1M9WA

Study of electrostatic potential surface distribution using high resolution side-chain conformation determined by nmr
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
98
structure length
98
Chain Sequence
ANATVKMGSDSGALVFEPSTVTIKAGEEVKWVNNKLSPHNIVFAADGVDADTAAKLSHKGLAFAAGESFTSTFTEPGTYTYYCEPHRGAGMVGKVVVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords plastocyanin
publication title Study of electrostatic potential surface distribution of wild-type plastocyanin Synechocystis solution structure determined by homonuclear NMR.
pubmed doi rcsb
molecule tags Electron transport
total genus 29
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2002-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1m9wA00
2QPEB 2EIJB 2XU9A 2Y1AA 4DP5X 4WKXA 3QJQB 4ENZA 2GSMB 4HZ1A 2WO2B 3NJKA 2VM3A 5B3SB 2HX9A 2CALA 3ZBMA 1OE1A 1IKOP 2YAHA 5B1JC 3G5WA 1A8ZA 3AZUA 1NICA 3ABGA 4YSPA 4QLWA 3T9WA 2UXFA 2QDVA 1ID2A 3PCYA 1CUOA 4TXVB 2BHFA 3OMNB 2UXVA 4HALA 1FWXA 1YLBB 3NSYA 1PZCA 2XX1A 3ABKB 4E9RA 2HXAA 1J5CA 4A66A 2IDQA 3D12B 5B1JA 3JTBA 1BXVA 2UX7A 3FSZA 1SF3A 2H3XC 1AS6A 2DWSA 4PCYA 1V54B 3NSDA 1JZHA 3HEIB 3FSAA 4Q89A 4GP8B 1SHWA 2R7EA 1OCRB 2VSKB 4AKPA 2OV0A 2AZUA 4KO5A 3ABMB 4E9XA 1ZPUA 2W88A 1OCOB 4BDVB 1BYPA 3PLYA 1NIBA 2AZAA 5EHFA 2VW7A 1L9OA 3OQRA 3ASOB 1XB8A 1B3IA 2BWDA 3NJLA 3FQ1A 1OOWA 2BP0B 2RACA 3OMAB 4P5SA 3JT2A 5F7AA 3NSFA 4YSRA 1M9WA 2VN3A 4A2DA 1PZBA 4NB7A 3V9CA 1WA2X 1KV7A 3FU7A 3GYRA 4GXFA 3FT0A 1AS7A 1IBZA 1TU2A 2YAOA 2XYBA 4N4YB 1OF0A 1OCCB 1XMEB 2UX6A 5D4JA 5E9NA 1J9TA 1BXUA 2FT7A 1J9SA 5IY5B 2X87A 1AS8A 3CG8A 5PAZA 1ILUA 4AX3A 4GY4A 1M57B 2J56A 2XX0A 5FC9A 3IE9A 1OE2A 3H4HA 5I26A 2YAQA 5I28A 3TU6A 2ZOOA 1ET8A 3FQYA 1AG6A 2IWEA 5I6NA 3AG1B 3N2JA 2HZHA 3UAAA 4DP2X 3UAEA 1GSKA 2GB2A 1A65A 1L9SA 1JVOA 2R7EB 1KDIA 3QJUB 3CDZA 5B1KA 3NP4A 3ZIYA 4HCGA 5TK2A 2FNWA 4DP1X 1NINA 4DPCX 4FA7B 5PCYA 1HAWA 1ZV2A 3DTUB 2XWZA 1A4BA 3CZUB 3S8FB 1TKWA 4E9TA 4FAAB 5I6MA 4L0PB 1NDTA 1GR7A 1NIAA 1J5DA 1RKRA 2GI0A 7PCYA 2BW5A 2FQFA 3WNJA 1L9PA 1E67A 4YSCA 2QPDB 2A3TA 3BVDB 4G7QB 3UGEA 3FU8A 3NJIA 3AG3B 2PP8A 4JHUA 1ASQA 1JZIA 3EH4B 2QDWA 1NPJA 2QT6A 3FU7B 4GYBA 2BW4A 4X4KA 4KO6A 5B7FA 1HFUA 4E9YA 3FYIB 4W9ZA 2J5WA 1NIEA 2FQEA 1JVLA 3TA4D 2PP9A 4YSEA 3AG2B 2PPEA 3NSCA 5B1AB 4NAJA 1URIA 2XVBA 3ZX1A 1BQRA 4AZUA 1JXDA 2P80A 1SJMA 4RH4A 1E30A 3FPXA 7PAZA 2AANA 3H56A 5F7BA 2IDTA 5AZUA 1PMYA 2GHZA 5AKRA 4UAHA 2YAFA 2J57A 3QJVB 1MZYA 1X9UA 4AKOA 3PAVA 4CSZA 1M56B 2VSMB 2DWTA 4ZK8A 3PAZA 3X1BA 1GY1A 1PF3A 1KDJA 2E86A 3FQ2A 2XLLA 2VW4A 1KCWA 3CDZB 3CVCA 1BQKA 1NWPA 2EINB 2TSBA 2IWKA 3S3CB 2J55A 3AW5A 4DP8X 2UXGA 8PAZA 4A2FA 2IAAC 1TEGA 4BXVA 1NTDA 2DY2A 1GYCA 2EILB 3CVDA 2HRHA 2FWLB 1NWOA 4BWTA 2XXGA 5I5MA 2JKWA 5B7EA 4HAKA 3SBRA 2B3IA 1CYWA 1BYOA 2JFCA 4YSTA 5I6PA 3X1GA 4KOBA 2FQGA 5B7MA 4UF7C 2YQBA 1SDDA 2BP8A 3QJSB 1WA0X 2JXMA 1KGYE 4A2HA 3AG4B 3ZDWA 2B08A 4G71B 3T6ZA 4W1TA 3WKQA 3OD3A 1L9QA 3SQRA 2W8CA 4A67A 1SF5A 3WNIA 1A4CA 2Q5BA 2TSAA 3FS9A 4A2EA 4GP4B 4BWWA 1MG2C 1SFHA 2HLEB 4HHWA 1NZRA 4WTQA 4HCIA 9PCYA 1VLXA 3OMIB 4KNSA 3N55A 1AAJA 4UANA 4BXSV 2IDSA 3V9EA 1AZCA 1PLCA 2I7SA 5I5IA 2YXWA 4KNUA 1W6WA 4HHGA 1CURA 1IC0A 1ET7A 1AIZA 2Y69B 3IN2A 1SNRA 2XXFA 1BXAA 1RZPA 4YSAA 3MX0B 1AR1B 3PXLA 3NJJA 3QQXA 5D4IA 3S8GB 1J9RA 1JZGA 1JOIA 3H4FA 2ZWNA 3WIAA 1AACA 1I53A 1IBYA 2XV2A 2GIMA 5B1BB 1PY0A 4YL4A 3NYKA 1L9TA 2H47C 2CAKA 6PCYA 2EIMB 2PPCA 1QLEB 4E9VA 5AFAA 1JERA 3C75A 4G72B 1BQ5A 3FU9A 2PCFA 2VW6A 3TBBA 4DP7X 3NJFA 4DP6X 3FSWA 4E9QA 4KOCA 3NT0A 3X1NA 1QHQA 2PPDA 2YAMA 1N68A 4YVUA 1KBVA 3NJGA 3WKPA 1SDDB 2WO3B 2BP8B 2GBAA 3S3BB 2IH8A 2IWFA 2IDUA 1XB3A 3L45A 1GS7A 2MRYA 2PPFA 3EHBB 1J9QA 1DYZA 1OE3A 2PP7A 4HCFA 1PLAA 1A4AA 2HX8A 2P80D 2YAEA 4A68A 4NERA 1L9RA 1KBWA 4F7KA 1AQ8A 2XV0A 3NJMA 1SHXA 4YSQA 4M3HA 1ZIBA 4JKNA 3QJTB 1GW0A 2X88A 1EZLA 2IH9A 2FT6A 1JZEA 3DIVA 5ANHA 4YSSA 4YSOA 4CSPA 1AANA 1NIFA 2DYSB 2BZ7A 4AI7A 3X2QB 3U25A 1ADWA 3NJNA 4P5RA 4DP9X 2WSDA 1PZAA 2ZONA 2CBPA 3PAUA 4G7RB 4KNTA 4N8UA 4PAZA 4YSDA 1PLBA 1WA1X 3IBOA 3SBPA 4QKTA 1TEFA 1OV8A 3OM3B 1ET5A 2OCCB 4K9JA 1T5KA 1PNCA 3RYMA 3HB3B 1QNIA 3UABA 4E9WA 3AY2A 1MZZA 3ERXA 3FPYA 1AOZA 1AZUA 2NRDA 1RZQA 1V10A 2ZXWB 5I5JA 3TASA 3WI9A 4DP4X 3GXUB 2GC7C 2GC4C 3CVBA 2BZCA 4YVNA 2FTAA 3FYEB 3SBQA 1CYXA 1W8EA 1NPNA 1ZIAA 1CC3A 2DYRB 3ABLB 1FA4A 1HAUA 1FFTB 2PCYA 2BWIA 5D4HA 4HIPA 1F56A 2YAPA 4KO9A 2H5UA 3X1EA 5I6LA 3T6WA 1BAWA 5LDUA 1MG3C 2PLTA 3PPSA 2LLNA 1WS7A 1EHKB 5A7EA 4AKQA 6PAZA 1W6LA 4GP5B 1ASPA 1JXGA 1A3ZA 4F2FA 3GDCA 4F2EA 3ASNB 2UXTA 1JZJA 1E65A 2FJSA 2AFNA 3S3DB 1MDAA 4BK5C 1PNDA 1E5ZA 1WAEA 1ASOA 3T6XA 3T71A 4YSUA 1R1CA 3QPKA 4DPAX 1KYAA 1E5YA 4Q8BA 1JXFA 1XB6A 2OJ1A 1DZ0A 1JZFA 1N70A 1OCZB 2EIKB 2IDFA 2HRGA 1SFDA 1AZBA 2AVFA 2CJ3A 1PCSA 4G7SB 3MBWB 1ZDQA 3IEAA 5I6KA 1WS8A 4M4RB 3NP3A 2I7OA 3QJRB 1GS6X 1NIDA 1GY2A 2VMJA 5TK4A 2Q9OA 4E9SA 3UADA 3EH3B 1PAZA 2PPAA 4G70B 1ETJA 1UATA 5I6OA 1AZRA 2FQDA 3KW8A 4MFHA 1X9RA 3UACA 1AZNA 3EH5B 2YARA 2HX7A 4A2GA 3NJHA 1KCBA 3FSVA 3EF4A 3WG7B 2I85A 2DV6A 4DPBX 2YXVA 3X1FA 4BDVA 4BWUA 3KW7A 2N0MA 4KO7A 1ILSA 1ZDSA 1AG0A 1IUZA 2CCWA 3BQVA 1BEXA 3IN0A 2VM4A 2XUWA 3TBCA 2CUAA 1GS8A 3DKHA 4EF3A 4JHVA 2MTAA 2FT8A 2BP0A 1RCYA 2BO0A 2XV3A 1V55B 4DP0X 3T6VA
