1M9WA

Study of electrostatic potential surface distribution using high resolution side-chain conformation determined by nmr
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
98
structure length
98
Chain Sequence
ANATVKMGSDSGALVFEPSTVTIKAGEEVKWVNNKLSPHNIVFAADGVDADTAAKLSHKGLAFAAGESFTSTFTEPGTYTYYCEPHRGAGMVGKVVVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords plastocyanin
publication title Study of electrostatic potential surface distribution of wild-type plastocyanin Synechocystis solution structure determined by homonuclear NMR.
pubmed doi rcsb
molecule tags Electron transport
total genus 29
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2002-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1m9wA00
1ZIBA 1HFUA 1JZHA 3CVDA 2XXGA 4A66A 4E9QA 4DPCX 1CURA 1BXVA 3NJKA 4HHWA 1L9QA 2IDSA 3FPXA 1W6WA 1FA4A 2IWEA 4HCFA 2H3XC 4JKNA 3X1GA 3CZUB 1ASOA 2J56A 3RYMA 2FWLB 3FQ2A 4BXSV 1AG0A 2DV6A 1QHQA 4G7QB 3EH5B 3PCYA 1V55B 2I85A 5TK4A 4F7KA 1ZDQA 4BWWA 1RCYA 4AI7A 5B7MA 1A4BA 3NSFA 3CDZA 2UX6A 2E86A 3CDZB 4HCGA 3NYKA 4E9XA 1XB8A 2PPDA 3EH4B 3FSAA 1SNRA 1PZCA 1PNDA 1ET7A 1GW0A 4DP9X 1PLCA 2IAAC 3GXUB 4DP8X 3S8GB 2AZAA 4A67A 1EZLA 1KCBA 3FYEB 2J5WA 1NZRA 4HHGA 2OJ1A 2PCYA 4HAKA 1M57B 1TEGA 3X1FA 3FU8A 5I6OA 3NP3A 3FPYA 1ASQA 2BHFA 2YXWA 3S3CB 3WG7B 1OCZB 2PPAA 1BQRA 1AANA 3OMNB 1I53A 4BDVA 5A7EA 1KV7A 5D4HA 4BDVB 5PCYA 1ZPUA 2WO3B 3PPSA 4M4RB 1N70A 1OCOB 3NJLA 2IH8A 1PLAA 4BWTA 1PMYA 1AZBA 3X1BA 1NTDA 2CBPA 2XYBA 2GC7C 3ABMB 1NPJA 1URIA 3FYIB 4ENZA 1GS6X 1L9RA 1DZ0A 1AS8A 1KDIA 2B3IA 1ZDSA 2GI0A 4YSSA 4EF3A 5F7BA 1AZUA 4N4YB 1X9RA 1OOWA 4JHVA 3MX0B 5D4IA 2IWFA 2XVBA 3JT2A 1ID2A 1J5DA 4GY4A 2FQEA 8PAZA 3NSCA 5I6PA 3BVDB 1MDAA 4DP2X 2PCFA 2RACA 4F2FA 2AZUA 2FT6A 1PF3A 2ZONA 5ANHA 4A2EA 1XB6A 2Q9OA 3QJQB 3UAEA 4DP5X 2BZ7A 2AFNA 1PCSA 1AZNA 3IN2A 1F56A 1NICA 1X9UA 1WA1X 4W1TA 1E5YA 5B7FA 4A2GA 1BYOA 5PAZA 1BEXA 1PZBA 4E9RA 3ASOB 4GP8B 1CC3A 2CALA 3WNJA 2DWTA 2YQBA 3AG1B 1TU2A 4DPBX 1AIZA 5I28A 3NJFA 3NSDA 1QLEB 4QLWA 1OCRB 2W88A 1L9PA 2I7OA 2JXMA 1BXUA 3BQVA 2VSKB 2B08A 2WSDA 3FQ1A 1AZCA 5B1BB 4BWUA 1SF5A 2LLNA 3S3BB 2VSMB 1E5ZA 1CUOA 1OE2A 2QPEB 4YSPA 2EINB 4WTQA 1L9OA 3UACA 1L9SA 3TBBA 3OQRA 1NDTA 1KGYE 2J55A 1AR1B 4KO7A 2TSAA 3AG3B 1E67A 6PAZA 3KW7A 2DY2A 2NRDA 1MZYA 1ZV2A 1BYPA 3FU9A 2BP8A 3S3DB 1HAUA 5E9NA 2BP8B 6PCYA 4YSRA 3UGEA 1KBVA 4Q8BA 1SHWA 1ET5A 2XX0A 2BWIA 4KNSA 1J9SA 3X2QB 2UXGA 4A68A 4AKQA 2YAHA 4E9VA 3ERXA 4YSCA 4L0PB 3NJIA 1UATA 2YAFA 4G7RB 4E9WA 2PPEA 3V9CA 2XXFA 1OE3A 1W6LA 2P80A 3H4HA 1AOZA 3FSZA 4FAAB 2VW4A 1JVOA 3CG8A 2BWDA 2DYRB 4KOBA 5TK2A 3ZBMA 5F7AA 3V9EA 2H47C 1J5CA 4YSTA 3KW8A 2VW6A 1GS8A 1NIBA 4HCIA 2I7SA 4KO5A 5B1AB 1WS7A 4A2FA 2FQGA 1RZPA 2Y1AA 2YAEA 1NIEA 1JZIA 1AZRA 4HALA 2VW7A 2PLTA 2XU9A 3EF4A 2FT8A 3T6VA 2PP9A 3FU7A 3GDCA 2FQDA 3WI9A 3S8FB 3TU6A 4DP4X 4W9ZA 3MBWB 1AACA 4KO9A 2QDVA 3FQYA 2A3TA 2HX9A 1NIAA 1DYZA 2VM3A 3CVCA 9PCYA 3UADA 1KBWA 5IY5B 2BZCA 1SF3A 3FSVA 5I6MA 3UABA 1FWXA 1NPNA 3OMIB 3DTUB 2CAKA 1A8ZA 2QDWA 4KNTA 3WKPA 1MG3C 2QT6A 2EIMB 1SHXA 1E65A 2YAPA 3H56A 5I5IA 3ABLB 2FJSA 4GP5B 2J57A 3IE9A 1AQ8A 3IBOA 2W8CA 4X4KA 1A65A 2ZXWB 5B1JA 1CYWA 4CSPA 3X1NA 1ADWA 2YAQA 3FT0A 1WAEA 3QJRB 4YSAA 4E9YA 4KO6A 2IWKA 1JXFA 3NJMA 2XV2A 3AW5A 4QKTA 4M3HA 3OMAB 2XUWA 3OM3B 1JXGA 1JZEA 2OCCB 1BQ5A 2IDTA 3C75A 4E9TA 3QJTB 1GY2A 1EHKB 4P5RA 2DWSA 2XV0A 2EIJB 2MRYA 1V54B 3WKQA 4P5SA 3T9WA 3TA4D 3AY2A 4GYBA 2R7EA 2CCWA 1WA2X 2R7EB 4GP4B 2N0MA 1E30A 1FFTB 1OV8A 3U25A 5B3SB 3AG2B 5AFAA 3NT0A 4Q89A 2AVFA 2EIKB 4YSUA 2FTAA 1ET8A 2UXFA 5B1JC 3D12B 1OCCB 2PPCA 4UF7C 3SBRA 2GBAA 5AZUA 2PP7A 7PCYA 2WO2B 2XV3A 2XX1A 4PAZA 3HB3B 2FQFA 2P80D 1JVLA 2DYSB 2GSMB 1BQKA 3HEIB 4K9JA 1WA0X 1SFDA 2HZHA 3X1EA 2JKWA 2PP8A 3AZUA 4DP1X 3ABKB 1N68A 4G71B 4AZUA 3WNIA 2BW5A 1OF0A 5I26A 2BO0A 3ASNB 1JXDA 1W8EA 1JOIA 1WS8A 1PLBA 1HAWA 3TBCA 1M9WA 3DIVA 4MFHA 3IEAA 3JTBA 3SBQA 5D4JA 1IBZA 2IDFA 4AKOA 3DKHA 4UANA 3NJHA 4KNUA 3EH3B 4BK5C 1M56B 3SBPA 2AANA 1SJMA 3PAZA 2X87A 5B7EA 2FNWA 3WIAA 4HIPA 3QJSB 3N55A 3ABGA 1TKWA 1J9QA 2CJ3A 4FA7B 2UX7A 1KYAA 3ZDWA 4TXVB 4GXFA 7PAZA 4PCYA 1RZQA 3QPKA 2MTAA 4NAJA 2IH9A 4NERA 2HRHA 3FSWA 3OD3A 4YSEA 1BAWA 3T6ZA 1MZZA 1J9TA 3ZIYA 2VM4A 1L9TA 4HZ1A 1JZFA 2UXTA 3L45A 2GB2A 3PAVA 4E9SA 1YLBB 4G7SB 1GR7A 1R1CA 3FU7B 4BXVA 3H4FA 1TEFA 1NIDA 1NIFA 4G70B 4RH4A 2XLLA 3T71A 1VLXA 1CYXA 1NINA 1B3IA 1PAZA 5I6NA 4AX3A 3QJUB 4CSZA 3NSYA 4YL4A 1XB3A 1MG2C 4YSDA 2JFCA 5I6LA 3PLYA 2GC4C 2FT7A 1ETJA 3QJVB 5B1KA 1AG6A 5AKRA 1XMEB 3GYRA 3UAAA 1A4AA 1SDDA 3IN0A 1AS6A 2GHZA 1SDDB 4WKXA 4NB7A 4DPAX 2X88A 3CVBA 4F2EA 1GSKA 1IUZA 1QNIA 2GIMA 3NP4A 4KOCA 1AS7A 1RKRA 1IC0A 2H5UA 5I6KA 1ILSA 2YAMA 1V10A 4UAHA 3PAUA 2HXAA 2ZOOA 1T5KA 4YVNA 3QQXA 3SQRA 2Q5BA 2UXVA 3T6WA 2IDQA 4YVUA 1JERA 2PPFA 1PY0A 2TSBA 2QPDB 4YSQA 1GYCA 2HLEB 3NJNA 1GY1A 4JHUA 1ZIAA 1PNCA 2Y69B 4DP6X 1AAJA 2YAOA 3PXLA 2XWZA 1SFHA 3NJGA 1ILUA 1PZAA 2BP0A 1KCWA 4DP7X 2HRGA 2BP0B 5I5JA 3EHBB 1OE1A 2EILB 2HX7A 5FC9A 2YARA 4ZK8A 3T6XA 1JZJA 1GS7A 1KDJA 4YSOA 1IBYA 2BW4A 3NJJA 2VN3A 3G5WA 3TASA 2VMJA 4A2HA 2IDUA 1ASPA 2CUAA 3N2JA 5EHFA 4G72B 5I5MA 1J9RA 4N8UA 1BXAA 4A2DA 1A4CA 2ZWNA 4AKPA 4DP0X 1A3ZA 1IKOP 1JZGA 3ZX1A 2OV0A 1NWOA 1NWPA 5LDUA 2HX8A 2YXVA 3AG4B 3FS9A
