1M9XC

X-ray crystal structure of cyclophilin a/hiv-1 ca n-terminal domain (1-146) m-type h87a,a88m,g89a complex.
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
146
structure length
146
Chain Sequence
PIVQNLQGQMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVAMAPIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights into the catalytic mechanism of cyclophilin A
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase/viral protein
molecule keywords Cyclophilin A
total genus 50
structure length 146
sequence length 146
chains with identical sequence D, G, H
ec nomenclature
pdb deposition date 2002-07-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 1m9xC00
1M9CC 2PWOA 5HGOA 5JPAA 2PWMA 4QNBA 3H4EA 4U0EA 2EIAA 4XFZA 1M9FC 1EM9A 1M9YC 1P7NA 5HGLA 5HGNA 2V4XA 1GWPA 2WLVA 3P05A 4XRQA 3NTEA 1L6NA 2GONA 2M8LA 4J93A 2X83A 4PH0A 2XGYA 2JPRA 4WYMA 1M9XC 1EIAA 2XDEA 4E92A 4XROA 1AK4C 2X2DD 4DGAC 4E91A 4U0AA 1QRJA 4NX4C 2KGFA 1M9EC 4U0DA 3MGEA 4XFXA 5HGMA 2M8PA 2M8NA 3H47A 4LQWC 1D1DA 1G03A 2WLVB 4B4NA 4DGEC 2LF4A 1E6JP 5HGKA 2PXRC 2Y4ZA 1M9DC 4PH3A 3BP9A 2XGVA 1U7KA 2X82A 2XGUA 1AFVA 4HTWA 4INBA 4PH2A 4U0CA 4U0BA 4U0FA 4XFYA 2GOLB
chains in the Genus database with same CATH superfamily
1M9CC 2PWOA 5HGOA 5JPAA 2PWMA 4QNBA 3H4EA 4U0EA 2EIAA 4XFZA 1M9FC 1EM9A 1M9YC 1P7NA 5HGLA 5HGNA 2V4XA 1GWPA 2WLVA 3P05A 4XRQA 3NTEA 1L6NA 2GONA 2M8LA 4J93A 2X83A 4PH0A 2XGYA 2JPRA 4WYMA 1M9XC 1EIAA 2XDEA 4E92A 4XROA 1AK4C 2X2DD 4DGAC 4E91A 4U0AA 1QRJA 4NX4C 2KGFA 1M9EC 4U0DA 3MGEA 4XFXA 5HGMA 2M8PA 2M8NA 3H47A 4LQWC 1D1DA 1G03A 2WLVB 4B4NA 4DGEC 2LF4A 1E6JP 5HGKA 2PXRC 2Y4ZA 1M9DC 4PH3A 3BP9A 2XGVA 1U7KA 2X82A 2XGUA 1AFVA 4HTWA 4INBA 4PH2A 4U0CA 4U0BA 4U0FA 4XFYA 2GOLB
chains in the Genus database with same CATH topology
1M9CC 2PWOA 5HGOA 5JPAA 2PWMA 4QNBA 3H4EA 4U0EA 2EIAA 4XFZA 1M9FC 1EM9A 1M9YC 1P7NA 5HGLA 5HGNA 2V4XA 1GWPA 2WLVA 3P05A 4XRQA 3NTEA 1L6NA 2GONA 2M8LA 4J93A 2X83A 4PH0A 2XGYA 2JPRA 4WYMA 1M9XC 1EIAA 2XDEA 4E92A 4XROA 1AK4C 2X2DD 4DGAC 4E91A 4U0AA 1QRJA 4NX4C 2KGFA 1M9EC 4U0DA 3MGEA 4XFXA 5HGMA 2M8PA 2M8NA 3H47A 4LQWC 1D1DA 1G03A 2WLVB 4B4NA 4DGEC 2LF4A 1E6JP 5HGKA 2PXRC 2Y4ZA 1M9DC 4PH3A 3BP9A 2XGVA 1U7KA 2X82A 2XGUA 1AFVA 4HTWA 4INBA 4PH2A 4U0CA 4U0BA 4U0FA 4XFYA 2GOLB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M9C C;  2PWO