1M9WA

Study of electrostatic potential surface distribution using high resolution side-chain conformation determined by nmr
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
98
structure length
98
Chain Sequence
ANATVKMGSDSGALVFEPSTVTIKAGEEVKWVNNKLSPHNIVFAADGVDADTAAKLSHKGLAFAAGESFTSTFTEPGTYTYYCEPHRGAGMVGKVVVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Study of electrostatic potential surface distribution of wild-type plastocyanin Synechocystis solution structure determined by homonuclear NMR.
pubmed doi rcsb
molecule tags Electron transport
molecule keywords plastocyanin
total genus 29
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2002-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1m9wA00
5B1JA 2P80A 1KGYE 1OCCB 1PZCA 1NWPA 3WNIA 1NPNA 1EHKB 1XB3A 2JKWA 4X4KA 3PAUA 4DP8X 4YL4A 4CSPA 1ASQA 4JHVA 3G5WA 2EINB 3FSAA 4NB7A 1CUOA 4YSTA 2E86A 1L9PA 4E9SA 2VM4A 1BXAA 5I6KA 3H56A 3EH3B 4NAJA 1MZYA 3FYIB 3NP3A 2VSMB 3QQXA 2ZONA 1V55B 5TK2A 4ENZA 1JZEA 1AS7A 1CC3A 1CURA 1E65A 4DP0X 1ET7A 3EH5B 2FQEA 3AG2B 1FA4A 1BQKA 3UACA 4DP1X 3FQ2A 2PCFA 4FA7B 1AAJA 2EILB 4DPBX 4E9VA 2AFNA 1KBWA 4HALA 3L45A 3NJHA 1KCBA 1HAWA 2CJ3A 3ABGA 3PAZA 1NTDA 4DPCX 1OOWA 1J9QA 3IBOA 4BWWA 1E5YA 2AZAA 4ZK8A 4DP9X 2YAPA 1NIAA 1L9TA 4YSEA 1RZQA 3T9WA 3NSCA 1PNCA 3AZUA 1N70A 4HCIA 3AG1B 3TBBA 3WKQA 4DP2X 4YSCA 2PPFA 3T6ZA 2X88A 3WKPA 1NIEA 1BQ5A 1J5CA 4GY4A 3S3BB 1KCWA 2XXFA 1AZRA 5LDUA 1SFDA 3ABLB 3MX0B 1RKRA 1KDJA 3AY2A 5EHFA 3V9CA 1AZNA 4HAKA 2YARA 1ZDQA 1PF3A 1SDDA 1SFHA 4GP8B 2ZXWB 1KDIA 4Q8BA 1PY0A 1TKWA 3UAAA 1QLEB 3IN0A 3NJMA 2LLNA 5D4IA 2WSDA 1X9RA 4FAAB 4AKOA 2H47C 4QKTA 4G71B 3T6XA 5I6OA 3NJKA 3NP4A 3FSWA 3WG7B 9PCYA 1AS8A 3OMAB 3X1GA 1AIZA 2RACA 5D4HA 2FQFA 5B7EA 2FT8A 1GY2A 3NJLA 1M9WA 3TU6A 4GYBA 4A2HA 3EHBB 1L9RA 1OF0A 3QJQB 3S3DB 2BHFA 1BYOA 2FQGA 3ABMB 4PAZA 2FQDA 4BDVB 3ZDWA 3H4FA 2N0MA 1I53A 2FNWA 4E9TA 2B08A 4BWTA 1RZPA 2VM3A 2Y1AA 1GY1A 5PAZA 1AR1B 1A4AA 2QT6A 3QJVB 3NJJA 1WA1X 2CAKA 2HLEB 2XX1A 3WIAA 1AOZA 4P5SA 5PCYA 1NICA 1PLBA 2BW5A 2IDQA 2UX6A 2FTAA 1XB8A 1A8ZA 3BVDB 3EF4A 4AI7A 4YSDA 4QLWA 4YSOA 4W1TA 1GYCA 3N2JA 2GC4C 3HEIB 5D4JA 4KO7A 3NYKA 2HXAA 5AZUA 3FU9A 5I26A 1SF5A 2VW6A 1OCRB 1FFTB 4WTQA 1JXFA 4G72B 3IEAA 1YLBB 5I6NA 4A2GA 3ZBMA 1URIA 1GS6X 4BWUA 2ZWNA 5I28A 2YQBA 1GSKA 3FQ1A 2CUAA 4AKQA 1BYPA 1MDAA 3X1NA 4AZUA 2XX0A 3NSFA 5B7FA 3JT2A 1IUZA 3UADA 1JZJA 3FU8A 3ASOB 1MG3C 2XWZA 4YVUA 1OCZB 3SQRA 2H3XC 3QPKA 1AQ8A 3DIVA 2W8CA 2HRHA 4CSZA 4YSAA 4AX3A 4GXFA 2EIJB 5AKRA 3UGEA 2DYRB 3QJTB 1HAUA 5FC9A 2WO2B 5I5MA 2BW4A 1AZCA 3GDCA 4JKNA 2NRDA 2PPCA 1ZPUA 1T5KA 2CCWA 2QDWA 4E9RA 2B3IA 1HFUA 1GW0A 4KO5A 2PP9A 2HX7A 1A65A 5I6LA 2TSBA 5F7BA 1F56A 1DZ0A 2YAQA 4NERA 3OD3A 2W88A 1BXUA 2UXVA 1E67A 2GI0A 1ZIAA 2I7SA 3ASNB 1PLCA 1WAEA 1IKOP 1BQRA 1NINA 2UXGA 1GS8A 5IY5B 2IDSA 1A4CA 4G7QB 2GHZA 2QPEB 2J55A 4K9JA 4A2EA 4UANA 5B7MA 4JHUA 4E9XA 1JZIA 4AKPA 2J57A 2PPEA 2P80D 4G7SB 1VLXA 1WA0X 4YSSA 3FYEB 5B1JC 5B1KA 1PCSA 2FWLB 1L9SA 1ZDSA 1MG2C 2FJSA 4G70B 3X1EA 3RYMA 3TA4D 1CYXA 4E9QA 2J5WA 3FU7A 2MRYA 3AG4B 2IDTA 1L9QA 1E5ZA 4W9ZA 3QJUB 3AG3B 1EZLA 2YAEA 4KO9A 4BXSV 3BQVA 1CYWA 1JXGA 4KOCA 4YSPA 1NIFA 5I6PA 2IH9A 1GS7A 2JFCA 3TBCA 4HHWA 3CVDA 2BWIA 2YAOA 1WS7A 3NSDA 2Q9OA 1AG0A 2PPAA 1SNRA 5TK4A 1IC0A 2A3TA 2IDFA 2BP0A 3KW7A 2DYSB 3AW5A 4YSRA 1KBVA 3SBRA 2EIKB 4Q89A 2FT7A 2BO0A 2XV3A 1J5DA 2FT6A 2XV2A 3TASA 2PP7A 1ET5A 1A3ZA 3FS9A 1NWOA 1X9UA 1W6LA 1J9SA 1QHQA 1WS8A 2UXFA 4N4YB 1ILSA 2J56A 3NJGA 3T6VA 2VN3A 2DWSA 3NJNA 2UXTA 4G7RB 2Y69B 1A4BA 3NT0A 5F7AA 3X1FA 8PAZA 1JZHA 2X87A 4KOBA 2IH8A 4TXVB 2BP8A 4BDVA 2XV0A 2QPDB 2PPDA 2GSMB 5E9NA 1J9TA 1AZUA 3IE9A 5ANHA 4KNUA 2HRGA 1TU2A 2BP8B 2JXMA 3NJFA 2XXGA 2R7EB 4DPAX 2DV6A 4F2EA 1ET8A 2VMJA 3GYRA 2PLTA 5A7EA 4UF7C 5B1AB 1TEFA 2GBAA 3WNJA 1J9RA 3HB3B 3GXUB 2YXWA 2GC7C 2IWFA 1KV7A 3ERXA 3SBPA 2DWTA 3N55A 1PNDA 1JZFA 1FWXA 1OCOB 4HIPA 3PAVA 2BP0B 4P5RA 4DP4X 6PCYA 2IAAC 1NZRA 4L0PB 3S8FB 4A66A 1SDDB 2OJ1A 7PAZA 2HZHA 2XVBA 3QJRB 2MTAA 3UABA 4A2DA 1QNIA 3JTBA 2OV0A 3OM3B 1TEGA 1GR7A 1W6WA 3EH4B 4KNTA 1W8EA 3OMNB 2DY2A 1AANA 4F7KA 1V10A 4DP5X 5B1BB 1SHXA 1ETJA 3FU7B 4DP6X 1R1CA 4PCYA 3FPYA 2GIMA 3ABKB 5B3SB 7PCYA 1NIDA 3T6WA 5I6MA 4A68A 3OMIB 3OQRA 2AZUA 1ILUA 1ID2A 6PAZA 1AG6A 2BWDA 3WI9A 3S3CB 2EIMB 1PLAA 4A2FA 4MFHA 2AANA 4WKXA 1NDTA 1IBZA 1OE3A 2CALA 3D12B 3V9EA 4DP7X 3H4HA 3FSVA 1SHWA 2IWEA 3DKHA 4HCGA 1AS6A 3CVCA 4M3HA 2YXVA 2IDUA 4E9WA 4EF3A 3CVBA 1JVLA 3CG8A 1BAWA 3PPSA 2PCYA 2TSAA 3UAEA 1SJMA 1M56B 2XLLA 4YSUA 2QDVA 4YVNA 2Q5BA 3NSYA 2XYBA 2H5UA 3IN2A 4N8UA 2I7OA 4HCFA 3PCYA 2BZ7A 1IBYA 3FQYA 3FSZA 1ASPA 1WA2X 1XMEB 4F2FA 1NPJA 4GP4B 4GP5B 3NJIA 2XU9A 3ZIYA 2VW7A 1BEXA 3DTUB 1E30A 5I5JA 3CDZB 1JERA 1AACA 4E9YA 1ZV2A 1L9OA 1XB6A 1ASOA 1KYAA 3CZUB 1NIBA 2I85A 4KNSA 3FPXA 3SBQA 1PMYA 2AVFA 3ZX1A 2BZCA 1RCYA 2UX7A 3S8GB 1BXVA 1UATA 2R7EA 3QJSB 1OV8A 1PZAA 3U25A 3PLYA 1PZBA 2OCCB 2XUWA 1V54B 3X2QB 1ZIBA 1JOIA 3KW8A 2YAMA 5AFAA 2HX9A 1JZGA 3T71A 2WO3B 3C75A 5I5IA 1ADWA 2IWKA 1JXDA 4KO6A 4BK5C 1OE2A 4RH4A 4M4RB 3FT0A 2VW4A 4YSQA 2PP8A 1PAZA 2VSKB 2ZOOA 1M57B 4A67A 3MBWB 3PXLA 4BXVA 2CBPA 3CDZA 1AZBA 1SF3A 3X1BA 4HHGA 1B3IA 2YAFA 1N68A 2HX8A 1DYZA 2GB2A 1MZZA 1JVOA 4UAHA 2YAHA 1OE1A 4HZ1A