chains in the Genus database with same CATH superfamily
1GZPA 4D9RE 4MA7L 4O2FA 3MRCA 2I32A 4TLKA 4IDLA 1OAUH 4JFYB 3QI9B 2EIZA 3L9YA 1HEJC 3VD1A 2EYSB 3HA0A 1NGPL 3HE7B 5IHBA 3FOMB 2VITB 3C5SA 4YJZL 5KVEL 1PY4A 4RIRB 2ATAA 4CN1A 3UC0H 2IALA 5CGBA 1E42A 4JPSA 2P5EE 3EIFA 3FFCB 4BXSV 4NEHB 2E8YA 2NNAA 2O5XL 4AW7A 5CFHA 1DQKA 1R24B 3AY4C 2FZ3B 3FU6A 4RDQF 3A47A 2HUEA 4FJYA 1EDQA 5CP3H 4OCYH 4FHJA 3GMLA 2ERJC 5KZCD 4OBRA 5AVVB 4LSRL 3K2UL 2J44A 1MFEL 4IMKC 1HH6A 3I6SA 3FUFA 3FSAA 1RPKA 2EXYC 2W65B 3SY0B 1P5VA 2VMFA 3JXAA 5AOMA 3QXWA 1ITBB 1HOCA 2MQ3A 1V7NH 4FOMA 5F9JA 3QS2A 4CDGC 1P4IH 2ZUUA 4FFYH 4KTDH 4XNUL 1A02N 1KCBA 5DJ8B 1HQRA 2YK1L 5HXMA 1U91A 4CC0A 3GBNL 4JDZB 5CGMA 1UXMA 4Y2DA 3KYMB 3MCG1 1PG7L 3L5WB 4UT7H 4N9OB 1DANU 3S96B 2VXUH 2DM3A 3ZDZE 3LN4B 2HTLD 4Y16A 3GSNL 3SDDC 3B9KD 4OLEA 2HFTA 1RZJH 4R7NB 1TMQA 3HMXH 5D4HA 3NFSL 3MRBA 1JS4A 1WZAA 4AC2A 3V0IA 2J71A 2KBGA 2P24A 4RBPH 3ZKXB 43C9B 2IH8A 2LU4A 4WUKH 1VDGA 2M8XA 3MYJB 4UTBL 3ARGA 1YJDH 3FYIB 3CFTA 4AJYV 3CHPA 4YZFF 5JDJA 3NUKA 1AGEB 1VCBC 1RURH 4WJKB 1MRFH 1AVAA 3NAAL 4MYWB 1YY9C 3GF8A 3WMQA 5KVGH 4JHAL 4BK8A 4BH8B 4LSDA 2GBVA 4GSQA 3QJZA 3RUGE 4BK4A 3KLDA 4V33A 2DTMH 3CD4A 4X42A 3MUGA 2P8PA 1DQQB 4OZ4B 4YR6B 1MJUL 3B9KB 3EO1A 2HMIC 3RB5A 3TZVB 2XWRA 4LLWB 5FFOA 3M45A 4HMCA 4WDIB 3KYNA 2OMVA 1DUYB 1LNUA 2IH3A 3ISWA 5ICZB 4ZDHA 2WPGA 2A74B 1XGYH 4PJDF 1JPTL 3OHXA 4AV5A 3INUH 3LPFA 5CEZE 4M5ZH 4YHIB 4TSAL 4AGLA 3MPCA 5FX3A 2W95A 1PIGA 1PVHA 3AAZB 3DO3A 3F12B 3M7FB 4FQCL 3DXAD 3WTVA 4G83A 3IETB 4RFOH 4MD0B 3ZHFA 5E9DE 2JI3A 2EYTA 1RIVL 1T04A 4QJ5B 3VAEA 3GSXA 4OTXL 4ELMF 1L9SA 3PHOA 4DUXA 1BLIA 1U8IA 1QFWH 2BM3A 1E67A 2BIPA 2H7WA 3TM6A 4QD2E 5E8PA 4F58H 5LB1A 3G6AB 4B7IA 3TA3A 3MTXA 4MS6A 3FZUC 4NQED 4M03A 1MW0A 2XQBL 1C1EL 3FU9A 4R4NC 3HUJF 4M8VA 4E9LA 4Z77A 2AMUA 3BH4A 4U6YA 4G7YL 2WAHA 4H44C 3QO0B 4TYUA 1HXKA 1SHWA 3P02A 4RFEA 1DFBH 4HWEH 1IJ9A 2CNYA 4OW6A 3FO0L 5ABAA 3JTSA 2OYPA 2BWIA 5EO1A 5KG9B 3GJEA 4OCLC 3C6LC 3EYUL 4YSCA 4F80A 2ZJSL 1LMKA 3CBKB 1SJVA 4M7LH 4R4FL 3WCYA 3DXAB 1ZT1A 1FBIH 4BFIA 3V9CA 3U1QA 5AZ2L 3I50L 4ZXBA 1D5MA 1CWVA 1O6VA 2ENJA 2IBGA 4LKCA 4Y4FA 5DJAB 4QRFA 1AKJB 2CHDA 2DLIA 4L4VE 3D0LB 2WMPB 4MA8L 4D0BB 4OCSH 1TTGA 5B3JF 3D3VE 1BECA 3H3BC 2VR7A 4H8UA 4KK9C 1SMAA 3KW8A 4U6XA 4Z76B 4G42A 3N40F 2X3BA 1NL0L 3KJ6H 4P3DB 4MX7A 1SOXA 4NQSA 3T0ED 3OHMB 4U1GC 4KUCF 1JZIA 5BRPA 1VF5C 2CDFA 5D1ZB 2PLTA 4HS8L 2XU9A 1RK7A 1UUNA 2VB5A 1JFQL 4M6OL 2P7TB 4ANWA 3S8FB 2QFPA 3ULVD 5IZ7A 1G6RA 2NNFA 3RVVC 5FYJE 1E8ZA 3JWNE 2BZDA 1F3RB 4ZS7L 2EDFA 3BP6A 4WHYG 2O5ZL 1TLMA 5DJYB 3VGHA 2EO7A 4LCYB 4FG6C 1AXIB 1SF3A 5I6MA 2VR8A 2F53A 3QNYA 5LWYH 1D6VH 5IEKB 4NAQA 2EC9U 4XMKL 5E4IA 2OYLA 3OJDA 4N2OA 2FBOJ 1HKLH 3ABLB 2YMXH 1H9DA 3EDFA 3QUXC 4AMKH 4GP5B 3FB6B 3VXPA 4C57C 4MJIB 4WF7A 1G7QA 2O1AA 4PJGE 1S5HB 3RZCA 2ZXWB 3AU0A 2UZXB 2YAQA 5CN2A 3T0EB 4FMFA 1QEXA 1NGWB 3RWIA 3WLWC 4HOXA 2NNXA 3GHEL 2XUWA 5K9KB 4H1LG 2DIBA 4UOJA 3TF4A 2OZNA 2UUDK 2B16A 4IIQB 2AJYL 1I75A 4MTMA 4F2ME 5BXFB 4G6MH 2APTA 4I0PA 1GMIA 5MI0B 3VSUA 3VFWA 4MA3A 2MCPH 1O7DE 2IEPA 2MHAB 4KK6C 4WQOA 1THCA 1BQHA 5I8CA 5I8KH 4HWBA 1MVUB 3HI1A 3SE8L 3WIIH 1ZLWK 2AVFA 2EIKB 4QGTA 4PJ7A 5DJZB 5LBVA 3V5KB 5L88H 3BRGC 1B4RA 4GXVL 5DEJA 3BPNB 1FHGA 5AW7B 2YSSB 4U1JA 3H3PL 1NCWH 1RJYB 3ZKSD 1N2RB 4PB0H 1T7WA 2WO2B 4BCXA 2JH2A 5D1QC 3MRKB 5FKPB 4S1DC 3P11L 4XI5C 4DETA 2IAND 5H94B 1F2QA 1C8QA 3T65A 4BQ6A 1U8CB 2HN7A 3NCWA 4WKZB 3LH2L 4EDWH 4O9HL 4G6FB 2YD5A 4PRBB 1BZEA 1EFXD 2JJTC 1I1YB 2Z4TA 3IRZA 1HCVA 4N2EA 3K6SB 2VLRB 5JPNB 4IBVA 1JXDA 2C4FU 4W9CC 3MNVA 4JBSA 3DTXA 5AAWC 1NCUA 5K93A 1UD8A 4DGIH 3G5YB 2M26A 4N22A 3BKCH 1C16A 1FAKT 1CLOL 3GRWA 1HHJB 4LL4A 5H2BB 5HHPA 3GHPA 3N43B 2Z93B 1BVLA 3KL3A 2BSRB 4PJIA 2DMGA 4J28A 5E08H 5BS0B 2P5WE 3FL7A 5AVUB 4P46C 4WRLA 4JCWA 4F37F 4UWQB 1YHPA 5C07D 1FI8C 1KJ2L 2P3YA 2WY3B 5EOCH 1YPZF 2AABH 3MOAH 4Y19D 5H4YA 2Z31B 3G04A 3D25B 1SEQL 2O6DA 1JWUB 5F7DB 4PS8A 5I1DA 5JW4Q 5T3XH 3WO4B 1YEKH 5J0BA 4Z78B 1TKWA 3FOLA 1J9QA 3C09C 4HIEB 3WNLA 4X4ZA 5IQ7L 1KGJA 4YN3A 3QPKA 4AQAB 1ND0A 1QEWB 3JV6B 2WYIA 1YEJL 4RLDA 3QJHA 2ZUQC 1EFXB 3DVGB 1AIFA 1QRND 4DFIA 3U30B 3ULSB 5CUSH 2E7BA 4QLRA 3B7RL 1A25A 4FKHA 3KPRB 2CGRL 4JZJC 1KTKE 2DI9A 4I7ZC 4LQ1A 4NC1E 3DPBA 3ENEA 3UERA 1FE8L 1Z5LA 5MEOB 1AC0A 1UKTA 2IXQB 2W9EH 3DSFH 4OKDA 2H32B 3CZNA 4BFBD 3ECUA 1HZHH 3NIFB 1NINA 1TZHB 4JFHE 4NQDA 2AAVA 4OUOA 4Y19B 4JR9H 5GGQL 4QHMA 3NPSB 3PWUA 3ZGIA 2JFCA 3SOTA 1OSYA 2NY6D 1QFWI 5CU5A 5IB4A 3IWUA 4UDTB 1P4UA 3V4LA 3HN5A 3S37L 4UAOC 3O4OB 3GI9L 2LR4A 1JK9B 4K9EH 5ISZB 4N2AA 4C55A 3PGFH 5F9AC 4NKDB 4BH7A 4M6ML 5D7KE 2QHRL 1NUGA 3D69A 3LXAA 3MA7A 2Q86B 4M1CD 1ZK9A 2B5IB 2H26A 1INQA 1KG0B 4OGXL 1A47A 2Y7NA 2BJML 3O0LA 4M9OA 2ZYSA 3PIQA 1IMHC 5DHYB 3O3EA 3VI4A 5IWLA 2OTPA 5GRYA 2WQAA 4H0IA 3IVKA 2VAAA 1KIRB 1V27A 1KIPB 1RXLA 1NMCB 1U8JA 4JDEA 5HI4D 