1MAYA

Beta-trypsin phosphonate inhibited
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-TRYPSIN
publication title Inhibition of trypsin and thrombin by amino(4-amidinophenyl)methanephosphonate diphenyl ester derivatives: X-ray structures and molecular models.
pubmed doi rcsb
molecule tags Hydrolase (serine protease)
total genus 56
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1996-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1mayA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1mayA02
2R0KA 1NPMA 1ID5H 5GDSH 2ALPA 2XC4A 3ZZDA 5A8ZA 3P95A 1GGDB 3RXTA 3LGVA 2HPPH 3A8DA 1C4Y2 1W14U 2Y5GA 1TRMA 3GY3A 1GMCG 2KAIB 1ZSKA 2VIDA 1K9OE 3M3VA 5GJ4B 3RMOH 1FN8A 1TPPA 3BTEE 4ZKNU 2JKHA 6CHAB 5JBAS 5A8YA 1YPMH 2PW8H 1KLJH 1MTNB 1N6YA 3ZVBA 5DG6A 4MPUA 1O2ZA 4BAOB 2BDAA 5T6FA 4IC6A 3MU4A 3ELAH 4JZDH 1TGBA 3P8NA 1GJ4H 2WPKS 1C5YB 1GI6A 3A7YA 4K5ZA 1NFWA 1DS2E 1GGDC 3MH4A 4R0IA 2G52A 2ZQ1A 5AFZH 1TBRH 2Z9JA 4YO9A 1BITA 1TA6A 1QCPA 2EEKA 1PPEE 3HGPA 6CHAC 1MTNC 5LPRA 4BOHA 4DCDA 4IN2A 1JMOH 2H9HA 2Y82A 1W0ZU 1O3GA 1V2TT 3F9GA 2FODA 1GJAB 1EPTB 3TH4H 5FCRA 1AWHB 3LT3A 2ANWA 4CRAA 2PUXB 4UONA 2FTLE 1OWKA 2PTNA 2Z9IA 2O8MA 2BDGA 1G9IE 1FY3A 1K1MA 1K1PA 1FAKH 4WJG2 1EX3A 3OYPA 2ZHEH 1C2DA 1ZPBA 4XSKU 3ZZBA 5GCHG 2DE9A 5E0JA 4RKOB 2VH6A 3SU2A 2A0QB 2VGCB 3BTME 3RXMA 5C5NA 1PPCE 4DIIH 1GHWH 3SJIA 1QURH 4E7NA 4K1EA 4E7RG 1EZQA 3RXLA 1SGQE 5EXNA 1SGRE 3SJ9A 1C5QA 1EPTC 2ULLA 3RU4D 5GXPA 1QBVH 1JIMA 1CBWB 3LGUA 3UNRA 2WPJS 2XBXA 2FLRH 1QR3E 3RXQA 1GI9B 1GDUA 4CRBA 4X6PA 4Q80A 1O5GH 3TGKE 1T31A 1SGPE 1GJCB 3RDZA 4A5TS 2C8ZB 3IG6B 2GTBA 2A5AA 3GY7A 1XXFA 4FUEA 2OBQA 1QY6A 2XBYA 1O2VA 3KF2A 1GL1A 2A45B 1SBWA 5AFYH 2VGCC 5TCAA 1F0RA 1ZPCA 3FZZA 1NT1A 4Y7BA 1YF4A 1AI8H 1MD7A 3A8AA 1IQHA 2BDHA 1SFQB 1CBWC 2BD3A 2HNTC 1NN6A 1ZGVA 1GI5A 2WYJA 1V2VT 1O2MA 1MTUA 2AYWA 5H4IB 3SV2H 1P10A 1TWXB 3RM0H 1MH0A 1VCQA 2BDIA 4A7IB 4AFZA 2QY0B 1C1PA 3LGYA 2W7SA 1OWEA 4NGAH 4GPGA 3UWIA 1V2QT 2GZ7A 1EAIA 2O8UA 1ZMJA 2F9PA 2AEIH 1SSXA 3O8BA 1KY9A 2H2ZA 2KAIA 3FFGA 5HYOA 1ANEA 2EI6A 4INLA 3VB3A 3Q3XA 1Y3UA 2V35A 1ZSLA 3BTQE 1JXPA 5JB9S 2ZTXA 1FZZA 3URCA 3T25A 1KTSB 1A1RA 2ZGHA 1OKXA 1DVAH 1DPOA 2J4IA 1MZAA 1F0SA 5EQRA 8KME2 3UR9A 1S6HA 5CHAB 1QTFA 1C5UA 3QWCH 1Q3XA 1CHOG 3AW1A 5ABWA 1BT7A 1OOKB 4E05H 2HLCA 1LPZB 4D8NA 2VIPA 3S9BA 1PPGE 1C1QA 3VXFH 3F9FA 4IGDA 1CT2E 1HAZB 2PGBB 1THPB 4HTCH 3DT0H 1MTWA 5EPNA 2ZP0H 1SLVB 1XM1A 2A7CA 2V3HH 4XBBA 3U1IB 4X0WU 4BAKB 3MU0A 4TYDA 5JPMH 2XRCA 1HRTH 1TB6H 3KGPA 2AGEX 1PPFE 5DP7A 4X1NU 5DP5A 2XC5A 2C93B 5C2ZA 1EPTA 2J92A 2BTCE 3B9FH 3BG8A 5CHAC 3OX7U 4TWYA 3I29A 4KTUA 2ODPA 3GYLB 1TYNA 3A84A 2BD2A 3HPTB 3RXSA 1S85A 3ATIA 2UWLA 1S81A 4X2VA 5J4QA 3E3TA 1QGFA 1CSOE 2ZHFH 1ABJH 4KTCA 1FNIA 1MU6B 1ELVA 2P3TB 2HNTF 2ZDAH 1TOMH 1GI7B 1PFXC 1OP0A 1AIXH 2Z7FE 1SLWB 1IQIA 1Y3YA 1P11E 1GI3A 1UTMA 1ABIH 3SU6A 4FU9A 4QT8C 1ARBA 1EATA 3ZVDA 4B76A 4BANB 1SLUB 1Z8JB 2GCHG 2A2QH 3P8FA 1SQAA 1BOQA 1C9PA 4NG9H 4K8YA 3EGKH 1Q31A 1LTOA 4FVBA 3BV9B 4NSYA 3SV9A 2CJIA 2GZ8A 2AMDA 2ZQ2A 4X2WA 3A82A 2BVXH 2Z94A 5PTPA 1SFIA 4AGJA 4B73A 4OGXA 1OWHA 4JYUH 4OS6A 3U9AH 3BEUA 1EZXC 5EG4A 2VVCA 1O2GH 3TLOA 2FOEA 3A7XA 1YGCH 1DT2A 3UTUH 4KTSA 1V6DA 1DX5M 3LONA 3BF6H 1ETRH 1KLIH 4ZXYH 3QX5H 3SNDA 1LHCH 1D3TB 1EUFA 5FPTA 1HCGA 1IHSH 3ZVAA 3UREA 3UR6A 2BY6X 1OSSA 2TGPZ 1O33A 1O2JA 3EA9A 1ARCA 3V13A 3CP7A 1P03A 2B8OH 3M7QA 1CQQA 1C5ZB 3OY5U 4BAQB 1V2OT 1SLXB 2BQ7B 3STIA 2ANMH 4ZAEA 5A0CA 3QO6A 3Q76A 5C1XA 1TX8A 1MQ5A 2GKVE 1FY4A 4FUJA 1GHAF 1DANH 1YYY1 2R2WU 3P92A 1YPLH 1P01A 1NM6A 8GCHG 1O5FH 1KXDA 1K21H 1V2NT 4NA8A 2XCFA 3M37A 3F1SB 4MNXA 3RXPA 4OS2A 1C1OA 2HGTH 1C9TA 2OTVA 1ELGA 1HJAB 1WYKA 2FS8A 2UUFB 2O8WA 3K2UA 1C2LA 2I6SA 1BBRH 2Y5HA 3GCOA 1NRSH 3PWBA 1NO9H 4XBDA 3MWIU 3T2NA 2P94A 5EW1H 1JIRA 2ZPSA 2FOHA 5E0HA 2OC7A 2PSYA 1CO7E 4DT7B 2OQUA 1QRWA 1AZZA 4TPIZ 3HK3B 1O3JA 2C4FH 8ESTE 1NRPH 3E0PB 3IWMA 1ZHRA 2CHAB 7GCHF 1G2MA 5C20A 3M3SA 1HAYB 3PV4A 4GCHF 4DGJA 2BLQA 3BTKE 1SOZA 1E0FD 1GBFA 2FXRA 4ZMAH 4ISIH 4X1RU 4AFQA 1UVTH 1C2JA 1S0QA 3OSYA 1UTJA 1VCPA 2LPRA 1HAIH 4UDWH 1HJAC 5JYIA 4MDSA 1XUFA 1UVPA 2QGRA 5EXLA 4K1TA 3VXEH 4DOQA 2ESTE 1E36B 1GHBG 1MTSA 1GBDA 1KLTA 4Z0KA 4B1TA 1SGNE 1C5LH 3KQBA 1W7XH 1F0UA 1GBKA 4NIWA 4K3JA 2CHAC 1E37B 3ZZ7A 1ZRKA 1FIWA 1HUTH 3MNSA 3RLWH 1C1MA 4FUHA 2NWNA 1QIXB 3BTGE 3D49H 1P2NA 