chains in the Genus database with same CATH superfamily
3UFIA 2P48B 2XTJB 3KM1A 5IB4B 3QJQB 1K85A 3C60B 1GTNA 4JO3H 1IAIM 1UD5A 4UQDA 3V0EA 3O3DB 1MI5D 4C56E 3BE1H 3MUJA 4F2MA 1BQHA 2ENQA 4DN4H 3MRDB 2FBRA 3MYZA 4DESA 5JQ6L 5ECJE 1I8UA 4GIOA 1JRHH 2YK1L 3TN0B 5CCJA 2PO6A 3UZEA 1INQA 3UJIH 3ARFB 4R26H 1LMKA 4K7PX 4GW5B 2J88L 2ZUXA 3L3JB 4W68A 2P5WA 1CMOA 2EE9A 4PGEB 3D12B 5I8KH 4IOIA 4U0RB 2JTYA 2XIIA 2H26A 3BISA 5E1AB 3VGEA 4X0KB 5DD1H 4ZFOB 3GSNB 3LS4H 4H7VA 4RGNB 4WUUE 4PJXE 2OI9C 4QXWA 1SHWA 2BRQA 3GC3A 3IGFA 4L3EA 4JO4H 4MD5A 3ZPDA 4JFDD 4NN6C 3RFZB 3HPLB 4MMXC 3AXLB 1ZHKB 1NUDA 4LCYB 5JW5B 4NQCB 4MA7H 1VA9A 2PTTB 4WU7B 3OZLA 4GSDL 1T1XA 3TZVA 3ZZQA 4X6CA 5E5RB 1CFBA 1OAJA 5IQ9B 3IWUA 1X44A 2F5BL 1YA5A 2QZ5A 3AQXA 1EHNA 5T1DH 4YLCA 2CKNA 2AXGA 1ZVSB 3JT2A 5E6IC 1SOQA 1TFPA 1UWFA 1M9WA 2ADYA 3Q8BA 2X4UA 4QRTB 2AXFB 1ECZA 1FYTA 2ZKXA 5FM5M 4DETA 4GXFA 3V6OA 1KSRA 3QDJA 5L2KB 1HK6A 2EDBA 3US1A 1NOAA 3MUHL 5GJSL 4GSDH 4HQQH 2ARJB 2ED6A 4OJEH 1N59B 1HU8A 3F5WB 3INUL 3W3BA 2FT7A 2YO3A 4JG5A 1YNTF 4WW1A 1F90L 1MVFA 4HJGB 3D2UB 4JY6A 5IY5B 3THML 2AC0A 2YSSB 3KPSD 3GINA 1FO0H 5IJKC 4ZO9A 4HIEA 5HGBA 5LXVA 1CDBA 2KERA 2NY4B 5MI0C 1U6AL 3F83A 3W2DH 1OSYA 1E6JL 4JY5L 5H8DA 1IEAA 4HGWA 3VMNA 4X4ZA 4CGTA 3QZWG 4JQIH 4E41B 3IFPA 3L5HA 4GAJH 5C92A 2A1WL 3MRFB 4YXKL 3ZDYF 3T6QC 3PJNA 4JN1L 1U93B 5ACMA 2QFRA 4O02A 3GHBH 3SODB 4X4MA 2ZF8A 3UBXG 1U91A 1WIUA 1PLGL 3T0ED 3LN5A 4KKCC 4P3CH 3RKDC 3LNHA 3V10A 5GZNC 5J1AB 3BQUC 3OLDA 1YN7A 3DV4A 4HWBH 3P11L 3HG1B 4PVMA 1NKOA 3IJHB 2EICA 4NN6B 3EUUA 5FYLH 1A1OA 2BW5A 4MMXB 3UIZA 4DSYA 3KYNA 2L8AA 4G6MH 1P2CB 2EXSA 1IL1B 4X5WA 1AOHA 4G7QB 1I1AC 1HI6B 1B3JA 4YXKH 3Q5YA 1L9MA 2VDQB 1CZ8H 5HVFB 1YECH 3G5ZB 1UZ8A 2A9BA 2EC9T 3IMSA 2H7WA 2UY6A 3LH9A 3GMRB 4XVUC 3T1FB 1MJJB 4UOW0 4LPVA 2AW2A 3MRHA 4X7SL 5FDWB 2X6UA 4GINA 1WFIA 3QC5X 1MXGA 3DX3A 4FFYL 3PHQA 3QPXL 2ZUTA 3P2BA 3FO1A 1EWHA 3P11H 3ZZ1A 4B53A 1AE6L 3QEGL 2QQNL 1A6VH 1LP9A 4PTUB 3EFFB 3KPRA 5FWRA 3BAJA 3OPUA 2NSQA 5CIPH 5IB2B 3VWJB 2Y1YA 3B3BA 2NY3C 3KWVA 1G9MH 3JTTB 5B38B 1FZJB 1AR1D 3MU3A 5AB2A 1ZTXH 4OJCA 4CNIB 4LGRB 4X7SH 4GFXA 4CC1A 4GIPD 3EH1A 3PWPD 3VCLA 1K72A 4XI5D 3PAZA 1IQWH 1FFNB 1KB5B 2MKWA 2WINA 3D09A 5KUMA 1X5ZA 3QPXH 3L6FA 3UTTA 1BAGA 1XBDA 3D69B 4ELME 1OANA 2NR6C 1BQKA 5KVEE 2ITEA 1F3JB 1AR2A 2G2NA 2UWEA 5MI0B 1NFDF 3L3OC 4LOVA 1BVOA 1CDGA 5LCVA 3PV6B 2QVFB 1K4DB 5IG7A 3D08A 1J5IA 2XFXA 2IJ0C 3BEWB 3IMUA 2FWLB 1ZGLM 3QIUA 2X40A 1M9SA 2EDJA 4F7CB 5BS0B 1QA9B 3SBRA 3LKOB 4YSTA 3SDXA 3QNXA 5AQ0A 5HGHB 2A9NL 2W92A 3B2VL 4HHAA 4NC1E 4LLVA 4PG2C 2V4LA 3KPMB 4C55A 2JXMA 1ZGLB 4JZJB 4ZUTB 4MYWB 5DA0B 2DPKA 1AQHA 3UEQA 1IEBA 1NCAL 4ZMOA 4I3RL 2NCMA 2OCJA 4A38A 1DQTA 2WYIA 4HIIB 4YEFA 1IAOB 4JVPA 4J8QA 1NUFA 3CFCH 4UTBA 2DWDA 1I1AB 4IKLA 2QV2A 2FGWH 3ARQA 1NBQA 1VADB 2VC2B 4A6YH 4HCIA 3UYOD 4H0LC 3OMIB 3ARDA 1MWAB 1T0MB 1EV2E 4EI5A 1QASA 4BINA 2A9NH 4L8DA 1CQKA 2W0PA 4JZNB 1S78D 3ORJA 3BSGA 1AIZA 5ALCL 4FERA 5JOEA 2X44D 1NCAH 4IBLT 4NQDD 5F1NA 3MNVB 3T3PE 3AQDA 5SWZB 2CRMA 3S37L 5BOJA 1XSOA 3ZRFC 1CGTA 1W8OA 3Q1SH 4NO0D 1WHOA 1UEMA 4IDLA 2G5RA 2X4TA 3QQXA 3QR0A 1AGCA 2CDFA 1Q94A 4YXLH 5IJCC 1J9RA 4WV1A 3CU1A 4X5RA 5CP7B 2ZWNA 2K4AA 5HYFA 2NY3B 2WLKA 4QO1A 2XT1B 1TT6A 5GRWA 5DJ6B 2MNJB 2DB8A 3LIZA 5K9OA 4NKDA 1P0SE 2L3BA 3EYOB 4JM0A 4ANWA 4ZFQA 1FI8C 1A9BA 4ZW3A 5T1LB 3L7EA 3AXIA 3VD2A 1N3NB 1A8JH 4OGYH 3EDKA 3RQ3A 4JFFD 1RIHH 5F7YC 2EDLA 4AH2A 3L3OB 3WENA 4YVUA 4FTDA 1IM9D 4FXKB 2Y2YA 1U3HA 3S3BB 1HEJC 1PW3A 2E7DA 3L45A 3PFUA 3ZYIA 2DQUL 3NBNA 3WL9A 1DYZA 1R3JB 1MFUA 2ZCLL 1XCWA 3SKNB 1WCBB 4NSKB 1SEQL 4HKJB 4F7KA 3VXUB 5DTFA 3D34A 5FGCB 1KCLA 2GJZB 3PE9A 2GJ6D 3IKCA 1TYEB 3QJTB 4YMPA 3GRWA 4JFOB 4M1CD 3HI6H 3DX7B 3JYBA 5DJCB 4AC4A 1BEYL 3LJ3A 1GSMA 1SLVA 2JI3A 2P8MB 1KGJA 1CD1A 4NUMA 4PJDF 3T0WA 3IFOA 2X05A 5L9DL 2IGTA 1X4YA 4MA1C 2GHWB 2QLYA 4Z7UF 4JM2B 1DSWA 1F6AA 3BPOC 5IHZB 1CPUA 3UAJC 2Q3AA 1JXKA 4IBTA 3EO9L 3OM3B 2CXGA 3IXTB 3MMEB 3BRFA 4RNRA 3HB3B 5KAQG 1G7IB 1LWRA 4MD0B 4HAGA 3UTQB 1AGBB 2XN9B 3NVQA 2H32H 2X3CA 1L6PA 1S9YA 4N9GA 4Y89A 4F8OA 3Q1EA 4AITA 5FKPB 3BH4A 3MA7B 3BDXA 5GRJH 3C09C 3M8OH 4YVNA 3S4SB 1R5VB 2OMVA 4P2RD 5L0QC 3ZQWA 3NA9L 4WWPA 5DVOA 5G5DB 1KFGA 3MO1B 1P4UA 5C9KA 1KJ2B 2WKOA 3UBGA 5IMOB 2HTLC 1RLBA 2E6JA 2H5UA 2EE3A 2E46A 3PWLB 4M5YH 5IW1B 3W0WD 2YGPA 1BM3L 3OC8A 5JR1H 3MRRA 1CCZA 4B95C 5I1JH 1HYSC 4NUQA 3BZEA 4FTVA 3SQBA 5HJ3A 1H5BB 5C0CE 1TQTA 1NMBL 5E1QA 2EEBA 4G8GA 4IRZH 2UXTA 2IANA 2YD5A 4DHLA 5HI5C 3MXWH 3WY1A 2NY2B 3VFNB 5I1IL 1WIPA 3IJEB 1ZHNB 1K4CA 3DX9B 3GPEA 3HE7B 4P2QB 1U8KA 1KTDB 5HJBA 4OBRA 3W39B 2IXQB 4R0LA 4Z7VF 5GGTH 1E5YA 2R8SH 4P2YA 2W0FB 3QULB 4IS6A 1OM9A 3MV01 1I3RB 1G9NC 2J8UF 3VFMB 3HI1A 2CDEB 2VRQA 3SGKC 1JYVA 4OV5B 3QZPA 2C1PB 4HD5A 1S7XB 2VLJA 3QUGA 3MBWB 1GJIA 2KKQA 1NCGA 2G3MA 5DUPH 5T1MB 4CU7A 5E7FA 3NP3A 2VE6B 4FZ8L 2I7OA 4NNYB 