4N8CH 2MOGA 4X98B 1F86A 3DARA 3CDYA 5B38G 4WFED 3QPXL 1T2QH 4ZO6A 4PRNA 4WFGE 4ANVA 2NQDA 4L8DA 3OXSB 2YD8A 2R69L 5DQ9A 3MXVH 4KZEH 4FQIL 2VN4A 5TQ2H 3E3QE 2WOYA 2VXQA 4YC2C 5F9DC 4JPKL 1N8ZA 1I7UB 4UM8B 4XPHH 3PFQA 3I02A 1RVFH 5FC9A 3VXTB 1S4IA 1ZMYA 3SDXE 4GQQA 3QIBC 4TSCL 4L1TA 1E4JA 5D1XC 2BW4A 1CXIA 4OIFA 5DUBA 1S5IH 3ZTCC 1Z0MA 5C3TA 3OZLA 1A6ZB 2AS5M 4FQ2H 4OF5A 4LCIL 4YNYB 4JFED 1TVBB 3DOSB 3H42L 1M7IA 4UNUA 2FSEB 3I3EA 4IRSA 3C2AL 5JOEA 1R46A 4LEEA 5IT2L 2X6AA 4KK5C 5HYJB 5DJCA 5A7BA 3GSNA 3BRDA 2FATL 1BVZA 3WS3A 3U46A 3L7EA 2OSLB 2FD6L 3WD5H 2YXVA 3IPFA 2GITA 1CIUA 3O45B 5KYUA 1CURA 1UWEH 2ERJB 5FGBA 5A40E 2VN6A 4NFBA 4N5ED 1OHQA 1GZHC 1L9QA 1T4WA 3KYAA 4L29B 1BF8A 1XGRB 1EK3A 4UTBA 1LE5B 1T21A 1RZIA 1FYHB 3MUZ1 4DEUA 2XVLA 4HCFA 5FLVA 3RL1A 4XPAH 1JPFB 2FJHA 4P48A 2IGLA 2BMKA 4AL8C 4PSPA 2A9DA 5D5MB 5ABDE 1QHQA 2W07B 4G7QB 3OTTA 3PGDA 4JFEB 3GZQA 3KH4A 5DA4A 1AP2A 5INDB 3L3DA 2QKIA 3QEQB 5I8EA 2CU9A 3CVIL 4X4ME 2ATKB 2IJ0C 3PJNA 1CCZA 2KLSA 4AW4A 5DD3H 1NCTA 5CHNA 1ZWIA 4HUXB 2HFFA 1NC2A 1CD9B 1S7WA 1MFAH 5F9WC 1MCHA 3RWFB 1HCFX 4D0DA 5GS0C 5GRJH 5IMKA 1TVHB 1B4JL 3EBGA 1FYTE 4F33B 4OLUH 1VA9A 1C12A 3BUYB 2YMTA 1HE7A 2AQPA 4GRMA 3O6FA 1XSIA 4GAGH 2FH8A 4OD1L 2YPLD 4OCXH 4TNWK 4UU9B 1IBGL 1X5MA 4F15C 3VD0A 3S3CB 1ASQA 1C08A 1DANT 2NUTA 2V7HA 3QPQC 1CGSL 5A7EA 1YNTF 3DHMA 3ZDXB 2L8AA 3PPSA 1JMXA 3CFJA 1M7DB 1L5GA 2Y6SD 3NZHL 4F9PA 3A6OA 1YN6A 1SXZA 2AV7B 4MMZA 1ZVHA 4X6BA 3DRTB 1T7XA 5HGGS 5D70H 2XN9E 1VENA 5CP7A 1U3YA 3OPZH 3LEVL 3H9YA 2HFEA 3QULA 2WUCL 5LBGA 5LGHH 4DEPC 2Z91B 1UWXH 3OR6B 3H8NA 2BS8A 2DQTH 2O72A 1G6RH 1J0KA 3EG9B 4LASL 4Y1AD 3VCLB 2YPLB 4FQ1H 1IGYA 3QAZC 1MDAA 3FQTA 3L4WA 4DP2X 5CWSA 5AKSA 2C3XA 3PP3K 2X0VA 4AYDC 1PQZB 3MLYL 3R8QA 4Z18A 4ZUTA 1IQWL 2ADFL 3X12B 4LHUA 3VXOA 1O6SA 4XNZC 4W1TA 5B7FA 1W80A 3TIDA 3DUSB 3GSQA 3Q2NA 2ILLA 5FYLH 1HIML 1KLGA 1BGXH 3G6DH 4HVBA 3ZE1F 5FUCC 4ZMAT 3H55A 4JG0H 4LOVA 2X10A 4WWID 2GSGA 3UC2A 3K5RA 3EZJB 2V4LA 1B4TA 1IM9A 1BXUA 1TIUA 5FUOL 3BQVA 1FORL 2DLHA 3II3A 2R27A 5JTWA 3QSKB 3O3UN 1W0VB 4AJWA 3FCUB 3QS3A 3CDGA 5HDBF 2JKIS 1DCEA 2R56L 1JHLL 3WTWA 3MRNB 5E2UL 4AGQA 4YSPA 3L5IA 1XR9B 3C6LB 4J27A 4HV8B 3KXFA 4I77H 1TZIA 3UDWC 4G6KL 3FT1A 2ENQA 4FG6D 2UZIH 4EI6A 2LVEA 2LW3A 4KGJA 2YUZA 5BVPL 3T4YB 5L2JA 1GOFA 4X9YA 2DY2A 4HWBH 2YD1A 3L4CA 4FNLH 4HIHB 3CN4A 3IF1A 1CGXA 4QTIL 3EFOA 4L1HA 1D6EA 4Y7MA 5C0DB 5JDSA 3KNBA 3GBDA 3MGTB 5K9QG 1AQHA 4RFNC 2QKSA 3QUKA 3ISRA 3QQ9C 5SWSA 5HPMA 1OTUD 3CMOL 1RP9A 3P3TA 2A73A 4H20H 1ITCA 1KWGA 3EJSA 3WLWD 5I1HL 1RUKL 1QR4A 5IMLB 4OQTH 2B0SH 5E2JA 4DGUA 4K3DL 1EERB 5IBTL 2EDJA 4UIKL 1QPKA 5TGBB 4AVHA 5J7CC 1AR1C 3BW9B 3T2OA 4G7RB 3JV4B 3SPHA 4PJ9C 4XO9A 1TJGL 4LRIA 4GKNA 4HUUA 2P80A 3H4HA 3LPGA 3BUPA 3GNML 2FH6A 1RMFH 1I7TB 4JKPH 4KK6D 3CFIC 1RULH 3ULUH 3WJJC 3GRWH 3MV9A 2X4QA 2OMXA 5T1KD 1J5CA 3F83A 1ZLVK 4NCDA 3D30A 4IS6A 4S10A 1PKQA 3MRRB 4PGCB 3HNVH 1B0RB 3DBXB 3O4LE 3LKOB 3VWJC 4EIUA 4GT7A 3QUXB 1EDHA 1CL7H 3EO9H 3OKNB 2BWQA 3VH8B 4PJDA 3KL0A 5IVOA 4XI5D 5DFVC 5IJVA 1A1NB 4N0UB 3MOBH 3ZRFC 3K8KA 5CGTA 2WTRB 3UZEC 4QGYA 5A2BA 2DBLH 1PD1A 1DR9A 4RA3A 3TO2A 4WFFE 4C47A 5F7EH 1A6AB 3BZEB 2WLZA 3C5ZC 3QDGA 2FK9A 4R90L 4DTGH 2LGNA 5FIEA 1T66C 3COOA 4I18A 4Q0XH 3WAJA 1W2KT 1ZOXA 2NLJB 4NQXA 1S78C 1PZDA 4JFDA 2EIMB 4WUUA 5K39A 4AENB 4WWKC 4UM9D 5SV3A 2LU5A 1YRKA 5DUPL 1MDTA 4TVUA 2VDPB 1A9BB 3LXUX 3U36B 3BAEH 2FR4A 5C0BE 2Z65C 4YDVA 1CYWA 4CSPA 4JCMA 4HS6A 4R6UA 4QY8A 1WAEA 4MNGA 1KJ2A 1G0DA 2A9NL 3LXCA 3MNZB 2X12A 4QXUH 4W6XB 3WEBA 1ZHKA 4KNQA 4P2YA 4UTCA 3WS6C 4AQ1C 5F44A 4FI6A 2B1HL 5ERWB 1NQBA 1JXGA 2FDBP 5D1QB 3AREC 4MJ4A 1BF2A 1GY2A 2ZPKH 3SE6A 1MJ7L 2PW1A 5EBWA 3IT8D 2A9BA 2AXHA 3RI5F 4DW2L 4EQ2A 4Z3FA 1FL5A 5J57B 1U42A 1D2PA 1QSEB 3SKOB 3SYQA 4MZRA 4YQXH 3UCRA 2HLAA 1NGQL 3MLPA 3Q05A 2XFXB 3AG2B 4JQIL 1R3IH 4NCC2 3VXUD 3V5DA 4FMKA 3IFNL 4KQ4L 2FO1A 5I19L 4F8LA 1I8UA 2MMXA 4MA7H 4P2RE 1I7RB 1U93A 4TVPL 2WZ0A 3SN6N 2QSQA 2IAMC 2EE9A 5EN2B 4UM9B 3D12B 3Q48A 1UURA 2VERA 5CJ5A 1JNHB 1G1YA 5EDSA 2RB8A 1OW0A 1NGPH 1VEMA 4JM2F 1EAPA 4FF9A 1QBLL 3SPVB 5GZOA 2VDRL 5KVEH 2J8OA 4J39A 3HEIB 4KKQA 3JVFC 3ZT7A 5ES4B 1W0WB 3DX8B 4OJCA 4WGKA 3DUUB 1WCBB 1BLNA 4U05A 3MREA 3W5NA 2O5XH 4KKPA 3C09B 3QQDA 5I8OH 1J7VR 2BO0A 2X05A 5JOPE 1U3HA 1A6UL 2X4SB 1BEYL 2C3GA 3IKCB 1KELL 2ZUQB 2ICWI 1RV6X 1ICTA 4GRWF 4LSRH 4BELD 2GY7B 3K2UH 2CDEA 1MFEH 5JORB 4KQ0A 1YSOA 1HDMA 4MRCA 2IDFA 3MUJA 5DYFA 2Y36L 3AGVA 3GINA 2QPFA 4MB4A 4JZJB 3PABA 4JZNA 4XNUH 1KBKA 4RA0C 3WTUA 2YK1H 1JGDA 1HTYA 3FQ4A 3GBNH 4PJXB 3BFOA 4N2KA 2EDTA 3RWDB 1I3GL 5AW3B 4OCWL 1PG7H 4IBTA 4ZW8A 4XCEA 2Y24A 2YUXA 3SKMB 1USQA 3G08B 2IH9A 3SGEH 1E3FA 1WE5A 3OD3A 3TPUB 2R69A 1WBXB 1JI2A 3IJ9A 2A6JA 3NFSH 5J11C 1UJ3C 4GW1B 4BFFA 1QLRA 1SBSL 3UTSB 4Y88A 4QHNB 4A6YL 3SODB 1EZSA 3LS4L 2NCMA 4PY8I 3ARVA 3JZYA 1K3IA 1NSNL 4UTBH 5GPRA 1SYVB 5KYXA 2FEDC 4PB9L 4PY7B 3ZVVA 3NRQA 1N5AB 3FO2A 2ZOTA 2WB1A 4DGWC 5I0YA 4EXPX 2LQRA 1BFOB 4RH4A 2BK8A 2P47B 3QFJA 3NAAH 2IH1A 4MAYD 5L8KB 2CLZB 3F05A 1K6QL 4JHAH 2E9JA 4P5TD 4U1MB 4DIXA 2XG5A 3BT0A 