1MAPA

Crystal structures of true enzymatic reaction intermediates: aspartate and glutamate ketimines in aspartate aminotransferase
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
401
structure length
401
Chain Sequence
SSWWSHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMIAAKKMDKEYLPIAGLADFTRASAELALGENSEAFKSGRYVTVQGISGTGSLRVGANFLQRFFKFSRDVYLPKPSWGNHTPIFRDAGLQLQAYRYYDPKTCSLDFTGAMEDISKIPEKSIILLHACAHNPTGVDPRQEQWKELASVVKKRNLLAYFDMAYQGFASGDINRDAWALRHFIEQGIDVVLSQSYAKNMGLYGERAGAFTVICRDAEEAKRVESQLKILIRPMYSNPPMNGARIASLILNTPELRKEWLVEVKGMADRIISMRTQLVSNLKKEGSSHNWQHITDQIGMFCFTGLKPEQVERLTKEFSIYMTKDGRISVAGVASSNVGYLAHAIHQVTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ASPARTATE AMINOTRANSFERASE
publication title Crystal structures of true enzymatic reaction intermediates: aspartate and glutamate ketimines in aspartate aminotransferase.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Aminotransferase
total genus 143
structure length 401
sequence length 401
ec nomenclature ec 2.6.1.1: Aspartate transaminase.
pdb deposition date 1993-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 1mapA02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 1mapA01
3EI7A 2W7GA 3BB8A 4RM1A 1SF2A 2D61A 4MGRA 1TOGA 4WYFA 1FG3A 2JJFA 3HMUA 3EIBA 3GJUA 1TOEA 2DGKA 3MAFB 4ITGA 4A0HA 1I48A 2BKWA 4E3QA 2W8JA 5BJ3A 4CVQA 2EPJA 3I5TA 3N5MA 1QJ5A 1WYUB 2O0RA 3MAUA 2ZSMA 4F5KA 1WYVB 2ZY3A 1YOOA 3HT4A 3LVJA 4XEWA 3GZDA 2FNIA 3QGUA 3UAKA 4DGTA 3E2YA 3AEPA 3CQ4A 4R2NA 1BJWA 4XJPA 3AEMA 4ZWVA 2QA3A 1GDEA 4HVKA 4W8IA 1G7WA 2CFBA 4M2MA 1MGVA 4LNLA 3LVLB 1D7SA 4AOAA 1OHYA 1VP4A 8AATA 3HQTA 2ZUKA 1Z7DA 2QBTA 1MLYA 1JF9A 3G0TA 4WXGA 1OXPA 3ACZA 3PDXA 7AATA 1CL1A 1WYUA 3ATHA 2YCNA 4AO9A 3E2FA 3AEJA 4JF1A 1DJ9A 1MDXA 4F5JA 4OMAA 3GR9A 4MSOA 1QJ3A 1YIZA 4RJ0A 1AKCA 3BV0A 2E54A 2D7YA 4LW4A 3CAIA 2BI3A 2Z20A 1ASBA 2EO5A 2VMRA 1AAWA 1RV3A 2W8WA 3DXVA 3JWBA 3HLMA 4A0GA 1MAQA 2BIEA 1IAXA 1TATA 2YKYA 4JEXA 4EB7A 1YJSA 2EH6A 3NU7A 3H14A 2Z67A 2E7UA 2Z61A 3DR4A 2WK8A 1CQ7A 2W7JA 1V2EA 2Z9XA 1H1CA 4RLGA 5G2QA 3E6GA 4JEVA 1N31A 1MAPA 5DJ9A 2OKJA 3BWNA 2VGSA 4GEBA 2VYCA 4UHOA 5I92A 4EU1A 3FVXA 4U1TA 3KGWA 4R8DA 4TN4A 5HDMA 3TATA 4OYTA 1N8PA 1ASMA 1ECXA 3CQ6A 2R0TA 3A9XA 3EI6A 3DC1A 3BCAA 4JE5D 3AOWA 4Y0DA 2VMUA 2W7IA 2XBNA 4ZWMA 2DKBA 4P7YA 1ASDA 1OHVA 1AX4A 2BIAA 2Q7WA 4JE5A 4ZDOA 4ZLVA 1C7NA 4M2JA 2AY7A 3NYTA 4BA5A 3EI8A 4OT8A 3NU8A 1LC7A 2CY8A 1TARA 2C0RA 5TF5A 3FZ6A 4ZDLA 4W1WA 1W7LA 3MEBA 3BN1A 4FFCA 5EQCA 3WLXA 1EQBA 5IWQA 1BJOB 1LK9A 1SZKA 2CTZA 1RVUA 4WYGA 5LHAA 1LW5A 3F9TA 3FDBA 1EG5A 4LC3A 4ZM4A 2D64A 1GBNA 2ZY2A 2YRIA 2O1BA 1AHXA 1M6SA 3WY7A 3N75A 1ZODA 3H7FA 1V72A 3NYUA 1XI9A 2C81A 3W1JA 4ZM3A 3VK4A 4WXBA 1MDZA 3UWCA 4F5MA 5G09A 3E77A 4F5FA 2C7TA 2QB3A 2Z9VA 4A00A 4E3RA 4R5FA 1CZCA 1LC8A 1JS6A 1QZ9A 4I8AA 3TQXA 4QGRA 2VIBA 1YNUA 4KYOA 1PG8A 1KKJA 3G7QA 1ASAA 4UHMA 5EUEA 1IX8A 3TCMA 1M0NA 2YOBA 4Q31A 2VMZA 2JG2A 3AOVA 3ZRPA 1V2DA 1DTYA 3DODA 2G6WA 1G4XA 2BHXA 3USFA 2BYJA 1C7OA 4Y0HA 2PB0A 4WD2A 1IVRA 1Y4IA 2VMWA 1FC4A 3FVSA 3I16A 2RFVA 1GEYA 3KE3A 3AEOA 1H0CA 4EMYA 3QBOA 1PFFA 4MKJA 3NUIA 2X3LA 2W7MA 5HXXA 2ORDA 4F4EA 1S07A 4MQRA 2CB1A 1RVYA 3EIAA 3BCBA 2GSAA 4JEWA 4UHNA 3WZFA 4EB5A 2VGTA 5EAAA 1M4NA 3NYSA 3IHJA 5G4JA 2BYLA 2VLHA 3FFRA 4Y0IA 3L44A 1J32A 4F5LA 1LC5A 5G0AA 2EGYA 3QHXA 1OHWA 2FM1A 1CS1A 2QMAA 3G8MA 4GRXA 1KMJA 4IYOB 2W7HA 1CZEA 3BWOA 2VGZA 3GBXA 2HP2A 2W8TA 3B1DA 3M5UA 3JW9A 2E7JA 2HZPA 3GZDC 2W8UA 4ISYA 4WP0A 3VP6A 4A6TA 1W3UA 4JEZA 3AEMC 2FQ6A 2D63A 3AENA 2CJHA 2QLRA 1LS3A 4W5KA 1D7VA 2AY1A 2HUFA 5M4DA 1O4SA 2HOZA 4IYOA 2FN6A 1CQ6A 3AEJC 1M0OA 4ZASA 1B5PA 3LVKA 5FT6A 3QPGA 2NMPA 3OKSA 2BWNA 3ZZKA 3BS8A 2CINA 1M0PA 2BI2A 2W8VA 3A9YA 3GSBA 5E5IA 1DGEA 1JG8A 3JU7A 3COGA 2ZC0A 4WLJA 3NNKA 4OC9A 1AAMA 5E4ZA 2VMOA 4A72A 4OTLA 1ASNA 2D65A 3RCHA 1CL2A 2AEUA 2E7IA 4F5GA 3HL2A 1ASEA 1KL2A 1LW4A 1W23A 3NTJA 3JTXA 4PIWA 1BT4A 4XAUA 3ASAA 1ORDA 2YRRA 4ATQA 1SZSA 1X28A 2HUUA 3EZ1A 3DRDA 2FYFA 2WKAA 3RBFA 3BCXA 4CBRA 4F5HA 1VJOA 2Z9WA 4ADDA 3GZCA 2R5CB 3BWNC 3K40A 2VIAA 3PAAA 4RAEA 4FL0A 4UQVA 2GB3A 1UKJA 1AY4A 1KL1A 1SFFA 1W7MA 2AY8A 2GQNA 3R4TA 3WKSA 9AATA 4GE4A 2VMTA 1ARGA 1CQ8A 1GC0A 4F5IA 2X8UA 3RBLA 1KMKA 3ELEA 2F8JA 2GMSA 1MDOA 4K2BA 4Q6RA 1GC3A 5LH9A 4K2IA 3NX3A 2R5CA 4W91A 4LNMA 2VMXA 5J8QA 1O69A 1B9IA 4OCAA 1ASFA 3KGXA 3MADA 1DJEA 1X2AA 1C4KA 2CJGA 3PIUA 2V1PA 3FRKA 4EFFA 1UU2A 2ZJGA 1FG7A 2DGMA 2OQXA 2AY4A 4A6UA 3NRAA 4IXSA 4ATPA 2ZY4A 4PFNA 1LKCA 1GEWA 4H51A 2QB2A 2VI9A 4KAMA 2CJDA 3P1TA 2BI1A 2ZP7A 4ZSYA 4BA4A 1MLZA 4JF0A 4B9BA 2YKUA 2OGAA 4DQ6A 2ZSLA 5G4IA 3WKRA 4A0RA 1V2FA 4XQ2A 5HHYA 2VMYA 1S08A 1E5EA 3NUBA 4ADEA 4W1VA 1AIAA 3Q8NA 1I43A 3FVUA 1CJ0A 1YAAA 3B8XA 4XK1A 3TFTA 3PJ0A 1J04A 3WGCA 3LG0A 1OXOA 1TOJA 4OBVA 2VMVA 2YCPA 2BIGA 1YJZA 4A6RA 1AY5A 4TMRA 4PFFA 4Q75A 3MKJA 3EZSA 3F6TA 2HORA 1AMAA 3AELA 2BI5A 2HP1A 4BMKA 5M46A 1X0MA 3FQAA 1GEXA 4O6ZA 1ELQA 4ITXA 4MKKA 3I4JA 4GDYA 3P6KA 1IAYA 2D7ZA 2CH2A 3E2ZA 3NDNA 1EJIA 2AATA 1TPLA 2PO3A 2Z9UA 3CBFA 3N0LA 5EAVA 1S06A 4R5ZA 4WYAA 2BI9A 3PDBB 4CBSA 5EIGB 1OATA 3EUCA 2ZY5A 3EI5A 3FDDA 1B9HA 3AENB 1ASCA 1YIYA 2PB2A 3MC6A 3WX9A 1E5FA 3FKDA 4TV7A 1S0AA 3FQ8A 4ADBA 1BJNA 1ZOBA 5M49A 1AHGA 2W7DA 1C0NA 4WB0B 4B98A 3AV7A 3DR7A 4LNJA 4RJYA 1DFOA 1TASA 2VLFA 3VK3A 4CXQA 4WXFA 4WYCA 3QM2A 3FZ7A 3BC8A 3TFUA 3ASBA 1B5OA 3A2BA 1AMSA 4JEYA 3VOMA 3ZRQA 4AO4A 1B8GA 1QIRA 3PDBA 2C44A 3ECDA 4OBUA 3ELPA 3FQ7A 5EIGA 3RQ1A 4N0BA 1GD9A 3B1EA 4NOGA 1ARSA 2O7CA 4W1XA 2TPLA 2JJGA 3DU4A 2HUIA 3ZRRA 1SZUA 2HOYA 3R9AA 1AICA 1AKBA 3RCHB 4A0FA 1ASGA 1IX6A 2OATA 3B1CA 3QI6A 4WB0A 1GC4A 1I29A 3HVYA 4MQPA 2WK7A 2VGVA 4CXRA 4GSAA 2AY3A 1IX7A 1M32A 1ARTA 1WKGA 1WKHA 1D7RA 1XEYA 1QISA 3LY1A 3QN6A 3FZ8A 5FT5A 4LW2A 4N0WA 3A8UX 3WCOA 2YKXA 3HBXA 4AH3A 3FCRA 1T3IA 1ELUA 3L8AA 5BJ4A 1QITA 1PMMA 3MAFA 4KXKA 3VAXA 2D66A 2ZYJA 4DBCA 3WCNA 2EZ2A 3T32A 1ARIA 1DKAA 1WYVA 4K2MA 