1EJAA 4Y7AA 1IQKA 4AGKA 1YCPK 2C8WB 4RKJB 2BMGB 1BMLA 4TY6A 4B75A 2BLVA 2ZIQH 5SGAE 3RMLH 3LJOA 3TITA 2FZZA 1SR5C 4FU7A 2Y80A 2OCVB 3NK8A 5L2ZH 1AVXA 2Y6TA 1GBMA 5T3HA 4DG4A 2XYAA 3RXOA 1G3CA 3HATH 4NIXA 3RXUA 1GI2A 1ZPZA 3Q3KA 1WQVH 5JBBS 2ZHDA 1GJBB 1UO6A 4SGAE 1JRTA 4E06H 3HGNA 4CR9A 5HXFA 3BG4B 1W13U 1EOJA 3A89A 3U1JB 2NU1E 4WMDA 1NFYA 3AW0A 5DP9A 3ZVGA 3NZIA 7ESTE 1UVUH 4Y6DA 2TGAA 2UWOA 1O3AA 2ZGCA 4K60A 2RDLA 4BTUB 1CGHA 1A61H 1SOTA 4GHQA 4X2XA 1Y8TA 2ZCHP 4THNH 2XWAA 4X1PU 6GCHG 2FLBH 1QL8A 2TPIZ 1SGFA 5T6DA 3BN9A 8LPRA 1L4ZA 4D7GA 1UTQA 3FVFB 5FHTA 2ZA5A 2XXLA 3BG4C 2ZCLP 2M5TA 1PYTC 4NZQA 1UVOA 3WY8A 1P09A 5LPFA 4Y8ZA 4BXWA 1Y3VA 1O3NA 2UUKB 4DVAU 3MO9A 1K22H 1G3BA 3L33A 3PTNA 2HOBA 4YLQH 2VH0A 1O3MA 1LVBA 2ZPRA 4Q7ZA 3RXCA 3HKJB 4AN7A 1AN1E 4O03A 1QNJA 1NS3A 1L1GA 3QTVH 3FP8E 3QGJA 3TK6A 3MH7A 3UFAA 1YLCA 1DICA 1AUTC 1BCUH 2OBOA 2HWLB 4I8LA 4CH2B 3TU7H 1F0TA 1GBHA 2IJOB 1FIZA 3MU8A 1CU1A 1UHBB 2ALVA 2R3UA 1GDNA 5L30H 3K65B 1FQ3A 4MQAA 1TPOA 4ISHH 3MTYA 2BOKA 1D3QB 3MNBA 4JYTA 4ZKSU 3S0NA 1ANBA 3SORA 5EGMA 4ZHMU 3TH3H 1MCTA 2ZTZA 1YPHE 3F6UH 1LHGH 2BX4A 3E16B 1BRCE 2EC9H 4FUIA 4MPXA 1GWAA 3PMJA 3BIUH 3L3TA 4NFFA 3SZNA 4FU8A 1ESBA 1VR1H 4DJZB 4AYYB 1EZUC 1LPKB 3M61U 1TPAE 1G36A 1WTHD 2XBWA 1NRQH 3SNCA 5EODA 1LHFH 3E0NB 1MAXA 1UTKA 3W94A 1LHDH 4INHA 1ETTH 2XTTB 1YPEH 4D76A 3TGJE 2SGFE 2IOTA 3RXHA 2CGAA 2GT7A 4OS1A 7LPRA 3GOVB 1QRZA 2ANKH 4UFDH 1FAXA 2GDDA 4Y76A 1HLTH 3SUDA 3PLBA 4HGCA 1MKXK 2EI8A 1V2ST 5B6OA 1DITH 1HAHH 7KMEH 1VITF 2A1DB 4Q7YA 1C2MA 1NC6A 2NU3E 1D3PB 2J95A 2HNTE 3I78A 1MD8A 1YKTA 2ZHQH 1DUEA 2AH4X 1PPBH 3MMGA 2A4OA 3H7TA 2BZAA 1G30B 5I25A 4KKDA 1TNGA 2G55A 1L2EA 1O5AB 3S7HB 1DUAA 2ZGBH 1O30A 3SNEA 1IQNA 1J8AA 2HVXA 1ETSH 1TGNA 4B74A 2UUYA 2G4UA 5L2YH 4WY3A 1GMHF 3LGIA 1GBJA 1T4UH 1GJ7B 1W3CA 4FUDA 1BQYA 1GMDF 1YPHC 4INKA 2QIQA 2G4TA 3V7TA 4CHAB 1A46H 2ZU3A 1UCYK 2D8WA 2SFAA 4I32A 1QFKH 3KQEA 1FY1A 1C1WH 1CE5A 1O5BB 2W7UA 1EZSC 1GHYH 1FLEE 3EYDA 1V2LT 1C1TA 2GX4A 1SVPA 4U32A 1DY8A 3T29A 1C2KA 3T5FH 3QGNB 3DFLA 1DWEH 1FPHH 1O34A 3B8JA 1TNLA 4UFFH 4ISOA 2J38A 3TH2H 1D9IA 3MOCA 1XMNB 2FI5E 2QYIA 3MNXA 3UNQA 1RXPA 4AFUA 2F83A 4TWWA 1B0FA 1FXYA 3O8DA 1SC8U 1A3EH 1KSNA 1QRXA 2BM2A 2OC1A 5F8XA 1MMJN 3MYWA 1H1BA 3ZZCA 5FBEA 3NWUA 1FY8E 2H5CA 4CHAC 1B0EA 3DUXH 4HI3A 4ZHLU 2C3SA 5AVDA 2O8TA 2H5DA 1K1LA 1GMCF 3GDSA 2QF3A 2TIOA 5DP3A 3ZYDA 1UHBA 2BY8X 3RXGA 1O3BA 9LPRA 1O5EH 3U8TH 1QA0A 2GVFA 3SJOA 4X1SU 1WOFA 2FX6A 1EP6A 3A85A 1BTHH 2A7JA 3LGTA 2UWPA 1YBWA 1UK2A 1C5OH 1C5XB 4OS7A 5DP4A 3H5CB 2AFQB 1EP5A 2ZFRH 3ZVFA 1GI8B 3A7ZA 5TCCA 1Y5BT 3ZZAA 4K8BA 4ABEA 3RUOA 2ZGJA 1VJ9U 1VJAU 1GHVH 1MQ6A 3AAUA 1HJ8A 2OQ5A 3TNSA 4DIHH 1C1RA 3DA9B 1DWDH 1THSH 1BIOA 5J4SA 3KNXA 4U30A 1Z6EA 1O3CA 1LPGB 4JMYA 5ETXA 1HBTH 4DW2U 4IW4E 4KGAA 1YCPM 3KEEA 1GI0A 5CE1A 1F5KU 3Q00A 1XUJA 5LGOA 1UTOA 1V2WT 4YOJA 1RS0A 2PKSC 3RM2H 1RJXB 1K2I1 2GDEH 2STBE 3ITIA 1OXGA 1K1NA 2BOHB 3QTOH 2FP7B 1O2SA 2TRMA 3ESTA 2O9QA 2PV9B 3C27B 1AVGH 1C5TA 2AGGX 1MTVA 2ZU2A 1A0LA 4BAMB 3SUFA 1TNIA 1XVMA 1O2KA 1V2JT 4HFPB 2CV3A 4IC5A 5T6GA 1HAOH 5EQSA 3RMMH 4IS5A 1AD8H 1AFQB 1FPCH 2BB4A 2ZFPH 1OYTH 1DLKB 4H42U 3SJ8A 4AZ2B 2BYAX 2FOGA 4ISNA 2GP9B 1G37A 2CF8H 2XBVA 5EW2H 4X6NA 4AB9A 1Y3XA 1ELFA 1P12E 1AU8A 1LHEH 4GHTA 3U8RH 1GCDA 3M36A 1SG8B 3E90B 2ANYA 4JZ1A 1JRSA 4JK5A 3M7UA 2WV4A 3A8BA 1KXCA 1DSTA 2FOAA 5JBCS 1GHAG 1ESAA 2QXGA 3UQVA 1BRBE 1AMHA 1QB1A 1RTFB 5DO4H 1ELDE 3BTFE 3MH6A 1XUGA 1V2UT 1O2IA 1Z1JA 3GY6A 5F8TA 2VIVA 1AFQC 3UOUA 1YM0A 4Y10E 4X6OA 1O3FA 2XC0A 1TGCA 3SJKA 1XXDA 4WXIA 3QN7A 3SUGA 1TONA 3ZZ5A 2FX4A 2TGDA 4D9QA 1AQ7A 3MNCA 1P2OA 1ZRBA 3A88A 5K7RA 5A8XA 3GDVA 3QDZB 1CGIE 4YOGA 5L6NH 1O37A 4Z6AH 5A09A 3FP7E 1C5SA 4FUFA 1FN6A 3LIWA 3EA8A 1SGYE 4GLYA 4MTBA 1HDTH 1HFDA 4O3TA 1GBIA 7GCHG 1TFXA 4JZIA 4O9VA 2YNAA 4A1TA 1C2EA 4NIVA 1BA8B 1XKAC 3RU4T 2JETB 1C2FA 3SUEA 1BMAA 2WPLS 2GD4B 1S5SA 4BXSA 1BDAA 4ZKOU 3A86A 3ZVCA 1NFXA 3FP6E 1IQEA 2WUCA 3K6ZA 4WXVA 1DWBH 3T26A 1ELBA 3U69H 2BVRH 1CGJE 1BJUA 3O8CA 2GCTB 1FDPA 2P3FH 3SV7A 4B2AA 1WV7H 3ZZ8A 1BTUA 3ATMA 3TPIZ 5A0AE 2ZI2H 4R8TB 3SBKA 3A81A 1O35A 3SGAE 3OU0A 1J9CH 1BMMH 4X1QU 3LH1A 3GY8A 2CMYA 2ZEBA 1NZQH 2A4GA 1O2NA 1C2HA 2JETC 3RC4A 1D3DB 1O3LA 2D1JA 1O2TA 4B71A 1Y3WA 1A5HA 1U6QA 4ABJA 2RCEA 1G32B 3PYHA 5E8EH 5JDUB 2GCTC 1B7XB 1C4U2 1QJ6B 1IAUA 1SQTA 1PPHE 3RLYH 1DWCH 1TNHA 