chains in the Genus database with same CATH superfamily
2FIKB 4QMEA 5HI5D 5FPIA 4IGBC 3QS3A 4WU5B 4WV1C 2B16A 1J5OH 1ZE3C 4Y2LA 3TTSA 5LXGH 4IBUA 5IQ9B 4QT5B 4ODSL 3ARYA 3G6AB 4B5ZA 3I02B 1YNLH 1BFTA 3QZNA 1YEGH 4OQTH 5IB2A 2BIHA 4G5ZL 3N50A 3TV3H 5EF3A 2ADJB 3O0LA 4FL4B 4GO8A 4NO3B 4P8QA 4LHJB 2FEEI 5HDRA 4ZO8A 5C09A 1ZJBA 1INEH 4MA3A 2AJXH 4GMSH 1TKWB 2XWBB 3OV6A 4MJIA 2D7PA 3BXNB 1KT2B 1RZ8B 4PGZA 2EIBA 4DN3H 3DX0A 2VLKA 5DFWH 1AAJA 1QW8A 3L8QA 4DPBX 5JPMC 4LSRH 2OTPA 3S2CA 4H1LA 4JFFA 4MX7B 5AENA 5BV7L 2A73A 1HAWA 3PAZA 3RKPA 1F3DH 4LLUB 4LEEA 2GTWA 3ZDXB 4TTGA 4KBPA 4BWWA 4FFZA 4YXLL 3ESOA 1T0NB 2DWXA 4OU3A 5AW3B 2CNYA 5G55A 1FZJB 1DANT 1NIAA 1RZQA 3DX6A 1MCHA 4LF3A 2WCSA 3GPEA 1FNSH 4RAHA 1SJXA 3V5KA 3P0VH 1J8SA 1XIWB 2ARJQ 4HCIA 5IKCB 4U1GB 4UAOC 5G5DA 3APDA 4Y4KD 3LKSA 4I85A 1WWCA 2ZKXA 3IGFA 3V0VB 2VDQB 4XPFH 1Q9OA 5M7QA 3LY6A 3P4LA 4XODA 4K94C 1NFDF 4PWHA 3UZVA 1ZJAA 1VFOA 1YMHA 1LM8V 3EYFA 2CGZA 4QTIH 1KDIA 1RUQL 3FRPG 5DWUL 1BFVL 2QVKA 2VUKA 2XNAA 4UZSA 1MHEA 3TWCL 4ZMQA 5AYQA 1SBSL 4KK8D 2ZWYA 3F3HA 4BH7B 3FSWA 5INDB 2XG4A 1AIZA 5JMOC 5IJBC 1GC1H 2WQSA 4KVCH 3E9UA 1SOSA 5HYJE 2FGWH 1RUKL 2RBLA 1MJUH 3FUDA 2Q76B 5AYUL 4KRNA 4KI5D 3ZLQC 5IMLB 4HBCH 1IGCH 2MOVA 1RMFL 4JY4A 3ULUH 4PAZA 3VI3B 4HWBA 1JGUL 2W95A 2XWJA 5T3XL 2FYYB 4Z5RA 4Y4HA 4JFVA 5JHLL 3ARRA 1QFWI 5F1OB 4PY7B 1AR1B 4WDIA 2CHWA 2WVVB 3NJJA 3U6XA 4EIBA 4O5LH 2UZPA 1KPVB 3VGBA 4NRXB 3ENEA 3CIQA 3WIAA 3OAUH 1QATA 3QXDB 4HPOH 5JPNB 6FABL 3FO2A 4W81A 1A3QA 5FGBC 1MIMH 3DPBA 2J8UB 2WJ5A 5H37G 1KJMB 2NT1A 3DVGB 2OFQA 4E41D 2ZX5A 3KHOA 5F7KC 2K78A 4AYFB 2EE2A 5HVHB 4L9LC 4I5BA 3C8DA 1AXSB 4P23D 5DD0L 5AG8A 5C2BH 3KYNB 5ESVA 4LBAA 3O8XA 3I9PA 4R7LA 4JCWA 2AQPA 2WWMD 1JPSL 3HE6A 1IVTA 2FJHA 3O9WB 4TUOA 1NGZB 1R3LB 4HFUH 1P4LB 4H8PA 4M8RA 3GMNB 3VDAA 1T1YB 5LHDA 4MS8D 1FSKB 4ZAKD 4H26A 3WDJA 4TVPL 5IVZB 2ZOTA 4XMPH 5DO8A 5AW9B 1FYTE 2ADFL 2XWTA 4FDWA 5AZEH 3HS0C 5ICYA 3IMSA 5TE7H 2GEQA 3S34H 1DBML 3F7YB 2V2WA 5SWZE 3OWEA 3T8XB 4IGBD 4X4ZA 2VE6A 3DV4A 4M93B 3FCBA 5JHLA 2I25N 4N1HB 4EXKA 1LK2A 4TQHA 4MJ6B 4AYMC 4RA3A 3DUSB 1E8XA 3DVNB 4E9RA 2BNQD 1FZMB 1Y07A 2OM5A 5SX4H 3T3ME 1GW0A 5K9JL 2QTEA 3U82B 4HK3J 4ELME 2PP9A 4XC3H 1S78C 1MFCH 3HHMA 2VDNL 1Y18A 1C1EH 2X2JA 1CB4A 2A6IB 2BVUA 2A9NL 4WENB 5GGVL 3SZ6A 3HUJF 4WI3A 1TQUA 4PJIF 2MNJB 2ZYIA 3DVIA 5KYYB 4X9BA 3V9FA 4ODWA 4YLCA 1JDCA 1X4YA 2Y06L 2EE0A 5DMIL 3AS2A 1A4KB 3AY4A 4N0FA 4BSVB 1SM3L 1WCBA 5KYUA 4D0CA 5GJSH 1LVEA 3DK0A 3CFTA 2GHZA 4UT7L 2NDFA 2NQ3A 2QQKL 2R4SH 2P8MB 4W9FC 3X12B 4TMPA 2CDGB 1B9ZA 1DLHB 1KTCA 2P80D 2ZQKA 1M7UA 4N1EA 5DT1L 4F9PC 1BAFH 2VL5A 2X6BA 3CLEL 4L4VE 4GG8A 1H3XA 4YEEA 3NAAL 1O7VA 3MLZH 4XP4H 1ZDSA 2B3RA 4PLJD 3TBWA 3VD4A 2J5WA 1XD0A 3E6FB 1F86A 3FU7A 4XVUD 5GHWH 4A04A 1IAMA 2ZP0T 4IMLA 3SCMD 2AJUH 2IPUK 2YAEA 4DZ8A 3AU0A 3ZHDA 4TPRH 5KBMA 3IPBA 5KVGE 4FFVD 3F6JA 3T0EC 2XN1A 3GNMH 5BO1L 1DDHA 3WTYA 5A7BA 2B4CC 1NOAA 2EYSA 1TQCC 4JK0D 5DZNA 3RWIA 4LLDB 4L8BA 3V4LA 1KBVA 3I6GA 2JMRA 2F7PA 2HRPH 2XTJC 3TASA 1HDMB 5GSVB 1SJVA 4FGMA 3VH8A 1NWOA 4JZNA 15C8H 3TO4C 3OZ9L 4RFNC 2Y7QA 3EO1B 2B59B 1UYWL 3MXWL 3NCYS 3NJGA 3QULB 4PJXF 2JKJA 2VN3A 4P9MH 3T2NL 3EJCA 1F0LA 5IF0B 3U30B 4X5XA 5JTWA 3LD8B 1S5IL 4MAYA 2QPUA 1DLFL 1FI8C 3LQZB 4G42A 2GI7A 4GXUM 4Q52A 4APQC 1L6XA 3EDEA 3ZE1F 2DV6A 2AKRA 3UROR 4NN6C 3S35L 3P4OA 1FGNL 1JZ3A 2OMUB 4LVOB 1SHSA 2OP4H 3QXTA 2VT0A 2X0UA 2YPVL 2Q20A 4D9QE 1FUNA 5CBEB 4EQ2A 1AJ7H 3MLTA 4Y4KC 5LXGL 2F53A 3RWEB 2CA3A 1FYTD 1OP4A 1OT2A 3ZKXB 3GKZA 3PAVA 4ZTOH 1LWHA 4L8BB 4KK6C 2VXQL 4ZYKB 3UTOA 3WJLC 3BEWA 3LRLA 4DGVL 3HRZA 5TPWH 4X7EC 1O6VA 2MQ3A 4XMZA 12E8H 3G3LA 1DVFB 5IHLB 4CDHA 3WEXA 1H3WM 4OIIH 2G60H 3TEXA 2Y6SC 3CFJA 1P0SE 5CLYA 5F0PB 5GGTL 5DUBA 2AERT 3VGEA 1FV1B 2ENSA 1ZHKB 3OR7B 1JIBA 5EBLA 5F0LB 5EZOL 5DJZB 4DO4A 32C2B 3TF7C 2IG2L 5ADOH 3TT3L 4B9JA 3UDWC 2YKKA 2VXTL 1MJUL 3A4AA 4TTDD 1BAGA 4MKMA 3D0AA 3R7QA 3OMIB 3ULVE 1YMME 4JDZB 3UYRH 5E9AA 1ZHLA 4UV7L 3IFLH 4ZW8A 1FL5A 4ZFOA 4IIZA 1BVZA 5E8EB 1CXFA 2P5PA 3BSGA 1CT8B 3BP6B 3D85D 5BO0D 5JA8B 4R7NA 3DDFA 3IGUA 1OGSA 3MGAA 1LEIB 3NZHL 3U4KA 3U0PA 2F1EA 2XWRA 2W59A 3BMVA 1U8LA 2P5WA 4N8VA 4WFHE 4ODVH 5EF0A 5SWQB 1T6VN 5I0XA 4W9HC 3T1WA 1M1SA 1Z5LA 1L7IL 4FXGC 1LMIA 1AD9B 3W56A 2W9DH 4ZFQA 4YVNA 4MJ6A 2EKJA 3MRNA 2VISA 3IN2A 5CBAB 1TPXB 2OYKA 2W9DL 4XH2B 1QHPA 3L5JA 3WNNA 2BMKB 3CFCH 3X3FH 3T1FA 2WWKT 4PRPA 3DOSB 2VDRH 3EYUL 1OGAE 3OKKB 4X9HA 2BWQA 3SBWA 1E30A 1RLBA 2YQGA 3ECBA 3PAYA 1RVFH 2WWMC 3KXFE 2VWEC 2NLJA 2PXYD 3VX0A 2OK0L 1H3TA 4HVBA 2I5YH 3M17A 5AB0A 3L5IA 1MCIA 2VDLB 2D03L 5EOQH 5BRZE 1RHHA 3KL5A 4K3JL 4XTRD 1P4LA 5GZND 2IPUG 3VXSD 1RUPH 3A0OA 3DDGA 2NTFB 4GRWE 2EADA 3MRBA 7FABH 5IBLD 2A9BA 5L2KE 3QJFA 3N43B 3ZYJA 2HSIA 4YE0A 3T0ED 3WGVB 1PZAA 2HT4C 4LQ1A 3QRGH 4OB5H 4FQCL 5KAQF 5ID1A 3L08A 3INUL 5BOPA 4D0DA 3BUBA 2BNRD 3I3BA 4KRPB 4U1HA 4JFDB 4WI0A 4N2GA 