1M9XC

X-ray crystal structure of cyclophilin a/hiv-1 ca n-terminal domain (1-146) m-type h87a,a88m,g89a complex.
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
146
structure length
146
Chain Sequence
b'PIVQNLQGQMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVAMAPIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cyclophilin A
publication title Structural insights into the catalytic mechanism of cyclophilin A
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase/viral protein
total genus 50
structure length 146
sequence length 146
chains with identical sequence D, G, H
ec nomenclature
pdb deposition date 2002-07-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 1m9xC00
4E91A 4XRQA 3BP9A 5HGLA 4U0EA 4U0BA 2XDEA 1EIAA 5HGMA 4B4NA 4XFXA 2WLVA 5HGOA 4PH3A 2PXRC 4DGAC 4NX4C 1D1DA 4XROA 4XFYA 2X83A 4E92A 1M9CC 2LF4A 4DGEC 1P7NA 2XGVA 1EM9A 2X2DD 2XGUA 1M9DC 4INBA 4PH2A 1G03A 4J93A 2GONA 2M8NA 2PWOA 5HGNA 4HTWA 2X82A 4PH0A 5JPAA 2PWMA 1AFVA 1L6NA 1E6JP 4U0DA 3MGEA 1AK4C 2WLVB 1GWPA 3NTEA 1QRJA 1M9YC 3H4EA 4XFZA 1M9EC 2M8LA 3P05A 4LQWC 5HGKA 4U0AA 2KGFA 2Y4ZA 1U7KA 1M9FC 2EIAA 4U0CA 3H47A 4QNBA 2M8PA 2XGYA 2JPRA 4U0FA 4WYMA 1M9XC 2V4XA 2GOLB
chains in the Genus database with same CATH superfamily
4E91A 4XRQA 3BP9A 5HGLA 4U0EA 4U0BA 2XDEA 1EIAA 5HGMA 4B4NA 4XFXA 2WLVA 5HGOA 4PH3A 2PXRC 4DGAC 4NX4C 1D1DA 4XROA 4XFYA 2X83A 4E92A 1M9CC 2LF4A 4DGEC 1P7NA 2XGVA 1EM9A 2X2DD 2XGUA 1M9DC 4INBA 4PH2A 1G03A 4J93A 2GONA 2M8NA 2PWOA 5HGNA 4HTWA 2X82A 4PH0A 5JPAA 2PWMA 1AFVA 1L6NA 1E6JP 4U0DA 3MGEA 1AK4C 2WLVB 1GWPA 3NTEA 1QRJA 1M9YC 3H4EA 4XFZA 1M9EC 2M8LA 3P05A 4LQWC 5HGKA 4U0AA 2KGFA 2Y4ZA 1U7KA 1M9FC 2EIAA 4U0CA 3H47A 4QNBA 2M8PA 2XGYA 2JPRA 4U0FA 4WYMA 1M9XC 2V4XA 2GOLB
chains in the Genus database with same CATH topology
4E91A 4XRQA 3BP9A 5HGLA 4U0EA 4U0BA 2XDEA 1EIAA 5HGMA 4B4NA 4XFXA 2WLVA 5HGOA 4PH3A 2PXRC 4DGAC 4NX4C 1D1DA 4XROA 4XFYA 2X83A 4E92A 1M9CC 2LF4A 4DGEC 1P7NA 2XGVA 1EM9A 2X2DD 2XGUA 1M9DC 4INBA 4PH2A 1G03A 4J93A 2GONA 2M8NA 2PWOA 5HGNA 4HTWA 2X82A 4PH0A 5JPAA 2PWMA 1AFVA 1L6NA 1E6JP 4U0DA 3MGEA 1AK4C 2WLVB 1GWPA 3NTEA 1QRJA 1M9YC 3H4EA 4XFZA 1M9EC 2M8LA 3P05A 4LQWC 5HGKA 4U0AA 2KGFA 2Y4ZA 1U7KA 1M9FC 2EIAA 4U0CA 3H47A 4QNBA 2M8PA 2XGYA 2JPRA 4U0FA 4WYMA 1M9XC 2V4XA 2GOLB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4E91 