1MATA

Structure of the cobalt-dependent methionine aminopeptidase from escherichia coli: a new type of proteolytic enzyme
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
263
structure length
263
Chain Sequence
AISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the cobalt-dependent methionine aminopeptidase from Escherichia coli: a new type of proteolytic enzyme.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase(alpha-aminoacylpeptide)
molecule keywords METHIONYL AMINOPEPTIDASE
total genus 77
structure length 263
sequence length 263
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 1992-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 1matA00
4ZWUA 1W7VA 2GGBA 4KM3A 2BH3A 4OOKA 3IU9A 3RVAA 1C21A 2V3ZA 4U70A 2GG5A 1C23A 1M35A 1KQ0A 1R58A 1Y1NA 3MR1A 2Q92A 4IU6A 2GG9A 3L24A 3CB5A 2OAZA 2GZ5A 4U6EA 2ZSGA 2B3LA 4IKSA 1B59A 4IF7A 4MATA 4S00A 5CIKA 3RORA 2P9AA 1YW7A 4U6WA 1R5GA 2P98A 5CDVA 2BN7A 1XGOA 1YVMA 3PKCA 4ZNGA 4FLIA 1YJ3A 5JI6A 1KQ9A 1YW9A 2B3KA 4A6WA 1YW8A 5JHUA 5CLSA 5CDEA 2GA2A 3BIPA 4FKCA 1XNZA 1N51A 2Q8KA 2BWVA 2MATA 4Z7MA 1W2MA 1B6AA 2G6PA 1XGSA 3D27A 4U76A 3MX6A 5CE6A 5JFRA 2GG8A 4U75A 4U69A 4U1BA 2HOWA 2BHBA 3FMQA 4RZZA 1A16A 3IU7A 3PKEA 2BWSA 4FLJA 2NQ6A 3MATA 1JAWA 4RZYA 1QZYA 4S2RP 2EVCA 2V3YA 4B28A 1C24A 4A6VA 1KP0A 2GU4A 4FUKA 1PV9A 2NQ7A 2GG2A 1C27A 4IKUA 4IDYA 3PKDA 2BHDA 3L7GA 2GG3A 1WN1A 3IG4A 2GU7A 1QXZA 2V3XA 4FLLA 3Q6DA 3TAVA 5CNXA 2Q94A 3FM3A 4ZWOA 2BWXA 2GGCA 3CB6A 1BN5A 1QXWA 2BWUA 2BB7A 5FCFA 4ZWPA 3FMRA 4IKTA 4U6JA 3CTZA 4IKRA 1QXYA 2EA4A 2EVOA 4RGZ1 1WY2A 5E5BA 2OKNA 2P99A 2GU5A 1WKMA 3S6BA 4R60A 2Q96A 4U71A 4JUQA 4EGEA 1XGMA 3PKAA 2BWYA 4FO8A 3BIQA 2BWTA 1WL9A 4PV4A 5FCHA 1WBQA 2GG0A 3IU8A 2IW2A 1WLRA 1O0XA 2EVMA 3PKBA 2Q93A 3TB5A 2BWWA 2DFIA 1XGNA 4FLKA 5D6EA 4U73A 1BOAA 2BHCA 4HXXA 1MATA 4FO7A 1C22A 1WL6A 2EA2A 1R5HA 4S2TP 4S01A 5D6FA 3BITA 4QR8A 2V6CA 4U6CA 2GTXA 2GU6A 2ADUA 2B3HA 4IECA 4IPAA 4PNCA 4U6ZA 2Q95A 1CHMA 2BHAA 5CDLA 2GG7A
chains in the Genus database with same CATH superfamily