2FT7A 1A2YA 1G7PA 3IU4L 4GSDL 5EUOB 1AS6A 4C56A 1V3KA 4WI7A 2UZYA 4IBSA 1MJUH 2ZD0A 4F2EA 2YC1B 3NP4A 1GGCL 3CX2A 3DO4A 3FF8A 4IMLA 4BINA 1KYOK 4CBZA 4CC4A 3C6SA 5C08A 3FT4A 4PJBA 2XXCB 5E1GA 5A2AA 2BPBA 4M8RA 2QGCA 2IPTL 2XA3A 3W11D 4XMUA 3JVGA 1AH1A 1JPTH 4GBXC 1TOXA 1MY5A 3QIBB 3N04A 4QCIB 4TSAH 5HI5C 3HOGA 3MCKB 4XB7A 1PCXA 2D3VA 2WBJA 1KTCA 2JTYA 3MV8A 2JB6A 5DURD 2BOCB 4UQDA 4GKSB 1YPZA 1KEGL 2PWFA 3KPPA 2PPFA 4FQCH 4TLSA 1RSYA 5C7XL 4OAWA 5HYSA 2EICA 2HLEB 1GY1A 4K55A 2F54B 4P5TB 5AW4B 1RIVH 3EOBA 2JIXD 1AAJA 4OTXH 2CLRA 1SFHA 4X5RA 2PWDA 3OJMB 1U8KB 1F1DA 5CSZB 4QOKA 5HHQB 3J7HA 2EILB 3M8OL 2Y1YA 1QWUA 1OP9A 2GQHA 5J6GB 3RGBA 4PUBL 5FV1L 1CL7I 4G9FA 5KSUA 1V05A 3CFKA 3LNEA 2Z3FA 3GSVB 4JO1L 3X11B 2XQBH 1C1EH 4KY1L 4A7QA 3ATDA 4HDIA 4APQC 2K1MA 2R1YB 4G7YH 3DXAE 3ZKMD 3IMSA 2VWEC 2LFGA 3DWTA 3OSVA 4PLNC 3D4GA 3FO0H 4AXWA 5IIEA 2WCGA 3VI3A 1Q9OA 5EZOL 5JQIB 3MLZL 3NRPA 4G72B 1J9RA 5HJBA 2DQIL 5IEHA 5IVXE 4ETQA 3EYUH 1HHIB 4DVRL 2E7LA 2ZJSH 3QPQD 2MQCA 5FUZL 4R4FH 2OV0A 1S9WB 1Z32X 1JCKA 5EU6D 3GXTA 5AZ2H 3I50H 1PZSA 5BOJA 3IWVA 3C9NB 3JTTB 1XD0A 1FLTX 3HZMB 4NQEE 2WLJA 3FUMA 4MA8H 2JKLA 1BXVA 3QXDB 4NKOB 5GGUB 4K3JL 3DMMA 2DPKA 4XCNB 2IG2L 2YR3A 4KX8A 1NL0H 1R6VA 3QEHA 2WXHA 3PHSA 3QYMA 2V9UA 3QISA 5FO8A 2EEFA 3ZIMA 5F9WB 1JWMA 4ZFZB 4CU8A 4OI7A 2X53A 2V5MA 5DS8A 3NK3A 4CA4A 4HS8H 4L2LA 4ZNEA 2BIIA 2WINB 1CFSB 2DF3A 1JFQH 1EUUA 1F4XL 4M6OH 1N0XH 5JXED 4LO9A 3TJHC 2DIAA 4EZLA 1LWRA 1V55B 1QLFA 2VDQB 3KYOB 4ZS7H 4UV4L 1QSFA 1KYOJ 4QAMB 5GRUL 4CBPA 4F15B 3MMEA 2D7MA 2X4UA 2APVA 3LQZA 1JF5A 5F0MB 2O5ZH 4S2SB 3UOAB 1K72A 3AWFA 1A22B 1U58A 3HIZA 2NOYA 4PJAF 5D2LA 5E56A 1IEBB 4QWWC 4DP9X 3T0EE 4ZUVB 1ONQB 3D06A 4XMKH 3IJYA 4FFVC 4UOQA 3M1BB 2J6WA 1QA9B 4PG9B 1FQ9C 2JKXA 2P8LA 4V2CB 2OJ1A 1S8DB 4QRTA 1JD7A 1OZTG 1KXTA 3JYCA 1R3KB 1P53A 2H3NA 4N26A 3QZBA 3TN0A 1P2CA 3GHEH 1JV5B 1U9KA 3WJLC 4OFYA 3Q06A 2YPKA 5IREA 2CHNA 2UY7A 5GHWL 4LCVA 1FZOA 5TE4L 2B7DT 4BDVA 2R1XB 5CJXC 2AJYH 1A6PA 3GUFA 4L4TA 5TE7L 3RJQB 3QAZB 4R5VA 3DOHA 3RNKB 1IKFL 4P23A 1T3FA 4CILA 2E6QA 1XAUA 1BZQK 4AM0A 2XG4B 5FB8A 2W94A 1PLAA 4OR1A 4ZUUB 4YHYC 4WJ5A 4XNZB 3SE8H 4EVNB 2YA1A 1FLRL 2J1WA 3ABMB 2J21A 1HH9B 3QCVL 4GXVH 1GS6X 1L9RA 3F6JA 5G5DA 2ZIDA 3G5VA 3D05A 3A6CL 3PL6C 3H3PH 1T5XA 1SY6L 3L3OA 2YD6A 3WE6A 3UH8A 1X9RA 3MX0A 5F7YC 3P11H 5CBEB 4GAJL 4YHKL 1BQLL 1OL0A 2F9BT 3LH2H 3V52L 3WFEL 4PJ9D 1DJWA 4O9HH 2AZUA 2BVEA 3BP7B 3KPMA 2WN2A 5FA4A 1D5ZA 5SWQA 3HFML 3NZUA 4NLHA 2OJZH 1TTRA 4LSPL 4HCRL 5D7SL 2CPCA 3L3IA 2BDNL 5C8JB 5IKCA 1KYDA 1BYOA 3QQ4A 1RJLA 5LG6A 3PRZA 3DGGA 4UQEA 5DS1A 2CZNA 2VQ4A 3HCVB 4XMLL 3VB9A 3DV4A 3NSDA 3UJJL 3APCA 3CSBA 1QLEB 4HJJH 1ZHLA 1OP5K 3BQUA 2I7OA 2IANE 2NYKA 4NN6C 5IFHH 1KJ2H 4GSUA 2BHUA 1PTZA 4RFNB 5DFVD 3RNQB 2GY5A 4LIQE 1SEQH 4OD3L 4ZW3A 2IV8A 4J2XA 2WC7A 3QXAA 5G55A 2VLJB 4WTQA 4TMPA 3NEXA 5IQ7H 2OCJA 4JO2L 1ZANL 3MGOA 1AR1B 4WNQB 3QUMB 5IV2A 4KXBA 2B59B 3C5ZD 1EJOL 4PJ9B 1ORSA 3TV8A 1YEJH 1SLVA 1T1ZB 2BVUA 1S78D 3D4CA 3O6KL 3TC9A 2Y7LA 4WWKD 4R4BB 1MF2L 1BYPA 1Y07A 3HAEB 4AQEB 5E8EB 2HJLA 4ZMVA 1NBZA 3WENA 4GNKB 2BP8A 3L95B 2FSDA 2CGRH 1ZA3A 5C07E 4Y19E 5HGBB 4MMYA 3QEUA 5C0JB 4XCFL 3L4XA 1MHPL 2O61B 1XCQA 1OW0C 1FE8H 3VWJB 4EI0A 2OR8A 1FAIH 4ADIA 1J9SA 1FF5A 2UXGA 3EYFA 4W9FC 4A68A 3R1GL 5GZOC 1S7VA 5GGQH 1JF1B 1FSKB 3GLZA 1J0IA 4KZ0A 4Y5VA 4X4YA 1J5HA 3FHAA 3V0HA 4R96A 5CCHE 1QRNE 5L4JA 2HVKA 1M1SA 4RWYL 4L5FE 4JY6B 2AXGB 1ZRUA 2AJSL 1U3HC 3S34L 3S37H 3GI9H 3B2VL 5E8NB 3C5ZB 3KR3L 1UM5L 3TBSB 4DGVL 4KJQD 4M6MH 5A2LH 2QHRH 5IB5A 4BSJA 1S3KL 2EUWA 4RGMC 4WWKB 4ETYA 2X4TA 3NDZE 4OGXH 2BOBB 1OLLA 2BJMH 2VW7A 4KX7A 3JV5A 1IZJA 3GLEA 1B0GB 2EE0A 4QR7A 3T6VA 4TQ8A 4ZSOE 3UZQB 3R7RA 4OZIA 1LE9B 2FQDA 3TU6A 4WIQA 1JGEB 4FGMA 4H5SB 2N7SA 3AREB 3QPXH 3JWNG 2HX9A 1HI6A 2DL2A 2JK5B 4Y9BA 2FL5B 2WKGA 2XQYA 3ARFA 4Y5XA 5IQMA 2R69H 5EN3A 1UH4A 3DTDA 4FQIH 4EZKA 1A8ZA 3WKPA 5A16A 1XGQB 2X09A 2HT4D 4HHAA 4L0ZA 2C9QA 3KPLA 5EZJB 2ZWKA 4LPCA 5HJ3A 4JPKH 5I5IA 1L6XA 2NY4C 4IGBA 5E9AA 1J5OL 5F7KC 4OJEH 4PGDA 3U4AA 1G7HA 5B1JA 3SDCD 2WQWA 4TSCH 3QUYD 2IAMB 2O4EA 3FT0A 1RFDL 1OVZA 2YO3A 4OT1L 3QT2A 1O9WA 1MH5A 4MZIA 4WFEE 1QFHA 4M3HA 4J3OF 4LCIH 3BP5B 1BQ5A 2IDTA 3AROA 5GS3A 4PLKD 4ZFOL 3H42H 3PGCB 3C2AH 3IGAB 2FWOB 4MQXC 5IT2H 3FK3A 5AOLA 4PRHD 3NIDB 3ZUCA 2GYSA 3ZHNA 3AY2A 2X7LB 1LEKB 3NTCL 2N0MA 2E7DA 4H4NA 5IK3A 2FATH 1DEDA 3D0VA 3U9UA 1N8OE 2FD6H 4WFHD 3LQMA 3GRBA 3BX7C 3SYPA 4PGEB 4QRUB 4IU2B 2E8ZA 5DK3A 3C60D 3D8MA 1GC1C 3GQFA 4J1UB 3STZA 2C26A 4FQXA 3IDNA 5FW8A 3CFDB 3BGAA 5ESQA 3SPIA 4EDXA 3FQWB 4GMSL 4QT5B 4XXDB 2AITA 4WVRA 4IRZA 4JFEE 1CI3M 5HGHA 3UG5A 5DC0A 3P73B 2NNRA 2CR6A 4PTUA 2JKWA 1T2JA 4XRCB 2O5YL 1LP9A 3D7PA 3ETSA 2BW5A 3SKUD 1ACYL 3E8UH 1DP0A 1NC4B 1W8EA 3O3AB 4ONHB 2HG0A 5D7JC 3DIVA 2KDGA 2Y3AA 3OB8A 3IEAA 3NVQA 3KE0A 1MJJA 2EE6A 4FJ6A 3MROA 5J11B 3PE9A 5DZLA 1UJ3B 2DWEA 3CVIH 3PV6A 4J4PA 2F68X 4RSYA 5TH2A 1IV8A 3SBPA 5FF6B 1FNEB 1DQJA 1E43A 3NN8B 5T3ZD 2UWEB 1CVRA 1B4JH 1X5GA 3WIAA 4GRLA 1RK1B 1F2XK 1TJHL 2WYTA 2PTTB 1HL4A 3N55A 3IFOB 4LQFL 4XO5A 