1O61A 3LVMA 1S09A 3PGYA 4P3MA 1BKGA 2W7FA 4RKCA 5E3KA 4ZDPA 1DJUA 1O62A 1M0QA 2DR1A 2YCTA 1RV4A 1ASLA 2JISA 2WK9A 2GMUA 1AHYA 5K8BA 3LV2A 1G4VA 1UU1A 4RKDA 4BQ0A 1AIBA 3KKIA 1GC2A 4BHDA 2JJEA 3IF2A 4XJMA 4WYDA 1W7NA 2XH1A 3D6KA 1QGNA 4E77A 2VMPA 1AMRA 3K28A 4WYEA 4GE7A 1YJYA 3FD0A 4IW7A 4XJOA 4MY5A 5M4BA 5DX5A 1AKAA 4IX8A 4RIZA 3DXWA 1SVVA 1GCKA 5FT8A 1I41A 2OKKA 1AJSB 1BQAA 1X29A 2DGLA 3RI6A 4ADCA 3ZZJA 2R5EA 5DJ1A 1C9CA 3GETA 5FT4A 4UOYA 4IY7A 2AY6A 2X5FA 3B46A 1VEFA 2JJHA 3LWSA 2D5YA 5F8VA 5AX8A 3E9KA 1AJRA 2Z1YA 1AHEA 4ZSWA 1AHFA 1AMQA 2W7LA 2VMSA 1D7UA 2DOUA 1G7XA 2JGTA 3RUYA 3W1HA 3F0HA 1BS0A 3DYDA 4IXOA 4MQQA 1AJSA 2YKVA 3W1IA 5D5SA 5C6UA 4WLHA 3PD6B 1IBJA 2AY5A 4J5UA 3WGBA 4Q76A 3MBBA 4L0OA 4M2KA 3E2ZB 3FTBA 2AY9A 5EFSA 2YHKA 3GWPA 2R2NA 2BWOA 1IJIA 4E1OA 1PMOA 3PPLA 2DKJA 4ZAHA 5D95A 1B4XA 2OGEA 1U08A 4RITA 1WYTB 3AATA 5G2PA 3CQ5A 1JS3A 2BWPA 1Z3ZA 4AZKA 2CH1A 2X5DA 3PD6A 3PA9A 2HOXA 4PVFA 3OP7A 5DB5A 2CSTA 3A9ZA 4AZJA 2FNUA 3FSLA 1BJOA 2VGUA 4IXZA 4U2HA 3VK2A 4HF8A 1N2TA 2Z1ZA 4J8LA 1P3WA 1SPAA 1BW0A 1ZC9A 2V0YA 1TOIA 5JAYA 2W7KA 1BQDA 1UU0A 5F9SA 4GE9A 3FFHA 1ARHA 4XJLA 3MC6C 1WYTA 1AY8A 1BJ4A 3DZZA 1TOKA 3K7YA 3UE8A 2VGWA 1IUGA 4WBTA 2AY2A 1WSTA 5EUNA 2W7EA 3ISLA 2VMNA 1C7GA 1M7YA 3JWAA 2EZ1A 2AEVA 1DGDA 2VMQA 3JZLA 1D2FA 3HDOA 2CANA 5EUDA 3II0A 2VI8A 1KKPA 3EI9A
chains in the Genus database with same CATH superfamily
3EI7A 2W7GA 3BB8A 4RM1A 1SF2A 2D61A 4MGRA 1TOGA 4WYFA 1FG3A 2JJFA 3HMUA 3EIBA 3GJUA 1TOEA 2DGKA 3MAFB 4ITGA 4A0HA 1I48A 2BKWA 4E3QA 2W8JA 5BJ3A 4CVQA 2EPJA 3I5TA 3N5MA 1QJ5A 1WYUB 2O0RA 3MAUA 2ZSMA 4F5KA 1WYVB 2ZY3A 1YOOA 3HT4A 3LVJA 4XEWA 3GZDA 2FNIA 3QGUA 3UAKA 4DGTA 3E2YA 3AEPA 3CQ4A 4R2NA 1BJWA 4XJPA 3AEMA 4ZWVA 2QA3A 1GDEA 4HVKA 4W8IA 1G7WA 2CFBA 4M2MA 1MGVA 4LNLA 3LVLB 1D7SA 4AOAA 1OHYA 1VP4A 8AATA 3HQTA 2ZUKA 1Z7DA 2QBTA 1MLYA 1JF9A 3G0TA 4WXGA 1OXPA 3ACZA 3PDXA 7AATA 1CL1A 1WYUA 3ATHA 2YCNA 4AO9A 3E2FA 3AEJA 4JF1A 1DJ9A 1MDXA 4F5JA 4OMAA 3GR9A 4MSOA 1QJ3A 1YIZA 4RJ0A 1AKCA 3BV0A 2E54A 2D7YA 4LW4A 3CAIA 2BI3A 2Z20A 1ASBA 2EO5A 2VMRA 1AAWA 1RV3A 2W8WA 3DXVA 3JWBA 3HLMA 4A0GA 1MAQA 2BIEA 1IAXA 1TATA 2YKYA 4JEXA 4EB7A 1YJSA 2EH6A 3NU7A 3H14A 2Z67A 2E7UA 2Z61A 3DR4A 2WK8A 1CQ7A 2W7JA 1V2EA 2Z9XA 1H1CA 4RLGA 5G2QA 3E6GA 4JEVA 1N31A 1MAPA 5DJ9A 2OKJA 3BWNA 2VGSA 4GEBA 2VYCA 4UHOA 5I92A 4EU1A 3FVXA 4U1TA 3KGWA 4R8DA 4TN4A 5HDMA 3TATA 2FKIA 4OYTA 1N8PA 1ASMA 1ECXA 3CQ6A 2R0TA 2EYQA 3A9XA 3EI6A 3DC1A 3BCAA 4JE5D 3AOWA 4Y0DA 2VMUA 2W7IA 2XBNA 4ZWMA 2DKBA 4P7YA 1ASDA 1OHVA 1AX4A 2BIAA 2Q7WA 4JE5A 4ZDOA 4ZLVA 1C7NA 4M2JA 2AY7A 3NYTA 4BA5A 3EI8A 4OT8A 3NU8A 1LC7A 2CY8A 1TARA 2C0RA 5TF5A 3FZ6A 4ZDLA 4W1WA 1W7LA 3MEBA 3BN1A 4FFCA 5EQCA 3WLXA 1EQBA 5IWQA 1BJOB 1LK9A 1SZKA 2CTZA 1RVUA 4WYGA 5LHAA 1LW5A 2KFPA 3F9TA 3FDBA 1EG5A 4LC3A 4ZM4A 2D64A 1GBNA 2ZY2A 2YRIA 2O1BA 1AHXA 1M6SA 3WY7A 3N75A 1ZODA 3H7FA 1V72A 3NYUA 1XI9A 2C81A 3W1JA 4ZM3A 3VK4A 4WXBA 1MDZA 3UWCA 4F5MA 5G09A 3E77A 4F5FA 2C7TA 2QB3A 2Z9VA 4A00A 4E3RA 4R5FA 1CZCA 1LC8A 1JS6A 1QZ9A 4I8AA 3TQXA 1KAFA 4QGRA 2VIBA 3N4SA 1YNUA 4KYOA 1PG8A 1KKJA 3G7QA 1ASAA 4UHMA 5EUEA 1IX8A 3TCMA 1M0NA 2YOBA 4Q31A 2VMZA 2JG2A 3AOVA 3ZRPA 1V2DA 1DTYA 3DODA 2G6WA 1G4XA 2BHXA 3USFA 2BYJA 1C7OA 4Y0HA 2PB0A 4WD2A 1IVRA 1Y4IA 2VMWA 1FC4A 3FVSA 3I16A 2RFVA 1GEYA 3KE3A 3AEOA 1H0CA 4EMYA 3QBOA 1PFFA 4MKJA 3NUIA 2X3LA 2W7MA 5HXXA 2ORDA 4F4EA 1S07A 4MQRA 3H9XA 3N7NA 2CB1A 1RVYA 3EIAA 3N4XA 3BCBA 2GSAA 4JEWA 4UHNA 3WZFA 4EB5A 2VGTA 5EAAA 1M4NA 3NYSA 3IHJA 5G4JA 2BYLA 2VLHA 3FFRA 4Y0IA 3L44A 1J32A 4F5LA 1LC5A 5G0AA 2EGYA 3QHXA 1OHWA 2FM1A 1CS1A 2QMAA 3G8MA 4GRXA 1KMJA 4IYOB 2W7HA 1CZEA 3BWOA 2VGZA 3GBXA 2HP2A 2W8TA 3B1DA 3M5UA 3JW9A 2E7JA 2HZPA 3GZDC 2W8UA 4ISYA 4WP0A 3VP6A 5KTBA 4A6TA 1W3UA 4JEZA 3AEMC 2FQ6A 2D63A 3AENA 2CJHA 2QLRA 1LS3A 4W5KA 1D7VA 2AY1A 2HUFA 5M4DA 1O4SA 2HOZA 4IYOA 2FN6A 1CQ6A 3AEJC 1M0OA 4ZASA 1B5PA 3LVKA 5FT6A 3QPGA 2NMPA 3OKSA 2BWNA 4K05A 3ZZKA 3BS8A 2QSRA 2CINA 1M0PA 2BI2A 2W8VA 3A9YA 3GSBA 5E5IA 1DGEA 1JG8A 3JU7A 3COGA 2ZC0A 4WLJA 3NNKA 4OC9A 1AAMA 5E4ZA 2VMOA 4A72A 4OTLA 1ASNA 2D65A 3RCHA 1CL2A 2AEUA 2E7IA 4F5GA 3HL2A 1ASEA 1KL2A 1LW4A 1W23A 3NTJA 3JTXA 4PIWA 1BT4A 4XAUA 3ASAA 1ORDA 2YRRA 4ATQA 1SZSA 1X28A 2HUUA 3EZ1A 3DRDA 2FYFA 2WKAA 3RBFA 3BCXA 4CBRA 4F5HA 1VJOA 2Z9WA 4ADDA 3GZCA 2R5CB 3BWNC 3K40A 2VIAA 3PAAA 4RAEA 4FL0A 3N4RA 4UQVA 2GB3A 1UKJA 1AY4A 1KL1A 1SFFA 1W7MA 2AY8A 2GQNA 3R4TA 3WKSA 9AATA 4GE4A 2VMTA 1ARGA 1CQ8A 1GC0A 4F5IA 2X8UA 3RBLA 1KMKA 3ELEA 2F8JA 2GMSA 1MDOA 4K2BA 4Q6RA 1GC3A 5LH9A 4K2IA 3NX3A 2R5CA 4W91A 4LNMA 2VMXA 5J8QA 1O69A 1B9IA 4OCAA 1ASFA 3KGXA 3MADA 1DJEA 1X2AA 1C4KA 2CJGA 3PIUA 2V1PA 3FRKA 4EFFA 1UU2A 2ZJGA 1FG7A 2DGMA 2OQXA 2AY4A 4A6UA 3NRAA 4IXSA 4ATPA 2ZY4A 4PFNA 1LKCA 1GEWA 4H51A 2QB2A 2G7JA 2VI9A 4KAMA 2CJDA 3P1TA 2BI1A 2ZP7A 4ZSYA 4BA4A 1MLZA 4JF0A 4B9BA 2YKUA 2OGAA 4DQ6A 2ZSLA 5G4IA 3WKRA 4A0RA 1V2FA 4XQ2A 5HHYA 2VMYA 1S08A 1E5EA 3NUBA 4ADEA 4W1VA 1AIAA 3Q8NA 1I43A 3FVUA 1CJ0A 1YAAA 3B8XA 4XK1A 3TFTA 3PJ0A 4H63Q 1J04A 3WGCA 3LG0A 1OXOA 1TOJA 4OBVA 2VMVA 2YCPA 2BIGA 1YJZA 4A6RA 1AY5A 4TMRA 4PFFA 4Q75A 3MKJA 3EZSA 3F6TA 2HORA 1AMAA 3AELA 2BI5A 2HP1A 4BMKA 5M46A 1X0MA 3FQAA 1GEXA 4O6ZA 1ELQA 4ITXA 4MKKA 3I4JA 4GDYA 3P6KA 1IAYA 2D7ZA 2CH2A 3E2ZA 3NDNA 1EJIA 2AATA 1TPLA 2PO3A 2Z9UA 3CBFA 3N0LA 5EAVA 1S06A 4R5ZA 4WYAA 2BI9A 2A1VA 3PDBB 4CBSA 5EIGB 1OATA 3EUCA 2ZY5A 3EI5A 3FDDA 1B9HA 3AENB 1ASCA 1YIYA 2PB2A 3MC6A 3WX9A 1E5FA 3FKDA 4TV7A 1S0AA 3FQ8A 4ADBA 1BJNA 1ZOBA 5M49A 1AHGA 2W7DA 1C0NA 4WB0B 4B98A 3AV7A 3DR7A 4LNJA 4RJYA 1DFOA 1TASA 2VLFA 3VK3A 4CXQA 4WXFA 4WYCA 3QM2A 3FZ7A 3BC8A 3TFUA 3ASBA 1B5OA 3A2BA 1AMSA 4JEYA 3VOMA 3ZRQA 4AO4A 1B8GA 1QIRA 3PDBA 2C44A 3ECDA 4OBUA 3ELPA 3FQ7A 5EIGA 3RQ1A 4N0BA 1GD9A 3B1EA 4NOGA 1ARSA 2O7CA 4W1XA 2TPLA 2JJGA 3DU4A 2HUIA 3ZRRA 1SZUA 2HOYA 3R9AA 1AICA 1AKBA 3RCHB 4A0FA 1ASGA 1IX6A 2OATA 3B1CA 3QI6A 4WB0A 1GC4A 1I29A 3HVYA 4MQPA 