4ZWUA 1W7VA 2GGBA 4KM3A 2BH3A 4OOKA 3IU9A 3RVAA 1C21A 2V3ZA 4U70A 2GG5A 1C23A 1M35A 1KQ0A 1R58A 1Y1NA 3MR1A 2Q92A 4IU6A 2GG9A 3L24A 3CB5A 2OAZA 2GZ5A 4U6EA 2ZSGA 2B3LA 4IKSA 1B59A 4IF7A 4MATA 4S00A 5CIKA 3RORA 2P9AA 1YW7A 4U6WA 1R5GA 2P98A 5CDVA 2BN7A 1XGOA 1YVMA 3PKCA 4ZNGA 4FLIA 1YJ3A 5JI6A 1KQ9A 1YW9A 2B3KA 4A6WA 1YW8A 5JHUA 5CLSA 5CDEA 2GA2A 3BIPA 4FKCA 1XNZA 1N51A 2Q8KA 2BWVA 2MATA 4Z7MA 1W2MA 1B6AA 2G6PA 1XGSA 3D27A 4U76A 3MX6A 5CE6A 5JFRA 2GG8A 4U75A 4U69A 4U1BA 2HOWA 2BHBA 3FMQA 4RZZA 1A16A 3IU7A 3PKEA 2BWSA 4FLJA 2NQ6A 3MATA 1JAWA 4RZYA 1QZYA 4S2RP 2EVCA 2V3YA 4B28A 1C24A 4A6VA 1KP0A 2GU4A 4FUKA 1PV9A 2NQ7A 2GG2A 1C27A 4IKUA 4IDYA 3PKDA 2BHDA 3L7GA 2GG3A 1WN1A 3IG4A 2GU7A 1QXZA 2V3XA 4FLLA 3Q6DA 3TAVA 5CNXA 2Q94A 3FM3A 4ZWOA 2BWXA 2GGCA 3CB6A 1BN5A 1QXWA 2BWUA 2BB7A 5FCFA 4ZWPA 3FMRA 4IKTA 4U6JA 3CTZA 4IKRA 1QXYA 2EA4A 2EVOA 4RGZ1 1WY2A 5E5BA 2OKNA 2P99A 2GU5A 1WKMA 3S6BA 4R60A 2Q96A 4U71A 4JUQA 4EGEA 1XGMA 3PKAA 2BWYA 4FO8A 3BIQA 2BWTA 1WL9A 4PV4A 5FCHA 1WBQA 2GG0A 3IU8A 2IW2A 1WLRA 1O0XA 2EVMA 3PKBA 2Q93A 3TB5A 2BWWA 2DFIA 1XGNA 4FLKA 5D6EA 4U73A 1BOAA 2BHCA 4HXXA 1MATA 4FO7A 1C22A 1WL6A 2EA2A 1R5HA 4S2TP 4S01A 5D6FA 3BITA 4QR8A 2V6CA 4U6CA 2GTXA 2GU6A 2ADUA 2B3HA 4IECA 4IPAA 4PNCA 4U6ZA 2Q95A 1CHMA 2BHAA 5CDLA 2GG7A
chains in the Genus database with same CATH topology
4ZWUA 1W7VA 2GGBA 4KM3A 2BH3A 4OOKA 3IU9A 3RVAA 1C21A 2V3ZA 4U70A 2GG5A 1C23A 1M35A 1KQ0A 1R58A 1Y1NA 3MR1A 2Q92A 4IU6A 2GG9A 3L24A 3CB5A 2OAZA 2GZ5A 4U6EA 2ZSGA 2B3LA 4IKSA 1B59A 4IF7A 4MATA 4S00A 5CIKA 3RORA 2P9AA 1YW7A 4U6WA 1R5GA 2P98A 5CDVA 2BN7A 1XGOA 1YVMA 3PKCA 4ZNGA 4FLIA 1YJ3A 5JI6A 1KQ9A 1YW9A 2B3KA 4A6WA 1YW8A 5JHUA 5CLSA 5CDEA 2GA2A 3BIPA 4FKCA 1XNZA 1N51A 2Q8KA 2BWVA 2MATA 4Z7MA 1W2MA 1B6AA 2G6PA 1XGSA 3D27A 4U76A 3MX6A 5CE6A 5JFRA 2GG8A 4U75A 4U69A 4U1BA 2HOWA 2BHBA 3FMQA 4RZZA 1A16A 3IU7A 3PKEA 2BWSA 4FLJA 2NQ6A 3MATA 1JAWA 4RZYA 1QZYA 4S2RP 2EVCA 2V3YA 4B28A 1C24A 4A6VA 1KP0A 2GU4A 4FUKA 1PV9A 2NQ7A 2GG2A 1C27A 4IKUA 4IDYA 3PKDA 2BHDA 3L7GA 2GG3A 1WN1A 3IG4A 2GU7A 1QXZA 2V3XA 4FLLA 3Q6DA 3TAVA 5CNXA 2Q94A 3FM3A 4ZWOA 2BWXA 2GGCA 3CB6A 1BN5A 1QXWA 2BWUA 2BB7A 5FCFA 4ZWPA 3FMRA 4IKTA 4U6JA 3CTZA 4IKRA 1QXYA 2EA4A 2EVOA 4RGZ1 1WY2A 