1MATA

Structure of the cobalt-dependent methionine aminopeptidase from escherichia coli: a new type of proteolytic enzyme
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
263
structure length
263
Chain Sequence
b'AISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHDE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords METHIONYL AMINOPEPTIDASE
publication title Structure of the cobalt-dependent methionine aminopeptidase from Escherichia coli: a new type of proteolytic enzyme.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase(alpha-aminoacylpeptide)
total genus 77
structure length 263
sequence length 263
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 1992-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 1matA00
4U70A 4IF7A 3L24A 2HOWA 2BHDA 1A16A 2Q94A 2GGBA 4ZWPA 2BWVA 3MX6A 1XGOA 1Y1NA 2OAZA 2EVOA 4S2RP 3FMRA 1XGSA 2GG5A 1MATA 2GTXA 2V3ZA 3CTZA 1W7VA 1QXYA 3MATA 1XNZA 2P9AA 5JFRA 4OOKA 2P99A 1R58A 2V3XA 2EA2A 4RGZ1 3BITA 4U73A 1YJ3A 2G6PA 2GGCA 4FLLA 4IPAA 4S00A 3TAVA 1C23A 4ZWUA 1QZYA 2NQ7A 4IKUA 2Q92A 4U6ZA 5D6EA 1WN1A 2NQ6A 4ZWOA 5FCHA 1WL9A 2BWWA 2GG9A 2ADUA 1W2MA 1N51A 1O0XA 1WL6A 1XGNA 4FKCA 4Z7MA 1R5HA 3PKAA 2Q8KA 4U6CA 3FM3A 3CB5A 3S6BA 1YVMA 2BN7A 4FLKA 5CDLA 4KM3A 2GG3A 1C24A 4S2TP 2GG7A 5FCFA 1KQ9A 3MR1A 4IECA 2Q96A 1YW8A 2GU4A 5E5BA 3IG4A 3PKDA 1BOAA 2GU5A 4U69A 4U1BA 1M35A 4U6WA 4U71A 4RZYA 4FO8A 2BHAA 3IU8A 2BH3A 1WLRA 2EA4A 1WBQA 4MATA 3IU9A 3RVAA 5CDEA 4JUQA 5JI6A 1C21A 4U6JA 1XGMA 2DFIA 1YW7A 2Q95A 2EVCA 1WKMA 1C27A 1R5GA 2OKNA 2Q93A 2GG0A 4R60A 1KP0A 1PV9A 5JHUA 1C22A 3IU7A 4A6VA 5D6FA 1CHMA 1YW9A 3PKBA 2MATA 3PKEA 4FUKA 3L7GA 2ZSGA 2B3KA 4ZNGA 4PNCA 5CLSA 3BIPA 2BWXA 5CE6A 3Q6DA 4FLJA 1B6AA 3CB6A 2V3YA 2GU6A 4B28A 3FMQA 3BIQA 2BWYA 4IDYA 2BHBA 1QXZA 1BN5A 2GU7A 2GZ5A 2BWSA 2GG8A 2BWTA 2P98A 2GG2A 3D27A 4IKRA 4PV4A 3TB5A 2B3HA 4IU6A 4S01A 5CIKA 1QXWA 4FLIA 2B3LA 2BB7A 4IKTA 4QR8A 4U75A 2GA2A 4IKSA 5CDVA 4U6EA 4RZZA 3RORA 2BHCA 2BWUA 2EVMA 4EGEA 5CNXA 3PKCA 4FO7A 2IW2A 2V6CA 1B59A 4HXXA 4U76A 1WY2A 4A6WA 1JAWA 1KQ0A
chains in the Genus database with same CATH superfamily