4GXVH 4LK4A 9CGTA 2KS0A 4PJ7A 3ECVA 5KS9E 3KYOA 1RZ7L 4NDMB 3HZVB 1XCWA 3MRBB 2XWDA 2Q7AA 2WLYA 1QFHA 3C8KA 3EHBC 1KB5B 4XCFH 2XDHA 2QJDA 4YK4C 3TURA 3LXUX 3ZSSA 4XCYA 3G5ZA 3H2WA 2QSCL 3WAKA 5KVFH 1KPVA 3M17B 2C3VA 3EH2A 3S35H 5EU6D 4OQTA 4WDIB 1KPRB 5CZKA 4KUZL 2XETA 3NCCB 2CBPA 2JK5B 4NKMB 1NBVH 3EFDH 2W38A 4KJWD 3D0LA 3JVGC 2EE6A 3AXHA 1AO7B 1JVOA 1WFIA 1E7VA 3HLAA 1ML0A 3GB7A 2BMKA 4GJTB 4M9OA 4PV9A 1I4FB 1EHLH 1NWPA 5CJXA 1I1AB 1BD2E 1R3KA 3KGTA 1UD6A 1UYWH 2VZVA 4QNPE 1LILA 3MNWB 5E9DD 2FECL 5DRNB 4YJZL 4N6QA 1XGPB 4XN4A 3SDDC 2RJMA 1HC1A 3FH7A 3IKKA 2EINB 3CTTA 3EGDA 4YSTA 4B60A 2E86A 2M8XA 2OMTA 3CFNA 3EJTA 5DVNA 5SWQA 1JVKA 2W07B 2WBXA 3EDFA 3KJ6L 1EH9A 4KPHH 3U0PB 4O4YL 1MFCL 4B41A 1A7OH 4XPTL 1CGYA 1PJWA 2JJWA 4KUCF 5J13C 4F2MA 3L81A 1DQMH 2BINA 2H2SC 4IYKA 5TE6L 5C0JB 2HN7B 4IQHA 1CF1A 4ONHA 1EZVX 1VFUA 2AFNA 3AREA 2B20A 3U2SB 1GIGL 4AMWA 2Y7SA 1DR9A 5CAYB 3N06B 1G4RA 4NEHB 4JN2A 4BKTC 1E40A 4QHPA 1WZKA 1A3LL 1ADQH 5EUOB 5G5DB 2YAPA 1BIHA 1SVZA 2JSFA 5IT2H 3V5KB 3Q1EA 3H55A 3WKQA 5DZ9A 5F6IC 3QUKB 1U8KB 3HJ0A 2NY6C 2BHYA 3EOTL 4LLUA 3SHSA 3SJVE 2KL6A 3P4MB 4NWTH 1H15A 4L5FL 4JFFB 1KDJA 1HT6A 1T1ZA 3KPLA 4MX7A 4FQJH 5E7BA 4XXCC 5KANG 1F4YH 1TNNA 1G1YA 1D5ZB 1KTBA 4G9FD 2ZF8A 3CXHJ 3HRZB 1U8IA 4M1CC 3QZMA 1DL7H 3BAKA 2RTTA 1E5AA 4XHJD 4WFGE 1JZ8A 1MWAB 3KLDA 1DDTA 1SJEB 4FFZH 1BMZA 4LBEB 4LKCA 4F7EB 3EOBA 3N9GL 4LRNH 5DEZA 1EHNA 1KYFA 3DIDA 2WINB 2J1ZA 1O6SB 1IZKA 2MEJB 2Y07L 1X4XA 4P3CL 5K1NA 2C3XA 3FU5A 5E08H 4QT5A 1Q1PA 4FNRA 1BZQK 1IZJA 2AKRB 3S37X 4M00A 4DKDC 1X5IA 8FABB 4YXHH 3ZL2A 2G2NA 5LQBL 2Y6SD 1ZLUH 2IF7A 3GXFA 3FCSA 5HSFA 1JK8A 4GIAA 3UL4A 4ABWA 4ZXBB 1JPFA 3QAZB 1FH5L 4MDIA 3QXAA 4L1DA 1RHFA 5DHVA 4YBQD 3ZRFC 1E9OB 1PX8A 3ETSA 4QPEA 4KTEL 4MLIA 3PGFL 1HI6A 2WCPA 4B9FA 4DQOL 1H0DA 5CD5C 1A64A 1XR8B 3MNZA 4K07A 4N2OA 1E50A 1OD7A 1NMAH 5I1GL 4OD3H 3MXVH 2YR3A 2L0DA 2Z6FA 3FW6A 3M45A 4HUUA 1UOLA 4JFZH 7TAAA 2A74C 2O93L 4PG9A 4Z77A 3QWQB 2I27N 1G5AA 1MQKH 3WSQL 2QSCH 2IIJA 2WLJA 2B0SH 4GT7A 4Z0XA 3CFIC 5AZUA 4AGMA 4G7VL 2CA4A 1A6PA 4FL4C 1OP3K 3UBXB 3EFOB 4X6CB 3RU8L 2K6YA 4DGIH 3V0AC 3U1SH 2BS71 4D8PA 2R1XA 3VXOA 1OK8A 3GIZL 1CI5A 1TG8A 4LLMB 5CJ8A 1FZKA 1MJJA 4C4KT 1F00I 5C09E 3U6XS 2CO2A 1QYGH 4QRBA 1MDAA 4RETB 1A3LH 5AOZA 1XGQA 1JMZA 4PJ5B 2XQBH 4APXA 4EI5D 3G5XA 3PU7A 3VNYA 5C0EA 3E38A 3HI1B 3FFOA 1GZHC 3DIFB 5AW8B 4HOXA 2AJVL 4H20H 2MHAA 1G9ML 3EGXB 2UVEA 4K2UL 4LVNB 4NQEA 4R4FL 4EI5A 1NBYB 4DGYH 3QEQB 3U7YH 2K45A 2B14A 4K55A 2NZ9C 1XGTA 4ODWB 5D6CB 1EEYA 2FO4B 4ZMAT 4BCXA 4U31A 3WKML 4Y2DB 4HCRA 5GSRA 1AZCA 1UWGH 3I9IA 2QEJA 1ZT1B 4YNYB 4ZW6A 3QYMA 1CU4H 5CCHE 1ZSDA 2P48B 3AM8A 3L5WA 1HFUA 3WY3A 4ZPTB 4YX2H 2MCG1 1S7TB 2NUTB 1NSNH 3UO1L 5ECGA 1DUZB 4GSQA 4XO8A 1DEEA 3RI5K 3TO2A 1P4UA 2CBTA 4G8EA 3V0IA 5I6LA 4JFDD 5LVEA 2QV4A 2OI9B 1U95A 1QSFE 3EGSA 5C6PB 3K5SA 4OQTL 4NERA 1UZ6F 2W88A 2Q8AH 3ELQA 1KXVC 2DKMA 3EOYG 1K5NA 3MOBH 3PNRB 3S2AA 3LH9A 3D25B 4JE4B 5ICUA 4AG4L 4IOSD 2QVIA 3MV7E 5ICYB 1IKFL 5FV1L 4OQ1A 3ZRSA 3HG3A 2J57A 4G7SB 4ATTA 2O1AA 3AS1A 4BH8B 4DK3A 1DJZA 5IVZA 3HZKA 3I75B 1A8JH 4JJOA 1TR7A 2PETA 3CHSA 4LVNC 5B1KA 5C07D 3UAFA 4RCAA 5DLML 2CKBB 4XT1C 1YEFL 4OZHF 2ED8A 2X3CA 1C12B 4KQ4L 1M3IA 2HJFB 4NKOB 3SGEH 3DMMC 5I18L 4TN9A 5EULV 2D73A 4MMYA 4GKLA 2X4QB 1AXSA 2B1OA 5H94A 5TGBA 1JK9A 4F91B 5IBTH 3U7AA 1HSBB 4CBZA 5HHVH 3V6FB 4ORGB 3O11B 4U6XB 1IBGH 2YLKA 4M1CD 3CN2A 5B39A 1BG9A 4MD5A 3QZLA 5F1NA 2HT3D 2IG2H 3I9AA 4G6MH 1DQKA 2VDQL 2YD2A 2A3TA 4UZUA 4AZ8B 3ZO0A 3DROB 3QUXC 4C56B 3O2DH 4QLRA 3QA3B 5E6ZA 3T0BA 3IF1B 3QDJB 4P2QE 1P5UA 1RZGA 3W1ZA 1D5MA 4FYTA 1N0XL 1N67A 2P44B 4RWYH 4KITB 4XCEB 1KTLA 1QKZL 1QFWL 1CG9B 2WWNA 2J56A 4CA4A 2MWCA 3BAWA 2WZ6A 1A4BA 3RZCC 4X0KA 3IJSA 1DFBH 3L9EA 4U1LA 4Z5RB 2ITCB 3OB8A 2JIXA 2G0LA 2VAJA 4Y9BA 3C9NB 2OULB 5IW6A 1RUKH 4FXLA 1BQUA 2I9LB 2J1YA 1CTOA 2KC0A 4ODSH 3HMWH 4CGTA 1I8IA 4P2QA 4Z7VF 1UD3A 2R7EB 2VO8A 1VAHA 4G5AA 2Y3NA 5AG9A 4R2GB 1N4XL 4LNVA 5DK0B 4XMTA 2LHAA 5CILL 3NCMA 3OF6D 4JM2D 1MRCH 3CH1B 3V0HA 4GUPB 3GMLA 4PRHD 1KGIA 4JR9L 5GRVL 5AVVB 4WEEA 1OT1A 3VD7A 1QA9A 3ZOAA 4DGIL 4LSDA 5HVHC 5T1LB 4C83B 3MACH 3QFJD 4L29A 2R2CA 3ARXA 4FMVA 1I3UA 4X7CC 2GJPA 4QHUA 3VJ6A 4FQIL 1CD1A 4N9OB 5J6GB 4P23B 1U93A 4NQSA 1KC5H 1Z9SA 3UERA 3GMPA 4PJAE 2HCZX 2MJWA 3QJRB 2ZIDA 4ALAC 2FJGA 2JKIS 2ZOKB 4HV8B 3BVUA 1RJLB 4PJDB 2Q8AL 3W0WE 1OGPA 5L9DL 4QRUB 3MX0A 5IZ7A 2JTYA 5DQDH 1OSPL 4JQVC 2VDRB 3RNKB 5KVGH 3QCVL 4HJSA 1T2XA 1WFMA 3SQOH 3QUZD 4ZMXA 2R0ZL 3N3EA 4G9FB 5FHBH 5E08L 4L4TD 4Q9RL 3OLGA 3L3GA 5GRJH 5T1KA 3ZTNH 2XPGA 4DW2H 3QHZH 3F2LA 1T0NA 4BA8A 2CGYA 5C08B 1EO5A 3DRQB 2BOBA 4LVOC 2D7NA 2DEYX 5LQBH 1I7RA 4PFEA 4UBDC 3VWJC 4K9EC 5DD1L 5HDQH 4PJXB 2VLRD 3IE4A 5GRUL 2HVJA 4K94L 1EAPA 5DDHB 2Y1VA 3OGCB 2VLJB 4A2FA 2F1BA 4EEEA 5DDHA 3LQAC 1S4IA 4G1MB 5E70A 1BZDA 4G8AC 1S9YA 2CR0A 4MSWA 1HIMH 2CIIA 2OMZA 3WFDL 4Z3HA 2X3BA 5D7JC 2OJZH 1K6QH 2O6EA 2ADJA 2OMXB 4HCGA 4ZFGH 2V3EA 3UTTE 4J2XA 1N7MH 4RZCA 3OKNA 3T4YA 3D51A 4L05A 4TNVF 4KK5D 2PCYA 1BZEA 4DVBA 2WZ5A 3L1GA 1T1XA 1JE6A 4BZ1H 4NT6A 