5F6IC 3MA9L 4OD1H 5I1AB 4NI3A 1IBGH 3CV5A 1J18A 3BRFA 2F7QA 3A23A 3EO0B 3QWQB 5J9PB 1VHPA 1CGSH 1N67A 5ECGA 1BAWA 4ODWA 5D7IA 5E4AA 1VPOL 3KLLA 3PWLB 5F1SA 4APXB 4GIPD 1T22A 2GK0A 3NZHH 4OFDA 2BVTA 1J8KA 4IRJA 2A6IA 4X8CA 4EIZC 4PJGF 2X5PA 2YRBA 3FQXB 1BZ7A 4APQD 2D7OA 1R1CA 2YPLE 3DOIA 1X5ZA 1YDPA 3T71A 3LEVH 4GBXB 3VMNA 5H35B 4AX3A 2J8HA 4N2FA 8FABA 2WUCH 5BZDA 5DI8A 1P5UA 5KSBA 4JM2A 3QJVB 3WMPA 5JXAL 1GH7A 4L05A 4LASH 3S7GA 1A9EB 2AV1A 3DVNB 3MQIA 1U8NA 2OMWB 4JO3L 4ZMZA 5K59E 1KOAA 3MLYH 4TN9A 1RZ8A 4F92B 3GD1C 1IQWH 3UYOD 1CLZL 3ARSA 3VG9C 2HSIA 3VD5A 1CDBA 2ZKHL 5I6KA 1OAXL 3HS0A 2J8UF 3MRIB 1CDIA 1HIMH 2X1OA 1V10A 5TDOA 5JIKA 2AAAA 2EZ0C 2K45A 3PAUA 1AD0B 1HCZA 2B2XL 1M05A 2DTSA 1DN0B 1ZPLA 4WU7A 3UAJD 4APQB 4UMGA 2Q5BA 5FUOH 4P0DA 1FORH 4Y1AE 4PV1C 3HG3A 3RTLA 5IW6A 5FFGA 4ZO9A 4I1RA 1NAKL 4YSQA 2R56H 1JHLH 2BVPB 2GVYA 1S7RB 1O5DT 4JB9L 5E2UH 2HG5B 4LNRA 2EC8A 5E5RB 4JFXB 1WC7B 1S9KC 3CHOA 1CICA 4I13B 4G6KH 2G3ZA 5T1JA 2KZ1B 2C3VB 5BVPH 1P9MC 4P23C 4P5MA 3LX9A 2HX7A 4QWWD 1QFPA 2NYYD 4UZUA 3IPBA 3ZSSA 2AJXL 4QTIH 4YPGA 4Q97A 1YMHA 3F7LA 4IKLA 4GIOA 5FOBB 3EJTA 2VT0A 1B9KA 1DEEA 3D33A 1I4FB 4EKJA 2P43B 3LD8C 5BRZB 3CMOH 1JPST 4R0LC 2XQ0A 1JNNL 5FCUL 3DDGA 5EF2A 3N2JA 1I8IB 1RUKH 4R7DB 5I1HH 5I5RA 4M7ZB 1FV1B 4K3DH 5IBTH 4F7TA 4UIKH 1UYWL 2ZSWA 3CZFA 4G1EA 3GSWB 2Q7AA 4BGDA 4YUEL 3B5GA 1TJGH 1P7KA 3ARYA 4QAWA 32C2A 4KXZH 4OZGA 3GNMH 3V0FA 1H6UA 3CVDA 4MKTA 2YFNA 1ZHNB 4TS6A 1F58L 4HKJB 5D9SA 2VR5A 3H3KA 1Q4NX 2BRQA 4WI0B 3CC5B 5JHDA 3WEOA 2HJFA 3G5ZB 3V2AR 3HRZC 2A77L 2IQ9L 3WIHA 3SE4C 1MAKA 3ZXAC 5D8JL 1IQDB 1S7SB 4HZLB 4RMTA 2V5YA 1USZA 4I87A 4JKNA 4LMQE 3CZUB 4NHCL 1CI5A 3CFUA 4YHNB 3Q3GB 3BWUC 3TVMA 4HLEA 4KKBD 1SY6A 4TLUA 4Z7NB 1DVTA 2AEPL 2DV6A 4LCCA 1BD2D 5JO5B 1I3VA 2C1PA 3SZ6A 4P2OD 2XNAA 2I85A 3L16A 3O2DL 4TLTA 1P6AB 4G8IB 3AWEA 4EZJA 4G8GA 4UOZA 4YHZL 1IGTB 3FSOA 5EU5A 4KBPA 1DL7L 4AK2A 2G30A 4GO8A 4R90H 5E6ZA 1GTFA 4F7EB 4HCRA 4KITB 4O2CB 5BV7L 4DK5A 2FYVA 3K7UA 2BNRA 3PQYD 1W8NA 1I31A 5AKVA 5DUPH 1CFVL 4GW4B 4YHYB 4ZFFB 5E00A 1YNKL 1FC1A 4X7SL 4BQ9A 1WHPA 2F7OA 1G9ML 4N6RA 3RDTA 4PGJA 2PCYA 3APDA 3HPLA 2ZUXA 3B5HA 3OGCB 2A9NH 4QHUB 2L0DA 4EIGB 3BEWA 5KTEL 1E8XA 2B1HH 2WWKO 1BMZA 4MS8D 5L8LB 2F0CA 1MHEA 4N5UA 3OMNB 4TKWA 5K33A 3BO8B 2B14A 5EO0A 2Y7QB 1MJ7H 3EGXB 4PJCF 2XWEA 3DBSA 4P2OB 5KBMA 5B21A 2Y5QA 3W0WA 5KANG 4DW2H 3N1FC 2WANA 5FECA 1NGQH 3KLAB 1NGYB 5JNYA 4JQIH 4X7EC 2ZKWA 3IFNH 4KQ4H 3CVHL 4KDTA 5I19H 1XH2A 2FGZA 3ZHKA 1QBBA 4TVPH 4XN7A 3HZYB 4FNRA 3EOAB 3CK0L 4F57L 2X6VA 2A83A 4X7FC 4NO3B 4YBLC 3DURB 1IILE 4N8VA 4NN6B 4YDIL 1JHKL 4Y1SA 1QBLH 4QRRD 1UQSB 2VDRH 5E51A 3P4MA 3QWOB 5D55A 1JRHL 4GY4A 4IHOB 3MHZA 3HUJB 4X99A 2E76C 1A4JA 3PWPA 2ROYA 1GIGL 2YBRA 3RVTD 1YNLL 1K8IA 5F1NA 4PJEA 3HS8A 3QJQB 2Q9OA 5FHAL 3W9DB 2GFBA 1HHHB 4P2QD 3KBEA 3VXUE 1A6UH 5EFIB 1BEYH 4I2XA 3FCSA 1NBVL 1KELH 3Q01A 2H2PC 3TEUA 2APWA 2MNJB 2HAZA 3OKEA 4OVUA 1X5YA 5I82A 1AIZA 3MNWA 3QWRD 5IR1B 1UWGL 2D0FA 2Y36H 3HHMA 1Q0EA 1OD7A 3RPKA 4WLCA 4KZCA 1DN2A 1U8LB 4YBHA 1F00I 1KXHA 2LE9A 4ZUWB 3PYCA 4Q9BA 2DQEL 2EDDA 5I2IB 2H2SD 5L4FA 2VSMB 5DTFA 2NY3C 1U33A 1NDMA 3VFRB 1I3GH 2QPEB 2E6JA 4ZMLA 4OCWH 1T03L 1LK2B 1WGVA 5DZVA 2TSAA 2W81C 3X14B 4LLQA 1QQDB 3VJ6B 2LV4A 3IJHB 4P2QB 3BH9B 3GJFH 1SBSH 1GGIL 2WWKT 4A6YH 2K9UA 3C12A 3E8VA 3SQOL 1RPUA 1BHGA 3LS4H 3LVEA 3GPEA 1UADC 1UEMA 1NSNH 2V7NA 4RGMB 4X6EA 3WFDL 1XBRA 4Q9QL 4PB9H 4NWTL 2CR0A 2VZUA 1DUZA 3ZYJA 4Z7VB 1SLWA 5EUOE 4KTYA 3ERXA 3L2MA 4M6NL 1K6QH 4LEXL 1EMTL 3KZ8A 4N0CC 3E2HC 4ZFOA 3V6OA 3ESOA 5E2TL 1MCWW 3I74A 3IU4H 5DJXB 3THML 2CO2A 4JDVB 4GSDH 4JRXA 5D2NA 3AQYA 5DEFB 4N0RA 3PXJA 2IBZY 4EQ3A 3DPDA 3IRCA 4YFLF 3V0VA 4HUVB 3BCFA 1GGCH 1H8SA 3SSGA 3FTZA 1HN1A 1SHMA 3FRUA 3SDYL 3OF6D 4NM8L 4ALAC 1D5BA 3T1FA 5IW1A 4LK4A 3G6JF 3MLWL 2IPTH 1NIEA 1U8MB 4XBGB 1G7JB 5C1MB 4AYMC 5HP5A 4QRPD 1XHHA 4IKKA 3LRSA 3T08A 1LILA 3RPIA 3EJZD 2CIIA 1H0DA 2ZKMX 2CBOA 2Q7YA 4PS4L 1UM4L 4WO4C 3WJMB 2QDVA 4UUJA 1AI1L 4W4NA 3DO7A 1ES0A 1KEGH 1H15B 1XH3B 2ICEA 1DBJL 4EO5A 5C7XH 4KXZI 2ITEA 3LKPA 3VNYA 1LD9B 2G5BB 5IY5B 3D9AL 3BT2L 1IBFA 3ESMA 1FWXA 5IOPB 5D7JD 5CLZA 5KBPA 4RRPM 1W9XA 1O6TA 1AMYA 1MG3C 2E4TA 2XTJC 4HQQL 1T4KB 2PO6D 4Z7WA 3KPTA 5AW1B 3IPEA 1IC5L 4X6CB 5EIIG 2G4GA 3M8OH 5I76A 3OG6B 2IV9A 5J6HA 4UQAA 2PUQT 1W72L 4PUBH 3FO9A 3WKNA 3RY6A 3QARA 3W3BA 4JO1H 2HT2C 4ISVA 4KY1H 3DIFB 1CFQA 1I8LC 3KD4A 2F74B 4KO6A 3QXVA 4XN4A 3BAIA 1UJTA 4HUWB 4HSQA 2QVMA 2OYMA 4XMTA 1FJ1B 2YFOA 1AZVA 2HYMA 4AV0A 4E9TA 2J1YA 4OZFG 5EZOH 3MLZH 1Z5YD 3FQNA 2DQIH 4B3VA 4FERA 2QSTA 4S11A 1KPVA 5CN1A 4DVRH 3D2UD 3O9WC 1SYSB 1L0XA 3BVWA 2BSEA 1OGAA 1TF4A 2GK2A 2QGEA 3BZFA 5FUZH 5JIMA 3SDAD 4MJ5A 1FFTB 4JJ5A 2EH7L 2Y07L 2VDLL 1E9QA 2ENYA 5D7JB 1AZZC 3K1DA 1G94A 2Z7WA 4IOSD 3KEHA 3VXNA 4QNPE 1BM7A 4AOFA 2NSXA 5C0CD 4K3JH 4G80A 2AJ3A 2IG2H 4GRWH 5ANME 5ID1B 4YXLL 4UDUA 1RAMA 1HOEA 3FN3A 3BDYL 1UCBL 3V0AC 1A7BA 1SN2A 3UPCA 5C70A 1CQKA 1FVDA 1MLBA 2WXJA 3CHRA 4XPFL 4AVJA 4A63A 3ZT6A 5EU6E 5F6IB 1F4XH 2DIJA 4POUB 5IMMB 4JGNA 3ARBC 1EQWA 3QIWA 2X4NB 3P77B 1QFOA 