A;  4K61 A;  1OHS A;  2IY2 A;  1W6C A;  4IPB A;  1IT8 A;  1GMR A;  3KSE D;  4J5G A;  2KF5 A;  1M1K 4;  1JBR A;  3KCH A;  3GRD A;  3D9R A;  1RGC A;  1UCK A;  1W2Z A;  4LEH A;  4O2H A;  5KP4 A;  3K5T A;  3X41 A;  1VZZ A;  1IVX A;  3CNX A;  3NUV A;  1EA2 A;  1Q9E A;  1ZS7 A;  1STF I;  1TUH A;  2WGQ A;  1IDP A;  2M7O A;  1MWU A;  3AMO B;  1AY7 A;  1GMQ A;  1HKX A;  5D81 A;  5JBS A;  1STD A;  1V57 A;  1ZGX A;  4K1U A;  3HIG A;  5AEW B;  1JN5 A;  1Q7H A;  2OWP A;  4RBN A;  1K73 4;  3EX9 A;  3GZR A;  1ULI B;  1FGQ A;  2C10 A;  1KD1 4;  1LOX A;  2F56 A;  2FGT A;  2K54 A;  1J2B A;  2KF4 A;  2XGN A;  4BL2 A;  1DMN A;  2E2T A;  4STD A;  5FW5 A;  1VQQ A;  2D1W A;  1OPY A;  1RGF A;  3VSY A;  3TDG A;  3M8C A;  4LYL B;  3HX8 A;  1ISK A;  1WMP A;  2BNG A;  3F8X A;  5AYR B;  4N6L A;  3MSO A;  3LTA A;  2CFW A;  2W56 B;  4CCV A;  3ZG5 A;  4Q53 A;  4BTW A;  1BIR A;  1NWW A;  5BXQ A;  1GD4 A;  1B2S A;  1BAN A;  1TRP A;  1WMN A;  3FZW A;  1RN1 A;  3S27 A;  1DMM A;  4NHF A;  1RMS A;  1OAC A;  2XFS A;  1EUI C;  5AEU B;  3OWU A;  2KRT A;  2YFJ B;  3KFQ C;  1VQM 3;  1RHL A;  1OGZ A;  1B2U A;  2W04 A;  1US1 A;  3GZY B;  3KE7 A;  1O7G B;  1SIH A;  1TP6 A;  3PS8 A;  4HAA A;  5LC6 A;  2P0M A;  2ML5 A;  2IMJ A;  1BVI A;  5TGN A;  2MC8 A;  2KF3 A;  1BRS A;  3LTB A;  1BSA A;  2CIU A;  1UUW B;  1TIJ A;  1BUQ A;  4R4K A;  5G1L A;  4FMD A;  6GSP A;  1JB5 A;  4GL6 A;  2XH9 A;  3JUO A;  1UDI I;  1CEW I;  5G1K A;  1BNR A;  3BNB A;  5RNT A;  1VQ4 3;  5D82 A;  2SAR A;  4EXR A;  3CC2 3;  3PCR A;  4BTX A;  3RGA A;  1NDO B;  2F5M A;  1JKG B;  2GBX B;  2CWV A;  4OUQ A; 
#chains in the Genus database with same CATH homology
 3MYT A;  2HMM B;  4KFD A;  4MMZ B;  4N6N B;  1S72 3;  1O7P B;  3CCQ 3;  1W02 A;  3EBT A;  4QWT A;  2P38 A;  1GY7 A;  3UB1 A;  2OOV A;  4ZM8 A;  4NRE A;  4IT7 A;  1SQW A;  4MMX B;  3G71 3;  2GU1 A;  1FA3 A;  1RRL A;  4N3V A;  3IMA B;  3EB8 A;  1OHO A;  4O3V A;  3UL6 A;  3H3H A;  2E2U A;  2BMQ B;  4LZI A;  1QAK A;  2PNC A;  3LML A;  1W2B 2;  2YFI B;  3QK9 A;  1UI8 A;  3MG1 A;  3LZA A;  4N6T A;  3PZW A;  3WOD G;  2QGU A;  3EJV A;  1YIT 3;  2HMN B;  3LH4 A;  1Z1S A;  4IIA A;  1N5H A;  1W00 A;  3STD A;  1W6G A;  5AIF A;  2O3O A;  5I97 A;  3NM2 A;  