2X4OB 3MV9B 3CDCA 2WGNB 3LPPA 3SBWC 2VMJA 3T8XB 2C9PA 4YDKL 4E9SA 4G83A 3B7SA 5F7WC 3OJ2C 1NJ9B 2NYYD 2P7TA 4JO2L 4Y7MA 4PJFE 4MA1B 3FCUB 3JXAA 1KXHA 2PWGA 2WTOA 4FQJL 4HG4K 2Y5EA 3ULVC 2P8PA 5KN5A 2FQDA 1CT8A 3AVEA 1ETZB 2IG2L 1BA9A 4Z5RA 4H44C 4ZMAT 4AIZB 4TUKL 3N1QC 3GMMA 3NEOA 3UTSD 2VAJA 1S7QA 4LSSL 2DV6A 4MZ2A 1MAKA 4ZUSA 3EGDA 1GIGH 4W6WB 2D3NA 4KAQL 4OZGB 2N0MA 4K4KA 1GTFA 5IB5A 3TO4A 4XAWH 4YDKH 2NPLX 3HMXA 5CEZL 5L0QB 4HEPG 5T8IA 4JO2H 2WBJD 3WHXB 3TPKA 1OGAA 4M03A 2FT8A 4Z7OE 2OQJA 3F8UB 4R96A 1BG1A 3QQ4A 4OCYH 4OZIB 3SCMB 4O00A 3MCKA 5D8JL 4ZAKC 5BZWB 4DEUA 2Z7YA 4HUNB 4AGQA 4U1LA 4ZTPL 1ZK5A 2ORBH 4LSSH 2PXYC 3MLRH 4JDZA 1UXLA 4CL7A 3P02A 3GZQA 2HRPL 3NN8B 4GRLA 4QTHB 4Y19B 3QS3A 2WJ7A 2DDQL 3ABGA 3MDJA 3WBDA 2FX8H 2UXFA 1TR7A 1HL9A 1UD3A 3OAZK 2ZWYA 4APXA 2CMRL 3F7VB 1MCOL 4FXGA 4JFUA 3ZXAC 2DQIH 4IMKA 4YWGL 1R24A 2X38A 1MFCH 4KJQD 3L4VA 3ZZLA 2EDKA 1KXQA 2GUOB 4PU2A 4ZTPH 1MSPA 3O2WL 1QZ1A 2K8QA 4BUQA 3FN0H 1KACB 1Q1JL 1MFAL 1FNFA 4HIHA 4IBYA 2HRPH 2CO6B 2X2UA 4KX9A 1JHLL 4U1GB 3DMMC 1DE4B 3KPSE 4RMQA 3E8UL 5L4IA 1MCNA 5TDOA 1MAJA 4G6KL 3GJEA 1QO3A 1NFKA 1MCDA 4L4VB 5H4ZA 3L08A 4I5BA 1F4XH 4UNIA 2O72A 1UASA 3BIKB 4DUVA 2NDFA 4AC2A 3OWEA 1SLWA 2ATAA 1IMHC 2ZTBA 4W9CC 1YEDB 1NCWL 2J8OA 4MDJB 3K71A 4JHWH 3VACA 3B9DA 3JBG7 1OARL 3FJTA 4UTCA 3OMZA 1UKQA 3O2WH 1TZIA 5EULV 2DWEA 2VDKH 1NEZG 1RZKH 1Q1JH 3AU1A 1E27A 4P5SA 2WWOA 2A0LC 2BHYA 5ES4B 1KTLB 1LEIA 1NBYB 2CIIA 3CSYA 3E8UH 4AL8H 1RP9A 2FECI 4C56A 3L1GA 2VN3A 1A4JA 4B9JA 4N2CA 2W60A 4L23A 4HVBA 2R39A 1AGDB 1IBZA 1ZAGA 2MPAL 2XG4B 1DQIA 2K8MA 4G80A 3ES6A 1OF0A 1VRSA 4I1PA 4R4NC 5DJXA 1OARH 2XSKA 2QVMA 2UX6A 1YEJL 4G7YH 3VE0B 2WUCL 1WUNT 5JW4M 2DI8A 3P9LB 2JLPA 4RMSA 2XJLA 1O0VA 5KG9B 2JK5B 4NO5A 1XR9A 2MFNA 4YK4C 4WUUA 3H4HA 4PJXA 1NC4D 5I28A 4QXGL 5AYQA 2LVEA 3ESMA 4I1NB 2ZOOA 3CN0A 4EOWL 3PY9A 2G75A 2J72A 4JFZL 5AG9A 2HG5B 2XWJA 3NACL 4H5SA 2LAGB 2JE8A 1PZUB 4W9DC 2GAZB 5CU9A 3UAAA 3MACL 2F54B 2BCMA 3E6FB 3M7OA 1NSNL 3EJZC 2GB2A 4MX7B 4PGCA 3CHSA 1BVNT 1D5ZA 2R69L 1G7HB 4MA8H 4GAAA 4I88A 1DQQA 1JAEA 2WUCH 2FNWA 3DTXA 3QUMB 5IBUB 4JB9L 1F58L 2APTA 5PCYA 4ZFZA 2WVSA 5D7LD 3JV6B 2C4FT 4Y2DC 1LL1A 1JGDB 2O1AA 4QXGH 4XH2A 4EOWH 3DIFB 1GR7A 3TL5A 1YY9D 1B2YA 1GJWA 4TQPA 4GI6A 3QFGA 5ANMB 3NACH 4OZFA 2GI0A 4PS4L 3FCGA 1VSCA 3FTXA 4BZ1H 3MUGB 4WI6A 3ZSSA 3O41B 3Q2CA 4K7FA 4NZ8A 1M2OA 1S6NA 4YQXL 2R69H 4FQ2L 4ZOAA 2PP8A 3EFDH 1C8PA 1D7FA 4UCFA 3B5GA 3CQFA 2F53B 4XGZA 4J3OG 3S9DB 3RZCD 2I69A 3CIAA 4CVXA 1OGTB 3BP5B 4XNUH 2C3VB 1T3FA 3C6LD 1YPZB 4X8XA 3JV5A 1KXVA 1Z5LB 3WLBB 4BCXA 3FUIA 3DRTA 4PLKC 3TA4D 4E0RB 1DVSA 3SN6N 3TA3B 1URIA 1NGXA 1HOCB 2AI0H 4HLZH 1TITA 4LKCB 4K55A 4PS4H 2IV8A 5GGRY 2DBJA 3SY0A 4AZUA 4Q6KA 3T0AA 4BA0A 1YHPA 2LOEA 4YQXH 3P40A 5DVNA 5F7BA 4LF3A 2E7CA 4ZUVA 5FA3B 3RHWK 1KPUB 4AGNA 1R46A 4P57A 3UBXI 3RGVB 3NMEA 3UO1H 3HRPA 3MOBH 4FJZA 3LEXB 4RA0C 1MLBA 2QPFA 4W9LC 5G55A 4EQ2A 3GMPB 4G8IA 3TGXA 3ZO9A 2Y1VA 5JQHC 1JFQH 3VG0H 5JPNB 4UDUB 3LCYA 5BRZE 5DQ9A 3ZDXF 4F9LA 2CKBL 1TJHL 4I77L 3SOTA 1UZ6E 3L4UA 3M45A 1XGPA 4Y4FC 4AQ1B 1KT2A 2EXYC 3DHUA 5I6XC 1OZUA 3DRQA 3AUWB 4OLVL 1BIIA 4NQDE 5IBLC 3ROOB 3P0VH 2H6UA 4Y16A 4FXLA 3SE4C 1BD2B 5JORA 1A4KB 2Z0BA 3N44F 4UTBL 4Y1SA 3Q2NA 2P47B 5DLLA 5FO7B 4K94H 4AWJC 4LU5H 3Q8AA 3QDHA 1JPST 4H13C 5F7DB 2VLKD 3WJJA 4OW6A 1LDPL 1IKFL 5FB8A 5JOPD 1EJOH 2WYZA 1JZDC 4P99A 1SDDA 3KYMB 1EEZB 4YHKH 4Y2DB 1TOXA 4IIQC 4NDMA 3AQYA 2A73A 5FPIA 2YSTA 1OQXA 4FFZA 2VOTA 4W1TA 5DU7A 1T80A 4FMFA 4F24A 4A67A 4R5VA 2MQCA 3I74A 3BKJL 3PL6A 1OAYL 4HF5H 3O81A 1LEKA 3OKKA 4BFGA 4UTAL 3O6FA 1AFVH 4ZPTB 5E6SB 1P84J 4K07A 9PCYA 5HPOA 1LDPH 4X5LA 1ZRUA 1WIOA 5TDNB 3D51A 3D4CA 1FG2A 4R7DB 4MDIB 4ELMA 3QNZA 3QWOB 5BQ7A 1A47A 2P43B 4OQ1A 5JW4R 5IQLA 5L2JA 1RZ7L 4UILL 1TG8A 1T5WB 3GXTA 3CFMA 3QJFB 1OSPL 2I60H 3P4NB 1MHEA 1UQSA 2VDOL 3MV8B 4ANXA 1FDLH 3GMNA 3MRPB 2EIZB 5T5FA 3HS9A 1MFEL 4UTAH 2E4TA 1QFWI 3T4AC 3PXJA 1N7ML 1NCTA 5HGAA 1A21A 3HNSL 3P3SA 2GY5A 1X9LA 2ICEC 4TRPL 4V2CB 4UU9A 1YVLA 2LE9A 3B2UD 1OW0C 3QRLA 5K9QG 2VZOA 4P46D 2FATL 4Z3EA 5LQBL 1RZ7H 3ZY7A 4Q4IA 1D5MA 3GZKA 3B1UA 5I0WA 1LM8V 5DZNA 3PNRB 5FHBH 2D0GA 2XWCA 5EH1A 3R06A 1TZAA 2VDOH 2IAMC 4RMTA 4Y4FB 1ZPLA 3RWCA 5G2NA 1CXHA 1JGUH 5IBTL 4PY8I 1RUAL 5LHDA 2DYPD 3SQOL 4WI3A 3RTQC 5FYKD 2P49B 3LY6A 1OTUD 2QVKA 2A9AA 2BVUA 4M6NL 2X4RB 3WNKA 4TRPH 3T08A 1L9RA 1AQ8A 4XTRD 4NRZA 1IGJB 5I8CB 2WZ0A 3I9AA 4OIBA 4HX1A 5LQBH 5EU5A 3UL4A 3C5SB 1QEWA 1WC7B 3VSVA 4O4YL 4YHMH 5DZVA 5F3BB 3IDYC 1D5BA 4PJHF 1UKTA 2ENPA 3GBDA 3U25A 4HFWB 4JO1H 1GZHC 2J6EH 1HQRA 4G7RB 1HCFX 5EU6B 5DA4A 4JAMB 1JWMB 3HAEG 3QPQC 1ZCRA 5CINL 4N0RA 5CBAA 1RUMH 2EEXA 1MHHB 4GUQA 4QKTA 4GUOA 4LIQH 4TUOB 1IGIH 1X5MA 2CIKA 3TVMD 4OM1L 5E9DE 2Z31D 3BP6B 4YPJA 2IOIA 3H6AA 5GGQL 3P9MA 4CILA 1S5IL 2DIAA 1WT5A 1F45A 3HG3A 2QV4A 4IK6A 4EIUA 4G7VL 1AXSA 1JHKL 4O4YH 5F7KC 4IRSA 4RGOH 4Q6IC 5I5JA 1WTLA 2PCPA 2VM9A 1U8QA 3GMQA 2ZF9A 2Y36L 5HP5A 2LQRA 2DWXA 1I8IB 4MCMA 4LBEB 1Q72L 5IM7B 1LP9F 3VB8A 5A43C 2EH8H 2CO1A 1Q90A 3TFBA 5JIMA 1OK0A 2XIBA 3CSTA 4LFHG 3WHE1 3SYAA 