5E5BA 2OKNA 2P99A 2GU5A 1WKMA 3S6BA 4R60A 2Q96A 4U71A 4JUQA 4EGEA 1XGMA 3PKAA 2BWYA 4FO8A 3BIQA 2BWTA 1WL9A 4PV4A 5FCHA 1WBQA 2GG0A 3IU8A 2IW2A 1WLRA 1O0XA 2EVMA 3PKBA 2Q93A 3TB5A 2BWWA 2DFIA 1XGNA 4FLKA 5D6EA 4U73A 1BOAA 2BHCA 4HXXA 1MATA 4FO7A 1C22A 1WL6A 2EA2A 1R5HA 4S2TP 4S01A 5D6FA 3BITA 4QR8A 2V6CA 4U6CA 2GTXA 2GU6A 2ADUA 2B3HA 4IECA 4IPAA 4PNCA 4U6ZA 2Q95A 1CHMA 2BHAA 5CDLA 2GG7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZWU A;  1W7V A;  2GGB A;  4KM3 A;  2BH3 A;  4OOK A;  3IU9 A;  3RVA A;  1C21 A;  2V3Z A;  4U70 A;  2GG5 A;  1C23 A;  1M35 A;  1KQ0 A;  1R58 A;  1Y1N A;  3MR1 A;  2Q92 A;  4IU6 A;  2GG9 A;  3L24 A;  3CB5 A;  2OAZ A;  2GZ5 A;  4U6E A;  2ZSG A;  2B3L A;  4IKS A;  1B59 A;  4IF7 A;  4MAT A;  4S00 A;  5CIK A;  3ROR A;  2P9A A;  1YW7 A;  4U6W A;  1R5G A;  2P98 A;  5CDV A;  2BN7 A;  1XGO A;  1YVM A;  3PKC A;  4ZNG A;  4FLI A;  1YJ3 A;  5JI6 A;  1KQ9 A;  1YW9 A;  2B3K A;  4A6W A;  1YW8 A;  5JHU A;  5CLS A;  5CDE A;  2GA2 A;  3BIP A;  4FKC A;  1XNZ A;  1N51 A;  2Q8K A;  2BWV A;  2MAT A;  4Z7M A;  1W2M A;  1B6A A;  2G6P A;  1XGS A;  3D27 A;  4U76 A;  3MX6 A;  5CE6 A;  5JFR A;  2GG8 A;  4U75 A;  4U69 A;  4U1B A;  2HOW A;  2BHB A;  3FMQ A;  4RZZ A;  1A16 A;  3IU7 A;  3PKE A;  2BWS A;  4FLJ A;  2NQ6 A;  3MAT A;  1JAW A;  4RZY A;  1QZY A;  4S2R P;  2EVC A;  2V3Y A;  4B28 A;  1C24 A;  4A6V A;  1KP0 A;  2GU4 A;  4FUK A;  1PV9 A;  2NQ7 A;  2GG2 A;  1C27 A;  4IKU A;  4IDY A;  3PKD A;  2BHD A;  3L7G A;  2GG3 A;  1WN1 A;  3IG4 A;  2GU7 A;  1QXZ A;  2V3X A;  4FLL A;  3Q6D A;  3TAV A;  5CNX A;  2Q94 A;  3FM3 A;  4ZWO A;  2BWX A;  2GGC A;  3CB6 A;  1BN5 A;  1QXW A;  2BWU A;  2BB7 A;  5FCF A;  4ZWP A;  3FMR A;  4IKT A;  4U6J A;  3CTZ A;  4IKR A;  1QXY A;  2EA4 A;  2EVO A;  4RGZ 1;  1WY2 A;  5E5B A;  2OKN A;  2P99 A;  2GU5 A;  1WKM A;  3S6B A;  4R60 A;  2Q96 A;  4U71 A;  4JUQ A;  4EGE A;  1XGM A;  3PKA A;  2BWY A;  4FO8 A;  3BIQ A;  2BWT A;  1WL9 A;  4PV4 A;  5FCH A;  1WBQ A;  2GG0 A;  3IU8 A;  2IW2 A;  1WLR A;  1O0X A;  2EVM A;  3PKB A;  2Q93 A;  3TB5 A;  2BWW A;  2DFI A;  1XGN A;  4FLK A;  5D6E A;  4U73 A;  1BOA A;  2BHC A;  4HXX A;  1MAT A;  4FO7 A;  1C22 A;  1WL6 A;  2EA2 A;  1R5H A;  4S2T P;  4S01 A;  5D6F A;  3BIT A;  4QR8 A;  2V6C A;  4U6C A;  2GTX A;  2GU6 A;  2ADU A;  2B3H A;  4IEC A;  4IPA A;  4PNC A;  4U6Z A;  2Q95 A;  1CHM A;  2BHA A;  5CDL A;  2GG7 A; 