2AKRB 3FONA 1MHCA 4PJ8D 1DVZA 2DWYA 4UV4H 5GRUH 3UTZA 1IL1B 2A0LC 4HIJA 2C3HA 3ARUA 4H1LB 5DRWA 5GIRB 2WLIA 3D2UB 5ITFB 2ESVB 5HDLA 4AK1A 1PX4A 3HG1D 3QDAA 1R9FA 3QK0A 2JCCE 3SEPA 4XNQA 3NCBB 4NZUL 2BC4A 1OQXA 5ESVA 2DI8A 3KG5A 1VACA 1JG9A 1DJZA 4QRBA 2A6DB 3L3KA 1IVLA 3K1KC 3R06B 3MRFB 2R39A 4GFXA 3V55A 3Q6FA 3ZDWA 4V1DD 5FDWB 4L23A 1XSJA 2N01B 3WELA 2VO5A 4NT6A 2N7BA 2ZP9A 2L7UA 5AOIA 5HVGB 2FBRA 2WOBA 2C1OA 2OMYB 3IMUA 3KM1A 3VRLE 5GHWH 5TE4H 5EUKB 2WM0A 4FQQB 1MZZA 4K2UL 5TE7H 3UTQB 1GA2A 2YLKA 3I6KB 3L6FA 3AVEA 1IKFH 3L2LA 4HEPG 1JGVL 3DX6A 2AERT 1H3XA 3IJ8A 3B83A 1HL9A 4F5CA 5IROA 4N2DA 4FXLA 5DJ2A 3T8VA 1MCPL 1NAMB 3UZVB 1HNFA 4GKOA 5T8IA 3CHXA 3VG9B 3RKDD 1FLRH 3JQOB 4UOW1 5L4MA 3QCVH 5DZJA 2B20A 5ELIA 1HILA 1MI5A 3CQQA 3LSOA 3A6CH 4JFPA 4AYGA 1R5VB 1SY6H 3LZOA 4NNXA 1R5IB 3B8SA 5EPMA 4OJFL 3LRHA 2YEQA 4GAJH 1ANUA 4YHKH 1BQLH 4CVWA 3V52H 3WFEH 3QORA 2Y06L 4KKRA 1ZT4A 4JLRB 3WHE0 3GMQB 3IN0A 2Q8BL 5FWQA 3CGTA 3NFPB 4FXKA 3ZKQD 3HFMH 2D7TL 4AH2B 5B4MC 3AJ7A 4HCRH 4JRFA 3HB3D 5D7SH 2BDNH 1X5AA 3OKMB 1Q9WA 2K6ZA 3S5LA 4A7TA 4D2NA 4IBYA 1ZD6A 4XMLH 4LDEB 5HY9A 5E23A 4NOBA 4ORGB 1HS6A 4PD4K 3K6NA 4BFGA 4PJ5A 3UJJH 3MFFB 5ICXB 1ACXA 2Z7UA 4LOFA 3VGGA 2V2TB 3LKQA 3AS2A 3UJTL 1K4CB 3LD8B 4R0LB 5A2KH 1IAOB 5FM8A 2E6PA 3G5XB 2IQAB 4OD3H 5JQHC 5KEZA 3NJNA 3OQ3B 1P7QB 3GPSA 4RZCA 5KYYB 1I3RA 3O2DA 3J07A 2D3NA 4JO2H 1IAIM 1X4XA 1ZANH 1F42A 3B43A 4KRNA 5E94A 5IM7B 3VXSD 1EJOH 2PWGA 5IVZA 1T0NA 2BP0B 4BM7A 1OE1A 5IJDC 3N1QC 3D07A 3O6KH 5JYLA 3BD4A 1DVFA 5AW9B 3VFVA 1MF2H 4ZPTB 3U4EB 5BOZG 1TTBA 5HI3C 2W0FA 5KYWB 2BSCA 4HJUA 4Y4HD 4LVNC 4XCFH 1MHPH 3HRZB 4ZYKB 4F9LC 3TO4C 3H53A 5J1TC 1JZ8A 3WHXB 5IJKA 5C0EA 2CKBB 1F8TH 3FT2A 4KI5C 5BZZA 2WXLA 1BG9A 1Z3RA 4AITA 2PCXA 1A4CA 3R1GH 4WI8A 4XGZA 2CLVB 3SE3A 4N28A 4BYHA 5EULV 4Z3HA 3ZX1A 5LCVL 1UWFA 2F5AL 3GMOA 3QDMD 3PS6A 1MFBL 4XP4L 5HD8C 2CBTA 2OL3L 2AQ3A 4RWYH 5B38B 2AJSH 1ZLUK 2XXGA 4YS4A 3DDFA 3W39A 3S34H 4JFQA 5EC1B 1H5BC 3B2VH 3NJKA 3S97C 4HAFA 4J12A 5HHMD 1AE6L 1T0PB 1UM5H 3KR3H 4DGVH 5L2KA 1MFVA 5I66A 1IEAA 2IDSA 3OB0K 2ADJA 1S3KH 5EWIL 2HKHL 5I0WA 3UBXA 4KU1A 3CVHA 2FJGA 4GKLA 2IF7A 2H3XC 2V2WA 3TPKA 3HG5A 2J8UA 2MNWA 5KS9B 3IKKA 2DJSA 3BHBA 3GI8L 4EE2A 1AGDA 1CG9B 1OGSA 3V7MA 4X6DB 5FFLA 4ZOEA 5GS1A 3NCXA 5B8CC 3CDZB 1J1XL 5CJOL 2MPVA 3RIFK 3QDMB 4K8RD 1BQUA 4NI6A 4M7LT 4PD4J 2NZIA 2FRGP 3RGVD 3ZDYB 2FO4A 2H2PD 1R5WB 4OZHB 2IAAC 3BSGA 3S8GB 4DEWA 2B15A 4KFMA 5IB1A 1J5OH 3R0MA 4MBRA 5AAMA 1VFBB 5SWZB 4CADA 1M57B 1V5JA 1RFDH 2EDXA 1HXYA 2QELA 2WNXA 1T89C 3HZKB 4OT1H 5DRNA 5I6OA 3KPNA 3SBWC 5KSVA 3CFBB 4LSSL 3BKJL 3LRLA 3MTRA 3ARTA 3P3UA 1HC1A 5C9JB 4L8SA 3ZE1B 2VQ1A 5ENWA 1M2VA 1QBMH 4ZTPL 4WHDA 2WLLB 3O11A 4LHJB 1OTSC 3ZY7A 5A6LA 3NTCH 4FQHB 1FH2A 1UA3A 1F3DH 3NSXA 4KGLA 4CAGA 3IE4A 2CG9X 1UB5B 3M46A 5IBLD 5A3IC 1RIHL 3LIZL 2PXYD 1IAKB 4B9FA 1A6VL 1N6VA 3R19A 2GI0A 4EF3A 1U2YA 2XPGB 4G5AA 4GMSH 3MKGA 1WICA 2W91A 4BSWA 1LQSR 1VGKB 4JPQA 4NDMB 2XXMB 1E5BA 3BMWA 4HKBB 5D4IA 5JPMA 3MV7B 4JJOA 2XVBA 1TCMA 1W0YT 3SPGA 4PRHE 2F8IA 1BP3B 5T1LA 3TONA 3HBPA 2NY3B 2RACA 1LK3L 1KT2B 2O5YH 3L7FB 1PF3A 2ZONA 1AHWC 3UTTD 4CNIB 1ACYH 4WFHE 5FHBL 3TV3L 1MUJA 2BZ7A 1R3HA 2D2OA 3P9MA 4X5PA 3WXVL 1D5XB 1E5YA 1X5HA 4PN6A 4TUOB 3RVXC 1UXSA 1ZXQA 1M71A 4HFWA 3CCHA 2CIKB 5DFAA 4XCCL 1FZJB 5DVPA 5IMOB 1GKOA 3GLAA 3OLGA 2KQNA 4KROC 3FT3B 2IADB 2CCLA 5IF0A 1S7UB 4XOEA 4PJFB 3A5VA 1AO7A 4H25B 3Q13A 3FW6A 2UVFA 3CQFA 5M95B 3FKUS 2VRAA 4OKVB 3Q44A 1SF5A 1ZSDA 1TJHH 4TNWF 4LHQB 1QABA 4JG1L 2HA1A 4XVUD 4LQFH 3MA9H 1FZKB 2EEXA 3FC8A 4FTVD 2QGBA 4YXHL 1KGYE 2X28A 1GZPB 2R9HD 3MRCB 1SVBA 4RISL 2NW2A 2EIEA 3HPJB 4L2YA 4MXQC 3UTTB 6PAZA 4NIKB 3G7TA 4IEFA 1VPOH 3BEVA 4FCAA 4I5BA 1U4FA 1XF2A 4PJCA 4Y2DD 4N8PA 1BAGA 3D5OF 2PYEB 3X13B 1E8YA 1JPSL 1MFMA 2JLLA 3QUZC 2IBBA 5T3ZE 2V0AA 3LZNA 2HT2D 1W72A 2Z0BA 1TVDA 2E47A 3QHZL 4NP9A 4CVXA 1DLFL 4TQEL 2JQAA 3A4DA 2CO6A 5C09D 4M43L 3B34A 3ZLQC 3ULVF 3O3DA 1SZNA 3X2QB 1PEWA 1K4DA 4PRAB 4PBVC 1NA8A 4M56A 3IU3A 1QTYT 5DHXB 1KBPA 2CRYA 3DRQA 1QZ1A 5DA0B 1Q9KA 2DL9A 4OFQA 4Z3JA 5KVDE 2XOTA 3NCMA 4QXTA 5JXAH 3ARGD 1ACZA 2C7UA 4FTVB 4XNMB 2BWDA 5DYOA 1HOCB 5F9JB 4JO3H 4OUUB 4XOBA 4V11A 2VW6A 4KTGA 4AUUA 3TBTB 1KGCD 4M1GL 1CLZH 2D4DA 2ZQKA 1X5FA 1KGXA 2Y6TE 5G4NA 2ZKHH 1OAXH 4Y2DB 2W9LA 1OAZL 2A38A 4HALA 3TJEL 5GSVB 5LGYA 3UMNA 4PLJD 3UEZA 3EBAA 3RWEA 2B2XH 4J8QA 5C0NC 4LF3B 4F7CB 3LV3A 5C09B 4HOWA 1ZCRA 2GBUA 2VGLM 1RUPL 2CO1A 1PJ9A 2YPVA 3MVSA 3SOBL 3DJRA 1U8PA 2I60L 4MZ3A 2VLLB 1NAKH 3N43F 4N25A 5KSAC 4JB9H 4MSWA 2Z35A 4J3OH 1MHHB 5T1DL 2BZCA 3VFOA 1A8JH 4YHLL 3Q1SL 1EANA 2AQ1A 3Q6GL 1QYGL 3A3YB 1SHXA 1NFDB 5DZAA 3W57A 1UXLA 4QRAA 3L54A 3VXRD 3IM1A 2AJXH 4X4MA 1DDHB 4NO0D 3ILDA 3H9SB 1ADWA 4FJZA 4AYFB 4QHLB 3ECBB 4X5WB 3OZ9L 2GSIA 1T20B 4RMWA 3S0PA 4TUJA 1JNNH 5FCUH 4ELMA 3NQKA 3N06B 1HHKB 4G59C 3TA3D 3G9VA 3VFSA 4AUYA 1WBZB 2MRYA 4EI5C 1X5JA 1TJMA 5E1AB 2V5RA 5AW6B 1R3LB 1UYWH 4L8CA 3EXJA 3ARBB 4YUEH 5IB2B 2J88L 4BQBA 1E30A 1JK8B 4OI8A 2V3DA 4PHXA 5EZLB 3DI3B 2MFNA 1ORQA 5D7LB 43CAA 5IFJA 4Q89A 4LCUB 5DT1L 2B4CL 