1F2SE 4JK6A 3PMBB 2ZDLA 3ATWA 4TPYA 1N8OB 1UCYE 2ZWLH 1HNEE 1NRNH 1H8DH 1ZLRA 3A8CA 1FMGA 3DHKH 2F9BH 3UNSA 1UJ1A 1X7AC 2H9TH 2HALA 2ZCKP 5C1YA 1A7SA 1WBGB 2BX3A 1SI5H 1GPZA 2ZFQH 4LK4A 5GWZA 4I8GA 1BTZA 1XKBC 2VWMA 2BY7X 3A7WA 5JBTA 3G01A 3BSQA 1P2KA 3UUZA 4M7GA 1SGFG 4AORA 4YM9A 1O3PB 1EKBB 1QQ4A 2AMPA 2Z9GA 4Y0ZE 3LGWA 4WF8A 1GL0E 4HZHA 4I8HA 1N8OC 2QCYA 1EASA 1PQAA 3SU3A 5F6MA 1GBLA 2GCHF 3U98H 4YZUA 4ESTE 1QB6A 1W11U 1CHGA 3OY6U 4WMEA 1L1JA 1S0RA 2SNWA 1MKWH 2NU0E 3SHCH 2ZG0H 1BTYA 1QHRB 3RXKA 3ATLA 2FYRA 1C5PA 3MI4A 4ZROA 3A80A 3P70B 3GCTF 2ILNA 1GJDB 1SQOA 4OS5A 3SU5A 4X8TH 1AE8H 2ZPQA 3GDUA 4IBLH 4A6LA 2G51A 2VB0A 1THRH 1MBQA 3EA7A 3SI3H 1PQ7A 2VNTA 1SHYA 4PROA 4CRDA 1W12U 3T27A 2VINA 3JZ2B 2OC8A 4UD9H 4AOQA 1WCZA 2A5IA 1Q2WA 1ZTKA 3A7VA 2G81E 4JZEH 3LDXH 1HYLA 1KYNA 4XDEA 2V6NA 3UQOA 4UE7H 3F68H 3GY5A 3FAOA 3P8GA 1TMTH 4ZKRU 2JH5D 1DFPA 2C90B 1EJMA 1TA2A 3ENSB 1AUJA 4XBCA 1B5GH 1GG6B 1BTWA 1AWFH 4CRGA 1TMUH 2SGEE 1TAWA 1IQLA 1ZHMA 2AIQA 3BTTE 2B5TB 3LPRA 3BEIB 1HXFH 1YP9A 1O2OA 5EOKA 3URDA 1BBRK 1ZMNA 2ZGXH 1Z71A 1OWDA 1S82A 3A83A 4SGBE 8GCHF 4XE4A 2FMJA 1ORFA 1RRKA 3D23A 2QAAA 3LC3A 1GI1A 2BD4A 1BMNH 1P3CA 1C1SA 2NU2E 4AB8A 2H1UA 1O2RA 1LKAA 1BUIA 2VVVA 3UWJH 3B23B 5E2PA 1T32A 1P2IA 3VEQB 2AGIX 4Y0YE 1O2HA 2Y7ZA 1HV7A 1SMFE 1DY9A 2P93A 1K1OA 3ZZ4A 1CA8B 3L6PA 3RXEA 2TGTA 2BXUH 1UK3A 5EQQA 1GG6C 1XVOA 2RA3A 1ZJDA 4ISLA 1WSSH 1TMBH 3LKWA 1O2YA 4B2CA 4NWKA 2Q1JA 1LKBA 2V0BA 4GAWA 4LOYH 1Y5UT 3QZRA 1AGJA 5FBIA 5K0HA 1HB0B 2TBSA 1SPJA 2XCNA 3ZZ3A 3LC5A 2QXHA 1AHTH 1P04A 3U8OH 1C1NA 1MKXH 1TX7A 3S7KB 1YPGH 4MPVA 4A1XA 2GMTB 4MG3A 3DFJA 3RP2A 1P9SA 4X8VH 5EPYA 1GJ8B 3HKIB 1KIGH 1GBBA 5IYTA 1V2RT 1ANDA 1E34B 1GMHG 2GT8A 2Z6BD 3I77A 2FOFA 4ZH8A 2P8OB 5E2OA 3TJUA 1HPGA 1EOLA 4CBOA 2Q6FA 1JWTA 1O2QA 1ZYOA 3CS7A 1ZGIA 4J2YB 1DOJA 1W10U 3M5LA 1J14A 5FXLA 2GMTC 1GI4A 1QB9A 2LNCA 1TBZH 1W8BH 2ZFSA 2A4RA 3H7OA 1QBNA 2BDBA 2QXIA 1AE5A 2QXJA 2ZKSA 1K28D 5G4BA 2BDYA 3PMAB 2B0FA 3SW2B 3RC5A 2ODQA 4ABGA 2P8OC 1EJNA 1LVOA 1V3XA 2ZNKH 3GCHB 3QUMP 4WMFA 1P3EA 1O38A 1T8MA 4I31A 1OWIA 3Q77A 4D7FA 3M35A 1TBQH 1YPJH 4AX9H 2FI3E 1ZJKA 5DKMA 1DXWA 1SGCA 3RC6A 1A2CH 1QL9A 5ESBA 3V12A 1JBUH 3R0FA 3VGCB 4ABBA 3SGBE 1RTLA 4UFGH 2WPMS 1AB9B 1LMWB 2Q6GA 4D9RA 2PUQH 1NY22 3EAJA 3PO1B 6GCHF 1S84A 2C8XB 2Z9KA 3M3TA 3LU9B 2FOBA 2BQ6B 1DSUA 2BY5X 3GCHC 1G3DA 4GSOA 5HGGA 3MU5A 4I8KA 3VFEA 3MU1A 4CRFA 2OUAA 1VITH 2OXSA 3AVZA 2D26C 5C5OA 1RD3B 5DK1A 4FUGA 4YOIA 1OS8A 1E35B 1OX1A 5FAHA 1SGIB 3VGCC 2PKAB 3TK9A 4RSPA 4ABIA 1H9IE 5HM2A 3RXBA 3VB7A 1O3EA 1IOEA 2P95A 2ZU4A 4X6MA 1D4PB 1AB9C 4LZ4B 4X8SH 1UMAH 1M9UA 1MUEB 2WYGA 3PO1C 1KXEA 2OINA 2ZDMA 4BTIB 1FI8A 1O3OA 4ZHAA 2Z3CA 2F91A 1GBEA 2BLWA 1L0ZA 1H4WA 1ESTA 4X2YA 3RXDA 2J2UA 1Z1IA 2PSXA 2ZHWH 3M7TA 1QQUA 3LJJA 4MNVA 1K1IA 3TJNA 2SNVA 2H6MA 1G3EA 1NROH 2ZU5A 1ZMLA 1J15A 4WVPE 1PQ5A 2ZZUH 4BTTB 2VJ1A 3A87A 2W3IA 1D6WA 1TGSZ 3STJA 1LCYA 1A5IA 4IMZA 1UTLM 2DUCA 3GY2A 1BHXB 1E38B 2FWWA 3KQCA 2ZF0H 1L4DA 1GHXH 2BD5A 2ZU1A 1O5CB 4IMQA 1XUIA 1WUNH 3SHAH 1J16A 3UY9A 3ZVEA 4NWLA 2PTCE 1UVSH 3V3MA 4OS4A 1TABE 4NA7A 2PWXA 3PLPA 5AF9H 1SHHB 1F7ZA 2JH6D 3VB5A 3PMHB 1HIAB 4Y8YA 1DXPA 4F49A 1TALA 4NFEA 1Z8IB 4B2BA 2PKSB 1QL7A 4NZLA 1P0SH 3S9CA 1O3IA 3K6YA 2BQWB 5FX6A 3VB4A 5DP6A 1AVWA 1T8NA 3QLPH 4WH8A 1HAVB 4H6TA 2PR3A 1BBRE 1O32A 2R9PA 3TGIE 1Z7KA 1AY6H 4X8UH 2I6QA 5LPEA 1H8IH 2QC2A 4OGYA 3M5OA 3GISB 1P06A 4YTAA 2SGAA 3SU0A 3ZZ6A 1GHZA 1W0YH 1QJ1B 1PQ8A 2STAE 2WPIS 2BZ6H 1C2IA 4J1YA 3CS0A 1GDQA 3BTHE 1PJPA 3EQ0H 1MCVA 1V2KT 2IN2A 2BHGA 2F9UA 2FEQH 2XNIA 1H9LB 5A2MH 2DE8A 3S9AA 5C67A 5LH8A 1OYQA 1FJSA 1H9HE 1BB0B 4UFEH 3KIDU 1PPZA 3MHWU 2VIOA 1LVMA 4NCYA 3UOPA 2ZDNA 1ZZZA 1FY5A 2GGVB 2H9EH 4CH8B 1NESE 2Z3DA 3VPKA 1WU1A 3ODDA 1OPHB 1XUHA 4MNYA 1IQGA 2Z3EA 2RA0A 5GCHF 1ZSJA 3PB1E 2VWNA 3N7OA 1IQJA 1OP8A 3RXIA 2R0LA 4Y8XA 2WV5A 3BTWE 1RFNA 2CXVA 2R3YA 1O2LA 1W2KH 1GBTA 2BD8A 1JOUB 3SN8A 4ABAA 1KDQB 3AASA 3SOSA 2PKAA 2HPQH 2RG3A 1IQFA 5DJ7A 3SQEE 1PYTD 1LDTT 1V2MT 4A92A 3E8LA 1IHTH 3F9EA 3O8RA 2Y81A 3ZV9A 3RXFA 3NXPA 2FO9A 1O36A 1TPSA 1WAYB 1KTTB 2W26A 4JZFH 1INCA 1C5NH 1BZXE 2VIQA 1RTKA 3HK6B 5I46H 1TIOA 2VWOA 1HAGE 5FPYA 5E0GA 1ZR0A 1C5MD 1WTGH 3P8OA 1T7CA 1BHXF 3E6PH 2F9OA 1NRRH 3FZDA 2AMQA 3SU1A 1ELTA 1AKSB 2FM2A 3ATKA 4YESB 2CF9H 4YT6H 2FYQA 1TGTA 2VIWA 3C1KA 1SGDE 1OWJA 2FOCA 1HJ9A 3JZ1B 1FUJA 