1MATA

Structure of the cobalt-dependent methionine aminopeptidase from escherichia coli: a new type of proteolytic enzyme
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
263
structure length
263
Chain Sequence
AISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords METHIONYL AMINOPEPTIDASE
publication title Structure of the cobalt-dependent methionine aminopeptidase from Escherichia coli: a new type of proteolytic enzyme.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase(alpha-aminoacylpeptide)
total genus 77
structure length 263
sequence length 263
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 1992-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 1matA00
4IKUA 2OKNA 2BWXA 3CB5A 3PKCA 1XGSA 1Y1NA 4S01A 4IF7A 1XGNA 2BN7A 2GA2A 1YJ3A 1WLRA 5CNXA 2EVCA 1XGMA 3FMRA 2BHAA 2GU5A 3L24A 4U1BA 4U6CA 2Q94A 4EGEA 4RZYA 4B28A 1CHMA 3CTZA 4FLLA 4U76A 5JHUA 4S2RP 1C23A 3FMQA 4PV4A 2IW2A 4ZWUA 2BB7A 3TAVA 2B3KA 4ZNGA 3Q6DA 2ADUA 2BWYA 2DFIA 1R5GA 3MX6A 5E5BA 2NQ6A 2GG8A 4FO7A 3RVAA 1B59A 4U6JA 1W2MA 4FKCA 2B3LA 4S2TP 1MATA 2GU6A 1C24A 4FLIA 3L7GA 1XGOA 2B3HA 1N51A 2P98A 2V6CA 4RGZ1 4A6VA 2Q92A 1KP0A 1WY2A 2Q96A 2BWWA 4MATA 1WBQA 2V3YA 1A16A 2GG9A 4JUQA 4U70A 3TB5A 2NQ7A 4QR8A 1KQ0A 4RZZA 4U6WA 1QXYA 2BHDA 4IECA 2BHBA 2G6PA 1KQ9A 2Q8KA 2GGCA 3RORA 2EVOA 4ZWPA 1YW7A 1PV9A 2GG3A 2P99A 4IU6A 3BITA 4R60A 4U75A 3MR1A 2GU4A 4FO8A 3CB6A 2GG0A 4OOKA 3FM3A 1JAWA 2V3ZA 3PKDA 2GG2A 3PKEA 3BIPA 5CDVA 1W7VA 5CDEA 2MATA 4U71A 3BIQA 4A6WA 1QXWA 5CIKA 1XNZA 3PKBA 4U73A 1WN1A 1BN5A 1C21A 1C22A 2BWSA 3IU9A 2P9AA 1YW8A 4IKSA 1B6AA 2EVMA 2EA2A 3IU8A 3IU7A 2GU7A 4U6ZA 5CDLA 4IDYA 4ZWOA 4Z7MA 4KM3A 3S6BA 4FLJA 2ZSGA 2BWUA 4IKTA 2BH3A 2GZ5A 1WL9A 5JI6A 3MATA 2GTXA 5D6EA 1WKMA 4FLKA 4S00A 4PNCA 1QXZA 1WL6A 2OAZA 1O0XA 2EA4A 4IKRA 1YVMA 2Q95A 2BHCA 4U6EA 3PKAA 2BWVA 5D6FA 2Q93A 1QZYA 4IPAA 1R58A 4U69A 2BWTA 5JFRA 2GG7A 3IG4A 5FCFA 1BOAA 1M35A 2GG5A 2HOWA 1R5HA 3D27A 4HXXA 5CE6A 1YW9A 2GGBA 5CLSA 4FUKA 1C27A 5FCHA 2V3XA
chains in the Genus database with same CATH superfamily