A;  4XRQ A;  3BP9 A;  5HGL A;  4U0E A;  4U0B A;  2XDE A;  1EIA A;  5HGM A;  4B4N A;  4XFX A;  2WLV A;  5HGO A;  4PH3 A;  2PXR C;  4DGA C;  4NX4 C;  1D1D A;  4XRO A;  4XFY A;  2X83 A;  4E92 A;  1M9C C;  2LF4 A;  4DGE C;  1P7N A;  2XGV A;  1EM9 A;  2X2D D;  2XGU A;  1M9D C;  4INB A;  4PH2 A;  1G03 A;  4J93 A;  2GON A;  2M8N A;  2PWO A;  5HGN A;  4HTW A;  2X82 A;  4PH0 A;  5JPA A;  2PWM A;  1AFV A;  1L6N A;  1E6J P;  4U0D A;  3MGE A;  1AK4 C;  2WLV B;  1GWP A;  3NTE A;  1QRJ A;  1M9Y C;  3H4E A;  4XFZ A;  1M9E C;  2M8L A;  3P05 A;  4LQW C;  5HGK A;  4U0A A;  2KGF A;  2Y4Z A;  1U7K A;  1M9F C;  2EIA A;  4U0C A;  3H47 A;  4QNB A;  2M8P A;  2XGY A;  2JPR A;  4U0F A;  4WYM A;  1M9X C;  2V4X A;  2GOL B; 
#chains in the Genus database with same CATH topology
 4E91 A;  4XRQ A;  3BP9 A;  5HGL A;  4U0E A;  4U0B A;  2XDE A;  1EIA A;  5HGM A;  4B4N A;  4XFX A;  2WLV A;  5HGO A;  4PH3 A;  2PXR C;  4DGA C;  4NX4 C;  1D1D A;  4XRO A;  4XFY A;  2X83 A;  4E92 A;  1M9C C;  2LF4 A;  4DGE C;  1P7N A;  2XGV A;  1EM9 A;  2X2D D;  2XGU A;  1M9D C;  4INB A;  4PH2 A;  1G03 A;  4J93 A;  2GON A;  2M8N A;  2PWO A;  5HGN A;  4HTW A;  2X82 A;  4PH0 A;  5JPA A;  2PWM A;  1AFV A;  1L6N A;  1E6J P;  4U0D A;  3MGE A;  1AK4 C;  2WLV B;  1GWP A;  3NTE A;  1QRJ A;  1M9Y C;  3H4E A;  4XFZ A;  1M9E C;  2M8L A;  3P05 A;  4LQW C;  5HGK A;  4U0A A;  2KGF A;  2Y4Z A;  1U7K A;  1M9F C;  2EIA A;  4U0C A;  3H47 A;  4QNB A;  2M8P A;  2XGY A;  2JPR A;  4U0F A;  4WYM A;  1M9X C;  2V4X A;  2GOL B; 
#chains in the Genus database with same CATH homology
 4E91 A;  4XRQ A;  3BP9 A;  5HGL A;  4U0E A;  4U0B A;  2XDE A;  1EIA A;  5HGM A;  4B4N A;  4XFX A;  2WLV A;  5HGO A;  4PH3 A;  2PXR C;  4DGA C;  4NX4 C;  1D1D A;  4XRO A;  4XFY A;  2X83 A;  4E92 A;  1M9C C;  2LF4 A;  4DGE C;  1P7N A;  2XGV A;  1EM9 A;  2X2D D;  2XGU A;  1M9D C;  4INB A;  4PH2 A;  1G03 A;  4J93 A;  2GON A;  2M8N A;  2PWO A;  5HGN A;  4HTW A;  2X82 A;  4PH0 A;  5JPA A;  2PWM A;  1AFV A;  1L6N A;  1E6J P;  4U0D A;  3MGE A;  1AK4 C;  2WLV B;  1GWP A;  3NTE A;  1QRJ A;  1M9Y C;  3H4E A;  4XFZ A;  1M9E C;  2M8L A;  3P05 A;  4LQW C;  5HGK A;  4U0A A;  2KGF A;  2Y4Z A;  1U7K A;  1M9F C;  2EIA A;  4U0C A;  3H47 A;  4QNB A;  2M8P A;  2XGY A;  2JPR A;  4U0F A;  4WYM A;  1M9X C;  2V4X A;  2GOL B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...