3RIAK 1S5IH 1Z0MA 1Q9OA 3G6AB 4UNUA 4YXHL 5EOCH 1WS7A 4KK5D 1FC1A 2MHAB 1W6LA 1MOEA 3IWVA 3TM6A 4M8UA 5DXWA 3B3IB 3VXQA 2AGJL 4ZDHA 4NQED 2GCYA 1BQLL 1JZJA 1J48A 4ZXBA 2N4IA 2D7TL 2C3HA 3G5VA 4BYHA 1R3HB 5CUSL 4FA8A 5KUKA 3FQRA 5T3XD 4D9LL 4TSBL 3T71A 4X42A 2VABB 5MERB 3WFEH 3W9DB 2DMGA 5ETUA 2FEDC 5KTEL 5C07B 4HFUL 1QVOB 3U0PA 1QBBA 4ANUA 3CXHK 2FE0A 4YXHH 4HIJB 2Z7WA 3TN0D 5GS0D 4ZG1A 1RZJL 2R2HA 1CLOL 1COBA 2IQ9L 2NT0A 3D33A 3GF8A 2AGJH 5JHDB 1S4IA 3FMGH 4FQHA 2R0WL 2XWBB 3QWQB 4NC0B 4UB0H 4XOEA 5CUSH 3K74B 2VR5A 4D9LH 4JBSA 1PFOA 2KDGA 2VLRB 3KHQA 2DKSA 1DQML 3R4RA 4PJAE 3TTYA 5J6GB 3HKFA 4RRPM 1QSFB 3CDGB 3F6IA 5EBMB 5KTEH 1IFHH 1UATA 4ODHL 4LQFL 1DDHB 4H8WL 1AQKL 4PW4A 4UQAA 5ID1A 1JZ6A 2ILLA 4NQSB 4ZUWA 1CFTA 3TNNA 4N0FB 3L3GB 3C6EA 4Z1PA 2V33A 4MQ7B 4HWZB 3GUTA 5C0CA 2BNRB 4L5FE 2IQ9H 3QYNA 3SD5A 3WG7B 2J25A 2H2SD 3IAQA 4TQIA 5LB1A 2R0WH 3X1FA 4N2OA 1IB5A 1CFQA 4BWUA 5BO0D 4I8DA 4Q6IB 5A3IC 1UA6L 2ZZUT 2BMKA 1INEL 5BMFL 1M1XB 32C2A 2VITA 4RMVA 5C86A 1GS8A 1ULVA 4HIQA 3O2DH 4LQFH 4AQOA 5IHBA 5ISZE 4HJSA 1V55B 3B6SA 3P1VA 2O6FA 3T2QA 5I1KH 5L2KD 3QO0B 4XPHH 1A6PA 4LEOA 4QRQA 4WKXA 5TFSL 1R3IL 1WWWX 4DEPC 1T03L 3CDFA 3GXIA 2K9UA 3MBEB 1G9MC 2HJKA 5IHUH 1XVSA 3NJXA 2YFNA 1HINL 1CL7L 3FFOA 4YSPA 3M17A 2GITA 5HDQL 2P45B 4ZQKB 3ARGC 3KH4A 4XBGA 2HRLA 4G8FA 4PJFA 5D1XC 4LB8A 4LRIA 2H8PA 4XNBA 2I5YL 1QSZA 4AZ8B 3L3KA 3OB8A 12E8H 1KN2H 2V37A 4HXAL 1BXVA 1R3IH 5EF2A 1I8MB 4HOMA 3JSSA 4AQEB 1JPGA 4JJ5B 4AQAB 3BAIA 3HEIB 3FSAA 1HINH 2YOAA 4QHNA 4LPWA 1UTDA 2NOYA 2EYRB 2PYFB 2VSKB 4AKPA 2EZ0C 5DD3L 4CSSA 5D2NE 5BOZG 4LKXB 3CVHL 4YHYC 3ZTEA 4L4TB 5CS7A 5DSCA 3RL2A 2I5YH 3KJ6H 4FI7A 4JHBA 4BDVB 4F15C 3JQOB 4MMYA 3S5YA 1KCRH 4H0HB 1RHHB 4JDEB 4GSXA 3RBGA 5EC2B 4PJDB 2NNCA 1MCJA 4PV1C 1UM5H 3DDFA 4K8RH 5ITFB 3ULUF 4U3SA 1BIHA 2BP0B 4MJ5A 4Z7UB 4G6AD 3OC5A 3ZL4H 4CC0A 4ZW7A 2ZKYA 4CDGC 3GKWL 4ISVB 4JPKH 3ETBF 3RWGA 4PEEA 1FZOB 1DTUA 4AOFA 5IQNA 1G1CA 3O45B 2NZIA 4KRPD 4Y9CA 5E6ID 5L8LB 2NTFB 2CBTA 4TQHA 1CU4L 1U92B 4J8RA 3FUHA 1TZOA 1GH7A 1BQHG 5CEXB 4M7JL 1XGUB 1F42A 1XGTB 3LRSB 3WYRA 1YYMH 3GXPA 3TBWB 3POCA 1CXEA 5HI4D 5F1KC 1E3XA 3QORC 5LNDA 3LDBC 3ROLA 4B9YA 3NFPB 4DEPB 2N3JA 3JTSB 2ZYIA 5DEGB 3H42L 3P30H 4MJ4A 2UYLA 5CGMA 3GKWH 4CN6A 3KPSA 1XL4A 2IGFH 4ADJA 4J7RA 1UD8A 1UXMA 5CGTA 3D5OF 3EGSA 3FQYA 1NH6A 2HSIA 2WGXA 5B4MD 3CFDB 2BSSB 3RDTC 1OP5H 1OPGL 3LSOB 1CU4H 1HE7A 2DLFL 2Z93B 2KQNA 3QJUB 4A63A 1Z6JT 4B60A 2AVGA 3VMOA 3FFCB 4L0ZA 4DP1X 3QUYA 1NINA 3VFUA 4FA7B 5DRXA 1KJVA 3EH2A 4CN1A 2BFVL 3X3GH 1OGPA 1JPFA 4JPIA 4ODWB 2E9BA 1AGFB 1KCSH 2X9ZA 4MBRA 4NNXA 3G6JE 5ITBL 4L0PB 1WBZA 1T1YA 4Z7VB 3SKMB 4PJBA 1PX4A 1PU0A 1BHGA 1KEMH 4PG9B 1X5FA 4FNQA 3H1ZA 4KKCD 3RNKB 3RKDD 4U1MB 4WUKH 1ZMYA 5GZND 2A3TA 3BQUD 1JNLH 1OPGH 4KV5F 2B5IB 2DLFH 3WKYA 3QXUA 3TJEL 4YHYB 2QLVB 4XC3H 1JZIA 4F15B 1PL3A 3NTCL 4GRWE 2AF2A 3B9KC 3LPFA 3UDWC 5HYJB 1PFCA 4YE0A 2V5TA 4UT9A 2BFVH 5IMKB 3STLB 1UVQA 4PJCE 4XN1A 1ACXA 2YGNA 1BZ7A 1I1AD 4ZMTA 4HZLA 4KJYB 4DN3L 2PP9A 4NHCH 1DVUA 1DBBH 4XVUD 1T7WA 2VIRA 4DZ8A 3RFRA 4DT2A 3MRIB 3TT1L 5JOPE 1L7TL 1X5AA 3DBSA 1E30A 1JS4A 4ZOCA 4E2OA 5I30L 4AK2A 5JIIA 5AVQB 3LV3A 2HLFC 1O7DE 1ZD6A 1XF3B 3RVVC 3WE6B 1VHPA 2QSCL 1G6RL 2JLLA 2FSEB 1A7NL 1PD0A 5FLUA 4JKKA 2BOCA 1M56B 1N0XL 2VSMB 2Q76B 3GXNA 5J89A 5AD0B 4FZEL 4OD1H 3QORB 5ICZA 4RVBA 3TP4A 3CVCA 3D0AA 2LLGA 3FQTB 5C0FB 3VFVA 2EINB 2HPOA 1KJMA 3TT1H 3AW5A 4W9HC 3BWUC 3J7HA 1E5BA 4NO2A 2GK2A 2KBGA 4FFZL 4YPGA 2OJEB 1NTDA 1W15A 1GYCA 3CU7A 3DV6B 2ADFL 2NR6D 3STBA 3HBPA 2Z91B 2QSCH 2VJ0A 1A7NH 4BWTA 5CNHA 2E75C 4DO5A 3QQ3A 1UXSB 5MEQB 2YPVA 3V4PA 1I7UA 3L16A 2OJZL 3FTVA 4M1GL 3D18A 5C0AE 4AJ0A 3C5ZA 4BQBA 5IFAL 2EVHA 1KB9J 1ZS2A 3A6BH 4FZEH 2F7PA 3D06A 2FX9L 1BYOA 4FLSA 4B7LA 3WNOA 1RUKH 2XOTA 4OR1A 4WI4A 5JIPA 3MCYA 4NOBA 5FO8A 1MCRA 1AY1L 3BVUA 4TQEL 1KGYE 2ARWA 1BWWA 1L0YA 1CTOA 3ECUA 1VZIA 2YMXL 5HHVH 4A39A 3WO4C 3U9PH 1UFGA 5KYUA 1UOKA 4S10A 4JGNA 2ADFH 2ICCA 3DXAB 2A9ML 3T65A 1TO5A 3O6LL 5LBSH 3D39B 5IFAH 2HLEB 2IC2A 1U8CA 4OCNC 1F6FB 4RSVA 4BH8B 1IT9L 4KKRA 2YWYA 5FYKE 5H94B 5D6DC 4OLXH 4BXSV 4PV9A 3IGAB 1M71A 1FP5A 5CJOL 5BRZA 2JJSC 1AY1H 1KY7A 3F01A 3G5XA 5LAXA 3HR5A 4HHGA 3SJVB 2C3XA 4PP1C 1CR9L 1E5CA 2IF7A 1SNRA 1AI1L 2YMXH 4Y9BA 2Z4TA 1MIEL 3FB6B 5F71A 4DQOH 1R3KA 5FUCE 5D4IA 3E1F1 2AS5M 4AIXA 4BZ2L 2QADC 4NQDA 1JZGA 1JOIA 3O6LH 1YO4A 4QNPE 4NO0A 3DSFH 5GGVY 1PY0A 4HS8L 3WN5C 2X4QA 4Y4HB 3AM8C 4KJPC 4OFDA 4F9PA 3DUUB 2CLRB 3PG2A 2QTVA 2BY0A 4BSWB 4Z6AT 2Z8SA 3QBTB 2ZCKL 4YNYB 2VW6A 4MMZB 2F68X 3OR7B 5HHPB 1IBHA 1UZGA 4O58L 3SYPA 1PTZA 4OD2B 5KAQF 5JUEH 4MAYB 3KZ8A 1F13A 5IZ7A 1LO4H 2I26N 3CLEH 1QHQA 3LKSA 4OQTL 3R4DA 1FCGA 4NS0A 2YC1A 4LDLB 4OGXH 4LHJB 2BVEA 3I75B 3A24A 4PJEB 2PR9A 5FCUL 5C2BL 1CICC 2B20A 5D1QC 4PRIB 2VZVA 1P7QA 4YHLL 1IM9A 1QHOA 2I25N 1IAKB 3MREA 1I1CA 3CN3A 4MJID 2ZP9A 5SWQB 3CWGA 3NAAH 2ZPKL 4XP6L 5HYSA 5KSAA 4G6JH 3CE1A 3QFJE 3BIBX 4Q97A 3MJ8A 5EUKA 4D8PA 5IB3A 1A9EA 4O58H 1IM3B 2WNKA 2AV1B 3IMTA 3OHXB 2CO3A 3T0VA 1I9RH 5DVPA 1RZIA 2Y4SA 1AANA 3VFRB 5B8CB 1EXGA 3QUZC 