2WK7A 2VGVA 4CXRA 4GSAA 2AY3A 1IX7A 1M32A 1ARTA 1WKGA 1WKHA 1D7RA 1XEYA 1QISA 3LY1A 3QN6A 3FZ8A 5FT5A 4LW2A 4N0WA 3A8UX 3WCOA 2YKXA 3HBXA 4AH3A 3FCRA 1T3IA 1ELUA 3L8AA 5BJ4A 1QITA 1PMMA 3MAFA 4KXKA 3VAXA 2D66A 2ZYJA 4DBCA 3WCNA 2EZ2A 3T32A 1ARIA 1DKAA 1WYVA 4K2MA 1O61A 3LVMA 1S09A 3PGYA 4P3MA 1BKGA 2W7FA 4RKCA 5E3KA 4ZDPA 1DJUA 1O62A 1M0QA 2DR1A 2YCTA 1RV4A 2WB6A 1ASLA 2JISA 2WK9A 2GMUA 1AHYA 5K8BA 3LV2A 1G4VA 1UU1A 4RKDA 4BQ0A 1AIBA 3KKIA 1GC2A 4BHDA 2JJEA 3IF2A 4XJMA 4WYDA 1W7NA 2XH1A 3D6KA 1QGNA 4E77A 2VMPA 1AMRA 3K28A 4WYEA 4GE7A 1YJYA 3FD0A 4IW7A 4XJOA 4MY5A 5M4BA 5DX5A 1AKAA 4IX8A 4RIZA 3DXWA 1SVVA 1GCKA 5FT8A 1I41A 2OKKA 1AJSB 1BQAA 1X29A 2DGLA 3RI6A 4ADCA 3ZZJA 2R5EA 5DJ1A 1C9CA 3GETA 5FT4A 4UOYA 4IY7A 2AY6A 2X5FA 3B46A 1VEFA 2JJHA 3LWSA 2D5YA 5F8VA 5AX8A 3E9KA 1AJRA 2Z1YA 1AHEA 4ZSWA 1AHFA 1AMQA 2W7LA 2VMSA 1D7UA 2DOUA 1G7XA 2JGTA 3RUYA 3W1HA 3F0HA 1BS0A 3DYDA 4IXOA 4MQQA 1AJSA 2YKVA 3W1IA 5D5SA 5C6UA 4WLHA 3PD6B 1IBJA 2AY5A 4J5UA 3WGBA 4Q76A 3MBBA 4L0OA 4M2KA 3E2ZB 3FTBA 2AY9A 5EFSA 2YHKA 3GWPA 2R2NA 2BWOA 1IJIA 4E1OA 1PMOA 3PPLA 2DKJA 4ZAHA 5D95A 1B4XA 2OGEA 1U08A 4RITA 1WYTB 3AATA 5G2PA 3CQ5A 1JS3A 2BWPA 1Z3ZA 4AZKA 2CH1A 2X5DA 3PD6A 3PA9A 2HOXA 4PVFA 3OP7A 5DB5A 2CSTA 3A9ZA 4AZJA 2FNUA 3FSLA 1BJOA 2VGUA 4IXZA 4U2HA 3VK2A 4HF8A 1N2TA 2Z1ZA 4J8LA 1P3WA 1SPAA 1BW0A 1ZC9A 2V0YA 1TOIA 5JAYA 2W7KA 1BQDA 1UU0A 5F9SA 4GE9A 3FFHA 1ARHA 4XJLA 3MC6C 1WYTA 1AY8A 1BJ4A 3DZZA 1TOKA 3K7YA 3UE8A 2VGWA 1IUGA 4WBTA 2AY2A 1WSTA 5EUNA 2W7EA 3ISLA 2VMNA 1C7GA 1M7YA 3JWAA 2EZ1A 2AEVA 1DGDA 2VMQA 3JZLA 1D2FA 3HDOA 2CANA 5EUDA 3II0A 2VI8A 1KKPA 3EI9A
chains in the Genus database with same CATH topology
3EI7A 2W7GA 3BB8A 4RM1A 1SF2A 2D61A 4MGRA 1TOGA 4WYFA 1FG3A 2JJFA 3HMUA 3EIBA 3GJUA 1TOEA 2DGKA 3MAFB 4ITGA 4A0HA 1I48A 2BKWA 4E3QA 2W8JA 5BJ3A 4CVQA 2EPJA 3I5TA 3N5MA 1QJ5A 1WYUB 2O0RA 3MAUA 2ZSMA 4F5KA 1WYVB 2ZY3A 1YOOA 3HT4A 3LVJA 4XEWA 3GZDA 2FNIA 3QGUA 3UAKA 4DGTA 3E2YA 3AEPA 3CQ4A 4R2NA 1BJWA 4XJPA 3AEMA 4ZWVA 2QA3A 1GDEA 4HVKA 4W8IA 1G7WA 2CFBA 4M2MA 1MGVA 4LNLA 3LVLB 1D7SA 4AOAA 1OHYA 1VP4A 8AATA 3HQTA 2ZUKA 1Z7DA 2QBTA 1MLYA 1JF9A 3G0TA 4WXGA 1OXPA 3ACZA 3PDXA 7AATA 1CL1A 1WYUA 3ATHA 2YCNA 4AO9A 3E2FA 3AEJA 4JF1A 1DJ9A 1MDXA 4F5JA 4OMAA 3GR9A 4MSOA 1QJ3A 1YIZA 4RJ0A 1AKCA 3BV0A 2E54A 2D7YA 4LW4A 3CAIA 2BI3A 2Z20A 1ASBA 2EO5A 2VMRA 1AAWA 1RV3A 2W8WA 3DXVA 3JWBA 3HLMA 4A0GA 1MAQA 2BIEA 1IAXA 1TATA 2YKYA 4JEXA 4EB7A 1YJSA 2EH6A 3NU7A 3H14A 2Z67A 2E7UA 2Z61A 3DR4A 2WK8A 1CQ7A 2W7JA 1V2EA 2Z9XA 1H1CA 4RLGA 5G2QA 3E6GA 4JEVA 1N31A 1MAPA 5DJ9A 2OKJA 3BWNA 2VGSA 4GEBA 2VYCA 4UHOA 5I92A 4EU1A 3FVXA 4U1TA 3KGWA 4R8DA 4TN4A 5HDMA 3TATA 2FKIA 4OYTA 1N8PA 1ASMA 1ECXA 3CQ6A 2R0TA 2EYQA 3A9XA 3EI6A 3DC1A 3BCAA 4JE5D 3AOWA 4Y0DA 2VMUA 2W7IA 2XBNA 4ZWMA 2DKBA 4P7YA 1ASDA 1OHVA 1AX4A 2BIAA 2Q7WA 4JE5A 4ZDOA 4ZLVA 1C7NA 4M2JA 2AY7A 3NYTA 4BA5A 3EI8A 4OT8A 3NU8A 1LC7A 2CY8A 1TARA 2C0RA 5TF5A 3FZ6A 4ZDLA 4W1WA 1W7LA 3MEBA 3BN1A 4FFCA 5EQCA 3WLXA 1EQBA 5IWQA 1BJOB 1LK9A 1SZKA 2CTZA 1RVUA 4WYGA 5LHAA 1LW5A 2KFPA 3F9TA 3FDBA 1EG5A 4LC3A 4ZM4A 2D64A 1GBNA 2ZY2A 2YRIA 2O1BA 1AHXA 1M6SA 3WY7A 3N75A 1ZODA 3H7FA 1V72A 3NYUA 1XI9A 2C81A 3W1JA 4ZM3A 3VK4A 4WXBA 1MDZA 3UWCA 4F5MA 5G09A 3E77A 4F5FA 2C7TA 2QB3A 2Z9VA 4A00A 4E3RA 4R5FA 1CZCA 1LC8A 1JS6A 1QZ9A 4I8AA 3TQXA 4QGRA 2VIBA 3N4SA 1YNUA 4KYOA 1PG8A 1KKJA 3G7QA 1ASAA 4UHMA 5EUEA 1IX8A 3TCMA 1M0NA 2YOBA 4Q31A 2VMZA 2JG2A 3AOVA 3ZRPA 1V2DA 1DTYA 3DODA 2G6WA 1G4XA 2BHXA 3USFA 2BYJA 1C7OA 4Y0HA 2PB0A 4WD2A 1IVRA 1Y4IA 2VMWA 1FC4A 3FVSA 3I16A 2RFVA 1GEYA 3KE3A 3AEOA 1H0CA 4EMYA 3QBOA 1PFFA 4MKJA 3NUIA 2X3LA 2W7MA 5HXXA 2ORDA 4F4EA 1S07A 4MQRA 3H9XA 3N7NA 2CB1A 1RVYA 3EIAA 3N4XA 3BCBA 2GSAA 4JEWA 4UHNA 3WZFA 4EB5A 2VGTA 5EAAA 1M4NA 3NYSA 3IHJA 5G4JA 2BYLA 2VLHA 3FFRA 4Y0IA 3L44A 1J32A 4F5LA 1LC5A 5G0AA 2EGYA 3QHXA 1OHWA 2FM1A 1CS1A 2QMAA 3G8MA 4GRXA 1KMJA 4IYOB 2W7HA 1CZEA 3BWOA 2VGZA 3GBXA 2HP2A 2W8TA 3B1DA 3M5UA 3JW9A 2E7JA 2HZPA 3GZDC 2W8UA 4ISYA 4WP0A 3VP6A 5KTBA 4A6TA 1W3UA 4JEZA 3AEMC 2FQ6A 2D63A 3AENA 2CJHA 2QLRA 1LS3A 4W5KA 1D7VA 2AY1A 2HUFA 5M4DA 1O4SA 2HOZA 4IYOA 2FN6A 1CQ6A 3AEJC 1M0OA 4ZASA 1B5PA 3LVKA 5FT6A 3QPGA 2NMPA 3OKSA 2BWNA 4K05A 3ZZKA 3BS8A 2QSRA 2CINA 1M0PA 2BI2A 2W8VA 3A9YA 3GSBA 5E5IA 1DGEA 1JG8A 3JU7A 3COGA 2ZC0A 4WLJA 3NNKA 4OC9A 1AAMA 5E4ZA 2VMOA 4A72A 4OTLA 1ASNA 2D65A 3RCHA 1CL2A 2AEUA 2E7IA 4F5GA 3HL2A 1ASEA 1KL2A 1LW4A 1W23A 3NTJA 3JTXA 4PIWA 1BT4A 4XAUA 3ASAA 1ORDA 2YRRA 4ATQA 1SZSA 1X28A 2HUUA 3EZ1A 3DRDA 2FYFA 2WKAA 3RBFA 3BCXA 4CBRA 4F5HA 1VJOA 2Z9WA 4ADDA 3GZCA 2R5CB 3BWNC 3K40A 2VIAA 3PAAA 4RAEA 4FL0A 3N4RA 4UQVA 2GB3A 1UKJA 1AY4A 1KL1A 1SFFA 1W7MA 2AY8A 2GQNA 3R4TA 3WKSA 9AATA 4GE4A 2VMTA 1ARGA 1CQ8A 1GC0A 4F5IA 2X8UA 3RBLA 1KMKA 3ELEA 2F8JA 2GMSA 1MDOA 4K2BA 4Q6RA 1GC3A 5LH9A 4K2IA 3NX3A 2R5CA 4W91A 4LNMA 2VMXA 5J8QA 1O69A 1B9IA 4OCAA 1ASFA 3KGXA 3MADA 1DJEA 1X2AA 1C4KA 2CJGA 3PIUA 2V1PA 3FRKA 4EFFA 1UU2A 2ZJGA 1FG7A 2DGMA 2OQXA 2AY4A 4A6UA 3NRAA 4IXSA 4ATPA 2ZY4A 4PFNA 1LKCA 1GEWA 4H51A 2QB2A 2G7JA 2VI9A 4KAMA 2CJDA 3P1TA 2BI1A 2ZP7A 4ZSYA 4BA4A 1MLZA 4JF0A 4B9BA 2YKUA 2OGAA 4DQ6A 2ZSLA 5G4IA 3WKRA 4A0RA 1V2FA 4XQ2A 5HHYA 2VMYA 1S08A 1E5EA 3NUBA 4ADEA 4W1VA 1AIAA 3Q8NA 1I43A 3FVUA 1CJ0A 1YAAA 3B8XA 4XK1A 3TFTA 3PJ0A 4H63Q 1J04A 3WGCA 3LG0A 1OXOA 1TOJA 4OBVA 2VMVA 2YCPA 2BIGA 1YJZA 4A6RA 1AY5A 4TMRA 4PFFA 4Q75A 3MKJA 3EZSA 3F6TA 2HORA 1AMAA 3AELA 2BI5A 2HP1A 4BMKA 5M46A 1X0MA 3FQAA 1GEXA 4O6ZA 1ELQA 4ITXA 4MKKA 3I4JA 4GDYA 3P6KA 1IAYA 2D7ZA 2CH2A 3E2ZA 3NDNA 1EJIA 2AATA 1TPLA 2PO3A 2Z9UA 3CBFA 3N0LA 5EAVA 1S06A 4R5ZA 4WYAA 2BI9A 2A1VA 3PDBB 4CBSA 5EIGB 1OATA 3EUCA 2ZY5A 3EI5A 3FDDA 1B9HA 3AENB 1ASCA 1YIYA 2PB2A 3MC6A 3WX9A 1E5FA 3FKDA 4TV7A 1S0AA 3FQ8A 4ADBA 1BJNA 1ZOBA 5M49A 1AHGA 2W7DA 1C0NA 4WB0B 4B98A 3AV7A 3DR7A 4LNJA 4RJYA 1DFOA 1TASA 2VLFA 3VK3A 4CXQA 4WXFA 4WYCA 3QM2A 3FZ7A 3BC8A 3TFUA 3ASBA 1B5OA 3A2BA 1AMSA 