1MATA

Structure of the cobalt-dependent methionine aminopeptidase from escherichia coli: a new type of proteolytic enzyme
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
263
structure length
263
Chain Sequence
AISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords METHIONYL AMINOPEPTIDASE
publication title Structure of the cobalt-dependent methionine aminopeptidase from Escherichia coli: a new type of proteolytic enzyme.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase(alpha-aminoacylpeptide)
total genus 77
structure length 263
sequence length 263
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 1992-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 1matA00
5JI6A 2NQ6A 3IG4A 4EGEA 1QXYA 2G6PA 2Q95A 1XGOA 2BWWA 2P9AA 3Q6DA 5CDEA 2GG9A 1YW8A 2GG3A 2GU6A 3RVAA 3PKEA 1QXWA 4IKSA 4S00A 2GU4A 1KQ9A 4A6WA 4IPAA 1M35A 4FLKA 5CNXA 1BOAA 2GGCA 1R5GA 4IKRA 5E5BA 2BWXA 4ZWOA 1C21A 4ZWPA 4IKTA 1CHMA 5JHUA 4U70A 2BWYA 4U6CA 2GG8A 2EA4A 2EA2A 2EVMA 4S01A 2GG2A 1KP0A 2BWSA 3BIQA 4MATA 2P99A 1MATA 3FM3A 4FUKA 2GG7A 3D27A 2IW2A 2MATA 4U6ZA 4ZNGA 5CDVA 2EVOA 1C23A 1WL6A 5FCFA 1R5HA 2ZSGA 1O0XA 2Q92A 2BH3A 3CTZA 3PKBA 1W7VA 2Q96A 1QXZA 3L7GA 4U73A 4FLLA 3MR1A 4IKUA 4IU6A 4S2RP 2GU7A 2GG0A 1XNZA 4IDYA 4KM3A 2B3HA 4FO8A 2BHDA 2V3YA 4Z7MA 3CB6A 4U69A 2GZ5A 1XGNA 2BHBA 3PKAA 4U1BA 1WKMA 1WL9A 4U6EA 4U6WA 2V3ZA 1PV9A 4QR8A 4U75A 1YW7A 4U71A 4B28A 5CDLA 1WY2A 4ZWUA 3FMRA 1XGSA 2V6CA 4A6VA 5CE6A 2B3KA 1YVMA 2P98A 3BITA 3RORA 3MX6A 4IF7A 2OAZA 1WLRA 4FKCA 2BWVA 1C24A 4RZYA 1YW9A 1Y1NA 4R60A 1WBQA 1BN5A 3BIPA 3PKCA 3S6BA 3FMQA 2GTXA 1YJ3A 2BB7A 3MATA 4HXXA 3IU8A 1C27A 2V3XA 4IECA 2BWUA 4PV4A 5CIKA 3TAVA 5D6EA 3CB5A 1B59A 2GG5A 1N51A 4U76A 4PNCA 5D6FA 2B3LA 5JFRA 1B6AA 3L24A 2OKNA 2BN7A 3PKDA 1C22A 4JUQA 4FLIA 2BHAA 4OOKA 4S2TP 2GA2A 2BHCA 2NQ7A 3IU9A 2Q8KA 2ADUA 1QZYA 2DFIA 2EVCA 5FCHA 1W2MA 2GU5A 4FLJA 2HOWA 1A16A 1WN1A 2Q94A 4RZZA 3TB5A 1KQ0A 2BWTA 2GGBA 2Q93A 4U6JA 1R58A 3IU7A 1JAWA 4FO7A 1XGMA 5CLSA 4RGZ1
chains in the Genus database with same CATH superfamily