1ADWA 3WO4B 5CCKH 5KYWA 5IR1A 5C2BH 1E4JA 1EHLL 4TKWA 4ORGB 5KYNA 4N8PA 3CMGA 1IE5A 1USQA 2XTJE 1BZ9A 4HGMA 3LKRB 4U6HB 4V1DB 1UENA 4YHLH 5F88B 1ECYA 3MV9D 1WA1X 4JRXB 5SV3A 5T3XE 1KYOK 2OCCB 3OKNA 5JIQA 5C3LD 1DJGA 2JKNA 3EGXB 3ERXA 2JCWA 1N9PA 2VDLH 4XBPB 3V4LA 1AZUA 3D05A 1NGYB 4LOFA 1M2VB 4W9FC 3UAJD 1QLRB 3KXFB 4HCRA 4JN2B 3B2DC 1L6ZA 3DBXA 2DQHL 2UZXA 1ESOA 1RZKC 3CCHA 3L3HB 5IROC 2BNQB 5C0IA 4K5PA 1HHIA 5JMOC 3FU3A 4P4RB 1KIQA 1Z1WA 3NRPA 3MRGB 5IOKA 3V5HB 3CFEA 4AL8C 4RGNE 3WN5B 5MEOA 3ARRA 5I1LA 2F8VA 3GQFA 4J3OH 2Q8AL 1G0DA 5HHNA 2PN5A 2YD8A 3VH8G 3KPNA 5BPPA 3TF7C 3WSQL 1SXCA 1KCUH 5EC1B 2HTLD 2VLME 1OSZA 4NQCE 5DRNB 5E8DL 1DSFL 1CFVH 3VWKA 3CLFH 3OJVC 4F2EA 4PYGA 2OL3A 3LZNA 1LD9B 4WJ5B 4YDLC 1HYSD 4IBUA 3QQDA 3F7LA 4WNJA 2Z7UA 1UWEL 4Y19D 3I02B 3WTUA 1CICB 3PQYD 3QPKA 4DCQA 4DH2A 3PWJB 5DFWH 1KYAA 5HI5D 5HDRA 5AAWA 3FOLA 4Y9FA 2AXWA 1OCZB 2VZUA 5IKCB 1U8JB 2VZ1A 3H9ZA 1EIBA 4JFXB 4KI5D 1DSFH 3MRBA 1EXUB 3N1PC 3VRJB 5L2KE 3N44B 2QKIA 1WFOA 3QUXC 2RCSH 3VD1A 3QUZB 4BRVA 2CPUA 1T22A 1UWEH 3N85H 3SZ6A 1OZTG 3ME0B 1TJIL 4I48A 3RVUC 1QFHA 4L4VD 3QVAA 1P4BH 3F12B 4Z78B 1UH2A 3QI9C 4MD5B 4NNPL 5G4MA 2JB6B 5E95B 2LV4A 2PW1A 5KSBB 4RX4D 3ULVD 4E41E 2BJMH 2B1AH 4PSRA 3CHXA 4KO7A 2XY1A 5DHVH 3U30B 35C8H 3E9TA 2R56H 3LNEA 5FUZL 2COQA 4U3CA 4HXBH 1JJUA 2YD3A 2D7OA 3WTWA 3UIYA 3QIWD 2OYMA 1I75A 1GW6A 1EO7A 2AEQL 3IAPA 2EDRA 2IADA 2VXQH 2A74B 1A7OL 4Q9RH 3V0VB 3P77B 4LPTA 2X2IA 2EYTB 4NNPH 4IMLA 4AYFA 3HG1E 3PJLA 3ISWA 1MCEA 1S9XB 4I2XB 4A7UA 1D9KC 2I07B 4HMDA 1L0XA 1V05A 4C58B 2AK4D 3FB5A 4JANB 3D25B 4ZAKD 1IC4H 2Y6TE 4W6YB 3HZVB 5FUZH 5DRZB 5DDHA 3Q2VA 2PXYD 3I6KB 4NKMA 4RAVB 4OUUB 3OVUB 4BE6A 2F58L 2Z65C 3HUJB 2G5UA 4JY6B 2NY5L 1FFPB 5GGSY 5E24E 3KCWA 2AEQH 1USZA 2VJXA 1KZQA 4HIEB 5GJTH 1A7OH 1N8ZA 4X2UA 2Y23A 1KGXA 2NNFA 2OW7A 2IDQA 4U6XA 4M6OL 4FHBD 2UX7A 4GXUN 4X6FB 3LNFA 2XQBL 1KN4H 5D2LB 1G7PB 4K3DH 2DLEA 2R7EA 1ACYH 2I9LA 4K94C 4ATTA 2OV0A 2EQDA 4XMLH 3T3PF 1AD0A 4P2OC 2FLBT 2HN7A 3VFSA 3ZUCA 5DS8A 2H0JA 3O0RL 1BOGA 3DMMD 1N64L 4DZBA 5C09B 2O5NA 1IGCH 2OP4H 1BX2A 3MV7D 5FYKU 4AGPA 2ZSVB 3ALWA 4RAUB 5ISZA 4PJHB 1MVYA 2ICWI 4IBQA 5DHDA 1RPKA 4YDJA 3D3VB 1FAIL 2BWDA 4XNDA 3QI9B 3X14A 3HG2A 1A0QL 2XQBH 3CZGA 2F53D 3MYJB 3OMAB 3KYNB 3PP4L 5JPMB 1A7QL 4ES8A 1WJ3A 4KQ4L 5EIQA 3HIZA 2GK0A 3OGCB 4X9YA 2WZ5A 5J9PB 2UY6B 4G3YL 1EBAA 1A02N 4XCNB 5BS0E 3IJ9A 2A0LD 2FJUB 3O0RH 1QR1A 3MHZA 4XZUB 3A4EA 3NFNA 1I1FA 1N0LA 3ZKXC 3TBYB 3NCCB 4ALAL 3HAEH 1N18A 3Q9PA 3QHTC 2HAZA 2ALWA 2AP2A 1FAIH 1PG7L 3BP4B 1FN4A 2QPSA 1E4HA 4FQCL 4EKXA 3HNTH 5FKAB 4LSTL 2WHVA 4N2FA 4PJGB 1FNGB 2AQPA 3BZ5A 1D9KB 4KQ4H 4R4ND 2YAQA 4Y2OB 1FPTH 4GEIA 5AKSA 5DO8A 3MROB 5CCHE 2F74A 1KJ3H 3FQXB 4XMPL 4AV0A 1NC4A 3AG1B 4QRUA 3EKCA 3MA9H 4JFHD 5GRVL 4D9RE 3BUPA 5K1NA 4HUXB 1GC1H 4QWWC 1S7UA 4HV8A 2KI6A 2VCOA 4NJAL 5K59F 3ZMNA 3MOAL 3JVGC 3GMLB 3NP4A 2L7EA 1PG7H 2ZWZA 1MFDH 1A14L 5D7JA 4K7PH 3R1GL 4NHUA 4BH7A 5SWZE 3EJZD 4LSTH 1ERNA 2O6DA 3NRFA 1BD2D 4XMPH 5GSRA 3VFGH 2R1XB 4FYRA 3WHE0 4DAGH 2JJUA 2JSFA 1HHGA 3I9IA 4HK3J 2OMTB 3Q6FB 3HE6C 3QEUB 5T5NG 2CJSA 3TBSB 1EJ8A 5DR5H 4JQXA 3MOAH 4WSKA 7FABL 3V4VA 5LGHH 2YMTA 4U1NA 1U36A 2CKBB 5KBPA 4ZUUB 4GAFB 2YJLA 4XT1C 2ADGA 4Z23A 3KPLA 1HFUA 5TPWL 3AITA 5BO1H 4P23A 2EC9U 2KLTA 4Z7NB 5L4JA 1O7VA 2EAEA 2KZKA 5FR3A 1S5HA 3C6LA 2N59A 3DI3B 4RGMC 3A6CL 4ZFFB 2DWDB 1VFBA 3REVB 3ML8A 5I8EB 1OM3L 4U3XA 4CADB 4D9QE 4IGBC 2XFGB 4H25A 4PLKD 4W9GC 1XAUA 1NEUA 1H3XA 3D0VB 3VXUE 7FABH 5FGCE 5K5YA 4UQ2B 5I1EL 2CO7B 4OFPA 1HN1A 2C7UA 4CSZA 1DEDA 4S0TD 4XVTL 1HL8A 2A77L 2WXFA 1KTJA 3G6JA 2AMGA 2C3WA 1OF2A 2WK2A 5EEYA 3SDCA 2WZAA 1KTBA 3QNYA 4X99B 3KH3A 1OIOA 2WLJA 3FQWB 4TV3A 1OM3H 5KVDL 2VERN 3H3KA 4HEME 4EVNA 2VKXA 1TKWB 3AGWA 3OAZH 4K2UL 3IDJB 4UQ3A 4X83A 3NRQA 2AK1L 1LTXA 5I1EH 1RSFA 2XN9E 1ODUA 3LZPA 4H8PA 4ABVA 5I5MA 3MLVL 5ACZB 1FJ1A 4PJCA 4UI2A 2EXYD 2CR0A 4XVTH 3VD3A 2VDOB 4MXQC 5I6PA 5IBLD 3ZKQD 1MCBA 2W91A 4GW1A 5HYQB 3QCTL 1VEOA 1JN6A 4Y5VA 2EXWD 3MAWA 4S1SL 5JHLH 5KVDH 4AIOA 4M7LL 3WTSA 1FNSH 4X6DF 3ZHNA 2Y7QA 3EDEA 2Z8VC 3HE6B 1YEFH 2LGNA 2CHWA 4BA8A 4F7MA 2ZX6A 4J39A 4NXKA 3CK0L 2JKJA 3MLVH 4QAMB 5B39A 3VFTA 4HJTA 4EKJA 4LRNH 4G2AA 4DQAA 4KNSA 4Y2NA 4X80H 1FV1B 2R27A 2I7SA 4S1SH 1FZMA 4R7NB 5D1ZA 3WS3B 3QZWB 2OK0L 1NBVL 1E4KA 4P2QE 2Y69B 2DQMA 5CSGA 1TPXC 2IIJA 1AKJD 15C8H 5FO9A 5MEPB 3OJMB 2G0LA 3MX0B 4H2CA 3VRLE 4EZMA 4EI0A 1VFOA 1HQ4A 1UFUA 4B6ZA 1ZEAH 4IGBB 5C08B 4MQXC 1DQJB 3EF7A 1T1ZA 4WEUD 4AK1A 2JJWA 5KSUA 4YOKA 2FO4B 3SE8L 5KVGE 2OSWA 1DVXA 5C0AA 5GGRA 3A21A 1RERA 4XX1G 3KPOB 1NAMH 4AEIL 3GT6A 3MV9E 3QUKB 4MSWA 1PZ5B 5I75C 4FP8L 2PCFA 3IU3A 1DFXA 1QSVA 2OMVB 3LKNA 1ED3A 4HC1L 4JRYB 5CHNA 2B59A 3SPIA 4F33B 1I8KA 2VDRL 4LLDB 4H8QA 5FUOH 1FLRL 2X3AA 4IU2B 3SPJA 2GSIA 2W94A 2I9TA 1NGQL 4AT6B 2X42A 3TJHD 1SJEA 5DQDH 5JO5B 1XGQB 1G7MB 3O8XC 1XB3A 1T83C 4GO6B 4IQHA 5IFHL 3F7KA 3MRRB 2DLHA 5IJVA 3UYRH 4O9HL 2VT0A 1EGJL 4EDWH 2G30A 2VXVL 3EDDA 1E4XI 2CLZB 2EDDA 4GKNB 2IAMD 4LLUB 2P8LB 1KBWA 4N24A 2CDGB 1XFPA 1SHXA 5FW8A 4YBQD 4M3HA 3RTQD 3BHBB 4B7IA 1ZVYA 