3NIFF 1F58H 2DM2A 3MNDA 3T4AC 3ECWA 1BPVA 5C0AA 4GQZA 1XGUB 1IJNA 4NZJA 5AZUA 4N85A 1HHGA 2A77H 2IQ9H 1DCLA 3VXRB 4ZXBD 3VXQA 2R2EB 4H8WL 2FQFA 2XN9A 4JDTL 4NO0B 2CXKA 4QTHA 4Y4FD 5D8JH 3O8XA 2EYTB 2QADD 4NHCH 5SX4H 3DX7B 3G6JA 1VZIA 5I16B 1RQ5A 1SFDA 2AEPH 5DVOA 3R8BB 1CFTA 3AZUA 4DPRA 3MRPB 3U6XS 2W60B 4UI2A 3MRHB 3OKKA 4LLUA 2ZF8A 3B37A 3O2DH 4NIYE 3PF2A 1W16A 4OH2A 5CR8A 4HWZA 4YO0B 4YHZH 3U82B 4LLDB 1NOAA 3GC3A 4TTDD 2VN5A 3JWNC 5B4MD 3JTBA 1DL7H 4XP6L 3STLB 3NCCB 3GSUB 4P9HL 5F8RC 3VWKC 1D7FA 1TLKA 4L1BA 2OXGB 4LPYA 5BV7H 1GAFL 2CHWA 3A21A 1XCTB 4NZDA 3VDAA 4YHML 1CFVH 1EEYB 4U1LA 2DLFL 4PHZA 1YNKH 2ZE0A 4X7SH 3P4NB 1VGEH 1G9MH 4FXGC 1BD2E 2N1TE 3OAYK 2F53D 2E7MA 4C83A 3TH4T 1D5MB 3T8XB 3EDDA 3TCLA 4DSYA 3ULVL 1CJYA 4TXVB 2BP3A 1WYJA 7PAZA 4PCYA 5KTEH 2ADGA 4NAJA 2ZUTA 6TAAA 1QBAA 4ZX3A 1J9TA 3RZCD 2G2NA 2ICWB 4D9LL 2PTVA 4NQSB 3PQYE 4FD0A 1O7SA 1BIIB 1DHKA 1JZ3A 1GZQB 2CDFB 1A21A 1BVNT 2J25A 1NANH 2V3FA 2VISB 1O7DC 3AS1A 1R3JA 3L8QA 4MD5A 4LGRB 3P30L 5E24E 2R2CA 4AY0A 2GIYA 3CK0H 4F57H 3GS7A 2PNDA 1UB6A 3MO1B 1FL3A 2EUZA 4I0PD 3US0A 1Z9SB 4NGHL 4AV4A 1CU4L 1U8QA 4YDIH 3RFZA 1JHKH 3VTAA 3V5HA 1JRHH 4WTWA 3PNWB 2DBJA 1NEZA 2RQ8A 3ARDA 3V4VB 1GIGH 5LCVA 4QXWA 1YNLH 5HD8D 4DKFL 4DPAX 4DZ8A 5FHAH 2ENPA 4KOCA 3QFGA 2OL3A 3PDDA 3VDCA 1SQMA 3C5JA 3O41A 1N6QL 1CD1B 2SODB 4EJ1C 1NBVH 3QO1B 2YWZA 1EBAA 1YC7A 3WFHB 5D5MF 4PJHE 3GGWA 1WWAX 3RWIB 1IE5A 1NMBL 4FI8A 1UWGH 4HMEA 1G7MA 3QQXA 4LPVA 3V79C 3ZYZA 1DO5A 4QRRE 4XX1E 4LVNB 4MXVE 1H3GA 2A9ML 3O4LA 5JHLL 1ZLSL 4YE4L 4KFZC 3TO4B 4DQAA 4G11A 4EXKA 3KDMA 2CGYA 2DQEH 4LIQL 3HLAB 3BFQG 4TNEA 2AQSA 1SJXA 4WNSA 4P2QE 4DUWA 2R51A 1T03H 2X2HA 2YEZA 3ZYOA 3NDYE 4L8SC 1LEGB 2MOQA 4EZMA 1ZGLA 4E5XB 5FK9A 4AT6B 4U0RC 4J3XA 5D7EA 3II1A 3V8OA 3U0PA 4ORZC 1QSVA 4OSUL 1YQVL 1H5BB 1ZA6A 1GGIH 3T09A 2NY7L 2VZ1A 4Z7VE 2CRIA 1T1YB 4ZPVA 4QIRA 1OB1A 3SQOH 3T65B 1F13A 1NDGB 2FGWL 5CZRA 3G5WA 3WFDH 4Q9QH 4UQ2B 3NZ8B 4JQXC 4NWTH 4XXCC 3DUHA 2BIOA 4PJAB 2NXZC 2JKNA 4NC1C 2AQTA 5JIPA 4AG4L 5J12C 5CZXC 3HG0A 4JANA 3DTXB 4M6NH 3CC1A 4LEXH 4B9PA 1EMTH 3GUTA 4XPBL 3BUBA 2A7BA 2W5PA 3NG5A 4B53A 1ADQL 3I75A 2XBTA 5E2TH 2WXOA 3ZUNC 4HWUA 3THMH 3H54A 1ZIBA 2IPKA 1CYGA 2RGSA 3DX1A 2NQCA 4NFCA 4LLYB 3IJEB 5B8CB 1X7TA 4JFYA 2P28B 3DYOA 4GG8B 3QI9A 1D5IL 4HHWA 5AZEL 2QTVA 1Y18B 4ADJA 3HE7A 1FA4A 3FOMA 3SDYH 1J5IA 3TYFB 1MQKL 4NM8H 5DJ0B 5I1DB 3LIZA 4RIRA 3MLWH 2A1WL 5IUCA 1A6TB 1CGYA 4HKZB 2NT1A 3FFCA 1GGTA 5T5FL 1JZ5A 1T5WB 1WEJL 1AQMA 1R24A 2R23B 4PS4H 1UM4H 2FZ3A 4RZKA 5F0PB 4AWJC 1MFUA 2IFGA 1AI1H 4HX1B 5HYIA 1X44A 4X6CE 1DBJH 5K59F 2GJ6D 1EV2E 3D9AH 3ZU8A 1XB8A 2W65A 1NEPA 2PPDA 3BT2H 3SY0A 2X9YA 1KJMB 1NCGA 1F11B 2Z0UA 3B2UC 4AZ8B 4HQQH 2DICA 2OFQA 3SY6A 4NQQA 3BOVA 1Z5LB 3WNKA 1IC5H 2AZAA 2OXHB 3WFCL 4ZX6A 5DJ8A 1T1WA 1XF1A 3HE6A 4QRPE 1W72H 2OX5B 4JDZA 1CVSC 2YD2A 2KMWA 5L4IA 5SX4I 1H19A 3BI9X 4HIIB 3UJIL 1QZNA 4W6WB 3K46A 1AQKL 1E4XI 2ED7A 3S96A 3LN4A 1OF2B 2JLPA 4R7NA 2PPAA 1FRGL 1S7XB 4OGYL 5FS5A 3FB5A 2K3TA 1J8HD 1OGTA 4I3GA 5DLLA 1NCJA 43C9A 3BYYA 5AW8B 2P5EB 3MYJA 2GJ6B 4BWTA 2EH7H 2Y07H 2VDLH 1G4RA 4XNAA 3TL5A 3H1ZA 4YDJB 1AGEA 3WIFB 1DO6A 4IRSD 2J72A 5C97A 4FFYL 1JD9A 4JDEB 4J8RB 4YXLH 4KROB 1ZT7A 4BH8A 1OOWA 3GXNA 5FYKL 3BDYH 1UCBH 4MMXC 4BSVB 3EJYC 2WD0A 3QJOA 1BJMA 2NY1D 3BVDB 3H2QA 3QR1A 1DQQA 3NCYS 1SMOA 4OZ4A 4KUZL 4YR6A 2Y3NA 1MCEA 3TZVA 4LLWA 3E1F1 4S1QL 4ENEC 3IFPB 1X9UA 1J8HB 1E4WL 5ICZA 5JUEL 4MCZB 1PZ3A 5C0CE 3ZDZB 3U4KA 1NANI 2CALA 3UBXI 1P1ZB 4YHIA 5JW5A 4QXGL 1FCCA 2AXWA 5FGCB 1OCRB 3AAZA 4UB0L 2VH5L 3CFEB 1B6UA 2G5RA 4NZUH 4UIMB 2OMZB 1M7IB 1RZFL 4RETB 3F12A 4IRSB 3Q5YA 3APMA 2WQVA 3E6HB 2YOCA 5GS2H 3IETA 5DJCB 3S3BB 1JRHI 4MD0A 4JZOB 4OD2B 3ZKND 2VIRB 3CH1B 3L7EB 1JF6A 1KLUA 5DZNA 2EDRA 4Q6YA 2NY1B 2WVSA 1CR9L 4N2NA 2MCMA 1BJ8A 3HG1E 3G6AA 4TULL 4K2UH 5E0QA 3MACL 4NZ8A 4AIOA 3BVXA 1JGVH 3RUGB 3ES6B 3O6FD 4WSKA 1L3NA 4K71C 3S3DB 1LO2H 2WTOA 1JYNA 1MCPH 3T8MA 1VZGA 3QO0A 4Q8BA 4DN4L 3ZTJH 4YE0A 1BVKA 1C9SA 2FJHB 2OSYA 4PU2A 3OLEA 1HL5A 2BMKB 2ZZUT 4RRPG 5KG9A 2ZWSA 4V1DE 4MLSA 1JZ2A 1TQCC 4PGBB 2WWOA 2Y4SA 3DXAA 3OVUB 4Y4KA 2YQGA 2PPEA 1ULVA 1NPUA 4OJFH 5DJAA 1AKJA 1T2XA 1P84K 3D0LA 2WMPA 2Y06H 2VW4A 2KC0A 1XZ0B 3V9EA 4Z76A 2QVIA 5CMAB 2D7TH 4X4XB 3KVPA 4P3DA 4J3SA 2V6HA 5E9DB 2R83A 3S4SA 1D9KC 1WRFA 2AGJL 4ONGL 1RSFA 5E0FA 1FFPB 4K94C 1J0HA 5D1ZA 1X9QA 2BNQD 4WEMB 4QRSB 3WE1A 1K5NB 2DJMA 4MZ2A 2P7TA 3HI6L 3FU7A 4XHJC 1TZAA 4LHUD 5CIPH 3UJTH 4ZAKC 5DJYA 2X6BA 2I07B 4LCYA 3DJTA 1DYZA 2VM3A 4M8QB 4MXWL 5F72S 9PCYA 2YQ3A 1QWNA 5BJTB 1HXMB 4M7JH 3NCJL 4B9ZA 4EI5B 1PPIA 1E8WA 2QDWA 2VERN 2R2BB 4P3WA 5FW7A 1IM9D 1U2CA 3MJWA 4WZ9A 5EO9B 4PJXF 4MJIA 5I1EL 4PTTB 3SQBB 3LHPL 1S5HA 5C86A 1M6OB 2HFEB 2UZXA 5AW2B 1OLZA 3T4AB 1J12A 3T0EA 2F7PA 1SN5A 4N2MA 2QQQA 4L4VB 3KXFD 4L9DA 4LPXA 3T0VA 1NGWA 4PM1A 1T83A 3D3VB 2IWKA 4Z7UB 3UFIA 4FFWC 5K9KA 5LXVA 2BNQB 4U1IB 1MKFA 3ROOA 5L7XH 4FLSA 3K71B 4IIQA 3AS0A 3WFZA 3ZZQA 2HWZL 2J1KA 5BXFA 3P4OB 4R5TA 4XN5A 3VXSE 4UBDD 1ZK5A 3MUY1 1PD6A 3TIDB 2MQGA 2P52A 2BY3A 2F5AH 3ILQC 5AUMB 4XP4H 