5JI6A 2NQ6A 3IG4A 4EGEA 1QXYA 2G6PA 2Q95A 1XGOA 2BWWA 2P9AA 3Q6DA 5CDEA 2GG9A 1YW8A 2GG3A 2GU6A 3RVAA 3PKEA 1QXWA 4IKSA 4S00A 2GU4A 1KQ9A 4A6WA 4IPAA 1M35A 4FLKA 5CNXA 1BOAA 2GGCA 1R5GA 4IKRA 5E5BA 2BWXA 4ZWOA 1C21A 4ZWPA 4IKTA 1CHMA 5JHUA 4U70A 2BWYA 4U6CA 2GG8A 2EA4A 2EA2A 2EVMA 4S01A 2GG2A 1KP0A 2BWSA 3BIQA 4MATA 2P99A 1MATA 3FM3A 4FUKA 2GG7A 3D27A 2IW2A 2MATA 4U6ZA 4ZNGA 5CDVA 2EVOA 1C23A 1WL6A 5FCFA 1R5HA 2ZSGA 1O0XA 2Q92A 2BH3A 3CTZA 3PKBA 1W7VA 2Q96A 1QXZA 3L7GA 4U73A 4FLLA 3MR1A 4IKUA 4IU6A 4S2RP 2GU7A 2GG0A 1XNZA 4IDYA 4KM3A 2B3HA 4FO8A 2BHDA 2V3YA 4Z7MA 3CB6A 4U69A 2GZ5A 1XGNA 2BHBA 3PKAA 4U1BA 1WKMA 1WL9A 4U6EA 4U6WA 2V3ZA 1PV9A 4QR8A 4U75A 1YW7A 4U71A 4B28A 5CDLA 1WY2A 4ZWUA 3FMRA 1XGSA 2V6CA 4A6VA 5CE6A 2B3KA 1YVMA 2P98A 3BITA 3RORA 3MX6A 4IF7A 2OAZA 1WLRA 4FKCA 2BWVA 1C24A 4RZYA 1YW9A 1Y1NA 4R60A 1WBQA 1BN5A 3BIPA 3PKCA 3S6BA 3FMQA 2GTXA 1YJ3A 2BB7A 3MATA 4HXXA 3IU8A 1C27A 2V3XA 4IECA 2BWUA 4PV4A 5CIKA 3TAVA 5D6EA 3CB5A 1B59A 2GG5A 1N51A 4U76A 4PNCA 5D6FA 2B3LA 5JFRA 1B6AA 3L24A 2OKNA 2BN7A 3PKDA 1C22A 4JUQA 4FLIA 2BHAA 4OOKA 4S2TP 2GA2A 2BHCA 2NQ7A 3IU9A 2Q8KA 2ADUA 1QZYA 2DFIA 2EVCA 5FCHA 1W2MA 2GU5A 4FLJA 2HOWA 1A16A 1WN1A 2Q94A 4RZZA 3TB5A 1KQ0A 2BWTA 2GGBA 2Q93A 4U6JA 1R58A 3IU7A 1JAWA 4FO7A 1XGMA 5CLSA 4RGZ1
chains in the Genus database with same CATH topology
5JI6A 2NQ6A 3IG4A 4EGEA 1QXYA 2G6PA 2Q95A 1XGOA 2BWWA 2P9AA 3Q6DA 5CDEA 2GG9A 1YW8A 2GG3A 2GU6A 3RVAA 3PKEA 1QXWA 4IKSA 4S00A 2GU4A 1KQ9A 4A6WA 4IPAA 1M35A 4FLKA 5CNXA 1BOAA 2GGCA 1R5GA 4IKRA 5E5BA 2BWXA 4ZWOA 1C21A 4ZWPA 4IKTA 1CHMA 5JHUA 4U70A 2BWYA 4U6CA 2GG8A 2EA4A 2EA2A 2EVMA 4S01A 2GG2A 1KP0A 2BWSA 3BIQA 4MATA 2P99A 1MATA 3FM3A 4FUKA 2GG7A 3D27A 2IW2A 2MATA 4U6ZA 4ZNGA 5CDVA 2EVOA 1C23A 1WL6A 5FCFA 1R5HA 2ZSGA 1O0XA 2Q92A 2BH3A 3CTZA 3PKBA 1W7VA 2Q96A 1QXZA 3L7GA 4U73A 4FLLA 3MR1A 4IKUA 4IU6A 4S2RP 2GU7A 2GG0A 1XNZA 4IDYA 4KM3A 2B3HA 4FO8A 2BHDA 2V3YA 4Z7MA 3CB6A 4U69A 2GZ5A 1XGNA 2BHBA 3PKAA 4U1BA 1WKMA 1WL9A 4U6EA 4U6WA 2V3ZA 1PV9A 4QR8A 4U75A 1YW7A 4U71A 4B28A 5CDLA 1WY2A 4ZWUA 3FMRA 1XGSA 2V6CA 4A6VA 5CE6A 2B3KA 1YVMA 2P98A 3BITA 3RORA 3MX6A 4IF7A 2OAZA 1WLRA 4FKCA 2BWVA 1C24A 4RZYA 1YW9A 1Y1NA 4R60A 1WBQA 1BN5A 3BIPA 3PKCA 3S6BA 