2OC0A 2J34A 1UK4A 5F03A 4GCHG 3BEFB 2WUBA 4CREA 3UPEA 2BDCA 1T4VH 1DDJA 3TIUA 3S69A 1Z8RA 2G5VA 4NSVA 2ZECA 1LQEA 3TJOA 1TOCB 5EU8A 4ABHA 2AERH 1RIWB 1KXFA 3RU4E 3LH3A 3A7TA 1ELAA 1HIAA 1TNJA 4F4OC 3GCTG 4AG1A 1F92A 1BTXA 1FONA 2A5KA 2R2MB 1DLEA 4KELA 1P57B 2IPHA 2W3KA 3D65E 1J17T 2F9VA 3AAVA 4I8JA 1TQ7B 1CHOF 4K2YA 2FPZA 1VZQH 1LVYA 2F3CE 2VWLA 3ODFA 4Y79A 4BNRA 1HAVA 4TY7A 1O31A 2SGDE 3RMNH 2EI7A 5ESTE 5BRRE 3GICB 3T62A 2UUJB 5GPIB 4CR5A 4H6SB 5JB8S 1DM4B 1RIWC 3TJVA 1FV9A 2W5EA 2FDAA 4MNWA 1VCWA 3NCLA 1D6RA 2ZDKA 4ZXXH 1YCPH 2THFB 1ACBE 1GJ6A 2WINI 1GBCA 1A3BH 3K9XB 1Y59T 1TQ0B 5CMXH 3PM3A 2QA9E 4NIYA 1P02A 1S6FA 1O2WA 1ZTLA 1P9UA 2YOLA 3M5MA 3RXVA 3CENA 2QV1A 3SNAA 1VGCB 3BTDE 3KN2A 1A4WH 3E91A 2G8TA 1TRYA 3PWCA 3SQHE 2FOMB 2K1QA 2GZ9A 1GJ9B 4ABFA 2ODYB 2ZFTA 1F5RA 1TE0A 4IN1A 1Z6JH 3GY4A 1AFEH 3PLKA 2GV6A 2FTMA 3ZYEA 1SL3A 5FX5A 4ZUHA 2OD3B 5C3NA 1EAWA 1O2UA 4MVNA 4UEHH 4NA9H 4CRCA 1C2GA 2A2XH 4VGCB 5DP8A 1O3HA 4CBNA 1RGQA 2G00A 4KP0A 1KDQA 3IITA 4FUBA 3OTJE 2Y5FA 1QJ7B 1VGCC 1HAPH 1NFUA 1ZHPA 2P3UB 5C1UA 2QF0A 4AFSA 1A0JA 2OLGA 4JCNA 1O0DH 2CN0H 1YC0A 3MFJA 1N6XA 1K1JA 5HMAA 1KXBA 1P2QA 2ZFFH 4LXBH 2C8YB 3SNBA 3SU4A 3KCGH 3W95A 1QBOA 1F5LA 4DURA 2ZC9H 3R3GB 1O3DA 4LZ1H 1NTPA 1Y5AT 1WQSA 1HAXB 6ESTA 4WWYA 6LPRA 3ZZ9A 2A7HA 3LOXA 4Y11E 4ABDA 3TVJB 4YT7H 3KL6A 4AG2A 1CT0E 4MPWA 3QZQA 1CA0B 1CT4E 4VGCC 1ZTJA 1W7GH 1C5WB 1GCTB 3MO6A 1AKSA 1AZ8A 2JH0D 4O97A 5IDKA 1L1NA 3M5NA 2OP9A 1EB2A 3P6ZB 3MO3A 4U2WA 2SGPE 2BD9A 2XWBI 1C5VA 4Y71A 1ELCA 2FS9A 1O5DH 4FUCA 3KHVA 5F8ZA 4WH6A 3V0XA 3KQDA 4I7YH 5FPSA 4GVUA 2BY9X 2D2DA 1MZDA 5DPAA 3Q3YA 4Q2KA 1BRUP 1P2MA 2PGQB 1NU9A 2A32A 2AS9A 1CA0C 1HGTH 1O39A 4H4FA 2ZDVH 3ZV8A 1BJVA 3BIVH 1OP2A 4DY7B 1EQ9A 1ANCA 1GCTC 4RN6A 3SGQE 1XUKA 2BVSH 1TRNA 2FESH 2VVUA 1P8VC 1Z8GA 2NU4E 2P16A 1EB1H 4JYVH 1MBMA 1GVLA 3DD2H 4Q7XA 3NUMA 4XOJA 3TK5A 2G5NA 3MH5A 1O3KA 4FVDA 1YLDA 5FCKA 2SGQE 1EXFA 1YPKH 4I33A 1GBAA 1O2XA 2ZO3H 4U01A 1C4V2 1BTPA 4FXGH 3SV6A 1TNKA 2FI4E 1P2JA 2J94A 1EAUA 3GCNA 4XFQA 1T8OA 4BAHB 5TJXA 1GVKB 1VITG 1UTNA 1MKWK 1N1LA 1TLDA 2B7DH 3RXAA 3F9HA 5GIBA 1LQDB 2WPHS 3EE0B 2A31A 2BXTH 3RXJA 1SGEE 2J9NA 2ZTYA 3P17H 2EA3A 9ESTA 3T28A 5AHGH 2Z9LA 1CVWH 2B9LA 2QN5T 1MU8B 1T8LA 3SO3A 3GYMA 2V3OH 3QK1A 2YNBA 3NKKA 2P59A 2VU8E 1UTPA 1A0HB 2ASUB 2PLXA 2Q6DA 4MLFB 1MAYA 1QA7A 1V2PT 1EAXA 4O3UA 3TNTA 1GHBF 3E1XB 2BLOA 5HM9A 1KXAA 1TX6A 3PTBA 1GMDG 2A4QA 1HXEH 4K1SA 1BRAA 1C1VH 3FANA 4K69A 1ZOMA 2BD7A 5BPEA 3SI4H 1AO5A 3PROA 2GV7A 3SV8A 1NU7B 1SB1H 3VB6A 1O2PA 4AYVB 2XW9A 4A1VA 5A0BA 3RXRA 1P05A 1A5GH 1S83A 3EDXB 1XX9A 2PHBA 2AIPA 4GUXA 3D62A 4YLUA 1C5RA 1G2LA 3UIRA 5DGJA 1GVZA 1LO6A 2O8LA 1ELEE 2FIRH 2Y7XA 5EXMA 1UCYH 2PFEA 1SGTA 1C1UH 2F9NA 1GJ5H 3NPSA 2HRVA 1IQMA 1DE7H 4ASHA
chains in the Genus database with same CATH superfamily
2R0KA 1NPMA 1ID5H 5GDSH 2ALPA 2XC4A 3ZZDA 2KX4A 5A8ZA 3P95A 1GGDB 4I86A 3RXTA 3LGVA 2HPPH 3A8DA 1C4Y2 5KECA 1W14U 2Y5GA 1TRMA 3GY3A 1GMCG 2KAIB 3WW7A 1ZSKA 2VIDA 1K9OE 3M3VA 5GJ4B 3RMOH 1FN8A 1TPPA 3BTEE 4ZKNU 2JKHA 6CHAB 5JBAS 5A8YA 1YPMH 2PW8H 1KLJH 1MTNB 1N6YA 3ZVBA 2V7QD 5DG6A 4MPUA 1O2ZA 4BAOB 2BDAA 5T6FA 4IC6A 3MU4A 3ELAH 4JZDH 1TGBA 3P8NA 1GJ4H 2WPKS 1C5YB 1GI6A 3A7YA 4K5ZA 1NFWA 1DS2E 1GGDC 3MH4A 4R0IA 2G52A 2ZQ1A 5AFZH 1TBRH 2Z9JA 1WDIA 4YO9A 1BITA 1TA6A 1QCPA 2EEKA 1PPEE 3HGPA 6CHAC 1MTNC 5LPRA 4BOHA 4DCDA 1SKYE 4IN2A 1JMOH 2H9HA 2Y82A 1W0ZU 1O3GA 1V2TT 3F9GA 2FODA 1GJAB 1EPTB 3TH4H 5FCRA 1AWHB 3LT3A 2ANWA 4CRAA 2PUXB 4UONA 2FTLE 1OWKA 2PTNA 2Z9IA 2O8MA 2BDGA 1G9IE 1FY3A 1K1MA 1K1PA 1FAKH 4WJG2 1EX3A 1E1RD 3OYPA 2ZHEH 1C2DA 1ZPBA 1UW7A 4XSKU 3ZZBA 5GCHG 2DE9A 5E0JA 4RKOB 2VH6A 4M9FA 3SU2A 2A0QB 2VGCB 3BTME 3RXMA 5C5NA 1PPCE 4DIIH 1GHWH 3SJIA 1QURH 4E7NA 4K1EA 4E7RG 1EZQA 3RXLA 1SGQE 5EXNA 1SGRE 3SJ9A 1C5QA 1EPTC 2ULLA 3RU4D 5GXPA 1QBVH 1JIMA 1CBWB 3LGUA 3UNRA 2WPJS 2XBXA 2FLRH 1QR3E 3RXQA 1GI9B 1GDUA 4CRBA 4X6PA 4Q80A 1O5GH 3TGKE 1T31A 2EY4C 1SGPE 1GJCB 3RDZA 4A5TS 2C8ZB 3IG6B 2GTBA 2A5AA 3GY7A 1XXFA 4FUEA 2OBQA 1QY6A 2XBYA 1O2VA 3KF2A 1GL1A 2A45B 1SBWA 5AFYH 2VGCC 5TCAA 1F0RA 1ZPCA 3FZZA 1NT1A 4Y7BA 1YF4A 1AI8H 1MD7A 3A8AA 1IQHA 2BDHA 1SFQB 1CBWC 2BD3A 2HNTC 1NN6A 1ZGVA 1GI5A 2WYJA 1V2VT 1O2MA 1MTUA 2AYWA 5H4IB 3SV2H 1P10A 1TWXB 4HG6A 3RM0H 1MH0A 1VCQA 2BDIA 4A7IB 4AFZA 2QY0B 1C1PA 3LGYA 2W7SA 1OWEA 4NGAH 4GPGA 3UWIA 1V2QT 2GZ7A 