4U70A 4IF7A 3L24A 2HOWA 2BHDA 1A16A 2Q94A 2GGBA 4ZWPA 2BWVA 3MX6A 1XGOA 1Y1NA 2OAZA 2EVOA 4S2RP 3FMRA 1XGSA 2GG5A 1MATA 2GTXA 2V3ZA 3CTZA 1W7VA 1QXYA 3MATA 1XNZA 2P9AA 5JFRA 4OOKA 2P99A 1R58A 2V3XA 2EA2A 4RGZ1 3BITA 4U73A 1YJ3A 2G6PA 2GGCA 4FLLA 4IPAA 4S00A 3TAVA 1C23A 4ZWUA 1QZYA 2NQ7A 4IKUA 2Q92A 4U6ZA 5D6EA 1WN1A 2NQ6A 4ZWOA 5FCHA 1WL9A 2BWWA 2GG9A 2ADUA 1W2MA 1N51A 1O0XA 1WL6A 1XGNA 4FKCA 4Z7MA 1R5HA 3PKAA 2Q8KA 4U6CA 3FM3A 3CB5A 3S6BA 1YVMA 2BN7A 4FLKA 5CDLA 4KM3A 2GG3A 1C24A 4S2TP 2GG7A 5FCFA 1KQ9A 3MR1A 4IECA 2Q96A 1YW8A 2GU4A 5E5BA 3IG4A 3PKDA 1BOAA 2GU5A 4U69A 4U1BA 1M35A 4U6WA 4U71A 4RZYA 4FO8A 2BHAA 3IU8A 2BH3A 1WLRA 2EA4A 1WBQA 4MATA 3IU9A 3RVAA 5CDEA 4JUQA 5JI6A 1C21A 4U6JA 1XGMA 2DFIA 1YW7A 2Q95A 2EVCA 1WKMA 1C27A 1R5GA 2OKNA 2Q93A 2GG0A 4R60A 1KP0A 1PV9A 5JHUA 1C22A 3IU7A 4A6VA 5D6FA 1CHMA 1YW9A 3PKBA 2MATA 3PKEA 4FUKA 3L7GA 2ZSGA 2B3KA 4ZNGA 4PNCA 5CLSA 3BIPA 2BWXA 5CE6A 3Q6DA 4FLJA 1B6AA 3CB6A 2V3YA 2GU6A 4B28A 3FMQA 3BIQA 2BWYA 4IDYA 2BHBA 1QXZA 1BN5A 2GU7A 2GZ5A 2BWSA 2GG8A 2BWTA 2P98A 2GG2A 3D27A 4IKRA 4PV4A 3TB5A 2B3HA 4IU6A 4S01A 5CIKA 1QXWA 4FLIA 2B3LA 2BB7A 4IKTA 4QR8A 4U75A 2GA2A 4IKSA 5CDVA 4U6EA 4RZZA 3RORA 2BHCA 2BWUA 2EVMA 4EGEA 5CNXA 3PKCA 4FO7A 2IW2A 2V6CA 1B59A 4HXXA 4U76A 1WY2A 4A6WA 1JAWA 1KQ0A
chains in the Genus database with same CATH topology
4U70A 4IF7A 3L24A 2HOWA 2BHDA 1A16A 2Q94A 2GGBA 4ZWPA 2BWVA 3MX6A 1XGOA 1Y1NA 2OAZA 2EVOA 4S2RP 3FMRA 1XGSA 2GG5A 1MATA 2GTXA 2V3ZA 3CTZA 1W7VA 1QXYA 3MATA 1XNZA 2P9AA 5JFRA 4OOKA 2P99A 1R58A 2V3XA 2EA2A 4RGZ1 3BITA 4U73A 1YJ3A 2G6PA 2GGCA 4FLLA 4IPAA 4S00A 3TAVA 1C23A 4ZWUA 1QZYA 2NQ7A 4IKUA 2Q92A 4U6ZA 5D6EA 1WN1A 2NQ6A 4ZWOA 5FCHA 1WL9A 2BWWA 2GG9A 2ADUA 1W2MA 1N51A 1O0XA 1WL6A 1XGNA 4FKCA 4Z7MA 1R5HA 3PKAA 2Q8KA 4U6CA 3FM3A 3CB5A 3S6BA 1YVMA 2BN7A 4FLKA 5CDLA 4KM3A 2GG3A 1C24A 4S2TP 2GG7A 5FCFA 1KQ9A 3MR1A 4IECA 2Q96A 1YW8A 2GU4A 5E5BA 3IG4A 3PKDA 1BOAA 2GU5A 4U69A 4U1BA 1M35A 4U6WA 4U71A 4RZYA 4FO8A 2BHAA 3IU8A 2BH3A 1WLRA 2EA4A 1WBQA 4MATA 3IU9A 3RVAA 5CDEA 4JUQA 5JI6A 1C21A 4U6JA 1XGMA 2DFIA 1YW7A 2Q95A 2EVCA 1WKMA 1C27A 1R5GA 2OKNA 2Q93A 2GG0A 4R60A 1KP0A 1PV9A 5JHUA 1C22A 3IU7A 4A6VA 5D6FA 1CHMA 