A;  5HGO A;  5JPA A;  2PWM A;  4QNB A;  3H4E A;  4U0E A;  2EIA A;  4XFZ A;  1M9F C;  1EM9 A;  1M9Y C;  1P7N A;  5HGL A;  5HGN A;  2V4X A;  1GWP A;  2WLV A;  3P05 A;  4XRQ A;  3NTE A;  1L6N A;  2GON A;  2M8L A;  4J93 A;  2X83 A;  4PH0 A;  2XGY A;  2JPR A;  4WYM A;  1M9X C;  1EIA A;  2XDE A;  4E92 A;  4XRO A;  1AK4 C;  2X2D D;  4DGA C;  4E91 A;  4U0A A;  1QRJ A;  4NX4 C;  2KGF A;  1M9E C;  4U0D A;  3MGE A;  4XFX A;  5HGM A;  2M8P A;  2M8N A;  3H47 A;  4LQW C;  1D1D A;  1G03 A;  2WLV B;  4B4N A;  4DGE C;  2LF4 A;  1E6J P;  5HGK A;  2PXR C;  2Y4Z A;  1M9D C;  4PH3 A;  3BP9 A;  2XGV A;  1U7K A;  2X82 A;  2XGU A;  1AFV A;  4HTW A;  4INB A;  4PH2 A;  4U0C A;  4U0B A;  4U0F A;  4XFY A;  2GOL B; 
#chains in the Genus database with same CATH topology
 1M9C C;  2PWO A;  5HGO A;  5JPA A;  2PWM A;  4QNB A;  3H4E A;  4U0E A;  2EIA A;  4XFZ A;  1M9F C;  1EM9 A;  1M9Y C;  1P7N A;  5HGL A;  5HGN A;  2V4X A;  1GWP A;  2WLV A;  3P05 A;  4XRQ A;  3NTE A;  1L6N A;  2GON A;  2M8L A;  4J93 A;  2X83 A;  4PH0 A;  2XGY A;  2JPR A;  4WYM A;  1M9X C;  1EIA A;  2XDE A;  4E92 A;  4XRO A;  1AK4 C;  2X2D D;  4DGA C;  4E91 A;  4U0A A;  1QRJ A;  4NX4 C;  2KGF A;  1M9E C;  4U0D A;  3MGE A;  4XFX A;  5HGM A;  2M8P A;  2M8N A;  3H47 A;  4LQW C;  1D1D A;  1G03 A;  2WLV B;  4B4N A;  4DGE C;  2LF4 A;  1E6J P;  5HGK A;  2PXR C;  2Y4Z A;  1M9D C;  4PH3 A;  3BP9 A;  2XGV A;  1U7K A;  2X82 A;  2XGU A;  1AFV A;  4HTW A;  4INB A;  4PH2 A;  4U0C A;  4U0B A;  4U0F A;  4XFY A;  2GOL B; 
#chains in the Genus database with same CATH homology
 1M9C C;  2PWO A;  5HGO A;  5JPA A;  2PWM A;  4QNB A;  3H4E A;  4U0E A;  2EIA A;  4XFZ A;  1M9F C;  1EM9 A;  1M9Y C;  1P7N A;  5HGL A;  5HGN A;  2V4X A;  1GWP A;  2WLV A;  3P05 A;  4XRQ A;  3NTE A;  1L6N A;  2GON A;  2M8L A;  4J93 A;  2X83 A;  4PH0 A;  2XGY A;  2JPR A;  4WYM A;  1M9X C;  1EIA A;  2XDE A;  4E92 A;  4XRO A;  1AK4 C;  2X2D D;  4DGA C;  4E91 A;  4U0A A;  1QRJ A;  4NX4 C;  2KGF A;  1M9E C;  4U0D A;  3MGE A;  4XFX A;  5HGM A;  2M8P A;  2M8N A;  3H47 A;  4LQW C;  1D1D A;  1G03 A;  2WLV B;  4B4N A;  4DGE C;  2LF4 A;  1E6J P;  5HGK A;  2PXR C;  2Y4Z A;  1M9D C;  4PH3 A;  3BP9 A;  2XGV A;  1U7K A;  2X82 A;  2XGU A;  1AFV A;  4HTW A;  4INB A;  4PH2 A;  4U0C A;  4U0B A;  4U0F A;  4XFY A;  2GOL B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...