4FG6C 1U3HC 2H5UA 2MKLC 2I7OA 3MDJA 4HCFA 4Q0XH 1QLEL 2YWZA 2DQCL 4OV5B 2BZ7A 1ERNA 1W0WB 3FQYA 3KPRA 3UPCA 4H4NA 4GSXA 1XMEB 2YA2A 2B9BA 2WQUA 3ZTEA 2DYPD 1O6TA 1FFNA 3ZIYA 4UV4L 2BSTB 3O2VL 2B1HL 5EU6E 2R1YB 4ZD3L 3FAWA 2FWUA 4MMZB 1G7QA 1LNUB 4X6DF 2O61A 4NQVA 2A4ZA 1OTSC 3U46A 2ZXBA 1NFIA 3E6HB 1EFXA 1QSVA 3GSXB 3L3IB 4HWBL 1NEZG 3RL2B 1LO5B 3E3QE 5ERWB 3T77A 3CZKA 3GSQA 4FE9A 2Z8VC 4H25A 3VWKA 5DD0H 4M3KB 3VXRE 1R5VA 1QBBA 1N9PA 1VENA 3ARDD 3GJFH 3RY6C 3TZVA 2WXNA 3O4LB 3ZE0F 4AT6B 4WO0A 3FUJA 4GKNB 5AVTB 1FFOA 4L3FA 5FW8A 5MERB 2OJEA 3O3AB 1ROWA 4H2CA 3C75A 4LCYA 4WLCA 1HXMB 4H1LG 1JXDA 4XBEL 5FOBB 1KTLB 5INCA 4KO6A 3OHXC 4PY8J 1OW0C 2QKSA 5T3ZE 2HRLA 3HHRB 5CINH 5A1AA 3MJ9L 3K8LA 2Z91A 1M57B 4NN6B 4UOQA 4PB9H 4DPRA 3LDBC 4Z76B 3QIBB 1AZBA 4NBXB 1E4XH 3B3IB 1T2JA 4JG5A 3S37L 1B3IA 3JV5A 5ABDE 3EFFA 2CCLA 4OFIA 3ULVF 5AZ2L 1MFVA 3GMOA 5D7IA 1MELA 2YAHA 1N2RB 3SY0B 1B0WA 5H8DA 5B1JA 3B9AA 3VFNA 3MFFA 3CFBA 5BXFA 2ZP9A 5KUKA 4UQCA 3H42L 3WNIA 4U49A 1KG0B 3N44F 4HUWB 3UTSB 1I85C 2IADA 4ZW5A 5D7JD 5E1AB 1TO5A 2VOTA 4JFEE 4XMVA 4IKNA 3FSAA 4KV5F 1CGVA 1RK0B 3CV5A 2ZG2A 4M43L 4JRXE 3IDIA 3VFTB 1PIFA 1J05A 2YMXL 3MJ8A 4ODXB 2QLYA 3RWCB 5D2LB 4OFDA 3NP3A 3AAZA 4AVHA 5H4ZA 1WK0A 3HMWL 2G3MA 4RGMC 4MB3A 1ND0B 4AV0A 4ICWA 2NY2B 1M7DA 2F08A 2FB4H 3A3YB 3TJHD 1CGTA 1I82A 2Y1ZA 4KX7A 3WKNA 5ANMB 1F18A 5F1NB 1KBWA 2P42B 4JFED 4OKVA 3ULVD 4AG4H 3ZE1B 4PG2A 1NLDH 5IFJA 5ITFA 4ZK8A 4NKIL 4U3CA 2PUQT 5E8PA 3UPRA 3TO2B 1CXKA 1CXHA 5AOMA 3FT1A 4ZPTA 2CLRB 3AG1B 4XB8A 4I88A 1QBLL 5E1AA 4TUKH 3VAEA 4AC4A 1GYUA 1A22B 1X7QB 4GY4A 2JIXD 3K8KA 3JTSA 1PIGA 4WTWA 1T04B 3UTQA 3VFNB 4F15B 1G7MB 3GMMB 2XKNB 4S1SL 4EN3B 3SY0A 3RWFB 1AZNA 4NGHL 1PEWA 4LSVL 5HDWA 4X98B 5HY9A 1SFHA 3FTGB 4IIQC 4PRHB 2F5AH 3QFJE 2BOCA 5HHME 2DLHA 3QDGA 4G6JL 4P2RB 2YKLL 3J7HA 4O2FB 1QACA 4JKLA 1CGSH 4PCSA 1MJ7H 3R1GH 4G8GB 4KGLA 1ZA3A 2QPSA 2V9UA 2EZ0D 4PRNA 3T6XA 2F0CA 1KLFB 3RWGA 4A2MA 4R0LC 2D2CC 2DH2A 3X1GA 1JF1A 1EA9C 2X7LA 4NQTA 2O5ZH 3VXRD 1FC2D 1TQVA 5F3HA 2EQDA 3IS1X 1GY2A 5E8OB 5IGXH 1VGKB 4K73A 3GGWB 4LFHG 2V2TB 1QSEB 4S0SD 4PEEA 4A2HA 2XBTA 3RTQB 3F7KA 5F1KC 3W0WA 3OL2A 4H0HB 4H13C 3S3DB 4DIXA 5BMFL 5K69A 2XXMB 3GFUA 4YFEA 2BVEA 5D5ME 4NO0D 4ZFZB 2B08A 3Q1SL 3Q8EA 4MJ2A 4P23C 1U8CB 2FX7L 3D85A 5FHAH 5LBVA 3WXVH 3MV9E 5F7FA 2Z4QA 1H0DB 1URLA 3LZOA 4TLUA 5I16A 1MVUB 2XN9B 3AREC 3EDKA 4LZKA 4U1JB 5HJDA 3FB6A 5BV7H 1V27A 4FCAA 2E5EA 4NQVB 4CADB 1B6DA 1GC1C 1WUNT 5HYFA 1D5IL 3I9GL 1KB3A 3RDTC 1E2WA 1JV5A 2AV7A 4UBDD 2YPVH 3V4VA 5JQ6L 1MKFA 1X5GA 3DX3A 4YC2C 5MEPA 3FCSB 1TDQA 3ES6B 3PL6B 4KY1H 5ALBH 2EVJA 2IDCA 3SKJH 3L3JA 4A7QA 2HXAA 3VXUA 2W0FA 4G6KH 1ZV9A 2H0JA 3DHPA 1A2YB 1SF5A 3KNBB 3KPRB 4ONOA 4YBHA 4JVWA 1FFTB 3F83A 1SMOA 3VO0A 1D7CA 3IEAA 5CR8A 3SDAA 4E0RB 1WJ3A 1KNOA 4FQ1H 3KXFA 5KOMC 4JFFE 3VXUD 2NY7L 1R3HA 3WIIL 1MCWW 3BISA 3SOBL 2AEOA 1U8HB 3B7UX 4A39A 2QKIA 1X4ZA 1YYLL 3TS8A 1FC1A 4FTVE 3AT9A 1D2OA 3SB3A 1SY6L 1W15A 5IMMB 1WTGT 4XX5A 1NMBH 3TGXA 1BQLL 2X41A 3SE6A 3VXSA 3RKDC 3IMWA 1KELL 3V0GA 3BPNB 4JFQA 1LO2L 4XNYL 3UTSE 1VACB 2XQBL 4P2AA 5I6XB 3B2UD 5CSZA 4OCSH 1O0VA 2DWEB 1SZNA 5IVXF 1OP5K 3DX8A 4WWKB 3NCWA 3IPEA 5GGSB 1MCKA 1SXSA 4ZOBA 3NACH 5IMKB 1J9CT 2E74C 4G8FA 2BK8A 1E6JL 1G7PB 2BOBB 4X8JA 4HIXL 3BEVB 5I5MA 3WTUA 3RPIB 5EN2B 4Y1AB 3SBWC 5FKPB 1OQOA 4N2AA 2QQLH 4OF7A 4NZJA 5CMAA 4ZMVA 5ACLA 5MEND 5DJCA 3Q01A 3MRIB 4XPGH 2BNQE 3CU7A 4G9FA 1R9FA 4XC1H 3B56A 4JO3L 1EAOA 4XO3A 2JWYA 1TCRA 1ZVYA 1D5XA 2ZX7A 3B7YA 4ABVA 2DIJA 2YD3A 1DZ0A 3G6DH 2HG5A 3O45A 2OYLA 5DZOA 2D3NA 2FBJL 3M1BA 4JFHE 4LRIC 4RAVB 4WHYH 4HIEB 3TJHC 2D0GA 4PVNA 5FYJE 4DZBB 1NINA 5C0JA 5CJOH 4HZLA 2OP4L 4P2RE 4GW1A 5LBSA 5C0BA 1EXGA 4CC1A 1KCSL 4R4BB 4I8DA 3RWJA 3MOQA 3MLUL 1HH6A 1CICB 3QARA 4HWUA 3D8MA 2VR6A 2FRGP 4QAMB 1WZ1H 5B1JC 5EORH 4JFXA 1XZWA 2X4TB 3CLEH 4LNRB 5EBMB 1K2DA 1NJ9B 3CZGA 3JBG7 1XGPA 2KQNA 2FSEA 3C6EA 1KIUA 2ZUVA 3Q2LA 3VDCA 5KJ7E 1L9QA 3B6SB 1QEXA 1S7XA 2XY2A 4FQ2L 4BINA 3IETB 3VYPA 4BXSV 5EO0B 2H1PH 3CC5A 4O58H 3UDWA 4ABUA 2KI6A 3U6RB 5AAMC 4D8OA 4GLRI 3TBCA 3SKNB 4AUJA 4W9GC 4G80A 3K6DA 5I8KH 1UA6H 3AS3A 3WL9B 1G0YR 5TK4A 1UM4H 5E8DH 1JF5A 3F5WA 5KEZA 5KYXB 2WLZA 1W72A 2ZX6A 5EV7A 1BEYH 2FT6A 2EABA 3T3MB 1XF4A 4X6BA 3UTZB 5IIEB 2WXHA 3G5ZB 3QDGD 2QLVB 4XCNA 3QUHA 4JRWA 3H2PA 2V2XB 2WXOA 4MNGE 1NGQL 2Z1KA 2I07B 3DROA 4R5XA 5J7CC 5H35B 1NGXB 3RKDD 1L7TL 2IPTL 4ZTEA 1RFDH 2Z8RA 4KK6D 1NCHA 4MD5B 2XV0A 2AQ1A 3B1TA 2DF3A 2PPDA 2GSMB 4JBSA 5DFAA 5E9DA 3OKOA 1S7QA 3S5LG 3B7SA 1QP1A 5EZPA 1TU2A 1HSBA 4PVLA 5B3JF 2AEQH 2ZCLL 5JHBA 2XIDA 5IMOB 4HFWB 5AOIA 1TQTA 5H94B 5TGBB 3FNKA 4NRYA 4OGYL 5J9PA 1KENL 1K3IA 3VGFA 1W2KT 1A6AA 4V11A 2EDWA 2DQHH 2HJFA 1T5WB 4PJFE 5B1AB 4TVPE 1GGTA 2GJ6B 4AQOA 4XP1H 2FLRT 4Z7QB 3QEUB 4HIXH 1YMMB 4GQPH 4MLSA 4WI5A 4XP6L 5HI3C 3RDTD 5E5RB 3W38A 4MRCA 5IHHA 4QYOB 5AW7B 2R2EB 3SPJA 2WC7A 3FT3B 4G9FE 1UA3A 2CJUH 2FWOA 3F5WB 1PZ2A 1H8OA 2D4DA 1DCEA 2PTUA 3QQDB 4WJ5B 5GGRB 3I6KB 5I1JL 5D2NC 1E27B 4ZS6C 3VQ1C 2WPGA 6PCYA 1OAKH 3D1MC 3HMXA 2FZ3B 4N0UE 5DHDA 1MRFL 4G8GD 1TVBB 3S8FB 