4JEYA 3VOMA 3ZRQA 4AO4A 1B8GA 1QIRA 3PDBA 2C44A 3ECDA 4OBUA 3ELPA 3FQ7A 5EIGA 3RQ1A 4N0BA 1GD9A 3B1EA 4NOGA 1ARSA 2O7CA 4W1XA 2TPLA 2JJGA 3DU4A 2HUIA 3ZRRA 1SZUA 2HOYA 3R9AA 1AICA 1AKBA 3RCHB 4A0FA 1ASGA 1IX6A 2OATA 3B1CA 3QI6A 4WB0A 1GC4A 1I29A 3HVYA 4MQPA 2WK7A 2VGVA 4CXRA 4GSAA 2AY3A 1IX7A 1M32A 1ARTA 1WKGA 1WKHA 1D7RA 1XEYA 1QISA 3LY1A 3QN6A 3FZ8A 5FT5A 4LW2A 4N0WA 3A8UX 3WCOA 2YKXA 3HBXA 4AH3A 3FCRA 1T3IA 1ELUA 3L8AA 5BJ4A 1QITA 1PMMA 3MAFA 4KXKA 3VAXA 2D66A 2ZYJA 4DBCA 3WCNA 2EZ2A 3T32A 1ARIA 1DKAA 1WYVA 4K2MA 1O61A 3LVMA 1S09A 3PGYA 4P3MA 1BKGA 2W7FA 4RKCA 5E3KA 4ZDPA 1DJUA 1O62A 1M0QA 2DR1A 2YCTA 1RV4A 2WB6A 1ASLA 2JISA 2WK9A 2GMUA 1AHYA 5K8BA 3LV2A 1G4VA 1UU1A 4RKDA 4BQ0A 1AIBA 3KKIA 1GC2A 4BHDA 2JJEA 3IF2A 4XJMA 4WYDA 1W7NA 2XH1A 3D6KA 1QGNA 4E77A 2VMPA 1AMRA 3K28A 4WYEA 4GE7A 1YJYA 3FD0A 4IW7A 4XJOA 4MY5A 5M4BA 5DX5A 1AKAA 4IX8A 4RIZA 3DXWA 1SVVA 1GCKA 5FT8A 1I41A 2OKKA 1AJSB 1BQAA 1X29A 2DGLA 3RI6A 4ADCA 3ZZJA 2R5EA 5DJ1A 1C9CA 3GETA 5FT4A 4UOYA 4IY7A 2AY6A 2X5FA 3B46A 1VEFA 2JJHA 3LWSA 2D5YA 5F8VA 5AX8A 3E9KA 1AJRA 2Z1YA 1AHEA 4ZSWA 1AHFA 1AMQA 2W7LA 2VMSA 1D7UA 2DOUA 1G7XA 2JGTA 3RUYA 3W1HA 3F0HA 1BS0A 3DYDA 4IXOA 4MQQA 1AJSA 2YKVA 3W1IA 5D5SA 5C6UA 4WLHA 3PD6B 1IBJA 2AY5A 4J5UA 3WGBA 4Q76A 3MBBA 4L0OA 4M2KA 3E2ZB 3FTBA 2AY9A 5EFSA 2YHKA 3GWPA 2R2NA 2BWOA 1IJIA 4E1OA 1PMOA 3PPLA 2DKJA 4ZAHA 5D95A 1B4XA 2OGEA 1U08A 4RITA 1WYTB 3AATA 5G2PA 3CQ5A 1JS3A 2BWPA 1Z3ZA 4AZKA 2CH1A 2X5DA 3PD6A 3PA9A 2HOXA 4PVFA 3OP7A 5DB5A 2CSTA 3A9ZA 4AZJA 2FNUA 3FSLA 1BJOA 2VGUA 4IXZA 4U2HA 3VK2A 4HF8A 1N2TA 2Z1ZA 4J8LA 1P3WA 1SPAA 1BW0A 1ZC9A 2V0YA 1TOIA 5JAYA 2W7KA 1BQDA 1UU0A 5F9SA 4GE9A 3FFHA 1ARHA 4XJLA 3MC6C 1WYTA 1AY8A 1BJ4A 3DZZA 1TOKA 3K7YA 3UE8A 2VGWA 1IUGA 4WBTA 2AY2A 1WSTA 5EUNA 2W7EA 3ISLA 2VMNA 1C7GA 1M7YA 3JWAA 2EZ1A 2AEVA 1DGDA 2VMQA 3JZLA 1D2FA 3HDOA 2CANA 5EUDA 3II0A 2VI8A 1KKPA 3EI9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EI7 A;  2W7G A;  3BB8 A;  4RM1 A;  1SF2 A;  2D61 A;  4MGR A;  1TOG A;  4WYF A;  1FG3 A;  2JJF A;  3HMU A;  3EIB A;  3GJU A;  1TOE A;  2DGK A;  3MAF B;  4ITG A;  4A0H A;  1I48 A;  2BKW A;  4E3Q A;  2W8J A;  5BJ3 A;  4CVQ A;  2EPJ A;  3I5T A;  3N5M A;  1QJ5 A;  1WYU B;  2O0R A;  3MAU A;  2ZSM A;  4F5K A;  1WYV B;  2ZY3 A;  1YOO A;  3HT4 A;  3LVJ A;  4XEW A;  3GZD A;  2FNI A;  3QGU A;  3UAK A;  4DGT A;  3E2Y A;  3AEP A;  3CQ4 A;  4R2N A;  1BJW A;  4XJP A;  3AEM A;  4ZWV A;  2QA3 A;  1GDE A;  4HVK A;  4W8I A;  1G7W A;  2CFB A;  4M2M A;  1MGV A;  4LNL A;  3LVL B;  1D7S A;  4AOA A;  1OHY A;  1VP4 A;  8AAT A;  3HQT A;  2ZUK A;  1Z7D A;  2QBT A;  1MLY A;  1JF9 A;  3G0T A;  4WXG A;  1OXP A;  3ACZ A;  3PDX A;  7AAT A;  1CL1 A;  1WYU A;  3ATH A;  2YCN A;  4AO9 A;  3E2F A;  3AEJ A;  4JF1 A;  1DJ9 A;  1MDX A;  4F5J A;  4OMA A;  3GR9 A;  4MSO A;  1QJ3 A;  1YIZ A;  4RJ0 A;  1AKC A;  3BV0 A;  2E54 A;  2D7Y A;  4LW4 A;  3CAI A;  2BI3 A;  2Z20 A;  1ASB A;  2EO5 A;  2VMR A;  1AAW A;  1RV3 A;  2W8W A;  3DXV A;  3JWB A;  3HLM A;  4A0G A;  1MAQ A;  2BIE A;  1IAX A;  1TAT A;  2YKY A;  4JEX A;  4EB7 A;  1YJS A;  2EH6 A;  3NU7 A;  3H14 A;  2Z67 A;  2E7U A;  2Z61 A;  3DR4 A;  2WK8 A;  1CQ7 A;  2W7J A;  1V2E A;  2Z9X A;  1H1C A;  4RLG A;  5G2Q A;  3E6G A;  4JEV A;  1N31 A;  1MAP A;  5DJ9 A;  2OKJ A;  3BWN A;  2VGS A;  4GEB A;  2VYC A;  4UHO A;  5I92 A;  4EU1 A;  3FVX A;  4U1T A;  3KGW A;  4R8D A;  4TN4 A;  5HDM A;  3TAT A;  4OYT A;  1N8P A;  1ASM A;  1ECX A;  3CQ6 A;  2R0T A;  3A9X A;  3EI6 A;  3DC1 A;  3BCA A;  4JE5 D;  3AOW A;  4Y0D A;  2VMU A;  2W7I A;  2XBN A;  4ZWM A;  2DKB A;  4P7Y A;  1ASD A;  1OHV A;  1AX4 A;  2BIA A;  2Q7W A;  4JE5 A;  4ZDO A;  4ZLV A;  1C7N A;  4M2J A;  2AY7 A;  3NYT A;  4BA5 A;  3EI8 A;  4OT8 A;  3NU8 A;  1LC7 A;  2CY8 A;  1TAR A;  2C0R A;  5TF5 A;  3FZ6 A;  4ZDL A;  4W1W A;  1W7L A;  3MEB A;  3BN1 A;  4FFC A;  5EQC A;  3WLX A;  1EQB A;  5IWQ A;  1BJO B;  1LK9 A;  1SZK A;  2CTZ A;  1RVU A;  4WYG A;  5LHA A;  1LW5 A;  3F9T A;  3FDB A;  1EG5 A;  4LC3 A;  4ZM4 A;  2D64 A;  1GBN A;  2ZY2 A;  2YRI A;  2O1B A;  1AHX A;  1M6S A;  3WY7 A;  3N75 A;  1ZOD A;  3H7F A;  1V72 A;  3NYU A;  1XI9 A;  2C81 A;  3W1J A;  4ZM3 A;  3VK4 A;  4WXB A;  1MDZ A;  3UWC A;  4F5M A;  5G09 A;  3E77 A;  4F5F A;  2C7T A;  2QB3 A;  2Z9V A;  4A00 A;  4E3R A;  4R5F A;  1CZC A;  1LC8 A;  1JS6 A;  1QZ9 A;  4I8A A;  3TQX A;  4QGR A;  2VIB A;  1YNU A;  4KYO A;  1PG8 A;  1KKJ A;  3G7Q A;  1ASA A;  4UHM A;  5EUE A;  1IX8 A;  3TCM A;  1M0N A;  2YOB A;  4Q31 A;  2VMZ A;  2JG2 A;  3AOV A;  3ZRP A;  1V2D A;  1DTY A;  3DOD A;  2G6W A;  1G4X A;  2BHX A;  3USF A;  2BYJ A;  1C7O A;  4Y0H A;  2PB0 A;  4WD2 A;  1IVR A;  1Y4I A;  2VMW A;  1FC4 A;  3FVS A;  3I16 A;  2RFV A;  1GEY A;  3KE3 A;  3AEO A;  1H0C A;  4EMY A;  3QBO A;  1PFF A;  4MKJ A;  3NUI A;  2X3L A;  2W7M A;  5HXX A;  2ORD A;  4F4E A;  1S07 A;  4MQR A;  2CB1 A;  1RVY A;  3EIA A;  3BCB A;  2GSA A;  4JEW A;  4UHN A;  3WZF A;  4EB5 A;  2VGT A;  5EAA A;  1M4N A;  3NYS A;  3IHJ A;  5G4J A;  2BYL A;  2VLH A;  3FFR A;  4Y0I A;  3L44 A;  1J32 A;  4F5L A;  1LC5 A;  5G0A A;  2EGY A;  3QHX A;  1OHW A;  2FM1 A;  1CS1 A;  2QMA A;  3G8M A;  4GRX A;  1KMJ A;  4IYO B;  2W7H A;  1CZE A;  3BWO A;  2VGZ A;  3GBX A;  2HP2 A;  2W8T A;  3B1D A;  3M5U A;  3JW9 A;  2E7J A;  2HZP A;  3GZD C;  2W8U A;  4ISY A;  4WP0 A;  3VP6 A;  4A6T A;  1W3U A;  4JEZ A;  3AEM C;  2FQ6 A;  2D63 A;  3AEN A;  2CJH A;  2QLR A;  1LS3 A;  4W5K A;  1D7V A;  2AY1 A;  2HUF A;  5M4D A;  1O4S A;  2HOZ A;  4IYO A;  2FN6 A;  1CQ6 A;  3AEJ C;  1M0O A;  4ZAS A;  1B5P A;  3LVK A;  5FT6 A;  3QPG A;  2NMP A;  3OKS A;  2BWN A;  3ZZK A;  3BS8 A;  2CIN A;  1M0P A;  2BI2 A;  2W8V A;  3A9Y A;  3GSB A;  5E5I A;  1DGE A;  1JG8 A;  3JU7 A;  3COG A;  2ZC0 A;  4WLJ A;  3NNK A;  4OC9 A;  1AAM A;  5E4Z A;  2VMO A;  4A72 A;  4OTL A;  1ASN A;  2D65 A;  3RCH A;  1CL2 A;  2AEU A;  2E7I A;  