1EAIA 2O8UA 1ZMJA 2F9PA 2AEIH 1SSXA 3O8BA 2HLDD 1KY9A 2H2ZA 2KAIA 3FFGA 5HYOA 1ANEA 2EI6A 4Q4LA 4INLA 3VB3A 3Q3XA 1Y3UA 2V35A 1ZSLA 3KYFA 3BTQE 1JXPA 5JB9S 2ZTXA 1FZZA 3URCA 3T25A 4ZCNA 1KTSB 1A1RA 2ZGHA 1OKXA 1DVAH 1DPOA 3PRBA 2J4IA 1MZAA 1F0SA 5EQRA 8KME2 3UR9A 1S6HA 5CHAB 1QTFA 1C5UA 3QWCH 1Q3XA 1CHOG 3AW1A 5ABWA 1BT7A 1OOKB 4B6FA 4E05H 2HLCA 1LPZB 4D8NA 2VIPA 3S9BA 1PPGE 1C1QA 3VXFH 3F9FA 4IGDA 1CT2E 2HVYB 1HAZB 2PGBB 1THPB 4HTCH 3DT0H 1MTWA 5EPNA 2ZP0H 3N99A 1SLVB 1XM1A 2A7CA 2V3HH 4XBBA 3U1IB 4X0WU 4BAKB 3MU0A 4TYDA 3PV2A 5JPMH 2XRCA 1HRTH 1TB6H 3KGPA 3N7DA 2AGEX 1PPFE 5DP7A 5GNDA 4X1NU 5DP5A 2XC5A 2C93B 5C2ZA 1EPTA 2J92A 2BTCE 3B9FH 3BG8A 5CHAC 3OX7U 4TWYA 3I29A 4KTUA 2ODPA 3GYLB 1TYNA 3A84A 4FETA 2BD2A 3HPTB 3RXSA 1S85A 3ATIA 2UWLA 1S81A 4X2VA 5J4QA 3E3TA 1QGFA 1CSOE 2ZHFH 1ABJH 4KTCA 1FNIA 1MU6B 2CK3D 1ELVA 2P3TB 2HNTF 2ZDAH 1TOMH 2V3MA 1GI7B 1PFXC 1OP0A 1AIXH 2Z7FE 3N7EA 1SLWB 1IQIA 1Y3YA 1P11E 1GI3A 1UTMA 1ABIH 3SU6A 4FU9A 4QT8C 1ARBA 3FKSD 1EATA 3ZVDA 4B76A 4BANB 1SLUB 1Z8JB 2GCHG 2A2QH 3P8FA 1SQAA 1BOQA 1C9PA 4NG9H 4K8YA 3EGKH 1Q31A 1LTOA 4FVBA 3BV9B 4NSYA 3SV9A 2CJIA 2F4LA 2GZ8A 2AMDA 2ZQ2A 4X2WA 3A82A 2BVXH 2Z94A 5PTPA 1SFIA 4AGJA 4B73A 4OGXA 1OWHA 5T1VA 4JYUH 4OS6A 3U9AH 3BEUA 3DSOA 1EZXC 5EG4A 2VVCA 1O2GH 3TLOA 2FOEA 3A7XA 1YGCH 1DT2A 3UTUH 1W0KD 4KTSA 1V6DA 1DX5M 3LONA 3BF6H 1ETRH 2GJGA 1KLIH 3DSPA 4ZXYH 3QX5H 3SNDA 1LHCH 1D3TB 1EUFA 5FPTA 1HCGA 1IHSH 3ZVAA 2KR7A 3UREA 3UR6A 2BY6X 1OSSA 2TGPZ 1O33A 1O2JA 3EA9A 1ARCA 3V13A 3CP7A 1P03A 2B8OH 3M7QA 1CQQA 1C5ZB 3OY5U 4BAQB 1V2OT 1SLXB 5DSFA 2BQ7B 3STIA 2ANMH 4ZAEA 5A0CA 3QO6A 3Q76A 5C1XA 1TX8A 1MQ5A 2GKVE 1FY4A 4FUJA 4TSFD 1GHAF 1DANH 2LP6A 1BMFD 1YYY1 2R2WU 3P92A 1YPLH 2PP6A 1P01A 1NM6A 8GCHG 1O5FH 5FL7D 1KXDA 1K21H 1V2NT 4NA8A 2XCFA 3M37A 3F1SB 4MNXA 3RXPA 4OS2A 1C1OA 2HGTH 1C9TA 2OTVA 1ELGA 1HJAB 1WYKA 2FS8A 2UUFB 2O8WA 3K2UA 1C2LA 2I6SA 1BBRH 3PRDA 2Y5HA 3GCOA 1NRSH 3PWBA 1NO9H 4XBDA 3MWIU 3T2NA 1SQRA 2P94A 5EW1H 1JIRA 2ZPSA 2FOHA 5E0HA 2OC7A 2PSYA 1CO7E 4DT7B 2OQUA 3CNRA 1QRWA 1AZZA 4TPIZ 3HK3B 1O3JA 2C4FH 8ESTE 1NRPH 3E0PB 3IWMA 1ZHRA 2CHAB 7GCHF 1G2MA 5C20A 3M3SA 1HAYB 3PV4A 4GCHF 4DGJA 2BLQA 3BTKE 1SOZA 1E0FD 1GBFA 2FXRA 4ZMAH 4ISIH 4X1RU 3VG8A 4AFQA 1UVTH 1C2JA 1S0QA 3OSYA 5F53A 1UTJA 1VCPA 2LPRA 1HAIH 4UDWH 1HJAC 5JYIA 4MDSA 1XUFA 1UVPA 2QGRA 5EXLA 4K1TA 3VXEH 4DOQA 2ESTE 1E36B 1GHBG 1MTSA 1GBDA 1KLTA 4Z0KA 4B1TA 1SGNE 1C5LH 3KQBA 1W7XH 1F0UA 1GBKA 4NIWA 4K3JA 2CHAC 1E37B 3ZZ7A 3SYJA 1ZRKA 1FIWA 1HUTH 3MNSA 3RLWH 1C1MA 4FUHA 2NWNA 1QIXB 3BTGE 3D49H 1P2NA 1EJAA 4Y7AA 1IQKA 4AGKA 1YCPK 4F48B 4AC9A 2C8WB 4RKJB 2BMGB 1BMLA 4TY6A 4B75A 2BLVA 2ZIQH 5SGAE 3RMLH 2KZ4A 3LJOA 3TITA 2FZZA 1SR5C 4FU7A 2Y80A 2OCVB 3NK8A 5L2ZH 1AVXA 2Y6TA 1GBMA 1FX0B 5T3HA 4DG4A 2XYAA 3RXOA 1G3CA 3HATH 4NIXA 3RXUA 1GI2A 1ZPZA 4RT1A 3Q3KA 1WQVH 5JBBS 2ZHDA 1GJBB 1UO6A 3AK5A 3DCLA 4SGAE 1JRTA 4E06H 3HGNA 4CR9A 5HXFA 3BG4B 1W13U 1EOJA 3A89A 3U1JB 2NU1E 4WMDA 1NFYA 3AW0A 3PV5A 5DP9A 3ZVGA 2K0QA 3NZIA 7ESTE 1UVUH 4Y6DA 2TGAA 2UWOA 1O3AA 2ZGCA 4K60A 2RDLA 4BTUB 2W6JD 1CGHA 1A61H 1SOTA 4GHQA 4X2XA 1Y8TA 2ZCHP 4THNH 2XWAA 4X1PU 6GCHG 3OAAD 2FLBH 1QL8A 2TPIZ 1SGFA 5T6DA 3BN9A 8LPRA 2IJD1 1L4ZA 4D7GA 2JJ1D 1UTQA 3FVFB 5FHTA 2ZA5A 2XXLA 3BG4C 2ZCLP 2M5TA 1PYTC 2WZQA 4NZQA 1UVOA 3WY8A 1P09A 5LPFA 4Y8ZA 4BXWA 1Y3VA 2WHXA 1O3NA 2UUKB 4DVAU 3MO9A 1K22H 1G3BA 3L33A 3PTNA 2HOBA 4YLQH 2VH0A 1O3MA 1LVBA 2ZPRA 4Q7ZA 3RXCA 3HKJB 4AN7A 1AN1E 4O03A 1QNJA 2WSSD 1NS3A 1L1GA 3QTVH 3FP8E 3QGJA 3TK6A 3DSGA 3MH7A 3UFAA 1YLCA 1DICA 1AUTC 1BCUH 2OBOA 2HWLB 4I8LA 4CH2B 3TU7H 1F0TA 1GBHA 2IJOB 1FIZA 3MU8A 1CU1A 1UHBB 2ALVA 5EIYA 2R3UA 1GDNA 5L30H 3K65B 1FQ3A 4MQAA 1TPOA 4ISHH 3MTYA 2BOKA 1D3QB 3MNBA 4JYTA 4ZKSU 3S0NA 1ANBA 3SORA 5EGMA 4ZHMU 3TH3H 1MCTA 2ZTZA 1YPHE 3F6UH 1LHGH 2BX4A 3E16B 1BRCE 3OEED 2EC9H 4FUIA 4MPXA 1GWAA 3PMJA 3BIUH 3L3TA 1OHHD 4NFFA 3SZNA 4FU8A 2JDID 1ESBA 1VR1H 4DJZB 4AYYB 1EZUC 1LPKB 3M61U 3FOAA 1TPAE 1G36A 1WTHD 2XBWA 1NRQH 3SNCA 5EODA 4XD7D 1LHFH 3E0NB 1MAXA 1UTKA 3W94A 1LHDH 4INHA 1ETTH 2XTTB 1YPEH 4D76A 3TGJE 2SGFE 2IOTA 3RXHA 2CGAA 2GT7A 4OS1A 1VKYA 7LPRA 3GOVB 1QRZA 2ANKH 4UFDH 1FAXA 2GDDA 4Y76A 1HLTH 1NBME 3SUDA 3PLBA 4HGCA 1MKXK 2EI8A 1V2ST 5B6OA 1DITH 1HAHH 7KMEH 1VITF 2A1DB 4Q7YA 1C2MA 1NC6A 2NU3E 1D3PB 2J95A 2HNTE 3I78A 1MD8A 1YKTA 2ZHQH 1DUEA 2AH4X 1PPBH 