4XOAA 3TO4B 4RGNC 3D25A 2AK1L 4J3VA 3HG1D 3C6SA 3MNDA 4KMTL 3PWJB 1MXGA 4GRMA 4Q14A 2Q3ZA 3OTTA 4XH2A 3MREA 2WMPB 1GR7A 4PTUB 1OHQA 5H37H 3ROOA 3D4YA 3OMNB 4HIHA 5ENWA 3BWSA 1F42A 4Z18A 1QI5A 5DMJB 4G8EB 1XF1A 2TRHA 1DQJA 5B1BB 1DEEB 3J27A 3RUGB 3ZE0B 3B5TA 5GS0L 3AB0C 2NUTA 3TJEH 4XMKL 1MEXL 4K7FA 2YGQA 4RGNB 5E23A 4PRPD 4DWHA 1NIDA 1HXYB 3R4RA 3OPZL 4Y2DC 1HH6B 2E9JA 4L3EE 2AZUA 1NCUA 4GSDL 4R7NB 2P8LA 5C0CA 5IWLC 3WUWG 1ZGLA 2Q7YA 3BP6A 3DRTA 1PLAA 2B4CL 3RJDA 1NBYA 2DZEA 4KJWC 2YRLA 2YPLE 2DMHA 1E2VA 2IAMD 4JCLA 4WKXA 2X6VA 4PJCA 4KZDL 1NDTA 3W39A 2XTJD 2P7TB 2VLLA 5I75B 2CLZA 4P2QD 1E3FA 4MJJA 3W9DA 4AQ8A 5MHSD 1S9VB 1VFBB 5B1CA 4NWUL 4MXVE 3BH9B 2IWEA 5JYMA 1DSFH 3CVCA 5E1IA 4EOWL 2D31A 3MROA 4M7JL 1G7LB 5CGMA 5I66B 2VMDA 5D6DA 5I1CL 1DJIA 2DMKA 4XNZC 1EX0A 1QRNA 1ZHKA 5EBLB 4ANKA 3GTNA 4D7PA 3HCVA 3QNYA 4N8UA 5EA0L 1MDTA 1FFPA 1KLUA 3PCYA 4M6MH 5DJ8A 4ZMPA 3HFML 4HX1B 1ZLSH 3U1PA 4HQQL 3W9EA 4HEPG 4HJ1A 2W9EL 2WBWB 3VB8A 5IEKB 1BP3B 2MCPH 5E2VL 4M6AA 3U0WH 5KVDE 1L7TH 1IAOB 1AR2A 1WT5A 3L2MA 3BP5A 2BY0A 3MODH 3JSSA 4JQIH 5T5FL 1KY6A 1JERA 2DQGH 1M71A 4LDOB 4GUQA 5D7KD 4Q6KA 4F9PA 1XR8A 3MNZB 2PR4L 1I3RA 3RP1A 2Q3XA 2HJLB 1E8WA 1C5CL 3ELAT 1D9KB 1NBQA 1TZGH 3DARA 4M7LT 4NKDA 4ZTOL 2XQYA 4L9DA 2JCCA 4HGWB 1ONQA 1U8HA 2VRQA 2YGVA 3NGBC 5EOQL 4JJ5B 5DD5L 1IT9L 4W6YB 4U3SA 3RRQA 4XNYH 2OMUA 3S88L 4PRPE 5E99L 3QJOA 4N2DA 2KPNA 3CVHA 1OV8A 3FQRB 1DQLL 3QQ4A 4ZS6D 3E8UL 4Y1SA 2H32H 4D7BA 1PZBA 3DUUB 4G42B 2PWDA 2XZQL 4B0MB 1OOAA 4PM1A 1ZIBA 2QMJA 5G4MA 3PWPE 1KBBA 3PL6A 5IHZB 3BZ5A 5ALBL 5AFAA 5F9DC 3CVHB 3FQRA 4JGNA 2XZQH 3BT0A 2OR9L 4N26A 2GKIA 5DFVD 4EDWH 2HG0A 3S97C 5ITBL 2EUWA 3U4BL 1ADWA 2Y7QB 1RZ7H 4IKJA 4CMMA 5TE4H 1ESOA 4YZWA 3D3VA 4X8XA 5FUCC 3CDGA 3TT1L 3I2CH 3ZDYF 4YFLI 5I16B 1YNTF 2X89A 1TJIL 3PDDA 2DEXX 2HJLA 2HPTA 1J48A 4JFOA 1YYLH 3ZR6A 3V4PL 4AL8H 2OLDA 4BXVA 1S2EA 5C0CD 3GHPA 3WS6C 4LLAA 1V5JA 2Q8BH 1FRGL 5DSCB 3QDMA 3BKML 4M56A 5I0ZA 2Y5QA 2IPKB 2IANA 5AD0B 5FO9A 2AJZB 3RTQA 2DL2A 1I3VA 3N44B 4KMLB 2X9XA 4L1HA 1H15B 3OQ3B 1ZA6B 3HE6C 2OMYB 4OKDA 1VGKA 2IBGA 3B9KA 3MCG1 1ODUA 5TD4A 4UIKH 3IMUA 1NPNA 3IDNA 3T8VA 5BS0D 3IAGC 4ZNCD 5EBWB 3ARTA 3VD0A 5JNYB 1P4IH 1QRNB 4DP8X 5I1EL 5DVMA 4HW6A 1RVFL 2EP6A 1SN2A 2JKNA 3C2AL 3RFZA 3CMOH 1T7ZA 5BMFH 4J3XA 1JF6A 3NIDE 2VDRL 5I6KA 4X9FA 1YZZA 3FYIB 4M7JH 3RIFK 2VSMB 3QQXA 3W5NA 3HAEB 4N8PA 1DLHA 4P3WA 4LCVA 2WSKA 3KZ8A 1M2VB 5SV4A 4FLRA 3UACA 4U1SA 5DUMH 3LMJH 5JOPD 2VQ1A 2EDXA 2EILB 3VMOA 3FQTB 5BZDA 5F88A 4MMXA 2J6WA 1NC2D 3L45A 3P3TA 4NNXA 3DYMA 3UTQB 3CPUA 1MRDL 3JWOC 3OKLA 1HKLL 3QIWD 1JHKH 1J9QA 3APNA 2EVHA 3MRHA 2K1MA 4MB5A 5F7DB 3SDCD 2K6ZA 4NM4H 4O2EB 4X5WB 5DI8B 3VXMB 1ZS8B 5A16A 5I1DB 5E5LA 3NSCA 3GMQA 3RVXD 4JM4L 2WXGA 4IDJH 4W9LC 1HHJA 2NUPB 4JN1L 2VLJD 2YOCA 1U58B 3TCTA 1S7RB 1NIEA 3U7WL 4NKIH 3SGJA 2R29A 2MCAA 1GZHA 3EO9H 1M6UA 2VSCA 3IJ8A 1QBLH 4LIQL 4NHCH 2H3NA 3ZRCC 1ZDQA 1P4BH 3GIZH 3W11D 4S1RL 3VGGA 3IU3B 3E8UH 5GRXG 3UAAA 1QLEB 3BCDA 2G3NA 2EEXA 1AIFA 5CEXB 1IAKB 1BBJB 4AKOA 4NZTH 2DS4A 3BIKA 4N1CA 3OBAA 5I6OA 3NJKA 2EYRA 4HF5H 1I7ZB 1TEYA 3TVMD 4ODHH 3UYRL 3PP4H 3HC3H 4HSCX 4QRFA 1QSZA 5FK9B 5D55A 1J1OL 5F72S 4PJ5E 2CJTA 2EYTA 4JAMB 1A6AB 4P99A 1NCDH 2VZ1A 4PJ7B 2BC4B 1P5VA 4R83A 4NO5A 1JMXA 5BNXD 5HD8D 1IL1A 4NC1C 3KS0J 1JWUB 3QJQB 3C2SA 5BVPL 5FO7B 3SD2A 3ABMB 2J25A 5ID1B 2X4NA 1A3RL 2X1WL 4FZ8H 2IMMA 4HJJH 1AY1H 3QDME 2PO6B 3GI8L 5F6IB 1ES0A 4PJ8C 1DBJH 1TTFA 3R0MA 5B3JE 1J8HA 1MNUL 2VDLH 5CGYC 5L8JB 5FF6A 1MIML 3F7RA 1UCBH 4QGTA 2VXQH 1XF4B 1DVXA 4X6BB 4XMXA 1HXMA 3UTZA 3K91A 4PY7A 2KZBA 3EBAA 3EF4A 4LSSL 3UPAA 4QLWA 5KZCB 4ZXBC 2ROYA 3BWAA 4FOMA 1DHKA 4HSAC 1BA9A 3I74A 2A9ML 4KO7A 3T0VA 5F7EH 1X7SA 4AUYA 3H7BA 4CVZA 4UT9H 4BSWB 2C26A 2NOYA 4LVEA 5GRJL 4DAGL 2TAAA 4OI7A 4PJIA 5CP7A 2AK1H 5CD3B 2P45B 4UT9L 1JGVL 3WXWH 2G2RA 4UILL 3R4DA 1Z5LB 2VO5A 5DQDL 1BYPA 4AZUA 2QVMA 2YD1A 2LTQB 2Y5TB 3W82A 4HDIA 4U0QB 5GS0H 5B7FA 2ZX9A 2CHZA 1LEIA 2RIKA 4XO9A 1GKOA 3ASOB 4KJYA 3SQRA 2ALAA 2H3XC 2UYLB 1TTRA 3PWNB 1FFQA 4DO6A 4ZG1A 1AYOA 3PWUB 4OCXH 3TPKA 3QNZA 5AB9A 5I73B 2VQ4A 1Y0LB 2HG5B 3O45B 4TRPL 4HJEA 5GS1B 2CCVA 3LDBB 1ZPUA 3AADB 4P2CG 5I5RA 4DVBB 2VC2L 2IPTH 2X2IA 2QHRL 3MV11 3DYPA 5L2JA 3D05A 2EVFA 4J12A 3THML 4XNXL 1N3NA 4FF9A 3VNZA 4GG6A 5F96H 3GBLA 3KPQA 4NZTL 5CMAB 2CMRL 1UFUA 2BNRE 3E8VA 3UYPB 2TSBA 3X13A 2BCKB 4M8QB 4Y5VC 4ZFGL 5A3IC 3GUTB 4LAJH 1WBYA 2BRRH 4LCWE 1I7TA 2H3KA 4JY6B 3I85A 4OGYH 1PLCA 4BZ1L 1U3YA 1JP5A 3DX8B 4HCRH 3D07A 1WO2A 2VJ0A 1KUMA 1KN4L 1A4CA 3GXDA 4A2EA 2J55A 5E03A 4EDXB 4E9XA 1T0MA 4P3DB 1UZ8A 5DC2A 2A38A 4OH2A 4ZTPL 1MJ8L 1CD0A 4M48L 1U4EA 4YDLB 1B4TA 5DYOA 5I8OL 2BS9A 2XPGB 4Z7IA 4MAZA 3TA4D 2YD9A 5LBGA 1NQBA 2JELH 4YQXL 2DICA 1E5ZA 3KXFB 3UC2A 2BCMA 5K9KA 1J88A 4ZMLA 1YNLL 3L3DA 4APQB 4KO9A 4PSPA 3BPCA 3MLYL 5F89A 2BNQB 2F54B 4QRUA 1PG7L 1UH2A 4ZFFA 1GS7A 2DOCA 4FLHA 2CNZA 4LSSH 4P2OA 4AVIA 3QZPA 4FMFA 2R0LH 2VLMD 2R0ZH 4P23A 2KDYA 5CZVL 4HFUL 4PG2C 3HUJA 3QULA 4PREA 4JQVA 4WFEE 3KYMB 4AYSA 3SKMA 3FS9A 4HIJA 2Y7MA 4TTDC 1N6QH 3CVIH 4R7VA 3VUAA 