3FMQA 2GTXA 1YJ3A 2BB7A 3MATA 4HXXA 3IU8A 1C27A 2V3XA 4IECA 2BWUA 4PV4A 5CIKA 3TAVA 5D6EA 3CB5A 1B59A 2GG5A 1N51A 4U76A 4PNCA 5D6FA 2B3LA 5JFRA 1B6AA 3L24A 2OKNA 2BN7A 3PKDA 1C22A 4JUQA 4FLIA 2BHAA 4OOKA 4S2TP 2GA2A 2BHCA 2NQ7A 3IU9A 2Q8KA 2ADUA 1QZYA 2DFIA 2EVCA 5FCHA 1W2MA 2GU5A 4FLJA 2HOWA 1A16A 1WN1A 2Q94A 4RZZA 3TB5A 1KQ0A 2BWTA 2GGBA 2Q93A 4U6JA 1R58A 3IU7A 1JAWA 4FO7A 1XGMA 5CLSA 4RGZ1
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JI6 A;  2NQ6 A;  3IG4 A;  4EGE A;  1QXY A;  2G6P A;  2Q95 A;  1XGO A;  2BWW A;  2P9A A;  3Q6D A;  5CDE A;  2GG9 A;  1YW8 A;  2GG3 A;  2GU6 A;  3RVA A;  3PKE A;  1QXW A;  4IKS A;  4S00 A;  2GU4 A;  1KQ9 A;  4A6W A;  4IPA A;  1M35 A;  4FLK A;  5CNX A;  1BOA A;  2GGC A;  1R5G A;  4IKR A;  5E5B A;  2BWX A;  4ZWO A;  1C21 A;  4ZWP A;  4IKT A;  1CHM A;  5JHU A;  4U70 A;  2BWY A;  4U6C A;  2GG8 A;  2EA4 A;  2EA2 A;  2EVM A;  4S01 A;  2GG2 A;  1KP0 A;  2BWS A;  3BIQ A;  4MAT A;  2P99 A;  1MAT A;  3FM3 A;  4FUK A;  2GG7 A;  3D27 A;  2IW2 A;  2MAT A;  4U6Z A;  4ZNG A;  5CDV A;  2EVO A;  1C23 A;  1WL6 A;  5FCF A;  1R5H A;  2ZSG A;  1O0X A;  2Q92 A;  2BH3 A;  3CTZ A;  3PKB A;  1W7V A;  2Q96 A;  1QXZ A;  3L7G A;  4U73 A;  4FLL A;  3MR1 A;  4IKU A;  4IU6 A;  4S2R P;  2GU7 A;  2GG0 A;  1XNZ A;  4IDY A;  4KM3 A;  2B3H A;  4FO8 A;  2BHD A;  2V3Y A;  4Z7M A;  3CB6 A;  4U69 A;  2GZ5 A;  1XGN A;  2BHB A;  3PKA A;  4U1B A;  1WKM A;  1WL9 A;  4U6E A;  4U6W A;  2V3Z A;  1PV9 A;  4QR8 A;  4U75 A;  1YW7 A;  4U71 A;  4B28 A;  5CDL A;  1WY2 A;  4ZWU A;  3FMR A;  1XGS A;  2V6C A;  4A6V A;  5CE6 A;  2B3K A;  1YVM A;  2P98 A;  3BIT A;  3ROR A;  3MX6 A;  4IF7 A;  2OAZ A;  1WLR A;  4FKC A;  2BWV A;  1C24 A;  4RZY A;  1YW9 A;  1Y1N A;  4R60 A;  1WBQ A;  1BN5 A;  3BIP A;  3PKC A;  3S6B A;  3FMQ A;  2GTX A;  1YJ3 A;  2BB7 A;  3MAT A;  4HXX A;  3IU8 A;  1C27 A;  2V3X A;  4IEC A;  2BWU A;  4PV4 A;  5CIK A;  3TAV A;  5D6E A;  3CB5 A;  1B59 A;  2GG5 A;  1N51 A;  4U76 A;  4PNC A;  5D6F A;  2B3L A;  5JFR A;  1B6A A;  3L24 A;  2OKN A;  2BN7 A;  3PKD A;  1C22 A;  4JUQ A;  4FLI A;  2BHA A;  4OOK A;  4S2T P;  2GA2 A;  2BHC A;  2NQ7 A;  3IU9 A;  2Q8K A;  2ADU A;  1QZY A;  2DFI A;  2EVC A;  5FCH A;  1W2M A;  2GU5 A;  4FLJ A;  2HOW A;  1A16 A;  1WN1 A;  2Q94 A;  4RZZ A;  3TB5 A;  1KQ0 A;  2BWT A;  2GGB A;  2Q93 A;  4U6J A;  1R58 A;  3IU7 A;  1JAW A;  4FO7 A;  1XGM A;  5CLS A;  4RGZ 1; 