#chains in the Genus database with same CATH topology
 4ZWU A;  1W7V A;  2GGB A;  4KM3 A;  2BH3 A;  4OOK A;  3IU9 A;  3RVA A;  1C21 A;  2V3Z A;  4U70 A;  2GG5 A;  1C23 A;  1M35 A;  1KQ0 A;  1R58 A;  1Y1N A;  3MR1 A;  2Q92 A;  4IU6 A;  2GG9 A;  3L24 A;  3CB5 A;  2OAZ A;  2GZ5 A;  4U6E A;  2ZSG A;  2B3L A;  4IKS A;  1B59 A;  4IF7 A;  4MAT A;  4S00 A;  5CIK A;  3ROR A;  2P9A A;  1YW7 A;  4U6W A;  1R5G A;  2P98 A;  5CDV A;  2BN7 A;  1XGO A;  1YVM A;  3PKC A;  4ZNG A;  4FLI A;  1YJ3 A;  5JI6 A;  1KQ9 A;  1YW9 A;  2B3K A;  4A6W A;  1YW8 A;  5JHU A;  5CLS A;  5CDE A;  2GA2 A;  3BIP A;  4FKC A;  1XNZ A;  1N51 A;  2Q8K A;  2BWV A;  2MAT A;  4Z7M A;  1W2M A;  1B6A A;  2G6P A;  1XGS A;  3D27 A;  4U76 A;  3MX6 A;  5CE6 A;  5JFR A;  2GG8 A;  4U75 A;  4U69 A;  4U1B A;  2HOW A;  2BHB A;  3FMQ A;  4RZZ A;  1A16 A;  3IU7 A;  3PKE A;  2BWS A;  4FLJ A;  2NQ6 A;  3MAT A;  1JAW A;  4RZY A;  1QZY A;  4S2R P;  2EVC A;  2V3Y A;  4B28 A;  1C24 A;  4A6V A;  1KP0 A;  2GU4 A;  4FUK A;  1PV9 A;  2NQ7 A;  2GG2 A;  1C27 A;  4IKU A;  4IDY A;  3PKD A;  2BHD A;  3L7G A;  2GG3 A;  1WN1 A;  3IG4 A;  2GU7 A;  1QXZ A;  2V3X A;  4FLL A;  3Q6D A;  3TAV A;  5CNX A;  2Q94 A;  3FM3 A;  4ZWO A;  2BWX A;  2GGC A;  3CB6 A;  1BN5 A;  1QXW A;  2BWU A;  2BB7 A;  5FCF A;  4ZWP A;  3FMR A;  4IKT A;  4U6J A;  3CTZ A;  4IKR A;  1QXY A;  2EA4 A;  2EVO A;  4RGZ 1;  1WY2 A;  5E5B A;  2OKN A;  2P99 A;  2GU5 A;  1WKM A;  3S6B A;  4R60 A;  2Q96 A;  4U71 A;  4JUQ A;  4EGE A;  1XGM A;  3PKA A;  2BWY A;  4FO8 A;  3BIQ A;  2BWT A;  1WL9 A;  4PV4 A;  5FCH A;  1WBQ A;  2GG0 A;  3IU8 A;  2IW2 A;  1WLR A;  1O0X A;  2EVM A;  3PKB A;  2Q93 A;  3TB5 A;  2BWW A;  2DFI A;  1XGN A;  4FLK A;  5D6E A;  4U73 A;  1BOA A;  2BHC A;  4HXX A;  1MAT A;  4FO7 A;  1C22 A;  1WL6 A;  2EA2 A;  1R5H A;  4S2T P;  4S01 A;  5D6F A;  3BIT A;  4QR8 A;  2V6C A;  4U6C A;  2GTX A;  2GU6 A;  2ADU A;  2B3H A;  4IEC A;  4IPA A;  4PNC A;  4U6Z A;  2Q95 A;  1CHM A;  2BHA A;  5CDL A;  2GG7 A; 