1JPEA 3VH8B 1FNEB 1XMWA 3P73A 3IJYB 4RA0C 4I3SH 3FUFA 2Y7NA 4HGMA 3Q2NA 2HT4D 3NT0A 4LLDA 3QC5X 2O5ZL 4HAGA 4A6YL 2Y22A 1DZBA 3DHJA 3KPSD 4AGQA 3CSBA 1I1YA 4Y7MA 4AV4A 3MLXH 1REIA 3IDXL 1FRGH 4ANUA 1QFUH 3QIWC 1ANUA 1AGFB 2GJJA 1AMYA 3PP4L 3BP7B 4AEIH 3U48A 1E8YA 5I24A 4PBWD 5C7XH 4LCIH 1B0RA 1RUMH 3E6FA 1T4WA 4OF3A 5HPMA 1U8MB 3TBWB 1MAJA 2LW3A 1J1XL 1JWMA 4J6RH 1BV8A 4OUOA 4C56A 1U8PB 4JR9H 3KPRD 2Z92A 1FO0L 5DFTA 3IRPX 4O2FA 2O5YH 4NZUH 4Y0GA 2N1KA 5BRZB 1RUPL 3H9SB 2BOCB 2PR4H 4G9DB 4Y5XA 5D1ZC 5ALCL 4YS4A 5B39B 1QQDB 3NABH 2GITB 4HEPA 3VFVB 5D7HA 4EI0A 4PWGA 3QWRD 3QUMB 5IBTL 5CGTA 4U1KA 4K7PL 4JJHA 4ZI8A 4LHUD 2B5IC 2A6IA 4YHPA 4DP5X 4R5TA 5AUMB 3TZVC 5JQHC 4XVJL 1C8QA 2Z31A 4Y2OA 1NGYB 1Q9LB 3IRCA 3DMMD 1QLFB 3P2BA 5HHVL 1BBDH 3TH4T 3PWVB 2NY7H 2Y72A 5HD8C 4FG6D 4BHUA 3FN0L 3FT2B 2FH6A 2BSBA 1F02I 1N0XH 1UB5A 3FB5A 3Q44A 5F0MB 4RWYL 5ESAB 5KN5B 1ZT4B 4D3CH 3F7YA 1HWWA 3RFZC 1OAJA 3UBXI 3UGXA 5T1KD 2L7EA 2LAAA 3S36X 4UMSA 1HEJC 1OAQL 5K59E 1TLKA 5JZ7C 2PCPA 3KPMA 3JV6A 2WO4A 2JJTA 3WE6B 2ETWA 3VFTA 2LOEA 1A4JB 1AS6A 1CDUA 3HPLA 1UQSB 4G1EB 3VVWA 2Z93B 1G9NL 1S7TA 2WXQA 1IGYA 3PHOA 5CILH 4NWUH 4PJ7F 5AUMA 2HLFD 2QDVA 4MJIE 5KW9H 1U92A 4LO9A 4Y2DA 4KZDH 2AV1B 3FQXA 4JO1L 2OMNA 5I8CB 3QO1A 4MA7H 3ZTCC 1ZWIA 1XGTB 4PWEA 2BOLA 1A1OB 1Q94B 3FOLB 1MWAH 3HJEA 3P9MB 2Y5EA 3DXAD 2ESVA 1ZVSB 2K6WA 4HC1L 4XAKE 5J1AB 1KYUA 6TAAA 3U4EB 3QNFA 3JTTB 1T66C 3VXRB 1U8PA 4QO1B 2X4UB 3K2IA 2Z91B 2WP3O 1SXBA 1HEZB 1AZVA 3STZB 2XV6B 2ZOUA 3QXDA 5C0EB 3LKPA 3MODL 1KCRL 2HLAA 4NO2A 5J6SA 4GAJL 3QPQD 3SPVA 1PU0A 2P28B 5INCB 5ADPL 3WTWA 1AO7D 1B0RB 4DGVH 1MAKA 1U3HD 3SKJL 2GW5A 4A38A 5F9JB 4PJ8B 5C3IA 1UCBL 2BIQA 3MCYA 4GNKB 3DURB 4JRFA 2E6PA 1IBFA 2DQGL 5DYFA 4OCXL 5HYJD 1F4HA 2ZKWA 1DJYA 1N19A 4JB9H 4PR5B 4ZTPH 4OZGF 1FP5A 2AF2A 3EH1A 1NLDL 3SDDB 3MA7A 5E99H 1QLRB 3I6LE 5EPMB 3U0TA 5MEQB 1U2HA 4P5KA 4MD4A 3WOVA 3OX8B 4IRJD 4KKCD 4NAQA 5E4AA 3FBQA 3GSQB 4UV7H 4KQ4H 1O7DE 2PWFA 3NMEA 4E5XG 1XGRB 3APMA 3JYCA 3RL2A 2VDPB 3SDYL 3HE7A 4BK5C 5J57B 2OYMA 4FI6A 2NY6D 3TESA 2EE9A 4LDLB 1YJDC 4OD1H 4FERA 3G5YB 3RB5A 1L0XA 4AXWB 3PXLA 1CI3M 4YR6B 1JK8B 1JZDC 3CUPA 4HHGA 3PG2A 2YA0A 1YMHB 1EVUA 4YHNB 3MSPA 2QVFB 1RFDL 1XCXA 1HNGA 4HZ1A 5AW4B 4K8RL 3WV0A 5KTEH 3AU1A 1SRDA 3MJ7B 5LAXB 2OTWA 4F7PA 1XSKA 1SM3H 4FFTA 3S9DB 3QI9D 1ITBB 2BIMA 2OYPA 3PAUA 1QLEH 2DW5A 4WUUD 3BN3B 5L6YH 1GHFH 1YPZA 4WNSA 4JGUA 2JQZA 5D1ZA 2BXYA 4RZCB 4URTB 3MV8B 2FHCA 5HGBA 4L9LB 2ENYA 1WGVA 2YPKA 2NPLX 1NKRA 4WKZA 3US9A 3RZCA 5TK2A 1DQDH 1YSOA 1AP2B 1CFMA 1W91A 4PGEA 1MLBB 5AW0B 4ENZA 3WHXB 4U6YB 2E7HA 4JEGB 3AG2B 3MRPA 1D5ZA 3R0NA 3C08H 4PRDA 3NZSA 5CWSB 2HVJB 1T2QH 5DR5H 2XWBA 4K5MA 3FO0H 4XP4L 3NN8B 1UWYA 3TNMB 1MLBA 2C8NA 3DRQA 1SEQH 2WLIA 4P5TA 3MV8A 4MYPA 1HHGB 4I3GA 2GFBB 4CSSA 2R2BB 2BERA 3SYQA 3DO4A 1F4YL 3Q6GH 4ZMZA 4XBEH 3ZKNC 1CLCA 4AMKL 3V8CA 3D34A 2AAVA 3MJ7A 3H6JA 4M6NL 2I24N 1TETL 1Y0LA 5IREA 3AY2A 4QTIL 3JUZA 1RJCA 4HV8A 4PJDA 4PGDA 4ONHB 3GMPB 4QDGA 4GP8B 3WD5H 4XE0A 4JG1H 4YUEH 4H2AA 1CFBA 3ZTDC 1WFOA 1BQHA 4V1DB 1CL7I 1MCOH 2Y2TA 3MV7A 4AJYV 4RFOH 4LOFA 2OMTB 4ZJ9A 1I1RA 3I50H 1CD8A 3PP3K 4B9KC 2YA1A 3NIDB 3MKGA 3I3EA 1QTSA 2C1PA 3EO0B 1DUYA 3K72B 4FHKA 5T3ZD 3QIUD 3LHPL 5HI4D 2FT8A 3LZFL 1I1AA 4PJIB 2XFXB 3FAXA 4UI2A 4A2LA 1NM4A 4K3EL 4ZODA 5MEOA 1TXKA 1XXFC 2FLMA 3H7BB 2CIKA 1X5YA 4CVZB 4OGAD 3T4AC 5IESH 1XH3A 1L9RA 4IS6A 2HFGH 5FDYA 1FSKC 1WPCA 3TIEB 2XHNA 2ITEA 2YD5A 1EZUA 4X0KB 4KKLC 4EZMA 4QWWC 4S2SB 3H9SD 3TN0B 1AHWC 1ZTXL 1FJ1A 2J1WA 4LEBA 4XXDB 2WB7A 1OLLA 3BT2H 3LJ3A 1BW8A 3ABZA 1A7OL 3O81A 1AOZA 1WBXB 1W0VB 3EADA 5F7WC 3UAJD 3VU1A 1ETZB 1LXMA 4U3XA 3QA3A 3HS8A 2L7UA 4WUKH 2FTAA 3LVTA 1Q1JL 2APTA 2ADIA 3MN8A 2P5EA 1Z7JA 1EDYA 1J87A 4TQEL 2BNUA 1NCGA 1XX9C 2GQHA 2PO6A 3VFOB 1JZ7A 2ZXDA 3DWTA 4KH2A 1VKXB 1N5AB 5KVGL 4PMFA 5I1LB 3ILPA 4YLQT 1IFHL 2NYYD 3WUZA 3TT3H 2BC4A 1HX0A 1CXIA 2N56A 3FCTA 1XEUA 1VA9A 3PHOB 1YN7B 3K6NA 3QE5A 1GSKA 1UQSA 3QR1A 4G1EA 2EYRB 5IQ7L 1TTUA 1LEKB 1RHHB 4LL4A 4W6XB 2WXRA 3WE6A 1A6WH 2Z34A 2Q6WB 1QWHA 2C4FT 3FRPB 1BBJA 1GKEA 5JO5A 1CE1H 4XHQA 5B38B 4I87A 1MG3C 5C0IB 1A1NB 3VVVA 3KCPA 3WIFB 1JJUA 1E5UI 3INOA 2ATPB 4P4RA 5EMYA 1SY6H 3DIVA 4NHUA 1J0KA 3WFHA 2WKLA 1E43A 2BVQB 4Z7QF 3DOSA 2H3NB 1AKJA 3F65A 1IGJA 4AQ1C 1J1PL 1B4LA 3D30A 1W80A 3RDTB 4FXKB 4GO9A 1YEDA 2CRYA 4MQSB 2ZUQB 4YHML 4Y4HD 3ZK0A 1MFDH 1U58A 1HESA 2ZUYA 4LHUG 3CD4A 4PTTA 1FDLH 4BV1A 4EXPX 1QLFA 5JPMA 3HBPA 1EEQA 2JH2A 3GMQB 1R5WB 2DQTL 2DKSA 2X9YA 3CHPA 4ZUWA 3L5WB 2WCGA 1A6ZA 1N59A 1IQDB 4LSTH 1P9MC 2WKOF 5C07E 4LARH 4D94A 4KV5E 1KCKA 3QUMA 4JQIL 3B5HA 3ULSB 2UXVA 4YDIH 1GGUA 4LGRB 3MGOB 1KZYA 4NQXA 4YDVA 2BIOA 4Y1AE 5BCAA 1RUML 4EI5B 1NBVL 3VD9A 4UANA 2ORBH 3LZLA 2NY6B 5LCVA 2VRAA 2X10A 4XZUA 4EUPH 4Z95H 1RPQA 4QJ3B 3FYEB 3K71B 1XGQB 4PJ5A 1JWMB 1P84J 5FB8B 1J0HA 3S5ZA 1ZLVK 5J89A 2ZP8A 1OAXL 32C2A 4GRLB 5DJXA 5I76A 2KUTA 2WP3T 3ARDB 3T2PA 3MBEB 3ALPA 3IDNB 4W4OC 3EOAB 4CSTA 2N7SA 5C71A 4IEFA 1SBSH 3OAWA 5HGAA 5DLMH 3U79A 1EXUB 1AOHA 4KOCA 5D96C 1ZOXA 2F7IA 5C0BE 5DQJB 2VXTH 5CLWA 4JFPB 1F3DJ 