#chains in the Genus database with same CATH topology
 5JI6 A;  2NQ6 A;  3IG4 A;  4EGE A;  1QXY A;  2G6P A;  2Q95 A;  1XGO A;  2BWW A;  2P9A A;  3Q6D A;  5CDE A;  2GG9 A;  1YW8 A;  2GG3 A;  2GU6 A;  3RVA A;  3PKE A;  1QXW A;  4IKS A;  4S00 A;  2GU4 A;  1KQ9 A;  4A6W A;  4IPA A;  1M35 A;  4FLK A;  5CNX A;  1BOA A;  2GGC A;  1R5G A;  4IKR A;  5E5B A;  2BWX A;  4ZWO A;  1C21 A;  4ZWP A;  4IKT A;  1CHM A;  5JHU A;  4U70 A;  2BWY A;  4U6C A;  2GG8 A;  2EA4 A;  2EA2 A;  2EVM A;  4S01 A;  2GG2 A;  1KP0 A;  2BWS A;  3BIQ A;  4MAT A;  2P99 A;  1MAT A;  3FM3 A;  4FUK A;  2GG7 A;  3D27 A;  2IW2 A;  2MAT A;  4U6Z A;  4ZNG A;  5CDV A;  2EVO A;  1C23 A;  1WL6 A;  5FCF A;  1R5H A;  2ZSG A;  1O0X A;  2Q92 A;  2BH3 A;  3CTZ A;  3PKB A;  1W7V A;  2Q96 A;  1QXZ A;  3L7G A;  4U73 A;  4FLL A;  3MR1 A;  4IKU A;  4IU6 A;  4S2R P;  2GU7 A;  2GG0 A;  1XNZ A;  4IDY A;  4KM3 A;  2B3H A;  4FO8 A;  2BHD A;  2V3Y A;  4Z7M A;  3CB6 A;  4U69 A;  2GZ5 A;  1XGN A;  2BHB A;  3PKA A;  4U1B A;  1WKM A;  1WL9 A;  4U6E A;  4U6W A;  2V3Z A;  1PV9 A;  4QR8 A;  4U75 A;  1YW7 A;  4U71 A;  4B28 A;  5CDL A;  1WY2 A;  4ZWU A;  3FMR A;  1XGS A;  2V6C A;  4A6V A;  5CE6 A;  2B3K A;  1YVM A;  2P98 A;  3BIT A;  3ROR A;  3MX6 A;  4IF7 A;  2OAZ A;  1WLR A;  4FKC A;  2BWV A;  1C24 A;  4RZY A;  1YW9 A;  1Y1N A;  4R60 A;  1WBQ A;  1BN5 A;  3BIP A;  3PKC A;  3S6B A;  3FMQ A;  2GTX A;  1YJ3 A;  2BB7 A;  3MAT A;  4HXX A;  3IU8 A;  1C27 A;  2V3X A;  4IEC A;  2BWU A;  4PV4 A;  5CIK A;  3TAV A;  5D6E A;  3CB5 A;  1B59 A;  2GG5 A;  1N51 A;  4U76 A;  4PNC A;  5D6F A;  2B3L A;  5JFR A;  1B6A A;  3L24 A;  2OKN A;  2BN7 A;  3PKD A;  1C22 A;  4JUQ A;  4FLI A;  2BHA A;  4OOK A;  4S2T P;  2GA2 A;  2BHC A;  2NQ7 A;  3IU9 A;  2Q8K A;  2ADU A;  1QZY A;  2DFI A;  2EVC A;  5FCH A;  1W2M A;  2GU5 A;  4FLJ A;  2HOW A;  1A16 A;  1WN1 A;  2Q94 A;  4RZZ A;  3TB5 A;  1KQ0 A;  2BWT A;  2GGB A;  2Q93 A;  4U6J A;  1R58 A;  3IU7 A;  1JAW A;  4FO7 A;  1XGM A;  5CLS A;  4RGZ 1; 