1YW9A 3PKBA 2MATA 3PKEA 4FUKA 3L7GA 2ZSGA 2B3KA 4ZNGA 4PNCA 5CLSA 3BIPA 2BWXA 5CE6A 3Q6DA 4FLJA 1B6AA 3CB6A 2V3YA 2GU6A 4B28A 3FMQA 3BIQA 2BWYA 4IDYA 2BHBA 1QXZA 1BN5A 2GU7A 2GZ5A 2BWSA 2GG8A 2BWTA 2P98A 2GG2A 3D27A 4IKRA 4PV4A 3TB5A 2B3HA 4IU6A 4S01A 5CIKA 1QXWA 4FLIA 2B3LA 2BB7A 4IKTA 4QR8A 4U75A 2GA2A 4IKSA 5CDVA 4U6EA 4RZZA 3RORA 2BHCA 2BWUA 2EVMA 4EGEA 5CNXA 3PKCA 4FO7A 2IW2A 2V6CA 1B59A 4HXXA 4U76A 1WY2A 4A6WA 1JAWA 1KQ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U70 A;  4IF7 A;  3L24 A;  2HOW A;  2BHD A;  1A16 A;  2Q94 A;  2GGB A;  4ZWP A;  2BWV A;  3MX6 A;  1XGO A;  1Y1N A;  2OAZ A;  2EVO A;  4S2R P;  3FMR A;  1XGS A;  2GG5 A;  1MAT A;  2GTX A;  2V3Z A;  3CTZ A;  1W7V A;  1QXY A;  3MAT A;  1XNZ A;  2P9A A;  5JFR A;  4OOK A;  2P99 A;  1R58 A;  2V3X A;  2EA2 A;  4RGZ 1;  3BIT A;  4U73 A;  1YJ3 A;  2G6P A;  2GGC A;  4FLL A;  4IPA A;  4S00 A;  3TAV A;  1C23 A;  4ZWU A;  1QZY A;  2NQ7 A;  4IKU A;  2Q92 A;  4U6Z A;  5D6E A;  1WN1 A;  2NQ6 A;  4ZWO A;  5FCH A;  1WL9 A;  2BWW A;  2GG9 A;  2ADU A;  1W2M A;  1N51 A;  1O0X A;  1WL6 A;  1XGN A;  4FKC A;  4Z7M A;  1R5H A;  3PKA A;  2Q8K A;  4U6C A;  3FM3 A;  3CB5 A;  3S6B A;  1YVM A;  2BN7 A;  4FLK A;  5CDL A;  4KM3 A;  2GG3 A;  1C24 A;  4S2T P;  2GG7 A;  5FCF A;  1KQ9 A;  3MR1 A;  4IEC A;  2Q96 A;  1YW8 A;  2GU4 A;  5E5B A;  3IG4 A;  3PKD A;  1BOA A;  2GU5 A;  4U69 A;  4U1B A;  1M35 A;  4U6W A;  4U71 A;  4RZY A;  4FO8 A;  2BHA A;  3IU8 A;  2BH3 A;  1WLR A;  2EA4 A;  1WBQ A;  4MAT A;  3IU9 A;  3RVA A;  5CDE A;  4JUQ A;  5JI6 A;  1C21 A;  4U6J A;  1XGM A;  2DFI A;  1YW7 A;  2Q95 A;  2EVC A;  1WKM A;  1C27 A;  1R5G A;  2OKN A;  2Q93 A;  2GG0 A;  4R60 A;  1KP0 A;  1PV9 A;  5JHU A;  1C22 A;  3IU7 A;  4A6V A;  5D6F A;  1CHM A;  1YW9 A;  3PKB A;  2MAT A;  3PKE A;  4FUK A;  3L7G A;  2ZSG A;  2B3K A;  4ZNG A;  4PNC A;  5CLS A;  3BIP A;  2BWX A;  5CE6 A;  3Q6D A;  4FLJ A;  1B6A A;  3CB6 A;  2V3Y A;  2GU6 A;  4B28 A;  3FMQ A;  3BIQ A;  2BWY A;  4IDY A;  2BHB A;  1QXZ A;  1BN5 A;  2GU7 A;  2GZ5 A;  2BWS A;  2GG8 A;  2BWT A;  2P98 A;  2GG2 A;  3D27 A;  4IKR A;  4PV4 A;  3TB5 A;  2B3H A;  4IU6 A;  4S01 A;  5CIK A;  1QXW A;  4FLI A;  2B3L A;  2BB7 A;  4IKT A;  4QR8 A;  4U75 A;  2GA2 A;  4IKS A;  5CDV A;  4U6E A;  4RZZ A;  3ROR A;  2BHC A;  2BWU A;  2EVM A;  4EGE A;  5CNX A;  3PKC A;  4FO7 A;  2IW2 A;  2V6C A;  1B59 A;  4HXX A;  4U76 A;  1WY2 A;  4A6W A;  1JAW A;  1KQ0 A; 