4F5G A;  3HL2 A;  1ASE A;  1KL2 A;  1LW4 A;  1W23 A;  3NTJ A;  3JTX A;  4PIW A;  1BT4 A;  4XAU A;  3ASA A;  1ORD A;  2YRR A;  4ATQ A;  1SZS A;  1X28 A;  2HUU A;  3EZ1 A;  3DRD A;  2FYF A;  2WKA A;  3RBF A;  3BCX A;  4CBR A;  4F5H A;  1VJO A;  2Z9W A;  4ADD A;  3GZC A;  2R5C B;  3BWN C;  3K40 A;  2VIA A;  3PAA A;  4RAE A;  4FL0 A;  4UQV A;  2GB3 A;  1UKJ A;  1AY4 A;  1KL1 A;  1SFF A;  1W7M A;  2AY8 A;  2GQN A;  3R4T A;  3WKS A;  9AAT A;  4GE4 A;  2VMT A;  1ARG A;  1CQ8 A;  1GC0 A;  4F5I A;  2X8U A;  3RBL A;  1KMK A;  3ELE A;  2F8J A;  2GMS A;  1MDO A;  4K2B A;  4Q6R A;  1GC3 A;  5LH9 A;  4K2I A;  3NX3 A;  2R5C A;  4W91 A;  4LNM A;  2VMX A;  5J8Q A;  1O69 A;  1B9I A;  4OCA A;  1ASF A;  3KGX A;  3MAD A;  1DJE A;  1X2A A;  1C4K A;  2CJG A;  3PIU A;  2V1P A;  3FRK A;  4EFF A;  1UU2 A;  2ZJG A;  1FG7 A;  2DGM A;  2OQX A;  2AY4 A;  4A6U A;  3NRA A;  4IXS A;  4ATP A;  2ZY4 A;  4PFN A;  1LKC A;  1GEW A;  4H51 A;  2QB2 A;  2VI9 A;  4KAM A;  2CJD A;  3P1T A;  2BI1 A;  2ZP7 A;  4ZSY A;  4BA4 A;  1MLZ A;  4JF0 A;  4B9B A;  2YKU A;  2OGA A;  4DQ6 A;  2ZSL A;  5G4I A;  3WKR A;  4A0R A;  1V2F A;  4XQ2 A;  5HHY A;  2VMY A;  1S08 A;  1E5E A;  3NUB A;  4ADE A;  4W1V A;  1AIA A;  3Q8N A;  1I43 A;  3FVU A;  1CJ0 A;  1YAA A;  3B8X A;  4XK1 A;  3TFT A;  3PJ0 A;  1J04 A;  3WGC A;  3LG0 A;  1OXO A;  1TOJ A;  4OBV A;  2VMV A;  2YCP A;  2BIG A;  1YJZ A;  4A6R A;  1AY5 A;  4TMR A;  4PFF A;  4Q75 A;  3MKJ A;  3EZS A;  3F6T A;  2HOR A;  1AMA A;  3AEL A;  2BI5 A;  2HP1 A;  4BMK A;  5M46 A;  1X0M A;  3FQA A;  1GEX A;  4O6Z A;  1ELQ A;  4ITX A;  4MKK A;  3I4J A;  4GDY A;  3P6K A;  1IAY A;  2D7Z A;  2CH2 A;  3E2Z A;  3NDN A;  1EJI A;  2AAT A;  1TPL A;  2PO3 A;  2Z9U A;  3CBF A;  3N0L A;  5EAV A;  1S06 A;  4R5Z A;  4WYA A;  2BI9 A;  3PDB B;  4CBS A;  5EIG B;  1OAT A;  3EUC A;  2ZY5 A;  3EI5 A;  3FDD A;  1B9H A;  3AEN B;  1ASC A;  1YIY A;  2PB2 A;  3MC6 A;  3WX9 A;  1E5F A;  3FKD A;  4TV7 A;  1S0A A;  3FQ8 A;  4ADB A;  1BJN A;  1ZOB A;  5M49 A;  1AHG A;  2W7D A;  1C0N A;  4WB0 B;  4B98 A;  3AV7 A;  3DR7 A;  4LNJ A;  4RJY A;  1DFO A;  1TAS A;  2VLF A;  3VK3 A;  4CXQ A;  4WXF A;  4WYC A;  3QM2 A;  3FZ7 A;  3BC8 A;  3TFU A;  3ASB A;  1B5O A;  3A2B A;  1AMS A;  4JEY A;  3VOM A;  3ZRQ A;  4AO4 A;  1B8G A;  1QIR A;  3PDB A;  2C44 A;  3ECD A;  4OBU A;  3ELP A;  3FQ7 A;  5EIG A;  3RQ1 A;  4N0B A;  1GD9 A;  3B1E A;  4NOG A;  1ARS A;  2O7C A;  4W1X A;  2TPL A;  2JJG A;  3DU4 A;  2HUI A;  3ZRR A;  1SZU A;  2HOY A;  3R9A A;  1AIC A;  1AKB A;  3RCH B;  4A0F A;  1ASG A;  1IX6 A;  2OAT A;  3B1C A;  3QI6 A;  4WB0 A;  1GC4 A;  1I29 A;  3HVY A;  4MQP A;  2WK7 A;  2VGV A;  4CXR A;  4GSA A;  2AY3 A;  1IX7 A;  1M32 A;  1ART A;  1WKG A;  1WKH A;  1D7R A;  1XEY A;  1QIS A;  3LY1 A;  3QN6 A;  3FZ8 A;  5FT5 A;  4LW2 A;  4N0W A;  3A8U X;  3WCO A;  2YKX A;  3HBX A;  4AH3 A;  3FCR A;  1T3I A;  1ELU A;  3L8A A;  5BJ4 A;  1QIT A;  1PMM A;  3MAF A;  4KXK A;  3VAX A;  2D66 A;  2ZYJ A;  4DBC A;  3WCN A;  2EZ2 A;  3T32 A;  1ARI A;  1DKA A;  1WYV A;  4K2M A;  1O61 A;  3LVM A;  1S09 A;  3PGY A;  4P3M A;  1BKG A;  2W7F A;  4RKC A;  5E3K A;  4ZDP A;  1DJU A;  1O62 A;  1M0Q A;  2DR1 A;  2YCT A;  1RV4 A;  1ASL A;  2JIS A;  2WK9 A;  2GMU A;  1AHY A;  5K8B A;  3LV2 A;  1G4V A;  1UU1 A;  4RKD A;  4BQ0 A;  1AIB A;  3KKI A;  1GC2 A;  4BHD A;  2JJE A;  3IF2 A;  4XJM A;  4WYD A;  1W7N A;  2XH1 A;  3D6K A;  1QGN A;  4E77 A;  2VMP A;  1AMR A;  3K28 A;  4WYE A;  4GE7 A;  1YJY A;  3FD0 A;  4IW7 A;  4XJO A;  4MY5 A;  5M4B A;  5DX5 A;  1AKA A;  4IX8 A;  4RIZ A;  3DXW A;  1SVV A;  1GCK A;  5FT8 A;  1I41 A;  2OKK A;  1AJS B;  1BQA A;  1X29 A;  2DGL A;  3RI6 A;  4ADC A;  3ZZJ A;  2R5E A;  5DJ1 A;  1C9C A;  3GET A;  5FT4 A;  4UOY A;  4IY7 A;  2AY6 A;  2X5F A;  3B46 A;  1VEF A;  2JJH A;  3LWS A;  2D5Y A;  5F8V A;  5AX8 A;  3E9K A;  1AJR A;  2Z1Y A;  1AHE A;  4ZSW A;  1AHF A;  1AMQ A;  2W7L A;  2VMS A;  1D7U A;  2DOU A;  1G7X A;  2JGT A;  3RUY A;  3W1H A;  3F0H A;  1BS0 A;  3DYD A;  4IXO A;  4MQQ A;  1AJS A;  2YKV A;  3W1I A;  5D5S A;  5C6U A;  4WLH A;  3PD6 B;  1IBJ A;  2AY5 A;  4J5U A;  3WGB A;  4Q76 A;  3MBB A;  4L0O A;  4M2K A;  3E2Z B;  3FTB A;  2AY9 A;  5EFS A;  2YHK A;  3GWP A;  2R2N A;  2BWO A;  1IJI A;  4E1O A;  1PMO A;  3PPL A;  2DKJ A;  4ZAH A;  5D95 A;  1B4X A;  2OGE A;  1U08 A;  4RIT A;  1WYT B;  3AAT A;  5G2P A;  3CQ5 A;  1JS3 A;  2BWP A;  1Z3Z A;  4AZK A;  2CH1 A;  2X5D A;  3PD6 A;  3PA9 A;  2HOX A;  4PVF A;  3OP7 A;  5DB5 A;  2CST A;  3A9Z A;  4AZJ A;  2FNU A;  3FSL A;  1BJO A;  2VGU A;  4IXZ A;  4U2H A;  3VK2 A;  4HF8 A;  1N2T A;  2Z1Z A;  4J8L A;  1P3W A;  1SPA A;  1BW0 A;  1ZC9 A;  2V0Y A;  1TOI A;  5JAY A;  2W7K A;  1BQD A;  1UU0 A;  5F9S A;  4GE9 A;  3FFH A;  1ARH A;  4XJL A;  3MC6 C;  1WYT A;  1AY8 A;  1BJ4 A;  3DZZ A;  1TOK A;  3K7Y A;  3UE8 A;  2VGW A;  1IUG A;  4WBT A;  2AY2 A;  1WST A;  5EUN A;  2W7E A;  3ISL A;  2VMN A;  1C7G A;  1M7Y A;  3JWA A;  2EZ1 A;  2AEV A;  1DGD A;  2VMQ A;  3JZL A;  1D2F A;  3HDO A;  2CAN A;  5EUD A;  3II0 A;  2VI8 A;  1KKP A;  3EI9 A; 
#chains in the Genus database with same CATH topology