3MMGA 2A4OA 3H7TA 2BZAA 1G30B 5I25A 4KKDA 1TNGA 2G55A 1L2EA 1O5AB 3S7HB 1DUAA 2ZGBH 1O30A 3SNEA 1IQNA 1J8AA 2HVXA 1ETSH 1TGNA 4B74A 2UUYA 2G4UA 5L2YH 4WY3A 1GMHF 3LGIA 1GBJA 1T4UH 1GJ7B 1W3CA 4FUDA 1BQYA 1GMDF 5C0TA 1YPHC 4INKA 2QIQA 2G4TA 3V7TA 4CHAB 1A46H 2ZU3A 1UCYK 3F0OA 2D8WA 2SFAA 4I32A 1QFKH 3KQEA 1FY1A 1C1WH 1CE5A 1O5BB 1W0JD 2W7UA 1EZSC 4TT3D 1GHYH 1FLEE 3EYDA 1V2LT 1C1TA 2GX4A 1SVPA 4U32A 1DY8A 3T29A 1C2KA 3T5FH 3QGNB 3DFLA 1DWEH 1FPHH 1O34A 3B8JA 1TNLA 4UFFH 4ISOA 2J38A 3TH2H 1D9IA 3MOCA 1XMNB 3OTPA 2FI5E 2QYIA 3MNXA 3UNQA 1RXPA 4AFUA 2F83A 4TWWA 1B0FA 1FXYA 3O8DA 1SC8U 1A3EH 1KSNA 1QRXA 2BM2A 2OC1A 5F8XA 1MMJN 3MYWA 1H1BA 3ZZCA 5FBEA 3NWUA 1FY8E 2H5CA 4CHAC 1B0EA 3DUXH 4HI3A 4ZHLU 4ASUD 2C3SA 5AVDA 1YY3A 2O8TA 2H5DA 1K1LA 1GMCF 3GDSA 2QF3A 2TIOA 5DP3A 3ZYDA 1UHBA 2BY8X 3RXGA 1O3BA 9LPRA 1O5EH 3U8TH 1QA0A 2GVFA 3SJOA 4X1SU 1WOFA 2FX6A 1EP6A 3A85A 1BTHH 2A7JA 3LGTA 2UWPA 1YBWA 1QZ8A 1UK2A 1C5OH 1C5XB 4OS7A 5DP4A 3H5CB 2AFQB 1EP5A 2ZFRH 3ZVFA 1GI8B 3A7ZA 5TCCA 1Y5BT 3ZZAA 4K8BA 3OE7D 3RUOA 4ABEA 2ZGJA 1VJ9U 1VJAU 1GHVH 1MQ6A 3AAUA 1HJ8A 2OQ5A 3TNSA 4DIHH 1C1RA 3DA9B 2YMSB 1DWDH 1THSH 1BIOA 3FN8A 5J4SA 3KNXA 4U30A 1Z6EA 1O3CA 1LPGB 4JMYA 5ETXA 1HBTH 4DW2U 4IW4E 4KGAA 1YCPM 3KEEA 1GI0A 5CE1A 3W1EA 1F5KU 3Q00A 1XUJA 5LGOA 1UTOA 1V2WT 4YOJA 1RS0A 2PKSC 3RM2H 1RJXB 1K2I1 2GDEH 2STBE 2IPQX 3ITIA 1OXGA 1K1NA 2BOHB 3QTOH 2FP7B 1O2SA 2TRMA 3ESTA 2O9QA 2PV9B 3C27B 1AVGH 1C5TA 2AGGX 1MTVA 2ZU2A 1A0LA 4BAMB 3SUFA 1TNIA 1XVMA 1O2KA 1V2JT 4HFPB 2CV3A 4IC5A 5T6GA 1HAOH 2YMSC 5EQSA 4Q63A 3RMMH 4IS5A 1AD8H 1AFQB 1FPCH 2BB4A 2ZFPH 1OYTH 1DLKB 4H42U 3SJ8A 4AZ2B 2BYAX 2FOGA 4ISNA 2GP9B 1G37A 5EJZA 2CF8H 2XBVA 5EW2H 4X6NA 4AB9A 1Y3XA 1ELFA 1P12E 1AU8A 1LHEH 4GHTA 3U8RH 1GCDA 3M36A 1SG8B 3E90B 2ANYA 4JZ1A 1JRSA 4JK5A 3M7UA 2WV4A 3A8BA 1KXCA 1DSTA 2FOAA 5JBCS 1GHAG 1ESAA 2QXGA 3UQVA 1BRBE 1AMHA 1QB1A 1RTFB 5DO4H 1ELDE 3BTFE 3MH6A 1XUGA 1V2UT 1O2IA 1Z1JA 3GY6A 5F8TA 2VIVA 1AFQC 3UOUA 1YM0A 4Y10E 4X6OA 2KFWA 1O3FA 2XC0A 1TGCA 3SJKA 1XXDA 4WXIA 3QN7A 3SUGA 1TONA 3ZZ5A 2FX4A 2TGDA 4D9QA 1AQ7A 3MNCA 1P2OA 1ZRBA 3A88A 5K7RA 5A8XA 3GDVA 3QDZB 1CGIE 4YOGA 5L6NH 1O37A 4Z6AH 5A09A 3FP7E 1C5SA 4FUFA 1FN6A 3LIWA 3EA8A 1SGYE 4GLYA 4MTBA 1HDTH 1HFDA 4O3TA 1GBIA 2AHME 1TFXA 7GCHG 4JZIA 4O9VA 2YNAA 4A1TA 1C2EA 4NIVA 1BA8B 1XKAC 3RU4T 2JETB 1C2FA 3SUEA 1BMAA 2WPLS 2GD4B 1S5SA 4BXSA 1BDAA 4ZKOU 3A86A 3ZVCA 1NFXA 3FP6E 1IQEA 2WUCA 3K6ZA 4WXVA 1DWBH 3T26A 1ELBA 3U69H 2J98B 2BVRH 1CGJE 1BJUA 2VBCA 3O8CA 2GCTB 1FDPA 2P3FH 3SV7A 4B2AA 1WV7H 3ZZ8A 1BTUA 3ATMA 3TPIZ 5A0AE 2ZI2H 4R8TB 3SBKA 3A81A 5IK2D 1O35A 3SGAE 3OU0A 1J9CH 1BMMH 4X1QU 3LH1A 4RT0A 3GY8A 2CMYA 2ZEBA 1NZQH 2A4GA 1O2NA 1C2HA 2JETC 3RC4A 1D3DB 1O3LA 2D1JA 1O2TA 4B71A 1Y3WA 1A5HA 1U6QA 4ABJA 2RCEA 1G32B 3PYHA 5E8EH 5JDUB 2GCTC 1B7XB 1C4U2 1QJ6B 1IAUA 1SQTA 1PPHE 3RLYH 1DWCH 3KQ5A 1TNHA 1F2SE 4JK6A 3PMBB 2ZDLA 3ATWA 4TPYA 1N8OB 4B6EA 1UCYE 2ZWLH 1HNEE 4XRNA 1NRNH 1H8DH 1ZLRA 3A8CA 1FMGA 3DHKH 2F9BH 3UNSA 1UJ1A 1X7AC 2H9TH 2HALA 2ZCKP 5C1YA 1A7SA 1WBGB 2BX3A 1SI5H 1GPZA 2ZFQH 4LK4A 5GWZA 4I8GA 4OM9A 1BTZA 1XKBC 2VWMA 2BY7X 3A7WA 5JBTA 3G01A 3BSQA 1P2KA 5C0UA 3UUZA 4M7GA 1SGFG 4AORA 4YM9A 1O3PB 1EKBB 1QQ4A 2AMPA 2Z9GA 4Y0ZE 3LGWA 4WF8A 2K8IA 1GL0E 4HZHA 4I8HA 1N8OC 2QCYA 5HIZA 1EASA 1PQAA 3SU3A 5F6MA 1GBLA 2GCHF 3U98H 4YZUA 4ESTE 1QB6A 1W11U 1CHGA 3OY6U 4WMEA 1L1JA 1S0RA 2SNWA 1MKWH 2NU0E 3SHCH 2ZG0H 1BTYA 1QHRB 3RXKA 3ATLA 2FYRA 1C5PA 3MI4A 4ZROA 3A80A 3ZIAD 3P70B 3GCTF 2ILNA 3OFND 1GJDB 1SQOA 2JIZD 2L74A 4OS5A 3SU5A 4X8TH 4P00A 1AE8H 1NBMD 2ZPQA 3GDUA 4IBLH 4A6LA 2G51A 2VB0A 1THRH 1MBQA 3EA7A 3SI3H 1PQ7A 2VNTA 1SHYA 4PROA 5KGOA 4CRDA 1W12U 3T27A 2VINA 3JZ2B 2OC8A 4UD9H 4AOQA 1WCZA 2A5IA 1Q2WA 1ZTKA 3A7VA 2G81E 4JZEH 3LDXH 1HYLA 1KYNA 4XDEA 2V6NA 3UQOA 4UE7H 2WPDD 3F68H 3GY5A 3FAOA 3P8GA 1TMTH 4ZKRU 2JH5D 1DFPA 2C90B 1EJMA 1TA2A 3ENSB 1AUJA 4XBCA 1B5GH 1GG6B 1BTWA 2J98A 1AWFH 3F3BA 4CRGA 1TMUH 2SGEE 1TAWA 1IQLA 2RDEA 1ZHMA 2AIQA 3BTTE 2B5TB 3LPRA 3BEIB 1HXFH 1YP9A 1O2OA 5EOKA 3URDA 1BBRK 1ZMNA 2ZGXH 1Z71A 1OWDA 1S82A 3A83A 4SGBE 8GCHF 4XE4A 2FMJA 1ORFA 1RRKA 3D23A 2QAAA 3LC3A 1GI1A 2BD4A 1BMNH 1P3CA 1C1SA 2NU2E 4AB8A 2H1UA 1O2RA 1LKAA 1BUIA 2VVVA 3UWJH 3B23B 5E2PA 1T32A 1KMHB 1P2IA 3VEQB 2AGIX 4Y0YE 1O2HA 2Y7ZA 1HV7A 1SMFE 1DY9A 2P93A 1K1OA 3ZZ4A 1CA8B 3L6PA 3RXEA 2TGTA 2BXUH 