5D1QA 1CDBA 1AGBB 1YN6B 3WEOA 3MUY1 2MKWA 2IH3B 4C8XA 2N01B 2NY5H 4OZGE 1DBAH 2DTSA 3II1A 2XV3A 2VDNB 4NOFA 1UWXH 3MYJB 4G6JH 4PB9L 1W6LA 3LRKA 3QHFH 5CBEA 4CMMB 3LKOA 5GRVK 3WKMH 5DEFA 5TF1L 3SE3C 2ATAA 1U36A 3BC9A 4AYGA 3CFDA 1NDMB 3EW3B 3EIFA 3HUJB 4PW4A 1FG9C 2NZIA 1D7DA 3BO8B 3X1FA 8PAZA 4DKAA 4YX2L 1KN2L 2Q0ZX 1I8LA 3BAYA 1H6UA 4TXVB 2BP8A 4P2OB 5DS8B 3FUHA 1BZ7B 1UGNA 3GSOB 3G7TA 4LPCA 8FABA 2GSIB 2BP8B 5DS8A 1MLCA 4KKLD 1CTMA 2IJ0C 3FB8B 3MI6A 4Q6IA 2FL5B 2APBA 2DYPA 2NY4D 4UF7C 1Q0XH 1UT1A 4HS6A 3FC8A 5K1JA 3T0EB 3LZFH 2CH8A 3RPKA 2AABL 1B2WL 1JGLL 2LV4A 3F7LA 3V6OA 3ZKND 3P9LA 4AE1A 1U0QA 2NMSA 3ERXA 3GSRB 4QXWA 1ZLWK 2RAMA 1I7UA 1YQ2A 1FZOA 2P8PA 2V8MA 4IU2B 5B8CC 2NYKA 1MWAA 4R96B 3UBGA 4FJ6A 3SGDH 4ACPA 3BP4A 5T3XD 2CJUL 4B27A 1SQ2N 4Y9GA 1CGUA 1MH5B 2HZHA 3PS6A 1G1OA 3BFQG 3JWOH 5D93C 2L04A 3G08A 1U30A 2OV0A 4CUCA 3MUHL 3CN0A 4IEFB 4F7KA 3GUTA 1DANU 1L3NA 2WXPA 1QI3A 5I0VA 4IMLB 3WGUB 2HP4A 4HOWA 2Q1EA 2BP3A 3BFWA 5CIPH 3L3HA 5AWNL 5L2JB 4GAAA 2CM6A 3UO8B 4XNAA 1C16A 1CZ8L 2NW3B 1X5KA 2ZYSA 1AFVL 2HH0L 2JLLA 4PV1C 1X9LA 3PGFH 1YY8A 3OZ9H 2P7TA 2Q86A 3V5DB 2A6JB 2AXFA 3IAPA 4XWGH 3N85L 5C1MB 2P1YA 3FTXA 5GGVY 4BSVA 35C8L 1G6RB 3VI4F 1WFTA 1D5BA 4QWWD 2YD7A 1IBZA 2BDNH 4J3BA 3MV9A 3NRPA 2PYFB 4P3CH 1UT2A 1Y1UA 3NCJL 4PVBA 1JWSA 3A6BH 2W07A 3BKJH 5JIIA 4MJ4A 1HL8A 4MNQB 5GGVH 5IQLA 3VD5A 2PF6A 1HQRA 3PV6B 1M42A 1E4WH 2VWEE 3APFA 4TVPD 7CGTA 2E7BA 2TSAA 3PPSA 5C86A 2G2RB 1BMWA 2XLLA 4P46D 3DVNA 2WKGA 2R0KL 4HIHB 1RMFH 5ENWB 5GGUA 2ADGA 1V7ML 4PV9B 4XN7A 4J3OC 1AQKH 3MCLH 4TNWK 2HFFA 1G5GA 3KYAA 2VDKH 3BN9C 5FGCB 5IQNA 1Q9KB 3L1OH 4OZIF 1KLGB 4IW4C 1G87A 3T2LA 2IAMC 1A7RL 2E27L 1WGOA 4S10A 1YG9A 4MZIA 4MA1C 4Y9CA 4P4RB 1G1CA 3IWUA 4AIEA 3OR6B 4FHBD 4WJ5A 3CH8A 3O41A 5GGRA 4WK0B 3SYAA 3D4CA 5JO5B 3EJSA 4JO3H 4LOUD 3WLBB 3SYPA 4MS8C 5GGRY 3LPPA 3QDGE 3KPSA 4ODBD 4OT1H 3KBPA 3R18A 2C9VA 2ICEA 3DXAA 43CAA 5KYNA 1F1DA 1MRFH 1NCCH 5DTFA 5B21A 3VFSA 3FPXA 1J5IA 4HH9B 4LOVA 2AVFA 3WFZA 1E2ZA 1DVZA 1DBKL 1CGWA 3KYOB 1J0YA 2PMZA 4BFRA 2V5RA 2Y36L 3GRWH 3PIQB 3U25A 4Q9QH 4BELD 1TU2B 4LU5H 4ZMOA 1DSYA 1JWUA 4J6IA 1RSFA 2BVPB 3X2QB 2YZ8A 3DSFH 2ZKYA 2YAMA 1EK3A 5JPNC 2EC9U 3T2QA 5H35A 1MSPA 2DIBA 3ZKXC 2G3ZA 3SPHA 2OSWA 3FO2B 5LCVL 1ZHNA 1KFAL 1K8IB 4H40A 3S48A 2DQUL 2X9ZA 5F0JB 2YOAA 4TLTA 4BZ2L 4L2LA 2HFTA 2QR0A 5BOZG 4PGCA 1TJHH 4JO1H 5IWLA 3UP1A 3CSGA 3QHTC 2B9AA 1VZGA 2NLJB 1P7BA 3PE9A 5AWNH 2OJZL 3TN0A 3RIFF 3O41B 1KTRL 4IRSA 1XQ4A 2XA3A 5FYKE 3ZT5A 5LBSH 1WVZA 4QJ4B 5SWSB 4JHWL 4M6OL 5D71H 3TIEA 1E6JH 1AVAA 4UAHA 1OE1A 3ESMA 1NCBH 4HU8A 1ZXKA 2HFFB 3Q2VA 5C0AB 1XGZA 2GUOB 1XTMA 1KCRH 4MMXC 5HYIA 3CX5J 2WSPA 2OX5A 2VISB 3WDIA 5C0FB 5TF1H 4PRAA 5JHDE 4KHTH 4UYPA 2K8QA 3LH8A 1OCWL 4WJKB 2QFPA 4AEIL 4O2EA 3VXMA 2AK4E 5G4OA 3VWKC 4XN5A 5JORA 4KVPA 4PJHE 3EH3B 4OJDH 5D72L 5FDWB 1CICA 1MHEB 3RL1A 1V55B 3D09A 4MMXB 1QKZH 2FE0A 3KWWA 4R4BA 1Q0YL 2ZAHA 4RESB 3S3PA 4MD0B 5EU5A 3V6BR 2IO5A 4PI0A 4U3HA 1J12A 1FL5B 4L3AA 4DGUA 4E9VA 4RAVA 1WEJL 4ERSH 1UVQB 1FAKT 3PREA 4HK0A 1YY8B 1GYWA 2H0FA 3OC5A 4JG0L 1WH0A 3LKSB 1TCRB 1E5YA 1YVLA 2AZAA 1JN6B 1YYCA 3WN5B 1OZUA 1J5HA 3HRZC 1PZ5B 4LF3B 1EGJH 5DJCB 2WY3B 2ZPKH 3QEQD 3BIAX 1BVNT 3KPSE 4YSCA 4XWOC 4V33A 3HW7A 1T6BX 1SFDA 1JCKA 1G7PA 2Q2EB 4MQTB 4F58H 5J4MA 4KZEH 1EAJA 1WD9A 1E4XI 4JUTA 4X6DB 3ULUE 1UWXK 4N9GA 2BJMH 4B9CA 1NUDA 1BQSA 3MA9L 1TKWA 3U9WA 3NJMA 1HL9A 3C5JB 5D4IA 4XAKD 3ZKMC 4IU2A 2A9CA 3J07A 1B2WH 1JGLH 3HG1A 3H85A 2V3FA 4Y16B 3TEUA 1QTPA 3CDGB 1SLVA 3KPOB 3NP4A 1HE8A 9PCYA 2NR6D 4RLDA 2OSLB 4I3RH 3T0WA 3GM8A 5D7LB 1C5BL 5G4NA 1XH2A 3JWNC 5D1QD 1IAII 5E8NA 2WK2A 3CN3A 5AAPA 3DK2A 2EKSA 3MR9A 4LB8A 1N18A 2FIKA 2XA8L 3O2WL 4PS4L 3UO1H 2DI9A 1X6NA 3VXUB 2FSDA 2X70B 1FDLL 4GEIA 2IFFL 1V7NL 2P47B 3I50L 1I53A 1SJHB 1WZLA 2WYTA 4PJAB 3QZOA 5AW6B 3ZXAC 1XSIA 4KVNH 4RMRA 2R9HD 4HULB 5F96L 1IEBB 4D9RE 3LMJL 3Q7JA 3G5YA 4JGMA 4U3SB 2E75C 1RPUA 3STLB 4Z9KB 3P4NB 4NN7B 3TC9A 4JFYA 5FHAL 1BZ9A 3NCFB 1R5IB 5DHXB 3V52H 5PCYA 1RAMA 1MCWM 1NAKL 3BAEL 4B6ZA 1PQZA 3H3PL 4XXCA 4K15A 3FTZA 2D7OA 3FTSA 3INUH 3BVDB 4MNHB 4AI7A 1LE9A 1WYJA 3WLWC 4OGXL 4W1TA 5AW5B 1SEBB 2ICES 2GC4C 3GSVA 2WQWA 5C3LD 5IEKA 1HILB 5BZWA 4KKRA 5SX5K 3KXFD 1RZFH 3ARZA 1O5PA 4TQEH 1IAIL 4ZO6A 4H88L 1OGAD 3QO0B 2BPBA 3AQDA 2QFRA 1UD5A 1M1XA 3UYOD 1INDL 2HA1A 1ACYL 2WXJA 2XIBA 2CZNA 5FM8A 2ZUTA 1F8TH 4GRLA 4WFFE 2AI0H 1MCCA 2E7LC 1M3JA 1X9QA 4NPYA 1G7LA 1IEAB 3V5HB 4E5XA 4Z95L 4OZIA 3X1NA 4PRBB 1V8HA 3UJJH 4HUXA 3ZY7A 1KEMH 3BH9A 4PRNB 4CILA 4I0PB 3K0WA 1S9VA 3QWOA 4O02H 1T03H 1MN4A 3GQFA 1EHAA 4RSVA 5TE4L 2UUDH 1QD0A 4TSCL 4AK1A 4P2RA 4H44C 5AOJA 1FN4A 3V6OC 1M7IA 4HG4J 4MZ2A 4Y16D 1OQXA 1Q94A 1H8SA 1J8HE 3IJ9A 3QVAA 3UGEA 1T4KB 1F90H 3QJTB 3DECA 3L4CA 3WY4A 5KYYA 2DQUH 2EE3A 3MRFA 3MV8D 1BJ1J 3NFPB 4WEBL 4ESKA 3QYNA 1GGIH 4BE6A 2V5YA 1XD1A 2J5LB 4EN3C 1EEZB 1A9BA 2BVYA 2ITDB 3DXAE 4UDUB 4XNUH 5MI0C 4FTDA 1HZLA 3LEXA 1SYSB 3FKUS 3AXLA 2Y7OA 2AXGB 4J4PD 5KG9B 2NR6C 5AW1B 4R26L 2R4RH 2B7DT 3DUSA 3BWUF 3US1A 4X4XA 4FZ8L 4HJJL 1P7HL 3MREB 3N43F 4KZ0A 4Y5VA 