 3EI7 A;  2W7G A;  3BB8 A;  4RM1 A;  1SF2 A;  2D61 A;  4MGR A;  1TOG A;  4WYF A;  1FG3 A;  2JJF A;  3HMU A;  3EIB A;  3GJU A;  1TOE A;  2DGK A;  3MAF B;  4ITG A;  4A0H A;  1I48 A;  2BKW A;  4E3Q A;  2W8J A;  5BJ3 A;  4CVQ A;  2EPJ A;  3I5T A;  3N5M A;  1QJ5 A;  1WYU B;  2O0R A;  3MAU A;  2ZSM A;  4F5K A;  1WYV B;  2ZY3 A;  1YOO A;  3HT4 A;  3LVJ A;  4XEW A;  3GZD A;  2FNI A;  3QGU A;  3UAK A;  4DGT A;  3E2Y A;  3AEP A;  3CQ4 A;  4R2N A;  1BJW A;  4XJP A;  3AEM A;  4ZWV A;  2QA3 A;  1GDE A;  4HVK A;  4W8I A;  1G7W A;  2CFB A;  4M2M A;  1MGV A;  4LNL A;  3LVL B;  1D7S A;  4AOA A;  1OHY A;  1VP4 A;  8AAT A;  3HQT A;  2ZUK A;  1Z7D A;  2QBT A;  1MLY A;  1JF9 A;  3G0T A;  4WXG A;  1OXP A;  3ACZ A;  3PDX A;  7AAT A;  1CL1 A;  1WYU A;  3ATH A;  2YCN A;  4AO9 A;  3E2F A;  3AEJ A;  4JF1 A;  1DJ9 A;  1MDX A;  4F5J A;  4OMA A;  3GR9 A;  4MSO A;  1QJ3 A;  1YIZ A;  4RJ0 A;  1AKC A;  3BV0 A;  2E54 A;  2D7Y A;  4LW4 A;  3CAI A;  2BI3 A;  2Z20 A;  1ASB A;  2EO5 A;  2VMR A;  1AAW A;  1RV3 A;  2W8W A;  3DXV A;  3JWB A;  3HLM A;  4A0G A;  1MAQ A;  2BIE A;  1IAX A;  1TAT A;  2YKY A;  4JEX A;  4EB7 A;  1YJS A;  2EH6 A;  3NU7 A;  3H14 A;  2Z67 A;  2E7U A;  2Z61 A;  3DR4 A;  2WK8 A;  1CQ7 A;  2W7J A;  1V2E A;  2Z9X A;  1H1C A;  4RLG A;  5G2Q A;  3E6G A;  4JEV A;  1N31 A;  1MAP A;  5DJ9 A;  2OKJ A;  3BWN A;  2VGS A;  4GEB A;  2VYC A;  4UHO A;  5I92 A;  4EU1 A;  3FVX A;  4U1T A;  3KGW A;  4R8D A;  4TN4 A;  5HDM A;  3TAT A;  2FKI A;  4OYT A;  1N8P A;  1ASM A;  1ECX A;  3CQ6 A;  2R0T A;  2EYQ A;  3A9X A;  3EI6 A;  3DC1 A;  3BCA A;  4JE5 D;  3AOW A;  4Y0D A;  2VMU A;  2W7I A;  2XBN A;  4ZWM A;  2DKB A;  4P7Y A;  1ASD A;  1OHV A;  1AX4 A;  2BIA A;  2Q7W A;  4JE5 A;  4ZDO A;  4ZLV A;  1C7N A;  4M2J A;  2AY7 A;  3NYT A;  4BA5 A;  3EI8 A;  4OT8 A;  3NU8 A;  1LC7 A;  2CY8 A;  1TAR A;  2C0R A;  5TF5 A;  3FZ6 A;  4ZDL A;  4W1W A;  1W7L A;  3MEB A;  3BN1 A;  4FFC A;  5EQC A;  3WLX A;  1EQB A;  5IWQ A;  1BJO B;  1LK9 A;  1SZK A;  2CTZ A;  1RVU A;  4WYG A;  5LHA A;  1LW5 A;  2KFP A;  3F9T A;  3FDB A;  1EG5 A;  4LC3 A;  4ZM4 A;  2D64 A;  1GBN A;  2ZY2 A;  2YRI A;  2O1B A;  1AHX A;  1M6S A;  3WY7 A;  3N75 A;  1ZOD A;  3H7F A;  1V72 A;  3NYU A;  1XI9 A;  2C81 A;  3W1J A;  4ZM3 A;  3VK4 A;  4WXB A;  1MDZ A;  3UWC A;  4F5M A;  5G09 A;  3E77 A;  4F5F A;  2C7T A;  2QB3 A;  2Z9V A;  4A00 A;  4E3R A;  4R5F A;  1CZC A;  1LC8 A;  1JS6 A;  1QZ9 A;  4I8A A;  3TQX A;  1KAF A;  4QGR A;  2VIB A;  3N4S A;  1YNU A;  4KYO A;  1PG8 A;  1KKJ A;  3G7Q A;  1ASA A;  4UHM A;  5EUE A;  1IX8 A;  3TCM A;  1M0N A;  2YOB A;  4Q31 A;  2VMZ A;  2JG2 A;  3AOV A;  3ZRP A;  1V2D A;  1DTY A;  3DOD A;  2G6W A;  1G4X A;  2BHX A;  3USF A;  2BYJ A;  1C7O A;  4Y0H A;  2PB0 A;  4WD2 A;  1IVR A;  1Y4I A;  2VMW A;  1FC4 A;  3FVS A;  3I16 A;  2RFV A;  1GEY A;  3KE3 A;  3AEO A;  1H0C A;  4EMY A;  3QBO A;  1PFF A;  4MKJ A;  3NUI A;  2X3L A;  2W7M A;  5HXX A;  2ORD A;  4F4E A;  1S07 A;  4MQR A;  3H9X A;  3N7N A;  2CB1 A;  1RVY A;  3EIA A;  3N4X A;  3BCB A;  2GSA A;  4JEW A;  4UHN A;  3WZF A;  4EB5 A;  2VGT A;  5EAA A;  1M4N A;  3NYS A;  3IHJ A;  5G4J A;  2BYL A;  2VLH A;  3FFR A;  4Y0I A;  3L44 A;  1J32 A;  4F5L A;  1LC5 A;  5G0A A;  2EGY A;  3QHX A;  1OHW A;  2FM1 A;  1CS1 A;  2QMA A;  3G8M A;  4GRX A;  1KMJ A;  4IYO B;  2W7H A;  1CZE A;  3BWO A;  2VGZ A;  3GBX A;  2HP2 A;  2W8T A;  3B1D A;  3M5U A;  3JW9 A;  2E7J A;  2HZP A;  3GZD C;  2W8U A;  4ISY A;  4WP0 A;  3VP6 A;  5KTB A;  4A6T A;  1W3U A;  4JEZ A;  3AEM C;  2FQ6 A;  2D63 A;  3AEN A;  2CJH A;  2QLR A;  1LS3 A;  4W5K A;  1D7V A;  2AY1 A;  2HUF A;  5M4D A;  1O4S A;  2HOZ A;  4IYO A;  2FN6 A;  1CQ6 A;  3AEJ C;  1M0O A;  4ZAS A;  1B5P A;  3LVK A;  5FT6 A;  3QPG A;  2NMP A;  3OKS A;  2BWN A;  4K05 A;  3ZZK A;  3BS8 A;  2QSR A;  2CIN A;  1M0P A;  2BI2 A;  2W8V A;  3A9Y A;  3GSB A;  5E5I A;  1DGE A;  1JG8 A;  3JU7 A;  3COG A;  2ZC0 A;  4WLJ A;  3NNK A;  4OC9 A;  1AAM A;  5E4Z A;  2VMO A;  4A72 A;  4OTL A;  1ASN A;  2D65 A;  3RCH A;  1CL2 A;  2AEU A;  2E7I A;  4F5G A;  3HL2 A;  1ASE A;  1KL2 A;  1LW4 A;  1W23 A;  3NTJ A;  3JTX A;  4PIW A;  1BT4 A;  4XAU A;  3ASA A;  1ORD A;  2YRR A;  4ATQ A;  1SZS A;  1X28 A;  2HUU A;  3EZ1 A;  3DRD A;  2FYF A;  2WKA A;  3RBF A;  3BCX A;  4CBR A;  4F5H A;  1VJO A;  2Z9W A;  4ADD A;  3GZC A;  2R5C B;  3BWN C;  3K40 A;  2VIA A;  3PAA A;  4RAE A;  4FL0 A;  3N4R A;  4UQV A;  2GB3 A;  1UKJ A;  1AY4 A;  1KL1 A;  1SFF A;  1W7M A;  2AY8 A;  2GQN A;  3R4T A;  3WKS A;  9AAT A;  4GE4 A;  2VMT A;  1ARG A;  1CQ8 A;  1GC0 A;  4F5I A;  2X8U A;  3RBL A;  1KMK A;  3ELE A;  2F8J A;  2GMS A;  1MDO A;  4K2B A;  4Q6R A;  1GC3 A;  5LH9 A;  4K2I A;  3NX3 A;  2R5C A;  4W91 A;  4LNM A;  2VMX A;  5J8Q A;  1O69 A;  1B9I A;  4OCA A;  1ASF A;  3KGX A;  3MAD A;  1DJE A;  1X2A A;  1C4K A;  2CJG A;  3PIU A;  2V1P A;  3FRK A;  4EFF A;  1UU2 A;  2ZJG A;  1FG7 A;  2DGM A;  2OQX A;  2AY4 A;  4A6U A;  3NRA A;  4IXS A;  4ATP A;  2ZY4 A;  4PFN A;  1LKC A;  1GEW A;  4H51 A;  2QB2 A;  2G7J A;  2VI9 A;  4KAM A;  2CJD A;  3P1T A;  2BI1 A;  2ZP7 A;  4ZSY A;  4BA4 A;  1MLZ A;  4JF0 A;  4B9B A;  2YKU A;  2OGA A;  4DQ6 A;  2ZSL A;  5G4I A;  3WKR A;  4A0R A;  1V2F A;  4XQ2 A;  5HHY A;  2VMY A;  1S08 A;  1E5E A;  3NUB A;  4ADE A;  4W1V A;  1AIA A;  3Q8N A;  1I43 A;  3FVU A;  1CJ0 A;  1YAA A;  3B8X A;  4XK1 A;  3TFT A;  3PJ0 A;  4H63 Q;  1J04 A;  3WGC A;  3LG0 A;  1OXO A;  1TOJ A;  4OBV A;  2VMV A;  2YCP A;  2BIG A;  1YJZ A;  4A6R A;  1AY5 A;  4TMR A;  4PFF A;  4Q75 A;  3MKJ A;  3EZS A;  3F6T A;  2HOR A;  1AMA A;  3AEL A;  2BI5 A;  2HP1 A;  4BMK A;  5M46 A;  1X0M A;  3FQA A;  1GEX A;  4O6Z A;  1ELQ A;  4ITX A;  4MKK A;  3I4J A;  4GDY A;  3P6K A;  1IAY A;  2D7Z A;  2CH2 A;  3E2Z A;  3NDN A;  1EJI A;  2AAT A;  1TPL A;  2PO3 A;  2Z9U A;  3CBF A;  3N0L A;  5EAV A;  1S06 A;  4R5Z A;  4WYA A;  2BI9 A;  2A1V A;  3PDB B;  4CBS A;  5EIG B;  1OAT A;  3EUC A;  2ZY5 A;  3EI5 A;  3FDD A;  1B9H A;  3AEN B;  1ASC A;  1YIY A;  2PB2 A;  3MC6 A;  3WX9 A;  1E5F A;  3FKD A;  4TV7 A;  1S0A A;  3FQ8 A;  4ADB A;  1BJN A;  1ZOB A;  5M49 A;  1AHG A;  2W7D A;  1C0N A;  4WB0 B;  4B98 A;  3AV7 A;  3DR7 A;  4LNJ A;  4RJY A;  1DFO A;  1TAS A;  2VLF A;  3VK3 A;  4CXQ A;  4WXF A;  4WYC A;  3QM2 A;  3FZ7 A;  3BC8 A;  3TFU A;  3ASB A;  1B5O A;  3A2B A;  1AMS A;  4JEY A;  3VOM A;  3ZRQ A;  4AO4 A;  1B8G A;  1QIR A;  3PDB A;  2C44 A;  3ECD A;  4OBU A;  3ELP A;  3FQ7 A;  5EIG A;  3RQ1 A;  4N0B A;  1GD9 A;  3B1E A;  4NOG A;  1ARS A;  2O7C A;  4W1X A;  2TPL A;  2JJG A;  3DU4 A;  2HUI A;  3ZRR A;  1SZU A;  2HOY A;  3R9A A;  1AIC A;  1AKB A;  3RCH B;  4A0F A;  1ASG A;  1IX6 A;  