#chains in the Genus database with same CATH topology
 4U70 A;  4IF7 A;  3L24 A;  2HOW A;  2BHD A;  1A16 A;  2Q94 A;  2GGB A;  4ZWP A;  2BWV A;  3MX6 A;  1XGO A;  1Y1N A;  2OAZ A;  2EVO A;  4S2R P;  3FMR A;  1XGS A;  2GG5 A;  1MAT A;  2GTX A;  2V3Z A;  3CTZ A;  1W7V A;  1QXY A;  3MAT A;  1XNZ A;  2P9A A;  5JFR A;  4OOK A;  2P99 A;  1R58 A;  2V3X A;  2EA2 A;  4RGZ 1;  3BIT A;  4U73 A;  1YJ3 A;  2G6P A;  2GGC A;  4FLL A;  4IPA A;  4S00 A;  3TAV A;  1C23 A;  4ZWU A;  1QZY A;  2NQ7 A;  4IKU A;  2Q92 A;  4U6Z A;  5D6E A;  1WN1 A;  2NQ6 A;  4ZWO A;  5FCH A;  1WL9 A;  2BWW A;  2GG9 A;  2ADU A;  1W2M A;  1N51 A;  1O0X A;  1WL6 A;  1XGN A;  4FKC A;  4Z7M A;  1R5H A;  3PKA A;  2Q8K A;  4U6C A;  3FM3 A;  3CB5 A;  3S6B A;  1YVM A;  2BN7 A;  4FLK A;  5CDL A;  4KM3 A;  2GG3 A;  1C24 A;  4S2T P;  2GG7 A;  5FCF A;  1KQ9 A;  3MR1 A;  4IEC A;  2Q96 A;  1YW8 A;  2GU4 A;  5E5B A;  3IG4 A;  3PKD A;  1BOA A;  2GU5 A;  4U69 A;  4U1B A;  1M35 A;  4U6W A;  4U71 A;  4RZY A;  4FO8 A;  2BHA A;  3IU8 A;  2BH3 A;  1WLR A;  2EA4 A;  1WBQ A;  4MAT A;  3IU9 A;  3RVA A;  5CDE A;  4JUQ A;  5JI6 A;  1C21 A;  4U6J A;  1XGM A;  2DFI A;  1YW7 A;  2Q95 A;  2EVC A;  1WKM A;  1C27 A;  1R5G A;  2OKN A;  2Q93 A;  2GG0 A;  4R60 A;  1KP0 A;  1PV9 A;  5JHU A;  1C22 A;  3IU7 A;  4A6V A;  5D6F A;  1CHM A;  1YW9 A;  3PKB A;  2MAT A;  3PKE A;  4FUK A;  3L7G A;  2ZSG A;  2B3K A;  4ZNG A;  4PNC A;  5CLS A;  3BIP A;  2BWX A;  5CE6 A;  3Q6D A;  4FLJ A;  1B6A A;  3CB6 A;  2V3Y A;  2GU6 A;  4B28 A;  3FMQ A;  3BIQ A;  2BWY A;  4IDY A;  2BHB A;  1QXZ A;  1BN5 A;  2GU7 A;  2GZ5 A;  2BWS A;  2GG8 A;  2BWT A;  2P98 A;  2GG2 A;  3D27 A;  4IKR A;  4PV4 A;  3TB5 A;  2B3H A;  4IU6 A;  4S01 A;  5CIK A;  1QXW A;  4FLI A;  2B3L A;  2BB7 A;  4IKT A;  4QR8 A;  4U75 A;  2GA2 A;  4IKS A;  5CDV A;  4U6E A;  4RZZ A;  3ROR A;  2BHC A;  2BWU A;  2EVM A;  4EGE A;  5CNX A;  3PKC A;  4FO7 A;  2IW2 A;  2V6C A;  1B59 A;  4HXX A;  4U76 A;  1WY2 A;  4A6W A;  1JAW A;  1KQ0 A; 