1OF5 A;  3I55 3;  2OQE A;  3FKA A;  3GZX B;  1YGE A;  5IW9 A;  3HII A;  1FGO A;  4HJL B;  3MKI A;  4HM3 B;  2D42 A;  2HMK B;  4FCZ A;  5IEP A;  2FXT A;  3OWY A;  2XEP A;  1O7W B;  1WMO A;  3FG3 A;  1V74 A;  2E2V A;  5IG3 A;  1K8A 4;  4N6O B;  2XGL A;  3MG2 A;  2RGQ A;  4KZ1 A;  1ASK A;  2XR8 B;  4N6V 0;  3X3Y A;  5IEN A;  2CWU A;  1SJW A;  3F40 A;  4J8T A;  3CD6 3;  1QMA A;  1T5Y A;  3ROB A;  3D3L A;  3CCS 3;  1DVC A;  3ER7 A;  1AV4 A;  4JF8 A;  5ELJ A;  3WA3 A;  3NV0 B;  3N8B A;  5JPU A;  3NBB A;  3B7C A;  4R1K A;  5JPP A;  2UX0 A;  5EEO A;  1FGT A;  2FNQ A;  1Q7Y 4;  4WFO A;  2F86 B;  2LYX A;  2Q07 A;  2GEX A;  1OHP A;  3FH1 A;  2Z7A A;  3L0R A;  1MNL A;  1LNH A;  2CW9 A;  2BO9 B;  2WOH A;  1E3R A;  1A2K A;  4MJD A;  3CCJ 3;  1VQO 3;  3LTC A;  1TU5 A;  3GWR A;  3ALA A;  3G0K A;  3LTD A;  4HBR A;  1EG9 B;  4KFF A;  5IG4 A;  4HM8 B;  1JJ2 2;  4H3U A;  5AII A;  5IG5 A;  3X3X A;  2XF3 A;  3CU3 A;  3B8L A;  2SBL A;  4I4K A;  1D6Z A;  3PGB A;  4FCJ A;  4N6M A;  4LMI A;  1NB5 I;  3EE1 A;  3JUP A;  5CF1 A;  5CLK A;  1N9E A;  3GZB A;  1Q40 A;  2P09 A;  3HI7 A;  3WA2 X;  1RN7 A;  2BMR B;  4R9K A;  5HGR A;  2CWT A;  3KSP A;  1KC8 4;  3LT8 A;  4FCM A;  4HM1 B;  1YVB I;  1W01 A;  2A15 A;  3DZL A;  3CXC 2;  2CFK A;  3CCE 3;  1JKG B;  2CK3 H;  2CH9 A;  2CHC A;  1VQP 3;  1Q81 4;  1A90 A;  6STD A;  3SX1 A;  3N9H A;  1JV2 B;  1Q86 4;  3MWZ A;  4L8P A;  3SOA A;  3K0Z A;  1E3V A;  3RDE A;  1OGX A;  3SVA A;  5KP1 A;  1VQL 3;  5FGO A;  4U13 A;  1C7H A;  3LXU X;  4JRF A;  3WOE B;  3FSD A;  1IQ8 A;  4XBT A;  1JN5 B;  1WNH A;  3GAX A;  3KN4 A;  4FMB A;  2ML6 A;  4LSO A;  1F8N A;  2P05 A;  1NJI 4;  3UL5 A;  3FF0 A;  3K9M C;  4EV2 A;  2B24 B;  1DVD A;  2XRX B;  1GS3 A;  4RZM A;  3IJE B;  5AIH A;  1Q42 A;  4OVM A;  5DRE A;  2OOV C;  3T0U A;  4AKZ A;  1N5P A;  3FG4 A;  3EHC A;  3B4O A;  2OCT A;  3FLJ A;  3DXO A;  3U1W A;  1LXE A;  2STD A;  1HU9 A;  4HM0 B;  2RSX A;  4HKV B;  4WHA A;  4LGQ A;  2V1L A;  3DGO A;  2MF7 A;  1IVW A;  1O7H B;  1O7M B;  1CQS A;  3S29 A;  1YI2 3;  1AVL A;  3H51 A;  3SED A;  1KQS 2;  2GU3 A;  4J9A A;  1DMQ A;  1W7C A;  3T8U A;  2O9U X;  5A0O B;  4ORL A;  1YIJ 3;  1QJG A;  4FMA A;  1N9J A;  1NB3 I;  2I9W A;  3WDG B;  3BNC A;  