2OAT A;  3B1C A;  3QI6 A;  4WB0 A;  1GC4 A;  1I29 A;  3HVY A;  4MQP A;  2WK7 A;  2VGV A;  4CXR A;  4GSA A;  2AY3 A;  1IX7 A;  1M32 A;  1ART A;  1WKG A;  1WKH A;  1D7R A;  1XEY A;  1QIS A;  3LY1 A;  3QN6 A;  3FZ8 A;  5FT5 A;  4LW2 A;  4N0W A;  3A8U X;  3WCO A;  2YKX A;  3HBX A;  4AH3 A;  3FCR A;  1T3I A;  1ELU A;  3L8A A;  5BJ4 A;  1QIT A;  1PMM A;  3MAF A;  4KXK A;  3VAX A;  2D66 A;  2ZYJ A;  4DBC A;  3WCN A;  2EZ2 A;  3T32 A;  1ARI A;  1DKA A;  1WYV A;  4K2M A;  1O61 A;  3LVM A;  1S09 A;  3PGY A;  4P3M A;  1BKG A;  2W7F A;  4RKC A;  5E3K A;  4ZDP A;  1DJU A;  1O62 A;  1M0Q A;  2DR1 A;  2YCT A;  1RV4 A;  2WB6 A;  1ASL A;  2JIS A;  2WK9 A;  2GMU A;  1AHY A;  5K8B A;  3LV2 A;  1G4V A;  1UU1 A;  4RKD A;  4BQ0 A;  1AIB A;  3KKI A;  1GC2 A;  4BHD A;  2JJE A;  3IF2 A;  4XJM A;  4WYD A;  1W7N A;  2XH1 A;  3D6K A;  1QGN A;  4E77 A;  2VMP A;  1AMR A;  3K28 A;  4WYE A;  4GE7 A;  1YJY A;  3FD0 A;  4IW7 A;  4XJO A;  4MY5 A;  5M4B A;  5DX5 A;  1AKA A;  4IX8 A;  4RIZ A;  3DXW A;  1SVV A;  1GCK A;  5FT8 A;  1I41 A;  2OKK A;  1AJS B;  1BQA A;  1X29 A;  2DGL A;  3RI6 A;  4ADC A;  3ZZJ A;  2R5E A;  5DJ1 A;  1C9C A;  3GET A;  5FT4 A;  4UOY A;  4IY7 A;  2AY6 A;  2X5F A;  3B46 A;  1VEF A;  2JJH A;  3LWS A;  2D5Y A;  5F8V A;  5AX8 A;  3E9K A;  1AJR A;  2Z1Y A;  1AHE A;  4ZSW A;  1AHF A;  1AMQ A;  2W7L A;  2VMS A;  1D7U A;  2DOU A;  1G7X A;  2JGT A;  3RUY A;  3W1H A;  3F0H A;  1BS0 A;  3DYD A;  4IXO A;  4MQQ A;  1AJS A;  2YKV A;  3W1I A;  5D5S A;  5C6U A;  4WLH A;  3PD6 B;  1IBJ A;  2AY5 A;  4J5U A;  3WGB A;  4Q76 A;  3MBB A;  4L0O A;  4M2K A;  3E2Z B;  3FTB A;  2AY9 A;  5EFS A;  2YHK A;  3GWP A;  2R2N A;  2BWO A;  1IJI A;  4E1O A;  1PMO A;  3PPL A;  2DKJ A;  4ZAH A;  5D95 A;  1B4X A;  2OGE A;  1U08 A;  4RIT A;  1WYT B;  3AAT A;  5G2P A;  3CQ5 A;  1JS3 A;  2BWP A;  1Z3Z A;  4AZK A;  2CH1 A;  2X5D A;  3PD6 A;  3PA9 A;  2HOX A;  4PVF A;  3OP7 A;  5DB5 A;  2CST A;  3A9Z A;  4AZJ A;  2FNU A;  3FSL A;  1BJO A;  2VGU A;  4IXZ A;  4U2H A;  3VK2 A;  4HF8 A;  1N2T A;  2Z1Z A;  4J8L A;  1P3W A;  1SPA A;  1BW0 A;  1ZC9 A;  2V0Y A;  1TOI A;  5JAY A;  2W7K A;  1BQD A;  1UU0 A;  5F9S A;  4GE9 A;  3FFH A;  1ARH A;  4XJL A;  3MC6 C;  1WYT A;  1AY8 A;  1BJ4 A;  3DZZ A;  1TOK A;  3K7Y A;  3UE8 A;  2VGW A;  1IUG A;  4WBT A;  2AY2 A;  1WST A;  5EUN A;  2W7E A;  3ISL A;  2VMN A;  1C7G A;  1M7Y A;  3JWA A;  2EZ1 A;  2AEV A;  1DGD A;  2VMQ A;  3JZL A;  1D2F A;  3HDO A;  2CAN A;  5EUD A;  3II0 A;  2VI8 A;  1KKP A;  3EI9 A; 
#chains in the Genus database with same CATH homology
 3EI7 A;  2W7G A;  3BB8 A;  4RM1 A;  1SF2 A;  2D61 A;  4MGR A;  1TOG A;  4WYF A;  1FG3 A;  2JJF A;  3HMU A;  3EIB A;  3GJU A;  1TOE A;  2DGK A;  3MAF B;  4ITG A;  4A0H A;  1I48 A;  2BKW A;  4E3Q A;  2W8J A;  5BJ3 A;  4CVQ A;  2EPJ A;  3I5T A;  3N5M A;  1QJ5 A;  1WYU B;  2O0R A;  3MAU A;  2ZSM A;  4F5K A;  1WYV B;  2ZY3 A;  1YOO A;  3HT4 A;  3LVJ A;  4XEW A;  3GZD A;  2FNI A;  3QGU A;  3UAK A;  4DGT A;  3E2Y A;  3AEP A;  3CQ4 A;  4R2N A;  1BJW A;  4XJP A;  3AEM A;  4ZWV A;  2QA3 A;  1GDE A;  4HVK A;  4W8I A;  1G7W A;  2CFB A;  4M2M A;  1MGV A;  4LNL A;  3LVL B;  1D7S A;  4AOA A;  1OHY A;  1VP4 A;  8AAT A;  3HQT A;  2ZUK A;  1Z7D A;  2QBT A;  1MLY A;  1JF9 A;  3G0T A;  4WXG A;  1OXP A;  3ACZ A;  3PDX A;  7AAT A;  1CL1 A;  1WYU A;  3ATH A;  2YCN A;  4AO9 A;  3E2F A;  3AEJ A;  4JF1 A;  1DJ9 A;  1MDX A;  4F5J A;  4OMA A;  3GR9 A;  4MSO A;  1QJ3 A;  1YIZ A;  4RJ0 A;  1AKC A;  3BV0 A;  2E54 A;  2D7Y A;  4LW4 A;  3CAI A;  2BI3 A;  2Z20 A;  1ASB A;  2EO5 A;  2VMR A;  1AAW A;  1RV3 A;  2W8W A;  3DXV A;  3JWB A;  3HLM A;  4A0G A;  1MAQ A;  2BIE A;  1IAX A;  1TAT A;  2YKY A;  4JEX A;  4EB7 A;  1YJS A;  2EH6 A;  3NU7 A;  3H14 A;  2Z67 A;  2E7U A;  2Z61 A;  3DR4 A;  2WK8 A;  1CQ7 A;  2W7J A;  1V2E A;  2Z9X A;  1H1C A;  4RLG A;  5G2Q A;  3E6G A;  4JEV A;  1N31 A;  1MAP A;  5DJ9 A;  2OKJ A;  3BWN A;  2VGS A;  4GEB A;  2VYC A;  4UHO A;  5I92 A;  4EU1 A;  3FVX A;  4U1T A;  3KGW A;  4R8D A;  4TN4 A;  5HDM A;  3TAT A;  2FKI A;  4OYT A;  1N8P A;  1ASM A;  1ECX A;  3CQ6 A;  2R0T A;  2EYQ A;  3A9X A;  3EI6 A;  3DC1 A;  3BCA A;  4JE5 D;  3AOW A;  4Y0D A;  2VMU A;  2W7I A;  2XBN A;  4ZWM A;  2DKB A;  4P7Y A;  1ASD A;  1OHV A;  1AX4 A;  2BIA A;  2Q7W A;  4JE5 A;  4ZDO A;  4ZLV A;  1C7N A;  4M2J A;  2AY7 A;  3NYT A;  4BA5 A;  3EI8 A;  4OT8 A;  3NU8 A;  1LC7 A;  2CY8 A;  1TAR A;  2C0R A;  5TF5 A;  3FZ6 A;  4ZDL A;  4W1W A;  1W7L A;  3MEB A;  3BN1 A;  4FFC A;  5EQC A;  3WLX A;  1EQB A;  5IWQ A;  1BJO B;  1LK9 A;  1SZK A;  2CTZ A;  1RVU A;  4WYG A;  5LHA A;  1LW5 A;  2KFP A;  3F9T A;  3FDB A;  1EG5 A;  4LC3 A;  4ZM4 A;  2D64 A;  1GBN A;  2ZY2 A;  2YRI A;  2O1B A;  1AHX A;  1M6S A;  3WY7 A;  3N75 A;  1ZOD A;  3H7F A;  1V72 A;  3NYU A;  1XI9 A;  2C81 A;  3W1J A;  4ZM3 A;  3VK4 A;  4WXB A;  1MDZ A;  3UWC A;  4F5M A;  5G09 A;  3E77 A;  4F5F A;  2C7T A;  2QB3 A;  2Z9V A;  4A00 A;  4E3R A;  4R5F A;  1CZC A;  1LC8 A;  1JS6 A;  1QZ9 A;  4I8A A;  3TQX A;  4QGR A;  2VIB A;  3N4S A;  1YNU A;  4KYO A;  1PG8 A;  1KKJ A;  3G7Q A;  1ASA A;  4UHM A;  5EUE A;  1IX8 A;  3TCM A;  1M0N A;  2YOB A;  4Q31 A;  2VMZ A;  2JG2 A;  3AOV A;  3ZRP A;  1V2D A;  1DTY A;  3DOD A;  2G6W A;  1G4X A;  2BHX A;  3USF A;  2BYJ A;  1C7O A;  4Y0H A;  2PB0 A;  4WD2 A;  1IVR A;  1Y4I A;  2VMW A;  1FC4 A;  3FVS A;  3I16 A;  2RFV A;  1GEY A;  3KE3 A;  3AEO A;  1H0C A;  4EMY A;  3QBO A;  1PFF A;  4MKJ A;  3NUI A;  2X3L A;  2W7M A;  5HXX A;  2ORD A;  4F4E A;  1S07 A;  4MQR A;  3H9X A;  3N7N A;  2CB1 A;  1RVY A;  3EIA A;  3N4X A;  3BCB A;  2GSA A;  4JEW A;  4UHN A;  3WZF A;  4EB5 A;  2VGT A;  5EAA A;  1M4N A;  3NYS A;  3IHJ A;  5G4J A;  2BYL A;  2VLH A;  3FFR A;  4Y0I A;  3L44 A;  1J32 A;  4F5L A;  1LC5 A;  5G0A A;  2EGY A;  3QHX A;  1OHW A;  2FM1 A;  1CS1 A;  2QMA A;  3G8M A;  4GRX A;  1KMJ A;  4IYO B;  2W7H A;  