3TCXA 1SXSA 5SWSD 1MVUA 3WN5C 2OL3H 3V5KA 1QFWM 2WN3A 5BZXA 1KLFB 2VQTA 1KPRA 3TFKC 3TEZA 1AE6H 5KS9E 3MOQA 2YSSA 3VWKB 5DRXB 3AADB 1N2RA 5I74C 5EWIH 2AMGA 2HKHH 3OSKA 2ICWJ 2ZCKL 5CGYC 3MRKA 5FKPA 4X6DE 3BIBX 3FUHA 2IGTA 5H94A 5TDPA 4BK5A 2P80D 1U8CA 3P9WB 2F8VA 5EUOF 2Q3AA 1DVXA 1ZEAL 1JNLL 2VZSA 1N7ML 1P84J 4PRBA 2HZHA 4FXGB 1TG8A 2P49B 3GI8H 3MV9D 1I1YA 1E6OL 3QDME 4G6AD 3VMOA 1JYXA 3UPRA 3BYTA 2VLRA 4PJGB 3MJ7B 3GIZL 5JPNA 5L2JB 3ZDYE 1EXUB 4FI7A 4KK8D 5FGSA 1UH2A 4OZHE 3G5YA 3TBCA 4NP4L 5CU9A 3VXMD 2UUDH 2EKSB 1HHJA 2RIKA 5H2BA 5HHME 3VGAC 1HKFA 1J1XH 2Z93A 5CJOH 2VDPL 5L8JB 3S36L 3RVWD 2BSRA 4AEIL 3J8F7 5SWSB 4KV5E 5BS0A 2F8XC 1EHNA 1HWGB 4F2MB 1K8DB 5EEXA 4AIXA 4LDOB 2NYZA 1KN4L 2Z31A 4PW3A 3D25A 4JHZA 1ZLWH 3RWGB 3LEYL 1F4AA 1JWUA 4I85A 1KJ3L 5F7DA 4NAMA 4O58L 2AQRA 3PWVB 4U4BA 3GKZA 3QDGD 3BZ4B 3QC6X 3O3BA 4FA7B 4HIEA 3VM7A 5JHLA 3BESR 3PP4L 4JFDD 4WUUD 4AQAA 1RZQA 5MEPA 1QEWA 3JV6A 4LSSH 2V2XB 2R4SL 3BKJH 4Y9EA 5G2NA 2X6MA 4XNXL 2F6AA 4KKAD 3ULSA 4ZTPH 1K2DB 3HZVA 3KWVA 4IS6B 2COVD 4NC0B 4P06A 5DU7A 3KPRA 5IJBC 1A9VA 2VYRE 3VXMB 1Y1UA 4GEJA 1WAAA 2XTSA 4XBPB 4LGSB 3II2A 1P0SE 5TDNA 2CRZA 4ANUA 5IJVB 5MEOA 5E08L 2IXQA 3ZYIA 3ZR6A 1OHZA 1RIHH 2H32A 3MRQB 3LIZH 3STBA 5CD5C 1NIDA 1TZHA 3CZGA 3DJ9A 5I73C 2EH8L 1A6VH 1BVNP 5I6NA 3MBEC 2WQRA 4CSZA 1XIWC 1QO3B 3QIUC 5T3XL 5I6LA 3OKLB 4IIZA 2VDOB 5AKRA 1IAII 4M00A 1JK9A 5ISZA 5K39B 3JBG7 1LK3H 3UBGA 4NKDA 2OQJA 1N6UA 1J10A 5E2VL 1ADQA 2Q86A 5FHBH 3TV3H 4ZFGL 5EBMA 3QYNA 3ABZA 3WXVH 5KN5A 4QNPF 4YFLI 2H5UA 3KPQB 2H8PB 3QQ3B 3JZ7A 4P07A 1MW2A 3IDIA 1N0LB 4KUCD 4YFDB 5DHYA 2AJZB 4XCCH 4XNYL 2P42B 4LFHG 5BNXD 1F02I 2XCMC 3DSFL 5D7HA 4N9GB 4F20A 4XE0A 3SHSA 4X98A 5AWNH 4D94A 5IB3B 2WUBL 5EBWB 2OTUB 1VFAB 3UTTE 1PYWA 5T5FA 3OXSA 1GGYA 5DR5L 4JG1H 5LQBL 1PNCA 1TQUA 5EEWA 5J12B 4KKZA 3B9VA 1C5DA 3K80A 4YXHH 3LJ3A 3V5DB 2K8QA 12E8L 1PZAA 1I7UA 5E8DL 4UM8A 3AU1B 4RISH 4EUPG 3MNMA 4PRDA 1PL3A 3FO1B 5JZ7D 2JCCF 1J0ZA 3VQLA 4DT2A 5DD0L 2Y7SA 1SOSA 1IBYA 1NCHA 5DZ9A 3CUPB 2D03L 3T2NL 1Z1WA 5M94B 3U4BL 1A6ZA 2BY2A 3H6JA 3I2CL 3PAYA 5L9DL 3FTWA 3KCWA 3QHZH 1KB5B 4PV9B 2O93L 1DLFH 2RH0A 1BLNB 2JF1A 3LH9A 4TQEH 1TVBA 3DOSA 4ELDA 4M43H 5AOZA 5CEYB 2FSEA 3VD4A 5EHFA 2DWDB 2VOTA 4N8UA 4FTVE 3F85A 4FP8L 5HYJA 1SJEA 1CF8H 5GZNC 2JJUA 4Q6IC 3VRLF 2GCYA 2OSLA 3AY4A 4AGPA 1JBJA 5LDUA 1I1RA 1KEMH 2DYPD 3B9KC 4HU8A 3O45A 2NT0A 4M3KB 4MDIB 1KBBA 4IMKA 3FAXA 3LPWA 1A1OA 3PABB 4J6IA 4L29A 2EVIA 2A74C 1XGRA 2X6UA 3BVTA 3GWJA 4F8PA 5GRXG 4L8BB 4M1GH 4E68A 4GXUN 5C09E 1AGFB 1AQDB 1WD9A 1JUFB 2X0WA 2BCKB 1M1XB 2D31A 1OAZH 2KI6A 4FFYA 1JPFA 3TJEH 5LUMA 1FNGA 3CU1A 3RE0A 4C56D 1MEXL 5D5MA 5F89B 2V9TA 1AG0A 2W07A 4HBCL 4K7PX 4RGOL 4YIQB 3SDXB 5F7UA 4JFEA 2GW5A 4YDMA 3LQAH 4HK3J 4XX5A 4NN7C 3BP4B 3SDDA 2DS4A 1X5XA 1RUPH 3QNXA 5C08D 5INDA 3SOBH 3LQAC 3VYNA 4BQCA 2N0KA 2I60H 3QEQA 2CHXA 4KI1A 3LHAA 4AMWA 4K7PL 2B1AL 2HH0L 3EGDB 3CX5K 4YHLH 1WPCA 3NYKA 3OAZK 5T1DH 4ENED 3Q1SH 4IKNA 4XB3A 1KGCE 2ATKA 4TPRH 2DYPB 4UT6L 4BKLB 2I9TB 1PS3A 3Q6GH 4NBYB 1QYGH 3VACA 2WBJD 3Q8FA 3FO2B 3RWFA 2JI2A 4OB5L 5I17A 25C8L 1MCKA 3GXUB 4A67A 1QI3A 1TVHA 1S9YB 2X2YA 3IGFA 3UCQA 2BCMA 4WI4A 4F33A 1XF5B 3W38A 3BUYA 3QCUL 3LB6D 4BUGA 2FX7L 1GVIA 2VLMD 2XG5B 2NPLX 4UU9A 1WT5C 4AL8L 2Y23A 3OZ9H 3UP1A 3EHBD 4QOKD 5G4MA 1CDJA 1JWSB 3PDOA 5HVHB 2CO3A 1BQRA 4DGYL 2HJKB 2G4EA 2WO3B 4G9FD 4M4RB 1M7DA 2CSPA 5DJDB 1KJVB 1SPDA 1Z0NA 1HK6A 4PJBB 5KBKA 2J88H 1ESOA 3DRTA 4O51B 3VXRE 1KGIA 2XY2A 5EBLB 4M9PA 2A4CA 5DT1H 4NENA 2B4CH 5GS0L 2GT9B 4JK0D 1WF5A 1CGWA 3QGVA 1ZDSA 2JB6B 3RL2A 4F8QA 1VRSA 1F6AA 2OJEA 4LOUD 4KX9A 1QX1A 4HK0A 2Z91A 2AVGA 3OR6A 2AQ2A 4H8WH 2WCSA 4JDTH 2A4EA 1OT4A 2VDQL 3EG9A 2QV4A 3IGLA 2RFXB 4N3UA 3ECQA 4FC3E 5E5UB 3ESNA 3FH7A 3VCLA 5L6YH 4BRVA 2CLRB 3FQRA 1J86A 2FT6A 1SBBA 1FYTB 3X12A 4IJTA 2NR6D 1PCSA 5L0QB 1F56A 1WA1X 3CLFL 3DUSA 1YEFL 3QE5A 1INDL 1BEXA 4E9RA 2ATPB 3GMMB 1GJIA 4XP6H 4P9HH 1MWAB 1D9KD 3NJFA 2CK2A 4M6AA 5BW7A 4P9HC 1N3NB 1GAFH 4K71B 3T0DA 4NQVB 1Q9OB 3A4AA 4YHMH 3OJVC 1QSFD 4OVVA 1W0VA 3T0EC 2ZX7A 4DKEL 5A1AA 5IEHB 2DLFH 2BOLA 3DSNA 2BLFA 3V4UL 5JLZB 1A1MB 5FM5O 2NZ9C 1WWWX 3MRNA 2FWUA 1XR9A 2Y5EA 4NO5B 3C6LA 4XHQA 3CX5J 4HV8A 3ULVH 1TQCB 2EQDA 1ED3A 2VUKA 4NPYA 4UCFA 2NNCA 4WWOA 2JTDA 4ODSL 3T4YA 2J2ZB 2K4WA 1EA9C 1T1XB 2VUYA 2WZPA 3AT0A 2W0KA 4HIHA 2F58L 2NRDA 2X4OB 1KSRA 1XEDA 5B1CA 1H6EA 1X5KA 3PP3H 4D9LH 5FO8B 1LWHA 4PRID 1YYCA 3MGTA 2AEOA 2ODIA 5B3NA 3TIEB 4GMTL 5DS8B 5EORL 3TN0D 5BQDA 1D9KB 5CAYB 2FX8L 1WFOA 1G0XA 2JJVA 3P30H 1XSOA 2F53E 2ZOKB 4JUTA 5IMLA 4KNSA 2Q2LA 4WHCA 3PV7A 2ZX6A 2MQ0A 2EP6A 5TGBA 2YAHA 1RH8A 4LLMA 3VFUB 3KYKL 5I75B 3FRPA 5FYLE 3JV4A 3LQZB 4NGHH 4RNRB 1CU4H 1CS6A 3SJVA 1KB9J 1ZY9A 2H1PL 3QWNA 4PBXA 3F62A 1KTLB 3ARXA 2ZCHL 4ZAKB 5CIPB 1I7TA 3CJJA 4CMHC 4OGZA 4H8QA 4YEFA 2X4PB 5F7AA 4DKFH 3L3JB 2DLGA 2DEWX 2ZKYA 4AIZB 4HCIA 1QLEL 2I7SA 3MRRA 1N6QH 4FNLL 1CXLA 4PGCA 4UZSA 1B0RA 3LKOA 3QUXA 3EJJX 1QWHA 4G5ZL 4PRIB 3VH8A 4LBEA 4IKJA 1EEUA 1EAQA 1FO0B 3LKSB 1J48A 1HU8A 3BN9D 1A1NA 4N0UA 3TN0B 1NMBH 3RX5A 3U79A 1FC2D 3BAXA<