4IKUA 2OKNA 2BWXA 3CB5A 3PKCA 1XGSA 1Y1NA 4S01A 4IF7A 1XGNA 2BN7A 2GA2A 1YJ3A 1WLRA 5CNXA 2EVCA 1XGMA 3FMRA 2BHAA 2GU5A 3L24A 4U1BA 4U6CA 2Q94A 4EGEA 4RZYA 4B28A 1CHMA 3CTZA 4FLLA 4U76A 5JHUA 4S2RP 1C23A 3FMQA 4PV4A 2IW2A 4ZWUA 2BB7A 3TAVA 2B3KA 4ZNGA 3Q6DA 2ADUA 2BWYA 2DFIA 1R5GA 3MX6A 5E5BA 2NQ6A 2GG8A 4FO7A 3RVAA 1B59A 4U6JA 1W2MA 4FKCA 2B3LA 4S2TP 1MATA 2GU6A 1C24A 4FLIA 3L7GA 1XGOA 2B3HA 1N51A 2P98A 2V6CA 4RGZ1 4A6VA 2Q92A 1KP0A 1WY2A 2Q96A 2BWWA 4MATA 1WBQA 2V3YA 1A16A 2GG9A 4JUQA 4U70A 3TB5A 2NQ7A 4QR8A 1KQ0A 4RZZA 4U6WA 1QXYA 2BHDA 4IECA 2BHBA 2G6PA 1KQ9A 2Q8KA 2GGCA 3RORA 2EVOA 4ZWPA 1YW7A 1PV9A 2GG3A 2P99A 4IU6A 3BITA 4R60A 4U75A 3MR1A 2GU4A 4FO8A 3CB6A 2GG0A 4OOKA 3FM3A 1JAWA 2V3ZA 3PKDA 2GG2A 3PKEA 3BIPA 5CDVA 1W7VA 5CDEA 2MATA 4U71A 3BIQA 4A6WA 1QXWA 5CIKA 1XNZA 3PKBA 4U73A 1WN1A 1BN5A 1C21A 1C22A 2BWSA 3IU9A 2P9AA 1YW8A 4IKSA 1B6AA 2EVMA 2EA2A 3IU8A 3IU7A 2GU7A 4U6ZA 5CDLA 4IDYA 4ZWOA 4Z7MA 4KM3A 3S6BA 4FLJA 2ZSGA 2BWUA 4IKTA 2BH3A 2GZ5A 1WL9A 5JI6A 3MATA 2GTXA 5D6EA 1WKMA 4FLKA 4S00A 4PNCA 1QXZA 1WL6A 2OAZA 1O0XA 2EA4A 4IKRA 1YVMA 2Q95A 2BHCA 4U6EA 3PKAA 2BWVA 5D6FA 2Q93A 1QZYA 4IPAA 1R58A 4U69A 2BWTA 5JFRA 2GG7A 3IG4A 5FCFA 1BOAA 1M35A 2GG5A 2HOWA 1R5HA 3D27A 4HXXA 5CE6A 1YW9A 2GGBA 5CLSA 4FUKA 1C27A 5FCHA 2V3XA
chains in the Genus database with same CATH topology
4IKUA 2OKNA 2BWXA 3CB5A 3PKCA 1XGSA 1Y1NA 4S01A 4IF7A 1XGNA 2BN7A 2GA2A 1YJ3A 1WLRA 5CNXA 2EVCA 1XGMA 3FMRA 2BHAA 2GU5A 3L24A 4U1BA 4U6CA 2Q94A 4EGEA 4RZYA 4B28A 1CHMA 3CTZA 4FLLA 4U76A 5JHUA 4S2RP 1C23A 3FMQA 4PV4A 2IW2A 4ZWUA 2BB7A 3TAVA 2B3KA 4ZNGA 3Q6DA 2ADUA 2BWYA 2DFIA 1R5GA 3MX6A 5E5BA 2NQ6A 2GG8A 4FO7A 3RVAA 1B59A 4U6JA 1W2MA 4FKCA 2B3LA 4S2TP 1MATA 2GU6A 1C24A 4FLIA 3L7GA 1XGOA 2B3HA 1N51A 2P98A 2V6CA 4RGZ1 4A6VA 2Q92A 1KP0A 1WY2A 2Q96A 2BWWA 4MATA 1WBQA 2V3YA 1A16A 2GG9A 4JUQA 4U70A 3TB5A 2NQ7A 4QR8A 1KQ0A 4RZZA 4U6WA 1QXYA 2BHDA 4IECA 2BHBA 2G6PA 1KQ9A 2Q8KA 2GGCA 3RORA 2EVOA 4ZWPA 1YW7A 1PV9A 2GG3A 2P99A 4IU6A 3BITA 4R60A 4U75A 3MR1A 2GU4A 4FO8A 3CB6A 2GG0A 4OOKA 3FM3A 1JAWA 2V3ZA 3PKDA 2GG2A 3PKEA 3BIPA 5CDVA 1W7VA 5CDEA 2MATA 4U71A 3BIQA 4A6WA 1QXWA 5CIKA 1XNZA 3PKBA 4U73A 1WN1A 1BN5A 1C21A 1C22A 2BWSA 3IU9A 2P9AA 1YW8A 4IKSA 