4A7SA 3CXDL 2QGCA 1CE1L 4HWNA 2VDRH 1UCBH 3CD4A 5DHXB 5FYJH 1A3LL 3H9SB 2B9BA 4XMUA 4XNQA 4XO3A 3KLAA 4PJBF 3U7YH 1E5AA 4OZIE 2RGSA 2PF6A 3FHEA 2AJSL 1YMHA 4QXTA 1LJMA 4O9HH 2WAHA 2XZZA 1IBGL 4UM9B 1T04A 2XIDA 4G9FD 4Y19E 3MODL 3IJ7A 3TURA 4ZO8A 2JELL 1QSFD 4PP2A 3QPQD 5BZDA 2V9RA 1QFUL 3CXDH 1A66A 3IAGC 2IVFC 2ZICA 3ARPA 3ELQA 4UQCA 2Z31A 3TVMA 2ZXWB 2NY6C 1SUHA 5DMKA 1HXYB 1JK8B 2AEPL 4FNLL 2VXSL 1DQDL 1L3NA 2BNRD 3WUWA 2VRKA 1KFAL 4X4YA 2XPZA 2R9HC 4K8RC 1YY8A 3N1FC 4WENB 1RUQL 1A25A 3PDOA 5FAAA 4YE4L 2KPNA 2VDNH 1EEUA 4L18A 3FK3A 2BCKA 4RQQB 4EDXB 4P4KA 1BAWA 3V6FB 3BVVA 3QFJA 4RZKA 5DJAB 5E5MA 4IEFA 2J1YA 4L4VE 3PIQA 1B4JL 1GYVA 3FN3A 3L3DA 2RALA 3BSZL 3HZ3A 3KR3H 4XCFH 4PRHB 4MCYA 2AEPH 4FNLH 4AM0B 2OQJB 1JP5A 1DQDH 3P4MB 5EIIG 2FR4B 3ULVE 3FTWA 3T6XA 5EEVA 1BJ1H 5IB4A 5I23A 2KPWA 4GG8B 4CC4A 4HK3N 4PBDA 3C60A 1WWCA 1O9WA 2R2EB 3BP7B 4Q8BA 2FDBP 1DZ0A 2C7FA 4JPQA 4OTXH 3O3DA 2DQ6A 3U0TB 5EWIL 1B88A 4WFHD 2AVFA 3MRDA 5DFVC 4CKQA 1PCSA 1ZDQA 4JFVA 2FEDD 3B2MA 3BSZH 4FE9A 2AAVA 3TN0A 2V17L 4NGHH 4RZCA 3BN9C 2HFFB 2DIEA 1EZSA 1J87A 3A0OA 3ARFA 4O02H 5F96L 3VXSE 4GW5A 3L3JA 4JKLA 1MRDL 1YYCA 1YEEL 4TVPH 4PGEA 5ERWB 3QQ9C 4AYEC 1RSYA 2EADA 5E1AA 4LLAA 3N0AA 4X0KA 2ZG1A 1SMAA 2XBTA 5E94B 4ZFOA 3GSNA 3NSJA 1KPRA 4OCRH 3KS0H 4Z3GA 2JTDA 1DO5A 3RFZA 3H6JA 2AQ1A 3UACA 1CS6A 3HZYB 3HPLA 2LVCA 1KCBA 3AXLA 3EF4A 5BVJB 1ZLUH 1ZHKA 3S3SA 5JTWA 2I85A 4LCYA 5JW5A 2F54E 4NQCA 1I3VA 2OMXB 1JGVL 4N5UA 2PTTA 4WU7A 2XQYG 1TTAA 4FCHA 1CXIA 2NY6B 2DICA 3JV0A 5FYLD 1ILSA 1T0OA 5IQ9A 4TOYH 1MRDH 4MAZA 1RUPL 1UZ6F 2WOBA 1ND0B 3I6LD 1WSST 3RU8L 5CZVH 4EF3A 3WJMB 5A3ID 2Z6FA 1ZVSA 3LZRA 2OZ4A 5T3ZE 2EEAA 4PJ9C 1MELA 3CSYB 1AHMA 1X7SA 5ANME 4QRTA 2AXFA 1V3LA 2X9WA 3ULSB 3CVHB 4WNQB 3HI5L 1E4XH 3MTXA 3LEYH 2GSMB 2E47A 1Y6MR 1JGVH 3TJPA 1E9QA 4OT1L 5L2KA 3FW6A 4N0YH 4KU1A 5B1JC 1MCQA 2ARJA 1N59A 3F5WA 1RUPH 4GKOA 4J2XA 4QHKJ 1BFTA 3DPDA 2QDVA 2FYYB 3IMVA 5J5EA 4HJGA 3D2UA 4PR5B 1VACB 1YPZE 2B9AA 2WWNA 2YSSA 3FQNB 3HC4L 1ROCA 1S9VB 4UYPA 1DN0B 1KENH 5KBLA 4FMKA 1H6TA 5I76B 4U6VL 1UGNA 1UCTA 4X7DC 2B4CL 3GK8L 3MBXL 3B9EA 3RIKA 4DTGH 1MF2L 5E2WL 5F6HJ 3ARGD 4YHIB 3CPLB 5LCVH 2C9XA 3B9AA 1B0IA 2WM0A 4P2CG 5D1XD 3GJFK 4KQ3L 4K7PY 1V7NL 3RWEB 4PCYA 4R97C 4E41A 1E8YA 2WCPA 1QFPA 3MRFA 4NUGL 4IHOB 3MLUH 4X9HA 1Y6KR 1U93A 3GSVB 4OZ4B 5I66B 4UINL 3IS1X 2M8XA 4DOHB 6TAAA 2BIOA 2CPCA 2OPCA 4R8WL 4CBPA 4HPOL 3ABMB 3PRZA 3DX6B 3BX7C 3OSKA 1F2QA 4JFHE 5J1AA 2EZ0D 3GK8H 5KVFH 5E2WH 1FNLA 3RDJA 2WV3A 4NZTL 1WWBX 3HG1A 2YUWA 2E7MA 3NJLA 3IJHA 4KXCA 3ILDA 4MMXA 1I9IL 1JNNL 1P2CA 4Z7IA 4P04A 5HYJD 1IL1A 2YGVA 1RJZB 5F7AA 1HI6A 1TZHB 4GBXC 5ADOL 4XP5H 3G5ZA 3D87B 4YSRA 4XGZB 1BD2E 3GMRA 3T1FA 2H3KA 1MJJA 5FDWA 5J6HA 4R4FH 2XRAL 3J27A 2BP3A 2YAOA 1RIVL 5EF3A 1M7XA 3O11B 1BGXH 3V7MA 1ZKAA 2HH0L 2L4OA 4NZTH 2D3LA 1J9TA 5E9NA 4IHBA 4PJ9B 4ODVL 5KBMA 5J56B 4Q9QH 1LO0H 4PTUA 3EFFA 4AX3A 1I9IH 4GUPA 4OY9A 2J56A 1NANI 3PUUA 5IB2A 3CH1B 1PDKA 3VWJA 3NEXA 1I4FB 5ABZA 1F86A 5JIDA 3JTTA 2LAAA 4GB9A 5B38A 1FZJA 3T77B 2BS9A 3KWUA 3WJLA 3QORD 4I0PC 4CNIA 2XRAH 4ZMWA 1DHKA 1FFNA 1KB5A 4KHXH 2CM5A 4QTFA 1KDIA 1CK0L 4CAGA 4EO5A 4RWYL 3LMJH 5IJKA 3I3BA 3D69A 4KUCD 1F3JA 3L1OH 1DUYB 4O2CB 3ZHLA 3RDTD 3K5SA 4YDIL 1J88A 3B37A 2Y7OA 3HZKB 2XWZA 1KT2B 3PV6A 3MV8E 1QX1A 1K4DA 3K5RA 4DUXA 5E8EB 1G6RB 4IRJD 3BEWA 3SDDC 3UJTH 4Z76B 2C4FU 2WQVA 4D3CH 4WZ9A 2IQAB 1BVZA 1M3JA 3DTDA 5JIHA 2NQ3A 1T6VN 3LVEA 4MXVF 1EFQA 4F7CA 5BS0A 1QA9A 5CO1A 1E90A 3NCJL 3ZTNL 3LKOA 2AV7B 5CF3A 3HC3L 3N5AA 3ILPB 3DECA 1CI3M 2HKFL 3GRWH 4RWYH 1GGCH 5HGHA 2AABL 2F5AL 5GZNA 5ICUA 2NQDA 3KPMA 2BH0A 2N1TE 1ZGLA 1E8WA 3HVNA 4JZJA 4ZUTA 4DNLA 1F1AA 4YO0B 2NUTB 1ZT4B 3BZFB 3EO0B 2ZUSA 1HWGB 2YPLB 2RAMA 2Z92B 3II3A 4HIIA 5DZPA 1IAOA 4NZJA 3B9KD 3UOAB 1MRCL 1YQVL 1I1AA 3ETBJ 1V3MA 2ESVB 4GBXB 1OP3K 4A2LA 3RGHA 4RH4A 5H37A 1NCIA 3U7AA 1VADA 2ZUUA 1IBDA 4AMKH 1QYGL 1QQDB 2X1WL 1T0MA 5AZUA 3VRIB 2YN3A 2GHZA 4JGUA 2AABH 2JCCB 1OP9A 1IRAY 2N1KA 5AW0B 4F37F 1U58B 4XCCL 4JZNA 2R29L 1QPKA 3EJCA 4PJ8C 2C9UA 3VXNB 3GBML 5L88H 2BS71 2HLFD 3MNVA 1PF3A 5SWZA 2HLAB 2YR3A 4P2AA 2HWZL 2WXNA 1J5OH 3RVVD 4HT1L 1F5WA 4B9FA 2PWDA 1MRCH 5HYEA 3LHAA 4PW3A 1YQVH 5CP7A 5EU6E 5G4NA 2LT9A 5AL8A 1AQMA 1HYRC 4A2FA 4AGMA 4J3OC 5DJ6A 1BVKB 2X6BA 5LXGH 3D85B 5AZ2L 3EYOA 3SO3C 4OI9A 4AUJA 1NEZB 2WB7A 1KGCD 1NWOA 5T1LA 2R29H 1RZGB 3IDIB 4J27A 1DN2A 4JMNA 1N3NA 4FJYA 1D5MB 2NR6A 3NCEB 4HAKA 2UUDK 1ZHBB 4GQ9H 3HCVB 3L3OA 4IDJH 2PYEB 4ZMNA 2X0WA 3VD7A 4FXKA 1HKLH 5J1TC 2HTKC 3AG4B 2OSYA 4S2SB 2KZ1B 2NXYC 5D72L 1E9PB 1WCBA 1TQWA 4NSKA 4UV7L 5AZ2H 1IM3D 1U95B 1IILE 1RMFL 3FHQA 4OCWL 4HKJA 5CJ8A 3HS0C 4ZMVA 1SF5A 3VXUA 2GJZA 4TLSA 3U4BL 1TO4A 1S3RA 4BWWA 3MNWB 4JFOA 5I18L 5DK2B 2ZAGA 4XCEB 5E5LA 1QTYT 2IPUG 2NLJB 3DX7A 4WWKC 4UT6A 5DJCA 1PEZA 4OM0H 2X12A 3I6GB 2P8MA 5IJDC 2GBVA 2JI1A 4V1DD 1OOAA 5J57B 4EBQH 1FCCA 2VTFA 4JRXD 3DIDA 2YFOA 4EJ1C 4PHZA 4WFED 4HS3B 2IOMA 1HQRB 2HKHH 3MNDA 1ZHLB 3QP3A 4JM2A 1B4TA 2DI9A 5IHZA 3L13A 4YSAA 1BBDL 1NANH 4LDOB 4BKSC 4HEMA 5CGYC 2HJLB 2OS7A 1RMFH 4HLJA 4N90D 3IXTA 