1UK3A 5EQQA 1GG6C 1XVOA 2RA3A 1ZJDA 4ISLA 1WSSH 1TMBH 3LKWA 1O2YA 4B2CA 4NWKA 2Q1JA 1LKBA 2V0BA 4GAWA 4LOYH 1Y5UT 3QZRA 1AGJA 5FBIA 5K0HA 1HB0B 2TBSA 1SPJA 2XOKD 2XCNA 3ZZ3A 3LC5A 2QXHA 1AHTH 1S6LA 1P04A 3MQKC 3U8OH 1C1NA 1MKXH 1TX7A 3S7KB 1YPGH 4MPVA 4A1XA 2GMTB 4MG3A 1E1QD 3DFJA 3H09A 3RP2A 1P9SA 4X8VH 5EPYA 1GJ8B 3F2FA 1EFRD 3HKIB 1KIGH 1GBBA 5IYTA 1V2RT 1ANDA 1E34B 1GMHG 5B6LA 2GT8A 2Z6BD 3I77A 2FOFA 4ZH8A 2P8OB 5E2OA 3UB0A 5HIYA 3TJUA 1HPGA 1EOLA 2KM0A 4CBOA 2Q6FA 1JWTA 1O2QA 1ZYOA 3CS7A 1ZGIA 4J2YB 1DOJA 1W10U 3M5LA 1J14A 5FXLA 2GMTC 1GI4A 1QB9A 2LNCA 1TBZH 1W8BH 2ZFSA 2A4RA 3H7OA 1QBNA 2BDBA 2QXIA 3NRLA 1AE5A 2QXJA 2ZKSA 1K28D 5G4BA 2BDYA 3PMAB 2KCPA 5HKKD 2B0FA 3SW2B 4FOUC 3RC5A 2ODQA 4ABGA 2P8OC 1EJNA 1LVOA 1V3XA 2ZNKH 3GCHB 3QUMP 4WMFA 1P3EA 1O38A 1T8MA 4I31A 1OWIA 3Q77A 4D7FA 3M35A 1TBQH 1YPJH 4F55A 4AX9H 2FI3E 1ZJKA 5DKMA 1DXWA 1SGCA 3RC6A 1A2CH 1QL9A 5ESBA 3V12A 1JBUH 3R0FA 3VGCB 4ABBA 3SGBE 1MABB 1RTLA 4UFGH 2WPMS 1AB9B 1LMWB 2Q6GA 4D9RA 2PUQH 3SZEA 1NY22 3EAJA 3PO1B 6GCHF 1S84A 2C8XB 2Z9KA 3M3TA 3LU9B 2FOBA 2BQ6B 1DSUA 2BY5X 3GCHC 1G3DA 4GSOA 5HGGA 3MU5A 4I8KA 3VFEA 3MU1A 4CRFA 2OUAA 2RFKC 1VITH 2OXSA 3EE7A 3AVZA 2D26C 5C5OA 1RD3B 5DK1A 4FUGA 4YOIA 1OS8A 1E35B 1OX1A 5FAHA 1SGIB 3VGCC 2PKAB 3TK9A 4RSPA 4ABIA 2LELA 1H9IE 5HM2A 3RXBA 3VB7A 1O3EA 1IOEA 2P95A 2ZU4A 4X6MA 1D4PB 1AB9C 4LZ4B 4X8SH 1UMAH 1M9UA 1MUEB 2WYGA 3PO1C 1KXEA 2OINA 2ZDMA 4BTIB 1FI8A 1O3OA 4ZHAA 2Z3CA 2F91A 1GBEA 2BLWA 1L0ZA 1H4WA 1ESTA 4X2YA 3RXDA 2J2UA 1Z1IA 2PSXA 2ZHWH 3M7TA 1QQUA 3LJJA 4MNVA 1K1IA 3TJNA 2SNVA 2H6MA 3F2GA 1G3EA 1NROH 2ZU5A 1ZMLA 1J15A 4WVPE 1PQ5A 2ZZUH 4BTTB 2VJ1A 3A87A 2W3IA 1D6WA 1TGSZ 3STJA 1LCYA 1A5IA 4IMZA 1UTLM 2F43B 2DUCA 3OEHD 3GY2A 1BHXB 1E38B 2FWWA 3KQCA 2ZF0H 1L4DA 1GHXH 2BD5A 2ZU1A 1O5CB 4IMQA 1XUIA 1WUNH 3SHAH 1J16A 3UY9A 3ZVEA 4NWLA 2PTCE 1UVSH 3V3MA 4OS4A 1TABE 4NA7A 2PWXA 2KCAA 3PLPA 5AF9H 1SHHB 1F7ZA 2JH6D 3VB5A 3PMHB 1HIAB 4Y8YA 1DXPA 4F49A 1TALA 4NFEA 1Z8IB 4B2BA 5CHBA 2PKSB 1QL7A 4NZLA 1P0SH 3S9CA 1O3IA 3K6YA 2BQWB 5FX6A 3VB4A 5DP6A 1AVWA 1T8NA 3QLPH 4WH8A 1HAVB 4H6TA 2PR3A 1BBRE 1O32A 3F0PA 2R9PA 3TGIE 1Z7KA 1AY6H 4X8UH 2I6QA 5LPEA 1H8IH 2QC2A 4OGYA 3M5OA 3GISB 1P06A 4YTAA 2SGAA 3SU0A 3ZZ6A 1GHZA 1W0YH 1QJ1B 1PQ8A 2STAE 2WPIS 2BZ6H 1C2IA 4J1YA 3CS0A 1GDQA 3BTHE 1PJPA 3EQ0H 1MCVA 1V2KT 2IN2A 2BHGA 2F9UA 2FEQH 2XNIA 1H9LB 5A2MH 2DE8A 3S9AA 5C67A 5LH8A 1OYQA 1FJSA 1H9HE 1BB0B 4UFEH 3KIDU 1PPZA 3MHWU 2VIOA 1LVMA 2XNDD 4NCYA 3UOPA 2ZDNA 1ZZZA 1FY5A 2GGVB 2H9EH 4CH8B 1NESE 2Z3DA 3VPKA 1WU1A 1WXRA 3ODDA 4YXWD 1OPHB 1XUHA 4MNYA 1IQGA 2Z3EA 2RA0A 5GCHF 1ZSJA 3PB1E 2VWNA 3N7OA 1IQJA 1OP8A 3RXIA 2R0LA 4Y8XA 2WV5A 3BTWE 4ACBA 1RFNA 2CXVA 2R3YA 1O2LA 3U28C 1W2KH 1GBTA 2BD8A 1JOUB 3SN8A 4ABAA 1KDQB 3AASA 3SOSA 2PKAA 2HPQH 2RG3A 1IQFA 5DJ7A 3SQEE 1PYTD 1LDTT 1V2MT 4A92A 3E8LA 1IHTH 3F9EA 3O8RA 2Y81A 2J5UA 3ZV9A 3RXFA 3NXPA 2FO9A 1O36A 1TPSA 1WAYB 1KTTB 2W26A 4JZFH 1INCA 1C5NH 1BZXE 2VIQA 1RTKA 3HK6B 5I46H 1TIOA 2VWOA 2W6ID 1HAGE 5KEDA 5FPYA 5E0GA 1ZR0A 1C5MD 1WTGH 3P8OA 5EJLA 1T7CA 1YWUA 1BHXF 2L6OA 3E6PH 2F9OA 1NRRH 3FZDA 2AMQA 4RI0A 3SU1A 1ELTA 1AKSB 4ACAA 2FM2A 3ATKA 3GS9A 4YESB 2CF9H 4YT6H 2FYQA 1TGTA 2VIWA 3C1KA 1SGDE 1OWJA 2FOCA 1HJ9A 3JZ1B 1FUJA 2OC0A 2J34A 1UK4A 5F03A 4GCHG 3BEFB 2WUBA 4CREA 3UPEA 2BDCA 1T4VH 1DDJA 3TIUA 3S69A 1Z8RA 2G5VA 4NSVA 2ZECA 1LQEA 3TJOA 1TOCB 5EU8A 4ABHA 2AERH 1RIWB 1KXFA 3RU4E 3LH3A 3A7TA 1E79D 1ELAA 1HIAA 1TNJA 4F4OC 3GCTG 4AG1A 1F92A 1BTXA 1FONA 2A5KA 2R2MB 1DLEA 4KELA 1P57B 2IPHA 2W3KA 3D65E 1J17T 2F9VA 3AAVA 4I8JA 1TQ7B 1CHOF 4K2YA 2FPZA 1VZQH 1LVYA 2F3CE 2VWLA 3ODFA 4Y79A 4BNRA 1HAVA 4TY7A 1O31A 2SGDE 3RMNH 2EI7A 5ESTE 5BRRE 3GICB 3T62A 2UUJB 5GPIB 4CR5A 4H6SB 5JB8S 1DM4B 1RIWC 3TJVA 1FV9A 2W5EA 2KCOA 2FDAA 4MNWA 1VCWA 3NCLA 1D6RA 2ZDKA 4ZXXH 1K0HA 1YCPH 2THFB 1ACBE 1GJ6A 2WINI 1GBCA 1A3BH 3K9XB 1Y59T 1TQ0B 5CMXH 3PM3A 2QA9E 4NIYA 1P02A 1S6FA 1O2WA 1ZTLA 1P9UA 2YOLA 3M5MA 3RXVA 3CENA 2QV1A 3SNAA 1VGCB 3BTDE 3KN2A 1A4WH 3E91A 2G8TA 1TRYA 3PWCA 1COWD 3SQHE 5CDFE 2FOMB 2K1QA 2QE7D 2GZ9A 1GJ9B 4ABFA 2ODYB 2QF4A 2ZFTA 1F5RA 1TE0A 4IN1A 1Z6JH 3GY4A 1AFEH 3PLKA 2GV6A 2FTMA 3ZYEA 1SL3A 5FX5A 4ZUHA 2OD3B 2OK5A 5C3NA 1EAWA 4DT4A 1O2UA 4MVNA 4UEHH 2KCYA 4NA9H 4CRCA 1C2GA 2A2XH 4VGCB 5DP8A 1O3HA 2J97A 1RGQA 2G00A 4CBNA 4KP0A 1KDQA 3IITA 4FUBA 3OTJE 2Y5FA 1QJ7B 1VGCC 