#chains in the Genus database with same CATH homology
 4ZWU A;  1W7V A;  2GGB A;  4KM3 A;  2BH3 A;  4OOK A;  3IU9 A;  3RVA A;  1C21 A;  2V3Z A;  4U70 A;  2GG5 A;  1C23 A;  1M35 A;  1KQ0 A;  1R58 A;  1Y1N A;  3MR1 A;  2Q92 A;  4IU6 A;  2GG9 A;  3L24 A;  3CB5 A;  2OAZ A;  2GZ5 A;  4U6E A;  2ZSG A;  2B3L A;  4IKS A;  1B59 A;  4IF7 A;  4MAT A;  4S00 A;  5CIK A;  3ROR A;  2P9A A;  1YW7 A;  4U6W A;  1R5G A;  2P98 A;  5CDV A;  2BN7 A;  1XGO A;  1YVM A;  3PKC A;  4ZNG A;  4FLI A;  1YJ3 A;  5JI6 A;  1KQ9 A;  1YW9 A;  2B3K A;  4A6W A;  1YW8 A;  5JHU A;  5CLS A;  5CDE A;  2GA2 A;  3BIP A;  4FKC A;  1XNZ A;  1N51 A;  2Q8K A;  2BWV A;  2MAT A;  4Z7M A;  1W2M A;  1B6A A;  2G6P A;  1XGS A;  3D27 A;  4U76 A;  3MX6 A;  5CE6 A;  5JFR A;  2GG8 A;  4U75 A;  4U69 A;  4U1B A;  2HOW A;  2BHB A;  3FMQ A;  4RZZ A;  1A16 A;  3IU7 A;  3PKE A;  2BWS A;  4FLJ A;  2NQ6 A;  3MAT A;  1JAW A;  4RZY A;  1QZY A;  4S2R P;  2EVC A;  2V3Y A;  4B28 A;  1C24 A;  4A6V A;  1KP0 A;  2GU4 A;  4FUK A;  1PV9 A;  2NQ7 A;  2GG2 A;  1C27 A;  4IKU A;  4IDY A;  3PKD A;  2BHD A;  3L7G A;  2GG3 A;  1WN1 A;  3IG4 A;  2GU7 A;  1QXZ A;  2V3X A;  4FLL A;  3Q6D A;  3TAV A;  5CNX A;  2Q94 A;  3FM3 A;  4ZWO A;  2BWX A;  2GGC A;  3CB6 A;  1BN5 A;  1QXW A;  2BWU A;  2BB7 A;  5FCF A;  4ZWP A;  3FMR A;  4IKT A;  4U6J A;  3CTZ A;  4IKR A;  1QXY A;  2EA4 A;  2EVO A;  4RGZ 1;  1WY2 A;  5E5B A;  2OKN A;  2P99 A;  2GU5 A;  1WKM A;  3S6B A;  4R60 A;  2Q96 A;  4U71 A;  4JUQ A;  4EGE A;  1XGM A;  3PKA A;  2BWY A;  4FO8 A;  3BIQ A;  2BWT A;  1WL9 A;  4PV4 A;  5FCH A;  1WBQ A;  2GG0 A;  3IU8 A;  2IW2 A;  1WLR A;  1O0X A;  2EVM A;  3PKB A;  2Q93 A;  3TB5 A;  2BWW A;  2DFI A;  1XGN A;  4FLK A;  5D6E A;  4U73 A;  1BOA A;  2BHC A;  4HXX A;  1MAT A;  4FO7 A;  1C22 A;  1WL6 A;  2EA2 A;  1R5H A;  4S2T P;  4S01 A;  5D6F A;  3BIT A;  4QR8 A;  2V6C A;  4U6C A;  2GTX A;  2GU6 A;  2ADU A;  2B3H A;  4IEC A;  4IPA A;  4PNC A;  4U6Z A;  2Q95 A;  1CHM A;  2BHA A;  5CDL A;  2GG7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...