4OCWH 5C07E 3MMEA 1QRND 3KXFD 1G7IA 4MD0A 3U4BH 2AJVH 3OJDB 2JJVA 3P9MB 2QGEA 4MB4A 3UTQA 5I18H 1AGBA 2XN9A 4S1QL 4L8CB 4M5ZL 3BPCB 1IC5L 5D7SL 4BM7A 5JHDE 3Q06A 5FKPA 3MA7A 2BNQD 2EIMB 1MCWW 2QADD 2VB5A 4G72B 5C6PB 1PIGA 1R5VA 2BLFA 3S4SA 5IMLB 1U4FA 5AUMB 2WANA 5G5DA 3MO1A 2J2ZB 3QDMD 5ALBL 5AB1A 4KROC 3FSWA 2P28B 3D1MC 4C4KT 2VLRE 3BVWA 4Z8FH 2C9QA 5DGQA 4H0GA 1NCCL 3UG3A 1QSFE 3PPEA 3WKNA 1KJ2A 5AVSB 5IMOA 3EOAB 5FW7A 4WO0A 1NL0L 1U33A 3E0GA 3PWLA 4ABWA 5IW1A 1FRGL 2V9TA 3SO3B 1MCIA 2GSGB 3BUQA 1H5BA 4M5ZH 1IC5H 2BNRE 1J1XL 5D7SH 3UTPE 3CIQA 4LDCA 4GMTH 5EBGA 6FABL 1FGNH 4QF1B 3OXSB 5DJYB 3NJMA 5D1QD 1SOKA 3EJUA 4JR9H 3NZHL 3VFNA 1NCDL 3VXMD 3IJEA 1ZHNA 5AVUB 4Z3IA 3DX9A 3MVSA 3HE7A 4P2QA 3HFML 2FT6A 1NCCH 1KTDA 3W39A 4JHAL 4NZUH 5D70L 2W9EL 2W0FA 3BKYH 1LWHA 3NJNA 3QULA 2EVGA 1I3RA 2WYHA 3SIKA 3VFMA 2CDEA 2WXGA 4OV5A 2ZOLB 2C1PA 4NOFA 5BUAA 3FSOA 1UEYA 1S7XA 3IBOA 3IDMB 3MBWA 5KEZA 4LSDA 4PN6A 5T1MA 3QUZD 6FABH 1ET5A 4PS8A 2BNUB 2C3GA 5IWLC 2UY7B 2VE6A 4WWKB 1VKXB 1IC1A 3OKYA 4NNYA 4PJ6A 1ZLWK 2X4OA 3MV9A 3WS6C 2NQCA 3T8XA 2CWRA 1NCOA 3EG9A 1NJ9A 5DJDB 5C0DB 3SD2A 4UAOC 4UOZA 1JZ3A 4ZMXA 4NENB 4XP4L 4L1TA 4LZKA 1JZ7A 2FEJA 5AW9B 4FG0A 3UAJA 4MLIA 1ETZA 4CVWA 4N1CA 2Y2TA 3UTZA 4OD3L 5F9OL 4AIZA 4WDIB 5MHSD 4NQXB 2ODIA 1EAOA 3KNBB 3K4DA 2IH3B 1P5UB 2PCYA 4TNVK 5DWUH 3CFTA 3T2LA 5GRUL 2HT3C 2PTUA 5IROD 2RR3A 3EBHA 4OZGA 5DHVB 3MR9B 2LLNA 1JXGA 3WHXA 4L4TE 4DFIA 3S2CA 4MRBA 4XP4H 3LQAL 4HIXL 1HSAB 2AFNA 4Q52A 5HYSG 1HH9B 1IAIL 4OZIA 3SCMA 5CN3A 1N5YL 1FBIL 3B6SB 4PJDE 4OD3H 3PP3K 5BZWA 1M7IB 1MQ8A 1WAEA 5J12C 3TPUB 2KLRA 4Q9CA 4AMXA 4PWFA 4OB5L 3QCUL 4X9FA 5C0JB 1BPLB 4DPRA 3QCVL 4Z7UE 3RUGF 1XB6A 3NN8A 5GRUH 4QTHA 4Y19A 4GRWF 4TNEA 2HPTA 2DTML 2JQZA 1KUMA 1SFDA 3CSGA 1MPAL 5F0MB 4MWFB 4BK4A 4N2NA 2CUIA 3F7VA 1Z9SB 1MI5B 3OBAA 5K9KB 5D71H 4JY4B 1ZTMA 1FBIH 2GUOA 4Y88A 1VGKB 1WF5A 1P5VB 1X7TA 4OSUH 4POYA 3SGKA 4AVHA 4G70B 3Q3GB 4XMWA 2CO6A 3FTUA 4NKIL 1WO2A 4OLZH 2AEIT 3QUXD 1DE4A 4X6DB 1SOSA 1X9RA 2AQSA 4GSRA 1O6SB 1O6TA 4WLCA 4DKEH 1MPAH 4L4VA 2EJ1A 3MJ9A 3RVUD 3BIKA 5I0XA 4JFDB 4MXWL 4XOAA 1YEDA 1A6UL 1YQ2A 4MDJA 4UAOB 1YNLL 3QI9D 4M62L 4OLUL 5CFAA 2OTUB 4QY8B 1SJVA 4RX4A 2W07B 2WOYA 5HY9B 4RFEB 3FFCE 5E4IA 3MZTA 1CYGA 2VM4A 4NQTA 2CUAA 4CW1B 1W72L 1VIWA 3VD5A 3BCFA 1KTLA 4Z7VE 4QJ4B 2E56A 1NBYA 4OCSH 3RY6A 3C12A 3QR1A 2EIJB 2WJ5A 5JXEA 4U1KB 1C12B 4CN4A 1AGDA 2Q2EB 3W11C 2XG4A 4MXWH 1OE1A 1A6UH 2Z8RA 2O5YL 3BSHA 4XB8A 4QLWA 3CBRA 2RQ8A 3MFGB 4L8BB 4TTDC 5HYJE 4W9JC 3S88H 3VE0A 1D9KD 5ADPL 3PCYA 3H2WA 5EO0B 3P9LA 5FV2A 3RRQA 4DKFL 5KG9A 4AW4A 2JK5A 2PXYA 2XZAH 3ROLB 1G0YR 3K0WA 1NKRA 4E9RA 4MS8C 5HD8C 4XPFL 1EEYB 1QBLH 1R33A 1J5CA 2CNYA 3PGFH 1TCMA 5D55A 2GBUA 2ZSWB 3BLKA 2KT6A 3CSPA 2J44A 2GAZA 4Y2LA 1IBFA 1Q1PA 1QLEH 2F54A 3S8WA 5DLML 3HHSB 3E6FA 4G43B 4MX7A 5IW6B 4ZMPA 5JMRA 1G7HA 1U21A 2C34A 1AO7D 5CJBA 1NOLA 4IBSA 3DARA 3QUMA 3GBNL 4LCCB 3WIFB 4XOCA 3MRJB 3QDGD 1KIUA 3TBVB 3RNQB 3IF1B 5DRXB 4RISL 4C59B 3WIHA 3JV6A 1FIGL 4NNXB 1NIBA 1JGDA 2R4RL 5L8JB 5EHFA 3DIFA 1D7CA 4TN9A 2P42B 4QNPF 5TE4H 2YLHA 3DMMA 3T0EB 4P2OD 5ANMA 4U1SB 1DVYA 1HDMB 4F1ZA 2W9DH 3DVFA 4KDWA 3MUGA 1RL1A 1GMEA 1KYDA 5C0GA 5HVWA 3TBTB 4A2DA 3C2SA 2F53A 3RWFB 1XIWC 1IGTB 1OGTA 2DMCA 2VQTA 2ZAHA 3BP5A 2ZOKB 2C3VA 1E50A 1YPZA 4M1DL 1GXEA 1EMTL 1Z5LA 2YD0A 3GHPA 1FIGH 3WLBA 1BZ7B 1KYUA 3L1FA 5KVEH 5IT2H 4GEJA 2JKSA 1VGEL 4E0RA 3TA3A 3EBAA 1HOCA 1SY6A 4LKCA 2Q7YB 4YEEA 4YGAB 2WTPA 2DF3A 3OAUL 1HCZA 1M42A 3CHRA 3DSNB 3DXAE 5FA3A 1KPUA 3B56A 1NUGA 2F8XC 4MHHG 2XXCB 5DC0A 3D39E 5T1KD 5F9WB 3RGVA 5HHXL 2HZHA 3LEXA 4TSCL 1AZZC 3GMPA 4I9XA 2HUHA 3L4YA 5D7IF 2W0KA 5JPNA 1D2OA 4UDUA 1HSBB 3PWPB 1VGEH 2JF1A 1F3DH 3SJVE 4H20L 2WYTA 3QG6B 1HZHL 4QWWD 1MCHA 1CE6B 4U05A 1ZV2A 1E2ZA 1WWAX 1RFDL 4AQ1A 2DOCA 3QG7H 3NIGB 1JV5B 1MAMH 1WZAA 5A2JH 2F7IA 1Z9LA 3ROOA 3ZZSA 3EJPA 1TLMA 1BD2A 4EIZC 3SEPA 2X1XR 1A4KA 4U0QB 3RWJB 4GJTB 4MCNA 4TSCH 5HHXH 5FO7A 2EKSB 5K9JL 5F7DA 1FSKB 3RX7A 3G04B 3WTVA 1MVUB 5FXCH 3WIIH 3KYMA 2BZDA 4KDVA 4Y2DA 1H0DB 3GB7B 1HZHH 2FHFA 4RLDA 1GHFL 3HE6D 1ANUA 1UXWB 2CHZA 1TU2B 2YOCA 4KX8A 3OB0K 4CMHC 5ELIA 4PJEE 1A6ZB 2B3RA 3IS0X 3OGOE 2JQAA 3UJJH 3WFZA 1JYWA 4PRIE 5B1AB 5DGRA 4OCXL 4NRXB 2GJRA 4XMTA 5K9JH 2P5EB 3JWNE 1AHWC 1RPQA 2F7QA 1CB4A 2OR9L 5TDNA 2IPTH 2X2HA 1DLFL 1U8MB 1PY4A 4R7DA 3KL5A 4MDIA 3QWOA 1XD1A 2YAFA 3FUDA 2VYRE 4TNWF 6CGTA 3TZVC 3G5YB 1V7ML 3M6DA 1T5WA 3TWCL 3Q8FA 3C8KB 1HWWA 3P4NA 1SXSA 3FQ2A 1JPEA 1EO8L 1G87A 3MV8A 3CNKA 3EXLA 2RMNA 3MCLH 3MRPA 2EIZA 4L37B 1NWPA 2K3HA 3DO4A 3EO1B 2BHUA 4DP8X 4OCXH 1QLFB 3FOMB 4EEEA 2N0KA 2AXJA 3BKCH 3E3QE 3BZ4B 2WXLA 4JRXE 2UZYB 4N6QA 2E9GA 4PB0H 3MSPA 4LP5A 3V6OC 2MOGA 1DLFH 4NKQB 3K4ZA 3PWUB 3U4KA 2YS4A 1V7MH 1LLAA 1F1GA 3TWCH 1TJGL 2K7QA 3KXFE 4U2YA 2WLYA 3K6IA 4UT6L 3LPWA 1EO8H 2VZSA 3ELAT 2HVBA 4KK8C 4Y4FA 5I2IB 4YFLI 3NQKA 2GTWA 4EN3C 3VSTA 4AXWB 2BNQE 1MXDA 4JFFB 2V9UA 1VENA 1PVHA 2B08A 3RI5K 1UG9A 4MXQD 4FNTA 2X4RA 2Y7NA 2NSMA 1EK3A 2JVUA 3FT1A 3MREB 4JRWA 3F6LA 2B2XL 3OG6B 3SOBL 3E8VA 4E5XG 5AB9A 2Q5BA 3MLYH 4BV1A 