2YFL B;  1IU7 A;  1W6Y A;  3LOY A;  1SPU A;  2PZV A;  2Z6B A;  3KZT A;  1PU4 A;  3S28 A;  5EQL A;  3NX0 A;  4L8O A;  3LYG A;  1NU3 A;  1IVU A;  3CCM 3;  1IQX A;  2HMO B;  3ECF A;  2Z77 A;  2CFG A;  2JDI H;  1A67 A;  8CHO A;  1UW1 A;  3Q1C A;  2IUJ A;  3FG1 A;  4RNZ A;  2BMO B;  5AIG A;  2R4I A;  2RCD A;  3DGN A;  1EQK A;  5AYS C;  3CPW 2;  1VQK 3;  4MEI A;  2INX A;  3J7Y d;  1NO3 A;  3PXM A;  3AMO A;  3NM7 A;  3UJM A;  3F14 A;  1CYU A;  4WWU C;  1A2V A;  4O8S A;  4WP5 A;  2JQ5 A;  4XM4 A;  3WMD A;  1OH0 A;  3DGM A;  3VGN A;  3VF1 A;  1GY6 A;  2W9Q A;  3X3Z A;  4EYC A;  3O8Y A;  3EC9 A;  1OCV A;  3NBJ A;  2KCD A;  3NHX A;  1QAF A;  4HM2 B;  4R9L A;  4FMC A;  1ZO2 A;  3MPH A;  3F7X A;  4K1V A;  2CC3 A;  1OF5 B;  1ROA A;  4H61 A;  3NXJ A;  2ZDJ A;  3OXA A;  4RNY A;  4EC6 A;  2W56 A;  3DMC A;  1L5G B;  3EF8 A;  3G16 A;  5IF6 A;  2OTL 3;  3V92 A;  1IVV A;  4EBG A;  1KWI A;  5IEO A;  2Y73 A;  1JNQ A;  2BT3 A;  2CKF B;  3DM8 A;  1K41 A;  4WYK A;  2HML B;  3N54 B;  1M1X B;  2YX9 A;  1ROV A;  3LT9 A;  4XBY A;  2WOF A;  1N8R 4;  3JVC A;  2RFR A;  3NBR A;  1D6U A;  2W03 A;  3S67 A;  2P0X A;  4R80 A;  4O02 B;  3CCL 3;  1QVG 2;  3F7S A;  1TFO A;  4HM5 B;  3CCV 3;  3CC4 3;  3JUM A;  1ULJ B;  2GXF A;  3E99 A;  1E97 A;  1UI7 A;  3SLU A;  1JKG A;  1PFP A;  3Q90 A;  4G1M B;  1K28 A;  4PEJ A;  5CF2 A;  5AI1 A;  1GY5 A;  1R4C A;  4AKY A;  5CK6 A;  3Q2P A;  1AVK A;  7STD A;  3CMA 3;  1IV7 A;  2CG0 A;  3BLZ A;  1VQN 3;  3K63 A;  4K90 B;  2F99 A;  3X42 A;  2CFL A;  3BND A;  3CCR 3;  2Y74 A;  1YHQ 3;  3BB9 A;  3DGL A;  3CPO A;  1WTH A;  1M90 4;  4HZB B;  2B1X B;  1YJ9 3;  3G8Z A;  5ELU A;  1IV9 A;  3BNE A;  4X2O A;  5IER A;  1RKY A;  3OWS A;  2C11 A;  2IA7 A;  2ZL8 A;  3F8H A;  3HZP A;  3PYJ A;  1QAL A;  4WYK B;  1Y4K A;  3V99 A;  1LVN A;  5G2G A;  1SII A;  2IUK A;  1U8C B;  1U5O A;  4FR9 A;  1Q40 B;  1IQY A;  1G96 A;  2BHM A;  3FGY A;  2QA4 3;  4N6U A;  1O7N B;  1GYB A;  1TFK A;  3WOF B;  3U97 A;  1IK3 A;  1N8Q A;  1RRH A;  4XDV A;  3PCS A;  3K7C A;  5EVH A;  1UUV B;  3FF2 A;  4KVH A;  5IG0 A;  4GB5 A;  2W0Q A;  3IPT A;  3F9S A;  2GBW B;  4XDW A;  2LQV A;  1MOL A;  3KII A;  1D6Y A;  2QIY A;  1WQL B;  1FUW A;  2OQE C;  1QVF 2;  3EN1 B;  4HM6 B;  