#chains in the Genus database with same CATH homology
 5JI6 A;  2NQ6 A;  3IG4 A;  4EGE A;  1QXY A;  2G6P A;  2Q95 A;  1XGO A;  2BWW A;  2P9A A;  3Q6D A;  5CDE A;  2GG9 A;  1YW8 A;  2GG3 A;  2GU6 A;  3RVA A;  3PKE A;  1QXW A;  4IKS A;  4S00 A;  2GU4 A;  1KQ9 A;  4A6W A;  4IPA A;  1M35 A;  4FLK A;  5CNX A;  1BOA A;  2GGC A;  1R5G A;  4IKR A;  5E5B A;  2BWX A;  4ZWO A;  1C21 A;  4ZWP A;  4IKT A;  1CHM A;  5JHU A;  4U70 A;  2BWY A;  4U6C A;  2GG8 A;  2EA4 A;  2EA2 A;  2EVM A;  4S01 A;  2GG2 A;  1KP0 A;  2BWS A;  3BIQ A;  4MAT A;  2P99 A;  1MAT A;  3FM3 A;  4FUK A;  2GG7 A;  3D27 A;  2IW2 A;  2MAT A;  4U6Z A;  4ZNG A;  5CDV A;  2EVO A;  1C23 A;  1WL6 A;  5FCF A;  1R5H A;  2ZSG A;  1O0X A;  2Q92 A;  2BH3 A;  3CTZ A;  3PKB A;  1W7V A;  2Q96 A;  1QXZ A;  3L7G A;  4U73 A;  4FLL A;  3MR1 A;  4IKU A;  4IU6 A;  4S2R P;  2GU7 A;  2GG0 A;  1XNZ A;  4IDY A;  4KM3 A;  2B3H A;  4FO8 A;  2BHD A;  2V3Y A;  4Z7M A;  3CB6 A;  4U69 A;  2GZ5 A;  1XGN A;  2BHB A;  3PKA A;  4U1B A;  1WKM A;  1WL9 A;  4U6E A;  4U6W A;  2V3Z A;  1PV9 A;  4QR8 A;  4U75 A;  1YW7 A;  4U71 A;  4B28 A;  5CDL A;  1WY2 A;  4ZWU A;  3FMR A;  1XGS A;  2V6C A;  4A6V A;  5CE6 A;  2B3K A;  1YVM A;  2P98 A;  3BIT A;  3ROR A;  3MX6 A;  4IF7 A;  2OAZ A;  1WLR A;  4FKC A;  2BWV A;  1C24 A;  4RZY A;  1YW9 A;  1Y1N A;  4R60 A;  1WBQ A;  1BN5 A;  3BIP A;  3PKC A;  3S6B A;  3FMQ A;  2GTX A;  1YJ3 A;  2BB7 A;  3MAT A;  4HXX A;  3IU8 A;  1C27 A;  2V3X A;  4IEC A;  2BWU A;  4PV4 A;  5CIK A;  3TAV A;  5D6E A;  3CB5 A;  1B59 A;  2GG5 A;  1N51 A;  4U76 A;  4PNC A;  5D6F A;  2B3L A;  5JFR A;  1B6A A;  3L24 A;  2OKN A;  2BN7 A;  3PKD A;  1C22 A;  4JUQ A;  4FLI A;  2BHA A;  4OOK A;  4S2T P;  2GA2 A;  2BHC A;  2NQ7 A;  3IU9 A;  2Q8K A;  2ADU A;  1QZY A;  2DFI A;  2EVC A;  5FCH A;  1W2M A;  2GU5 A;  4FLJ A;  2HOW A;  1A16 A;  1WN1 A;  2Q94 A;  4RZZ A;  3TB5 A;  1KQ0 A;  2BWT A;  2GGB A;  2Q93 A;  4U6J A;  1R58 A;  3IU7 A;  1JAW A;  4FO7 A;  1XGM A;  5CLS A;  4RGZ 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...