#chains in the Genus database with same CATH homology
 4U70 A;  4IF7 A;  3L24 A;  2HOW A;  2BHD A;  1A16 A;  2Q94 A;  2GGB A;  4ZWP A;  2BWV A;  3MX6 A;  1XGO A;  1Y1N A;  2OAZ A;  2EVO A;  4S2R P;  3FMR A;  1XGS A;  2GG5 A;  1MAT A;  2GTX A;  2V3Z A;  3CTZ A;  1W7V A;  1QXY A;  3MAT A;  1XNZ A;  2P9A A;  5JFR A;  4OOK A;  2P99 A;  1R58 A;  2V3X A;  2EA2 A;  4RGZ 1;  3BIT A;  4U73 A;  1YJ3 A;  2G6P A;  2GGC A;  4FLL A;  4IPA A;  4S00 A;  3TAV A;  1C23 A;  4ZWU A;  1QZY A;  2NQ7 A;  4IKU A;  2Q92 A;  4U6Z A;  5D6E A;  1WN1 A;  2NQ6 A;  4ZWO A;  5FCH A;  1WL9 A;  2BWW A;  2GG9 A;  2ADU A;  1W2M A;  1N51 A;  1O0X A;  1WL6 A;  1XGN A;  4FKC A;  4Z7M A;  1R5H A;  3PKA A;  2Q8K A;  4U6C A;  3FM3 A;  3CB5 A;  3S6B A;  1YVM A;  2BN7 A;  4FLK A;  5CDL A;  4KM3 A;  2GG3 A;  1C24 A;  4S2T P;  2GG7 A;  5FCF A;  1KQ9 A;  3MR1 A;  4IEC A;  2Q96 A;  1YW8 A;  2GU4 A;  5E5B A;  3IG4 A;  3PKD A;  1BOA A;  2GU5 A;  4U69 A;  4U1B A;  1M35 A;  4U6W A;  4U71 A;  4RZY A;  4FO8 A;  2BHA A;  3IU8 A;  2BH3 A;  1WLR A;  2EA4 A;  1WBQ A;  4MAT A;  3IU9 A;  3RVA A;  5CDE A;  4JUQ A;  5JI6 A;  1C21 A;  4U6J A;  1XGM A;  2DFI A;  1YW7 A;  2Q95 A;  2EVC A;  1WKM A;  1C27 A;  1R5G A;  2OKN A;  2Q93 A;  2GG0 A;  4R60 A;  1KP0 A;  1PV9 A;  5JHU A;  1C22 A;  3IU7 A;  4A6V A;  5D6F A;  1CHM A;  1YW9 A;  3PKB A;  2MAT A;  3PKE A;  4FUK A;  3L7G A;  2ZSG A;  2B3K A;  4ZNG A;  4PNC A;  5CLS A;  3BIP A;  2BWX A;  5CE6 A;  3Q6D A;  4FLJ A;  1B6A A;  3CB6 A;  2V3Y A;  2GU6 A;  4B28 A;  3FMQ A;  3BIQ A;  2BWY A;  4IDY A;  2BHB A;  1QXZ A;  1BN5 A;  2GU7 A;  2GZ5 A;  2BWS A;  2GG8 A;  2BWT A;  2P98 A;  2GG2 A;  3D27 A;  4IKR A;  4PV4 A;  3TB5 A;  2B3H A;  4IU6 A;  4S01 A;  5CIK A;  1QXW A;  4FLI A;  2B3L A;  2BB7 A;  4IKT A;  4QR8 A;  4U75 A;  2GA2 A;  4IKS A;  5CDV A;  4U6E A;  4RZZ A;  3ROR A;  2BHC A;  2BWU A;  2EVM A;  4EGE A;  5CNX A;  3PKC A;  4FO7 A;  2IW2 A;  2V6C A;  1B59 A;  4HXX A;  4U76 A;  1WY2 A;  4A6W A;  1JAW A;  1KQ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...