1CZE A;  3BWO A;  2VGZ A;  3GBX A;  2HP2 A;  2W8T A;  3B1D A;  3M5U A;  3JW9 A;  2E7J A;  2HZP A;  3GZD C;  2W8U A;  4ISY A;  4WP0 A;  3VP6 A;  5KTB A;  4A6T A;  1W3U A;  4JEZ A;  3AEM C;  2FQ6 A;  2D63 A;  3AEN A;  2CJH A;  2QLR A;  1LS3 A;  4W5K A;  1D7V A;  2AY1 A;  2HUF A;  5M4D A;  1O4S A;  2HOZ A;  4IYO A;  2FN6 A;  1CQ6 A;  3AEJ C;  1M0O A;  4ZAS A;  1B5P A;  3LVK A;  5FT6 A;  3QPG A;  2NMP A;  3OKS A;  2BWN A;  4K05 A;  3ZZK A;  3BS8 A;  2QSR A;  2CIN A;  1M0P A;  2BI2 A;  2W8V A;  3A9Y A;  3GSB A;  5E5I A;  1DGE A;  1JG8 A;  3JU7 A;  3COG A;  2ZC0 A;  4WLJ A;  3NNK A;  4OC9 A;  1AAM A;  5E4Z A;  2VMO A;  4A72 A;  4OTL A;  1ASN A;  2D65 A;  3RCH A;  1CL2 A;  2AEU A;  2E7I A;  4F5G A;  3HL2 A;  1ASE A;  1KL2 A;  1LW4 A;  1W23 A;  3NTJ A;  3JTX A;  4PIW A;  1BT4 A;  4XAU A;  3ASA A;  1ORD A;  2YRR A;  4ATQ A;  1SZS A;  1X28 A;  2HUU A;  3EZ1 A;  3DRD A;  2FYF A;  2WKA A;  3RBF A;  3BCX A;  4CBR A;  4F5H A;  1VJO A;  2Z9W A;  4ADD A;  3GZC A;  2R5C B;  3BWN C;  3K40 A;  2VIA A;  3PAA A;  4RAE A;  4FL0 A;  3N4R A;  4UQV A;  2GB3 A;  1UKJ A;  1AY4 A;  1KL1 A;  1SFF A;  1W7M A;  2AY8 A;  2GQN A;  3R4T A;  3WKS A;  9AAT A;  4GE4 A;  2VMT A;  1ARG A;  1CQ8 A;  1GC0 A;  4F5I A;  2X8U A;  3RBL A;  1KMK A;  3ELE A;  2F8J A;  2GMS A;  1MDO A;  4K2B A;  4Q6R A;  1GC3 A;  5LH9 A;  4K2I A;  3NX3 A;  2R5C A;  4W91 A;  4LNM A;  2VMX A;  5J8Q A;  1O69 A;  1B9I A;  4OCA A;  1ASF A;  3KGX A;  3MAD A;  1DJE A;  1X2A A;  1C4K A;  2CJG A;  3PIU A;  2V1P A;  3FRK A;  4EFF A;  1UU2 A;  2ZJG A;  1FG7 A;  2DGM A;  2OQX A;  2AY4 A;  4A6U A;  3NRA A;  4IXS A;  4ATP A;  2ZY4 A;  4PFN A;  1LKC A;  1GEW A;  4H51 A;  2QB2 A;  2G7J A;  2VI9 A;  4KAM A;  2CJD A;  3P1T A;  2BI1 A;  2ZP7 A;  4ZSY A;  4BA4 A;  1MLZ A;  4JF0 A;  4B9B A;  2YKU A;  2OGA A;  4DQ6 A;  2ZSL A;  5G4I A;  3WKR A;  4A0R A;  1V2F A;  4XQ2 A;  5HHY A;  2VMY A;  1S08 A;  1E5E A;  3NUB A;  4ADE A;  4W1V A;  1AIA A;  3Q8N A;  1I43 A;  3FVU A;  1CJ0 A;  1YAA A;  3B8X A;  4XK1 A;  3TFT A;  3PJ0 A;  4H63 Q;  1J04 A;  3WGC A;  3LG0 A;  1OXO A;  1TOJ A;  4OBV A;  2VMV A;  2YCP A;  2BIG A;  1YJZ A;  4A6R A;  1AY5 A;  4TMR A;  4PFF A;  4Q75 A;  3MKJ A;  3EZS A;  3F6T A;  2HOR A;  1AMA A;  3AEL A;  2BI5 A;  2HP1 A;  4BMK A;  5M46 A;  1X0M A;  3FQA A;  1GEX A;  4O6Z A;  1ELQ A;  4ITX A;  4MKK A;  3I4J A;  4GDY A;  3P6K A;  1IAY A;  2D7Z A;  2CH2 A;  3E2Z A;  3NDN A;  1EJI A;  2AAT A;  1TPL A;  2PO3 A;  2Z9U A;  3CBF A;  3N0L A;  5EAV A;  1S06 A;  4R5Z A;  4WYA A;  2BI9 A;  2A1V A;  3PDB B;  4CBS A;  5EIG B;  1OAT A;  3EUC A;  2ZY5 A;  3EI5 A;  3FDD A;  1B9H A;  3AEN B;  1ASC A;  1YIY A;  2PB2 A;  3MC6 A;  3WX9 A;  1E5F A;  3FKD A;  4TV7 A;  1S0A A;  3FQ8 A;  4ADB A;  1BJN A;  1ZOB A;  5M49 A;  1AHG A;  2W7D A;  1C0N A;  4WB0 B;  4B98 A;  3AV7 A;  3DR7 A;  4LNJ A;  4RJY A;  1DFO A;  1TAS A;  2VLF A;  3VK3 A;  4CXQ A;  4WXF A;  4WYC A;  3QM2 A;  3FZ7 A;  3BC8 A;  3TFU A;  3ASB A;  1B5O A;  3A2B A;  1AMS A;  4JEY A;  3VOM A;  3ZRQ A;  4AO4 A;  1B8G A;  1QIR A;  3PDB A;  2C44 A;  3ECD A;  4OBU A;  3ELP A;  3FQ7 A;  5EIG A;  3RQ1 A;  4N0B A;  1GD9 A;  3B1E A;  4NOG A;  1ARS A;  2O7C A;  4W1X A;  2TPL A;  2JJG A;  3DU4 A;  2HUI A;  3ZRR A;  1SZU A;  2HOY A;  3R9A A;  1AIC A;  1AKB A;  3RCH B;  4A0F A;  1ASG A;  1IX6 A;  2OAT A;  3B1C A;  3QI6 A;  4WB0 A;  1GC4 A;  1I29 A;  3HVY A;  4MQP A;  2WK7 A;  2VGV A;  4CXR A;  4GSA A;  2AY3 A;  1IX7 A;  1M32 A;  1ART A;  1WKG A;  1WKH A;  1D7R A;  1XEY A;  1QIS A;  3LY1 A;  3QN6 A;  3FZ8 A;  5FT5 A;  4LW2 A;  4N0W A;  3A8U X;  3WCO A;  2YKX A;  3HBX A;  4AH3 A;  3FCR A;  1T3I A;  1ELU A;  3L8A A;  5BJ4 A;  1QIT A;  1PMM A;  3MAF A;  4KXK A;  3VAX A;  2D66 A;  2ZYJ A;  4DBC A;  3WCN A;  2EZ2 A;  3T32 A;  1ARI A;  1DKA A;  1WYV A;  4K2M A;  1O61 A;  3LVM A;  1S09 A;  3PGY A;  4P3M A;  1BKG A;  2W7F A;  4RKC A;  5E3K A;  4ZDP A;  1DJU A;  1O62 A;  1M0Q A;  2DR1 A;  2YCT A;  1RV4 A;  2WB6 A;  1ASL A;  2JIS A;  2WK9 A;  2GMU A;  1AHY A;  5K8B A;  3LV2 A;  1G4V A;  1UU1 A;  4RKD A;  4BQ0 A;  1AIB A;  3KKI A;  1GC2 A;  4BHD A;  2JJE A;  3IF2 A;  4XJM A;  4WYD A;  1W7N A;  2XH1 A;  3D6K A;  1QGN A;  4E77 A;  2VMP A;  1AMR A;  3K28 A;  4WYE A;  4GE7 A;  1YJY A;  3FD0 A;  4IW7 A;  4XJO A;  4MY5 A;  5M4B A;  5DX5 A;  1AKA A;  4IX8 A;  4RIZ A;  3DXW A;  1SVV A;  1GCK A;  5FT8 A;  1I41 A;  2OKK A;  1AJS B;  1BQA A;  1X29 A;  2DGL A;  3RI6 A;  4ADC A;  3ZZJ A;  2R5E A;  5DJ1 A;  1C9C A;  3GET A;  5FT4 A;  4UOY A;  4IY7 A;  2AY6 A;  2X5F A;  3B46 A;  1VEF A;  2JJH A;  3LWS A;  2D5Y A;  5F8V A;  5AX8 A;  3E9K A;  1AJR A;  2Z1Y A;  1AHE A;  4ZSW A;  1AHF A;  1AMQ A;  2W7L A;  2VMS A;  1D7U A;  2DOU A;  1G7X A;  2JGT A;  3RUY A;  3W1H A;  3F0H A;  1BS0 A;  3DYD A;  4IXO A;  4MQQ A;  1AJS A;  2YKV A;  3W1I A;  5D5S A;  5C6U A;  4WLH A;  3PD6 B;  1IBJ A;  2AY5 A;  4J5U A;  3WGB A;  4Q76 A;  3MBB A;  4L0O A;  4M2K A;  3E2Z B;  3FTB A;  2AY9 A;  5EFS A;  2YHK A;  3GWP A;  2R2N A;  2BWO A;  1IJI A;  4E1O A;  1PMO A;  3PPL A;  2DKJ A;  4ZAH A;  5D95 A;  1B4X A;  2OGE A;  1U08 A;  4RIT A;  1WYT B;  3AAT A;  5G2P A;  3CQ5 A;  1JS3 A;  2BWP A;  1Z3Z A;  4AZK A;  2CH1 A;  2X5D A;  3PD6 A;  3PA9 A;  2HOX A;  4PVF A;  3OP7 A;  5DB5 A;  2CST A;  3A9Z A;  4AZJ A;  2FNU A;  3FSL A;  1BJO A;  2VGU A;  4IXZ A;  4U2H A;  3VK2 A;  4HF8 A;  1N2T A;  2Z1Z A;  4J8L A;  1P3W A;  1SPA A;  1BW0 A;  1ZC9 A;  2V0Y A;  1TOI A;  5JAY A;  2W7K A;  1BQD A;  1UU0 A;  5F9S A;  4GE9 A;  3FFH A;  1ARH A;  4XJL A;  3MC6 C;  1WYT A;  1AY8 A;  1BJ4 A;  3DZZ A;  1TOK A;  3K7Y A;  3UE8 A;  2VGW A;  1IUG A;  4WBT A;  2AY2 A;  1WST A;  5EUN A;  2W7E A;  3ISL A;  2VMN A;  1C7G A;  1M7Y A;  3JWA A;  2EZ1 A;  2AEV A;  1DGD A;  2VMQ A;  3JZL A;  1D2F A;  3HDO A;  2CAN A;  5EUD A;  3II0 A;  2VI8 A;  1KKP A;  3EI9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...