1B6AA 2EVMA 2EA2A 3IU8A 3IU7A 2GU7A 4U6ZA 5CDLA 4IDYA 4ZWOA 4Z7MA 4KM3A 3S6BA 4FLJA 2ZSGA 2BWUA 4IKTA 2BH3A 2GZ5A 1WL9A 5JI6A 3MATA 2GTXA 5D6EA 1WKMA 4FLKA 4S00A 4PNCA 1QXZA 1WL6A 2OAZA 1O0XA 2EA4A 4IKRA 1YVMA 2Q95A 2BHCA 4U6EA 3PKAA 2BWVA 5D6FA 2Q93A 1QZYA 4IPAA 1R58A 4U69A 2BWTA 5JFRA 2GG7A 3IG4A 5FCFA 1BOAA 1M35A 2GG5A 2HOWA 1R5HA 3D27A 4HXXA 5CE6A 1YW9A 2GGBA 5CLSA 4FUKA 1C27A 5FCHA 2V3XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IKU A;  2OKN A;  2BWX A;  3CB5 A;  3PKC A;  1XGS A;  1Y1N A;  4S01 A;  4IF7 A;  1XGN A;  2BN7 A;  2GA2 A;  1YJ3 A;  1WLR A;  5CNX A;  2EVC A;  1XGM A;  3FMR A;  2BHA A;  2GU5 A;  3L24 A;  4U1B A;  4U6C A;  2Q94 A;  4EGE A;  4RZY A;  4B28 A;  1CHM A;  3CTZ A;  4FLL A;  4U76 A;  5JHU A;  4S2R P;  1C23 A;  3FMQ A;  4PV4 A;  2IW2 A;  4ZWU A;  2BB7 A;  3TAV A;  2B3K A;  4ZNG A;  3Q6D A;  2ADU A;  2BWY A;  2DFI A;  1R5G A;  3MX6 A;  5E5B A;  2NQ6 A;  2GG8 A;  4FO7 A;  3RVA A;  1B59 A;  4U6J A;  1W2M A;  4FKC A;  2B3L A;  4S2T P;  1MAT A;  2GU6 A;  1C24 A;  4FLI A;  3L7G A;  1XGO A;  2B3H A;  1N51 A;  2P98 A;  2V6C A;  4RGZ 1;  4A6V A;  2Q92 A;  1KP0 A;  1WY2 A;  2Q96 A;  2BWW A;  4MAT A;  1WBQ A;  2V3Y A;  1A16 A;  2GG9 A;  4JUQ A;  4U70 A;  3TB5 A;  2NQ7 A;  4QR8 A;  1KQ0 A;  4RZZ A;  4U6W A;  1QXY A;  2BHD A;  4IEC A;  2BHB A;  2G6P A;  1KQ9 A;  2Q8K A;  2GGC A;  3ROR A;  2EVO A;  4ZWP A;  1YW7 A;  1PV9 A;  2GG3 A;  2P99 A;  4IU6 A;  3BIT A;  4R60 A;  4U75 A;  3MR1 A;  2GU4 A;  4FO8 A;  3CB6 A;  2GG0 A;  4OOK A;  3FM3 A;  1JAW A;  2V3Z A;  3PKD A;  2GG2 A;  3PKE A;  3BIP A;  5CDV A;  1W7V A;  5CDE A;  2MAT A;  4U71 A;  3BIQ A;  4A6W A;  1QXW A;  5CIK A;  1XNZ A;  3PKB A;  4U73 A;  1WN1 A;  1BN5 A;  1C21 A;  1C22 A;  2BWS A;  3IU9 A;  2P9A A;  1YW8 A;  4IKS A;  1B6A A;  2EVM A;  2EA2 A;  3IU8 A;  3IU7 A;  2GU7 A;  4U6Z A;  5CDL A;  4IDY A;  4ZWO A;  4Z7M A;  4KM3 A;  3S6B A;  4FLJ A;  2ZSG A;  2BWU A;  4IKT A;  2BH3 A;  2GZ5 A;  1WL9 A;  5JI6 A;  3MAT A;  2GTX A;  5D6E A;  1WKM A;  4FLK A;  4S00 A;  4PNC A;  1QXZ A;  1WL6 A;  2OAZ A;  1O0X A;  2EA4 A;  4IKR A;  1YVM A;  2Q95 A;  2BHC A;  4U6E A;  3PKA A;  2BWV A;  5D6F A;  2Q93 A;  1QZY A;  4IPA A;  1R58 A;  4U69 A;  2BWT A;  5JFR A;  2GG7 A;  3IG4 A;  5FCF A;  1BOA A;  1M35 A;  2GG5 A;  2HOW A;  1R5H A;  3D27 A;  4HXX A;  5CE6 A;  1YW9 A;  2GGB A;  5CLS A;  4FUK A;  1C27 A;  5FCH A;  2V3X A; 