4HM4 B;  3X40 A;  2GEY A;  2Z76 A;  3B4P A;  3CME 3;  1OUN A;  3G6E 3;  1FGM A;  4HM7 B;  4TX4 A;  2K0M A;  5KP3 A;  1IT7 A;  1RJO A;  4MMY B;  3SXX A;  4KFE A;  2W2C A;  3EBY A;  3KKG A;  1K9M 4;  3NV0 A;  4HYZ A;  1AR0 A;  2WGO A;  4CDL A;  1JB4 A;  3JUQ A;  3DUK A;  4OK0 A;  5STD A;  1CYV A;  2XSO B;  3CNM A;  4HVN A;  5DRV A;  1W5Z A;  1YJN 3;  3CCU 3;  2W6J H;  4BTY A;  4X2H A;  5CXO A;  3OW2 2;  1VQ8 3;  2CG1 A;  3EQQ B;  4XBX A;  3DY5 A;  3V98 A;  2L4V A;  2HMJ B;  4XB5 A;  1VQ7 3;  2WO0 A;  1ZX2 A;  1FGR A;  1JRQ A;  1YJW 3;  3FCS B;  5LC7 A;  1EKM A;  1KSI A;  1M9G A;  3S5C A;  1Q82 4;  3I56 3;  3RGR A;  2CFD A;  1W4N A;  3NQZ A;  2QEX 3;  3OV4 A;  3OX9 A;  1VQ9 3;  3I0Y A;  4EV5 A;  2F98 A;  2XSH B;  3HK4 A;  3MHE A;  3T8N A;  4AEQ A;  5D83 A;  1S5A A;  1DYU A;  3A76 A;  1JB2 A;  3CC7 3;  3NQY A;  3UNL A;  3EN8 A;  2OTJ 3;  3G4S 3;  2KXG A;  5BVB A;  1GD3 A;  3MG3 A;  4L7K A;  3QRD A;  3SOY A;  1VQ5 3;  3JUN A;  1VQ6 3;  4HZ9 B;  2XFT A;  4K61 A;  1OHS A;  1W6C A;  4IPB A;  1IT8 A;  3KSE D;  1M1K 4;  4LEH A;  3GRD A;  3D9R A;  4O2H A;  5KP4 A;  1W2Z A;  3K5T A;  3X41 A;  1VZZ A;  1IVX A;  3CNX A;  3NUV A;  1EA2 A;  1STF I;  1TUH A;  2WGQ A;  1IDP A;  2M7O A;  3AMO B;  1HKX A;  5D81 A;  5JBS A;  1STD A;  4K1U A;  3HIG A;  5AEW B;  1JN5 A;  2OWP A;  4RBN A;  1K73 4;  3EX9 A;  3GZR A;  1ULI B;  1FGQ A;  2C10 A;  1KD1 4;  1LOX A;  2K54 A;  2FGT A;  1J2B A;  2XGN A;  1DMN A;  2E2T A;  4STD A;  5FW5 A;  2D1W A;  1OPY A;  3VSY A;  3TDG A;  3M8C A;  3HX8 A;  1ISK A;  1WMP A;  2BNG A;  3F8X A;  5AYR B;  4N6L A;  3MSO A;  3LTA A;  2CFW A;  2W56 B;  4CCV A;  4Q53 A;  4BTW A;  1NWW A;  5BXQ A;  1GD4 A;  1WMN A;  3FZW A;  3S27 A;  1DMM A;  4NHF A;  5AEU B;  1OAC A;  2XFS A;  3OWU A;  2KRT A;  2YFJ B;  3KFQ C;  1VQM 3;  1OGZ A;  2W04 A;  1US1 A;  3GZY B;  3KE7 A;  1O7G B;  1SIH A;  1TP6 A;  3PS8 A;  5LC6 A;  2P0M A;  2ML5 A;  2IMJ A;  5TGN A;  2MC8 A;  3LTB A;  2CIU A;  1UUW B;  1TIJ A;  1BUQ A;  4R4K A;  4FMD A;  1JB5 A;  4GL6 A;  2XH9 A;  3JUO A;  1CEW I;  3BNB A;  1VQ4 3;  5D82 A;  4EXR A;  3CC2 3;  3PCR A;  4BTX A;  3RGA A;  1NDO B;  2W9P A;  2GBX B;  2CWV A;  4OUQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...