1IGJA 5I8CA 3GS0A 2ZE0A 4ZJ9A 5E4EC 3UROR 5EUKB 4PUBL 4PD4J 3C5SA 2VDRB 1S8DB 1WC7A 2N01B 4WTQA 1WFNA 4ZS6D 2FJHB 5F3BA 2GJ6B 1A22B 5KJRH 2C5DC 1L9NA 1U8OB 3ZU8A 4HFWA 5CR8A 2QL1A 4CMHB 2OW6A 5I5IA 5JNYB 4XBEH 4C4BA 1W6WA 3BUBA 5EU6A 5E1GA 2A83B 4N5EC 4JAMA 1JWMA 3UC0L 4ZFGH 3Q8EA 4IK7A 2VH5L 1D5IH 1FE8L 1MHHA 4ZZKA 1EHAA 1SYVB 5DJ2A 3S97C 4ANKA 5J8OA 3DGGB 4TUOA 3SOBH 1ADQL 2H41A 1AHWB 2WMPB 3BP6A 2L7QA 5CEZE 7TAAA 4ZYKA 4LT7A 3UBHA 2AJXL 2BVOB 3AT8A 3FUEA 1XV8A 1F02I 4UT7L 5L4MA 3KMDA 2CAKA 5GGUB 5TTRA 2CGRL 4N8VG 3AJ7A 3FU9A 1I8IA 4MQXD 3D9AL 4LBEA 4OFYA 3QAZB 1Q9LB 4YDMA 3UC0H 4DP6X 4X8GA 3VXOB 4E9QA 5E2UL 3BPNC 3D7PA 2FL5B 2VH5H 3DJSA 1FE8H 3T4AA 4P2RB 3CC5B 2YAMA 1ADQH 1BAFH 2MQ3A 4WAFA 4ZO6A 5DD6B 3EYQC 1FG9C 3G6AA 1XH3B 4XPGH 3KLHD 4FNPA 2XVKA 3HR6A 1ORQB 1J9QA 4P3DB 2MHAA 2WNWA 3FCBA 1PLAA 5KSBE 1A4AA 2HX8A 3B3IA 4LSUH 3W0WB 3S5LG 3VG9C 4TULH 1SDAB 3O8XD 2CGRH 4EMZA 1FNHA 4M7LT 1MFBL 1R3HA 1BCIA 1WTGT 1G7QB 2XN1A 3ZIMA 1EZLA 4L1BA 4EN3B 5FOBB 1IQDB 5LGJB 5ANHA 2VABA 2X9XA 3QXWA 4HUWB 1KLUA 5MERA 5F97E 3W9DA 2M26A 1J0HA 2Y3NA 5C07A 3ZKMC 1QVOA 1GGIL 3FOLB 3FT3B 3V4UL 2X28A 5F70A 4HIJA 1NFIB 2F0CA 4MDRA 4S1RL 1R75A 4I2XE 1EJ6A 5E4EB 3D50A 5M94B 5JHDA 3FO9B 3BT2L 5HHOD 3CHQA 3QDJE 2OTWB 2XWBA 4GI9A 3OZ9L 1JE6A 3MC0A 3EUDA 2BY2A 4JPVL 5AWNL 4FNSA 3TEYA 3IETB 1K8DB 2HFGL 2NMSA 3QHFH 1GZHA 1JV2B 2DD8H 4MB1A 2VLRA 3HUJE 1XSJA 5J6GA 4TUUA 1QSFA 3CDGA 4WHCA 5EBMA 2GC7C 3TFKC 1DDHA 4M8RA 3QEQB 4KKPA 4NQSA 2ZG3A 3E7JA 2WC7A 4N0FA 1PKOA 3L3GA 4PJ5D 1NPNA 5CLWA 1ZT7A 4JDVB 4MQ7A 3MJ7B 3LZOA 4HWZA 5GHWH 4KITB 1LE5A 1H3PH 2NY6D 2V2TB 2BNRA 4RRPA 3LIUA 5D2LE 5M7QA 2BWIA 5CD5C 1F56A 2YAPA 4KO9A 3VJ6B 1DFBL 2EH7L 4AY0A 3F2LA 2R9HD 4K8RD 4Q6IA 4D7BA 3UTSB 1KTCA 3WGVB 4EI5C 4OI7A 3EAKA 2Z34A 1M1XA 1ASPA 2GFBB 2YKLL 1GGBH 3Q7JA 2WIMA 2DQCL 3RPBA 5C09E 2D4DA 3BPNB 2VZ3A 5KS9B 4MJ6B 3B34A 3CMOH 4PJHE 2WBJB 5D93C 3T4YB 1P84K 3WFCL 3D3VE 1B6DA 3QO0A 2VUOA 1Y07A 1AKPA 4PV8B 1Y7VA 5MEND 4HKZB 3MBEA 1G9NL 3SKOB 2DBLL 5E5UB 1CDIA 4L1DA 1KCKA 1DFBH 1DEEB 1G7JB 2IDFA 5IIEB 5E8NB 1TETH 4XXWA 3ECWA 4J6RL 3KDPB 3P0YH 4ZQKA 5I24A 1TZGH 1T21B 2V5MA 4NZRL 3QAQA 4KMTH 2DQCH 4M4RB 4AZ8A 4JNXA 1N5AB 3US0A 4EI6B 4WFFD 4FQPA 4RBPK 2DH2A 3KBEA 1GS6X 2FO1A 1OD7A 3NK3A 5DFVD 3WFCH 3KWWB 2FWOB 3X11B 5DURD 4KDTA 1I8MA 2ZUYA 2DBLH 1TQSA 3BN9D 4AQEA 4YL9A 2GQHA 4PJGE 3NCYS 4JJ5A 3PAYA 4AQAA 3QJZA 5F7UA 4OI8A 4ODUB 4P5KB 1I9JH 4L4JA 4D0DB 2EYRA 2PYFA 1RK0B 3OX8B 4J6RH 3QQ9D 1RVFL 3O2VL 4TUJB 4LKXA 4L4TA 3S35L 2L7UA 4DPBX 4BDVA 2CBQA 1RHHA 2V2XB 3NIDB 4JDEA 4K71B 3ZTDC 5EC2A 4PJDA 4CVZB 3Q5TA 5AB0A 1PZSA 4L9LB 3ECVA 5ITFA 2QQKL 3RZCC 1MLCB 3QH3B 3H2PA 2BP0A 5I74C 5H35B 5E4OA 2RB8A 1XGYH 3NESA 4KKAC 2R59A 4ISVA 2X89A 1RVFH 5EMYA 4LNRB 4EXKA 2Y1AA 4B9PA 4WI9A 1FZOA 2VWEE 2EO7A 3O45A 2CALA 4NXSA 3ZBMA 1X5KA 4XXCA 4XO5A 1WP6A 1F8TH 4HPHA 2XYCA 1HX0A 2AJ3B 1SLUA 5C3IA 3G6DH 4FYTA 1U92A 4PI0A 3PGDB 3WXVL 5CEXA 1TYJA 2Y25A 1XGUA 5AKVA 1XGTA 4FKEA 3LRSA 1LK3L 1C7TA 2SEBB 5D93B 3DK0A 3TBWA 1IGYB 4Z7NE 2W95A 3KLDA 4M29A 1E9OB 3NFPA 5CIPA 3JTSA 5DEGA 2G3NA 3G3LA 1NM4A 3TNMB 4U2ZA 2HMID 4Q2ZB 3INOA 1CF8L 3NCFB 2Z3FA 3GFUA 3DJTA 5B3JF 1RJLB 2E7HA 3JTBA 3Q9QA 4ENEC 4G8EB 4H8HA 3CFDA 2BOBB 4RDQF 3QO1B 4FFYA 3NSDA 3BZDA 3DLQR 3LSOA 2IFFH 2Z93A 3AS3A 3WXVH 2YPVH 3V4PH 3U9WA 2AZUA 3FFCA 3LQZB 1LK3H 5C0BD 1GGYA 2FBOJ 2MCMA 4NBXB 1OAZL 2D31B 3RJDA 3CX5J 1LO2H 4ODWA 1AGFA 3ABZA 4R0LC 3SKMA 4Z7VA 2AZAA 4RFOL 1EUUA 5E8PB 2VGLM 5TDPB 3T2NL 4RFNC 5D7LB 2WBWB 4LPUA 4PG9A 1QHPA 1QEXA 3RNKA 1J8HD 3K6FA 1DVFC 4KKQA 1SY6L 4U1MA 3WNMA 3CN2A 2YA0A 5C6TL 4HKXB 2DQJL 2D2OA 4YGVB 5HYJA 4JKWA 4G59C 3ENEA 1AS7A 1OAZH 1SMDA 5IMKA 3STLA 3TEXA 3VQMA 4DEWA 2Q7NA 3Q01A 5CU5A 4BFRA 4RSYA 2ESVD 4N4YB 3RZCB 1E8ZA 4OFIA 4Z77B 1UB6B 4FKKA 3T2NH 4KPHL 4LAQH 1R0AH 3MRIA 2PNDA 5AOJA 1WICA 2E27H 2BWQA 4XPTL 4GY4A 1M57B 5AYUH 4OZGF 5I26A 5C9JB 3V79C 1NDMB 2XC8A 3VQ2C 1XF3A 5HDWA 5C6TH 4M7KH 1BFSA 3LKQB 3WE6A 1EHXA 1JK9B 2FSEA 1JTTA 2BHZA 3TO4C 5I1GL 3VTAA 1Z5HA 2Q76A 5AW2B 2GUYA 5AD0A 4UNTA 4OZIF 3H53A 4A37A 1JPTH 2DMBA 3I9GH 3QORA 1D6VH 4FYSA 1TQVA 1ONQB 2F1BA 3P4OB 1YMMD 2Q10A 4I0PD 3FQTA 5C0FA 4QRAA 3RA7L 3QNYB 4F57L 5D5MF 1IKNA 4DPCX 1N2RB 4XPTH 3VYPA 4R9HA 3LX9A 2OJEA 5AOZA 4FCAA 1CLCA 4PSPA 4PGBB 4YAQB 1RHFA 3DV6A 5C08E 5EUOB 3RUGB 2Z91A 43C9B 4GRLC 2D8KA 2BIMA 3GSWB 5MEQA 2J20A 5I1GH 4X5XB 1P4IL 4URTB 4ZBJA 2XWRA 5BVPL 3ZJAA 2J1XA 4B5EA 4M48L 1OK8A 1QI5A 1ASQA 2NUPB 3RWIB 1KBPA 2WCSA 3L8QA 3QXAB 3SDDD 1CGVA 1Q38A 4IMKC 4QTIH 4MNQD 2YJQA 4JRYE 4EZJA 2VLKB 1WBYB 3FYIB 3UAFA 3ZE2B 3MV11 2YD1A 4NAMA 1DVFB 2V0AA 2ZCHL 3DXAA 4NP4L 3MQIA 2B0SL 2OSLA 4NAJA 3IXAB 2WD0A 4WTXA 3P73B 3CFUA 3FPXA 1PD6A 4P9HH 1MW3A 4P9ML 3UDWA 2W80C 4BH8A 3N1GC 3MZGB 4QRBA 3FH7A 3ULVF 4MZRA 3IGAA 3UGUA 2E8ZA 4HCRH 1X9UA 5TQ2L 4YHZH 2JB5L 4MKTA 3GS4A 5DJZB 4I13B 2YGOA 2WLNA 4QI3A 3FB6A 3H9SE 1KDJA 4J3WA 2DQFB 1LEGB 3CDZB 3QNFA 4RETB 5TF1H 3KL0A 1II4E 1HCYA 2B0SH 3BEVB 2H32A 3IJSB 4PJ8D 3WD5L 3IDXH 4PTTB 4WTZG 4LCIH 1I7ZB 4Y4HA 4CMMB 4OJFH 5A2KH 2DQTL 2F08A 3DUUA 2CLRA 5LBGA<