#chains in the Genus database with same CATH topology
 4IKU A;  2OKN A;  2BWX A;  3CB5 A;  3PKC A;  1XGS A;  1Y1N A;  4S01 A;  4IF7 A;  1XGN A;  2BN7 A;  2GA2 A;  1YJ3 A;  1WLR A;  5CNX A;  2EVC A;  1XGM A;  3FMR A;  2BHA A;  2GU5 A;  3L24 A;  4U1B A;  4U6C A;  2Q94 A;  4EGE A;  4RZY A;  4B28 A;  1CHM A;  3CTZ A;  4FLL A;  4U76 A;  5JHU A;  4S2R P;  1C23 A;  3FMQ A;  4PV4 A;  2IW2 A;  4ZWU A;  2BB7 A;  3TAV A;  2B3K A;  4ZNG A;  3Q6D A;  2ADU A;  2BWY A;  2DFI A;  1R5G A;  3MX6 A;  5E5B A;  2NQ6 A;  2GG8 A;  4FO7 A;  3RVA A;  1B59 A;  4U6J A;  1W2M A;  4FKC A;  2B3L A;  4S2T P;  1MAT A;  2GU6 A;  1C24 A;  4FLI A;  3L7G A;  1XGO A;  2B3H A;  1N51 A;  2P98 A;  2V6C A;  4RGZ 1;  4A6V A;  2Q92 A;  1KP0 A;  1WY2 A;  2Q96 A;  2BWW A;  4MAT A;  1WBQ A;  2V3Y A;  1A16 A;  2GG9 A;  4JUQ A;  4U70 A;  3TB5 A;  2NQ7 A;  4QR8 A;  1KQ0 A;  4RZZ A;  4U6W A;  1QXY A;  2BHD A;  4IEC A;  2BHB A;  2G6P A;  1KQ9 A;  2Q8K A;  2GGC A;  3ROR A;  2EVO A;  4ZWP A;  1YW7 A;  1PV9 A;  2GG3 A;  2P99 A;  4IU6 A;  3BIT A;  4R60 A;  4U75 A;  3MR1 A;  2GU4 A;  4FO8 A;  3CB6 A;  2GG0 A;  4OOK A;  3FM3 A;  1JAW A;  2V3Z A;  3PKD A;  2GG2 A;  3PKE A;  3BIP A;  5CDV A;  1W7V A;  5CDE A;  2MAT A;  4U71 A;  3BIQ A;  4A6W A;  1QXW A;  5CIK A;  1XNZ A;  3PKB A;  4U73 A;  1WN1 A;  1BN5 A;  1C21 A;  1C22 A;  2BWS A;  3IU9 A;  2P9A A;  1YW8 A;  4IKS A;  1B6A A;  2EVM A;  2EA2 A;  3IU8 A;  3IU7 A;  2GU7 A;  4U6Z A;  5CDL A;  4IDY A;  4ZWO A;  4Z7M A;  4KM3 A;  3S6B A;  4FLJ A;  2ZSG A;  2BWU A;  4IKT A;  2BH3 A;  2GZ5 A;  1WL9 A;  5JI6 A;  3MAT A;  2GTX A;  5D6E A;  1WKM A;  4FLK A;  4S00 A;  4PNC A;  1QXZ A;  1WL6 A;  2OAZ A;  1O0X A;  2EA4 A;  4IKR A;  1YVM A;  2Q95 A;  2BHC A;  4U6E A;  3PKA A;  2BWV A;  5D6F A;  2Q93 A;  1QZY A;  4IPA A;  1R58 A;  4U69 A;  2BWT A;  5JFR A;  2GG7 A;  3IG4 A;  5FCF A;  1BOA A;  1M35 A;  2GG5 A;  2HOW A;  1R5H A;  3D27 A;  4HXX A;  5CE6 A;  1YW9 A;  2GGB A;  5CLS A;  4FUK A;  1C27 A;  5FCH A;  2V3X A; 