5I15H 2VR9A 5B8CA 2CO1A 4OKVB 2YLHA 4KQ3H 2BFVH 4RQQA 2RGSA 4DUXA 5F71A 3GS0A 1UWEL 3QCVH 2VDMH 4HZAA 4YGVB 4NUQA 3I6KA 5EC2A 3QJXA 1A1NA 2EIZB 1EJFA 3QQDA 4U7SA 2XZZA 2IAND 5DURB 3AQYA 4OFYA 3RIAK 3BZ4A 3U9PH 5F7UA 3PWVA 1PCSA 2Z35B 3IDIB 3WO4C 2HMIC 1OLZA 3FT4B 3F64A 4WFFD 4NZ8A 5CJBA 2CGRL 4DF9A 5EO9B 5HVWA 5A3ID 5C0RL 2X28A 3OKMB 3L9RB 43C9A 4ZXBD 2VIRB 2VB5A 3PQYA 1FORL 4NZRL 2HUHA 5DD3L 5JUEH 4I1RA 4ELMB 2AQRA 1KJ3H 4FX5A 2WOBA 4UYQA 2IMNA 3RDJA 3B34A 3GRWL 2AQQA 4Y5YA 3CHQA 3DVGA 3H9SA 1A6VH 3ATDA 1PG7H 2DKUA 3B3IA 4GS7B 2BNUB 1SNRA 1YO4A 5GGTA 2FJFB 2DMCA 3ESPA 2CJSA 2EIKB 1A6VL 2X40A 1O7SA 3ZZLA 1ET5A 1CLZH 4XCNB 4K3DL 5I8EB 2YGPA 3HAEH 1YYML 1FJ1B 3E3QC 1QPXA 2AI0L 4J3OG 5KYXA 1FFOB 1CICD 2A9DA 5F9AC 3V55A 4XP9H 3BVTA 1JZHA 3O4LA 4AT6A 5BS0B 4KOBA 1LO3L 3VI3A 1KXTA 1S3KH 3O6KH 4A7UA 4JY4B 2JJSC 2WZPD 1M6OB 2CIKB 4OZ4A 5LGYA 3ZQXA 4DKEH 5MEOB 4PJGA 1WAAF 2CXGA 2ENJA 4K8RC 5D1XD 2EDLA 4XPGL 3HKFA 1FL3A 4OFKA 3AGVA 3OG4B 3QIWA 4HUVB 1ZANL 4NQCB 3CMOL 4FTVA 4MWFB 3UIYA 4NX0A 4GQQA 2B1AH 4L37B 3SE8L 3GXUB 1DQTA 2FX9L 4XPBL 2I26N 3A6BL 1T89A 3MLUH 4KJPD 2VERA 1QZNA 5L6YL 3P11L 5I1IL 2XTJB 2PTTB 1F6AB 3FU0A 4IBYA 4KPHL 3F84A 1KCVL 4HWBH 3UOAB 4ODUB 3LZQA 4DZBA 3V0WL 2F1AA 1LEGA 4RAUA 3T5WA 3DX1A 1NOFA 4MQ7A 1HWHB 3OM3B 4I13B 3TWYA 5JXAL 3L6FA 4DOHE 1KSRA 3EJPA 1DN0B 2ZE0A 3KPNA 3HNVL 4NUJA 1QRNE 5IKCA 3TCLB 4OGXH 4PCTA 3FB7B 4U05A 1WIOA 4MJID 1Z9NA 2I5YL 3GSNL 4JDEB 4EVNB 2AXJA 5HDOA 3QJHB 4XZ4A 5ABZA 1NANH 4YHLL 5BVJA 3KE0A 4J3SA 1E4HA 1ID2A 2KMWA 1YNTB 2OBGA 3BZEB 1UZ8B 3MU3A 4JUSA 1JZ6A 1KBPA 1CO1A 1R3JB 2BWDA 3IVKB 3N5AA 2FUTA 3CZEA 1OL0A 4DEUA 3ATBA 5AVRB 4NLHA 4P59H 3PV7A 3L4ZA 3UP6A 4F8NA 1PY4A 2LU3A 4OGZA 3D2UD 3MUGA 3HG4A 4WKZB 1WBYB 2XY1A 5CJXC 5IB1B 2EUXA 2WUBH 4FQLH 1FL6A 3ARPA 3QAQA 3HAEG 5D1ZB 5HGBB 1R47A 1DVFD 3CVBA 3L3GB 1DVSA 1MFEL 4L8CB 2FYVA 5TQ2H 4TQ8A 4FQXB 3OZLA 4WWKC 3NSYA 1A0QH 2OTWB 2PO6D 2XYBA 5IB4B 4L8SB 5J11B 2JTDA 3FN9A 1WHPA 3Q5OA 5C6WH 4QRSA 3KNBA 5DGRA 3H9YA 3W11C 4YHNA 4GP5B 2UY6B 5JLZA 2Q2LA 3CN4A 1HZKA 2VW7A 4L5FE 2OZNA 3B9EA 3IDYB 3PWNA 4NJ9L 3DGGA 1Z3GH 3HNTH 3DTXA 4YR6A 2H45A 2GK0A 2L7JA 3NTCL 1S9XB 4PJCE 1GA2A 3D3VE 5T1LA 1KYAA 4C83A 3HNTL 3C60B 4XR8C 3TVMC 2MFNA 5DXWA 4U1JA 2ESVD 1C8PA 1AMXA 4PJEB 1HHIA 1MREH 3O2DA 4MQXC 4NQCA 2FX9H 4XPBH 1HINL 2EIDA 3KJ4B 1F1AA 1DO6A 1I1AC 1MPAL 2R8SL 3NQKA 4JRXA 1CLYH 2AQ3A 2MMXA 2NY5C 2OR9H 5DA4A 1Y7VA 5IW6B 1OAZH 4X6CE 1T83A 5IK3B 2XN9D 2GJRA 1XAKA 5FYLH 1U8QA 2JVUA 3QRFM 2NQCA 1BGXH 3BKYH 2EACA 2IALB 4ISVB 3T71A 3O3UN 2I9TA 1YNKL 2XKUA 4OLYH 5F9JA 4I2XA 5F3HB 2XFGB 1VEMA 3V8OA 3WY1A 3II3A 1IIKA 4J4PC 4UQDA 1TCMA 4ES8A 2IWKA 1MCNA 1DVQA 2CDFA 3VSVA 1BVKB 1KELH 1OE2A 5DJYA 4P9ML 4NO2B 1EJOH 1EQWA 3RTQD 2NNCA 1A1MB 3LH2H 2PP8A 1NANI 3VH8G 1JNLH 3GHEH 3CZNA 1ZXQA 4AGOA 2HKHH 3ZGHA 3GEFA 4TULL 4PRHA 3K4ZA 1IGTB 4HWEL 3K6IA 4LSUH 1YEIL 4I2XE 5ID0B 5DHYB 1JRHH 4F58L 4K8RD 3P11H 1GJUA 2DAVA 4N8CL 2P80A 4DGYL 3OAYH 5C0BD 3B2XA 3FOMA 3HFMH 3DLQR 4XTRC 4NKOA 1BFSA 4I9XA 5C8JB 4JHVA 5EA0H 3FT4A 2BRRL 4XBGB 3KVPA 2E9IA 2P5EE 3UTTA 2GT9B 5JIPA 1U2YA 1BXAA 2LVCA 3BZ4B 3H56A 2HJKB 1HOEA 3HOGA 3NCXA 4WWKD 3J8F7 2X89D 1HKFA 1UUNA 1UACL 3OLDA 1WWWX 2J71A 2AGJL 4AENA 5BQDA 1B4JH 5HJBA 3DMMA 3IU3A 3H0TA 2FQEA 3GS7A 5F3FA 3U1QA 4WHCA 3D69A 1EERB 2YD0A 1MHPL 1XFPA 2AAAA 4KHTL 1RPKA 1C5CH 3L48A 5BQ7A 2J8OA 1E3XA 2WLNA 1RQ5A 2X38A 3C5ZA 4G43A 2VDOL 1UB5B 4JG9A 1BX2B 4P5MA 1KCBA 4AWJC 5IFAH 3MRMA 3QH3B 4HEMA 5E1GA 4PSRA 1J05B 3MJ8B 4ODXA 1E9PA 2EDMA 3LD8C 3RWCA 1IEHA 3PUCA 2H0EA 3T4AB 1X5HA 5E7FA 3GM0A 1I1FB 2AXGA 1E9QA 3IJHA 3C5SB 1I9RH 3IS0X 3PXJA 3T6ZA 1RJYB 2X88A 2DLFL 3CSFA 4JM2F 4YHPB 2IOOA 4HUWA 3UTSA 1K6QL 4MQXD 2AK4A 3KWTA 4PUBL 3UJTH 3KH4A 2YC1B 4FQHA 2WN3A 4JDVB 5D6CA 4OM0H 5J56B 4UTBH 5CZVH 1CGSL 4U1SB 4QTFA 4IRJC 4KKCC 5BRZA 4YE4L 2ZUSA 1OTUD 1K72A 4XWGL 2Y0SA 2L7QA 4GRLD 2XQ0A 2FH8A 2WVTA 2ARJA 2VDNH 3G5XB 1QEWA 5I0WA 3N1PC 3QZBA 4IRZH 1CFNA 3CJJA 5KS9F 4Y4HC 5JOPE 3N1MC 4QXVA 3IPFA 1BVKA 5MP6L 3BQUB 1IEAA 1G9NC 2MPVA 3O2VH 4E5XB 2XN2A 5JXEA 4OZIB 3QQ3A 1AGCB 1FZKB 5JNYA 1ZRUA 2OJEB 1G4MA 3GSNA 5CU5A 4D8PB 4I1PA 1BCIA 1DP0A 4HYTB 3QUXB 3TTYA 1WAPA 1M9WA 4QUOA 3L2LA 4GYBA 3N9GH 4LRNL 3NK4A 2YZ1A 4N2HA 3CK0L 4LKXA 1HILA 4JFUA 5BZWB 4FNTA 2R39A 3G6DL 1SMDA 3H4FA 1UM6H 4PJ6A 2A9AA 4HCRL 4MNHA 1R3IL 5I1HH 4PJEA 1CBVL 5BVPH 3VI4B 3IXAB 1J7VR 2YK1L 3FDWA 3QG7L 4OLXH 4Q56A 5A2FA 5A2LH 1HI6B 4R90H 4UDTA 1W8NA 1ED3B 3BUPA 4HKZA 2UWEB 4NFDA 4JO4L 3STLA 2JKLA 3TM6A 4YH6A 4A55A 4IKIA 3QXAB 5JW3H 4PS3A 4Z7UF 1BFOA 1ITCA 3I3DA 4YSDA 3IXTB 2G0KA 2BSTA 5D5MA 3TN0C 2IBBA 5CCKL 2NY4B 4M4PA 4MAUL 1BM3L 4ZFFB 4JDTH 1OCRB 4Y4FC 1SDAB 3M8OL 5BV7C 4HD5A 1R0AH 4APQA 4FQXD 1HHHA 5F8QC 2HTKD 3OPZH 5HYSG 3ZGIA 4FNLL 1CFTB 4LVHB 2IOMA 2E7MA 2GTQA 1LJMA 3FQ1A 2WXFA 4AQ1B 3UAJC 4WW1A 2XCMC 4G3YH 4JB9L 3UEQA 1FL6B 3UTSD 1ZLVH 4BUGA 4Y4FB 3BRFA 5IB1A 1UXWB 1JZJA 2H8PB 3R19A 5IVXE 1I9RL 4F8LA 3DHMA 5F7MC 3BRGC 1VADA 4FFYL 3FMGH 5D1ZD 2G5BA 4Y88A 3D2TA 3MJWA 4MA8L 5C6TL 2UZXB 2W8CA 2VH5H 1UOKA 4L4VB 5AKRA 1CFSB 3K1DA 2CKBL