#chains in the Genus database with same CATH homology
 4IKU A;  2OKN A;  2BWX A;  3CB5 A;  3PKC A;  1XGS A;  1Y1N A;  4S01 A;  4IF7 A;  1XGN A;  2BN7 A;  2GA2 A;  1YJ3 A;  1WLR A;  5CNX A;  2EVC A;  1XGM A;  3FMR A;  2BHA A;  2GU5 A;  3L24 A;  4U1B A;  4U6C A;  2Q94 A;  4EGE A;  4RZY A;  4B28 A;  1CHM A;  3CTZ A;  4FLL A;  4U76 A;  5JHU A;  4S2R P;  1C23 A;  3FMQ A;  4PV4 A;  2IW2 A;  4ZWU A;  2BB7 A;  3TAV A;  2B3K A;  4ZNG A;  3Q6D A;  2ADU A;  2BWY A;  2DFI A;  1R5G A;  3MX6 A;  5E5B A;  2NQ6 A;  2GG8 A;  4FO7 A;  3RVA A;  1B59 A;  4U6J A;  1W2M A;  4FKC A;  2B3L A;  4S2T P;  1MAT A;  2GU6 A;  1C24 A;  4FLI A;  3L7G A;  1XGO A;  2B3H A;  1N51 A;  2P98 A;  2V6C A;  4RGZ 1;  4A6V A;  2Q92 A;  1KP0 A;  1WY2 A;  2Q96 A;  2BWW A;  4MAT A;  1WBQ A;  2V3Y A;  1A16 A;  2GG9 A;  4JUQ A;  4U70 A;  3TB5 A;  2NQ7 A;  4QR8 A;  1KQ0 A;  4RZZ A;  4U6W A;  1QXY A;  2BHD A;  4IEC A;  2BHB A;  2G6P A;  1KQ9 A;  2Q8K A;  2GGC A;  3ROR A;  2EVO A;  4ZWP A;  1YW7 A;  1PV9 A;  2GG3 A;  2P99 A;  4IU6 A;  3BIT A;  4R60 A;  4U75 A;  3MR1 A;  2GU4 A;  4FO8 A;  3CB6 A;  2GG0 A;  4OOK A;  3FM3 A;  1JAW A;  2V3Z A;  3PKD A;  2GG2 A;  3PKE A;  3BIP A;  5CDV A;  1W7V A;  5CDE A;  2MAT A;  4U71 A;  3BIQ A;  4A6W A;  1QXW A;  5CIK A;  1XNZ A;  3PKB A;  4U73 A;  1WN1 A;  1BN5 A;  1C21 A;  1C22 A;  2BWS A;  3IU9 A;  2P9A A;  1YW8 A;  4IKS A;  1B6A A;  2EVM A;  2EA2 A;  3IU8 A;  3IU7 A;  2GU7 A;  4U6Z A;  5CDL A;  4IDY A;  4ZWO A;  4Z7M A;  4KM3 A;  3S6B A;  4FLJ A;  2ZSG A;  2BWU A;  4IKT A;  2BH3 A;  2GZ5 A;  1WL9 A;  5JI6 A;  3MAT A;  2GTX A;  5D6E A;  1WKM A;  4FLK A;  4S00 A;  4PNC A;  1QXZ A;  1WL6 A;  2OAZ A;  1O0X A;  2EA4 A;  4IKR A;  1YVM A;  2Q95 A;  2BHC A;  4U6E A;  3PKA A;  2BWV A;  5D6F A;  2Q93 A;  1QZY A;  4IPA A;  1R58 A;  4U69 A;  2BWT A;  5JFR A;  2GG7 A;  3IG4 A;  5FCF A;  1BOA A;  1M35 A;  2GG5 A;  2HOW A;  1R5H A;  3D27 A;  4HXX A;  5CE6 A;  1YW9 A;  2GGB A;  5CLS A;  4FUK A;  1C27 A;  5FCH A;  2V3X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...