1HAPH 1NFUA 1ZHPA 2P3UB 5C1UA 2QF0A 4AFSA 1A0JA 2OLGA 4JCNA 1O0DH 2CN0H 1YC0A 3MFJA 1N6XA 1K1JA 5HMAA 1KXBA 1P2QA 2ZFFH 4LXBH 2C8YB 3SNBA 3SU4A 3KCGH 3W95A 1QBOA 1F5LA 4DURA 2ZC9H 3R3GB 1O3DA 4LZ1H 1NTPA 1Y5AT 5EJ1A 1WQSA 1HAXB 6ESTA 4WWYA 6LPRA 3ZZ9A 2A7HA 3LOXA 4Y11E 4ABDA 3TVJB 4YT7H 3KL6A 4AG2A 1CT0E 4MPWA 3QZQA 1CA0B 1CT4E 4VGCC 1ZTJA 5DN6D 1W7GH 1C5WB 1GCTB 3MO6A 1AKSA 1AZ8A 2JH0D 4O97A 5IDKA 1L1NA 3M5NA 2OP9A 1EB2A 2QF5A 3P6ZB 3MO3A 4U2WA 2SGPE 2BD9A 2XWBI 1C5VA 3KYGA 4Y71A 1ELCA 2FS9A 1O5DH 4FUCA 3KHVA 5F8ZA 4WH6A 3V0XA 3KQDA 4I7YH 5FPSA 4GVUA 2BY9X 5C94A 2D2DA 1MZDA 5DPAA 3Q3YA 4Z1MD 4Q2KA 1BRUP 1P2MA 2PGQB 1NU9A 2A32A 2AS9A 1CA0C 1HGTH 1O39A 4H4FA 2ZDVH 5C17A 3ZV8A 1BJVA 3BIVH 1OP2A 4DY7B 1EQ9A 1ANCA 1GCTC 2JJ2D 4RN6A 1XUKA 2BVSH 3SGQE 1TRNA 2FESH 2VVUA 1P8VC 1Z8GA 2NU4E 2P16A 1EB1H 4JYVH 1MBMA 1GVLA 3WWFA 3DD2H 4Q7XA 3NUMA 4XOJA 1H8HD 3TK5A 1YLNA 2G5NA 3MH5A 1O3KA 4FVDA 1YLDA 5FCKA 2SGQE 1EXFA 1YPKH 4I33A 1GBAA 1O2XA 2ZO3H 4U01A 1C4V2 1BTPA 4FXGH 3SV6A 1TNKA 2FI4E 1P2JA 2J94A 1EAUA 2WV9A 3GCNA 4XFQA 1T8OA 4BAHB 5TJXA 2YMSD 1GVKB 1VITG 1UTNA 1MKWK 1N1LA 1TLDA 2B7DH 3RXAA 3UAIC 3F9HA 5GIBA 1LQDB 3F2HA 2WPHS 3EE0B 2A31A 2BXTH 3RXJA 1SGEE 2J9NA 2ZTYA 3P17H 2EA3A 9ESTA 3T28A 5AHGH 2Z9LA 1CVWH 2B9LA 2QN5T 1MU8B 1T8LA 3SO3A 3GYMA 2V3OH 3QK1A 2YNBA 3NKKA 2P59A 2VU8E 1UTPA 1A0HB 2ASUB 2PLXA 2Q6DA 4MLFB 1MAYA 1QA7A 1V2PT 1EAXA 4O3UA 3TNTA 1GHBF 1H8ED 3E1XB 2BLOA 5HM9A 1KXAA 1TX6A 3PTBA 1GMDG 2A4QA 1HXEH 4K1SA 1BRAA 1C1VH 3FANA 4K69A 1ZOMA 2BD7A 5BPEA 3SI4H 1AO5A 3PROA 2GV7A 3SV8A 1NU7B 1SB1H 3VB6A 1O2PA 4AYVB 2XW9A 4A1VA 5A0BA 3RXRA 1P05A 1A5GH 1S83A 3EDXB 4P02A 3WWBA 1XX9A 2PHBA 2AIPA 4GUXA 3D62A 2M2AA 4YLUA 1C5RA 1G2LA 3UIRA 5DGJA 1GVZA 1LO6A 2O8LA 1ELEE 2FIRH 2EQNA 2Y7XA 5EXMA 1UCYH 1SGTA 2PFEA 1C1UH 2F9NA 3FO8D 1GJ5H 3NPSA 2HRVA 1IQMA 1DE7H 4ASHA
chains in the Genus database with same CATH topology
2R0KA 1NPMA 1ID5H 5GDSH 2ALPA 2XC4A 3ZZDA 5A8ZA 3P95A 1GGDB 3RXTA 3LGVA 2HPPH 3A8DA 1C4Y2 1W14U 2Y5GA 1TRMA 3GY3A 1GMCG 2KAIB 1ZSKA 2VIDA 1K9OE 3M3VA 5GJ4B 3RMOH 1FN8A 1TPPA 3BTEE 4ZKNU 2JKHA 6CHAB 5JBAS 5A8YA 1YPMH 2PW8H 1KLJH 1MTNB 1N6YA 3ZVBA 5DG6A 4MPUA 1O2ZA 4BAOB 2BDAA 5T6FA 4IC6A 3MU4A 3ELAH 4JZDH 1TGBA 3P8NA 1GJ4H 2WPKS 1C5YB 1GI6A 3A7YA 4K5ZA 1NFWA 1DS2E 1GGDC 3MH4A 4R0IA 2G52A 2ZQ1A 5AFZH 1TBRH 2Z9JA 4YO9A 1BITA 1TA6A 1QCPA 2EEKA 1PPEE 3HGPA 6CHAC 1MTNC 5LPRA 4BOHA 4DCDA 4IN2A 1JMOH 2H9HA 2Y82A 1W0ZU 1O3GA 1V2TT 3F9GA 2FODA 1GJAB 1EPTB 3TH4H 5FCRA 1AWHB 3LT3A 2ANWA 4CRAA 2PUXB 4UONA 2FTLE 1OWKA 2PTNA 2Z9IA 2O8MA 2BDGA 1G9IE 1FY3A 1K1MA 1K1PA 1FAKH 4WJG2 1EX3A 3OYPA 2ZHEH 1C2DA 1ZPBA 4XSKU 3ZZBA 5GCHG 2DE9A 5E0JA 4RKOB 2VH6A 3SU2A 2A0QB 2VGCB 3BTME 3RXMA 5C5NA 1PPCE 4DIIH 1GHWH 3SJIA 1QURH 4E7NA 4K1EA 4E7RG 1EZQA 3RXLA 1SGQE 5EXNA 1SGRE 3SJ9A 1C5QA 1EPTC 2ULLA 3RU4D 5GXPA 1QBVH 1JIMA 1CBWB 3LGUA 3UNRA 2WPJS 2XBXA 2FLRH 1QR3E 3RXQA 1GI9B 1GDUA 4CRBA 4X6PA 4Q80A 1O5GH 3TGKE 1T31A 1SGPE 1GJCB 3RDZA 4A5TS 2C8ZB 3IG6B 2GTBA 2A5AA 3GY7A 1XXFA 4FUEA 2OBQA 1QY6A 2XBYA 1O2VA 3KF2A 1GL1A 2A45B 1SBWA 5AFYH 2VGCC 5TCAA 1F0RA 1ZPCA 3FZZA 1NT1A 4Y7BA 1YF4A 1AI8H 1MD7A 3A8AA 1IQHA 2BDHA 1SFQB 1CBWC 2BD3A 2HNTC 1NN6A 1ZGVA 1GI5A 2WYJA 1V2VT 1O2MA 1MTUA 2AYWA 5H4IB 3SV2H 1P10A 1TWXB 3RM0H 1MH0A 1VCQA 2BDIA 4A7IB 4AFZA 2QY0B 1C1PA 3LGYA 2W7SA 1OWEA 4NGAH 4GPGA 3UWIA 1V2QT 2GZ7A 1EAIA 2O8UA 1ZMJA 2F9PA 2AEIH 1SSXA 3O8BA 1KY9A 2H2ZA 2KAIA 3FFGA 5HYOA 1ANEA 2EI6A 4INLA 3VB3A 3Q3XA 1Y3UA 2V35A 1ZSLA 3BTQE 1JXPA 5JB9S 2ZTXA 1FZZA 3URCA 3T25A 1KTSB 1A1RA 2ZGHA 1OKXA 1DVAH 1DPOA 2J4IA 1MZAA 1F0SA 5EQRA 8KME2 3UR9A 1S6HA 5CHAB 1QTFA 1C5UA 3QWCH 1Q3XA 1CHOG 3AW1A 5ABWA 1BT7A 1OOKB 4E05H 2HLCA 1LPZB 4D8NA 2VIPA 3S9BA 1PPGE 1C1QA 3VXFH 3F9FA 4IGDA 1CT2E 1HAZB 2PGBB 1THPB 4HTCH 3DT0H 1MTWA 5EPNA 2ZP0H 1SLVB 1XM1A 2A7CA 2V3HH 4XBBA 3U1IB 4X0WU 4BAKB 3MU0A 4TYDA 5JPMH 2XRCA 1HRTH 1TB6H 3KGPA 2AGEX 1PPFE 5DP7A 4X1NU 5DP5A 2XC5A 2C93B 5C2ZA 1EPTA 2J92A 2BTCE 3B9FH 3BG8A 5CHAC 3OX7U 4TWYA 3I29A 4KTUA 2ODPA 3GYLB 1TYNA 3A84A 2BD2A 3HPTB 3RXSA 1S85A 3ATIA 2UWLA 1S81A 4X2VA 5J4QA 3E3TA 1QGFA 1CSOE 2ZHFH 1ABJH 4KTCA 1FNIA 1MU6B 1ELVA 2P3TB 2HNTF 2ZDAH 1TOMH 1GI7B 1PFXC 1OP0A 1AIXH 2Z7FE 1SLWB 1IQIA 1Y3YA 1P11E 1GI3A 1UTMA 1ABIH 3SU6A 4FU9A 4QT8C 1ARBA 1EATA 3ZVDA 4B76A 4BANB 1SLUB 1Z8JB 2GCHG 2A2QH 3P8FA 1SQAA 1BOQA 1C9PA 4NG9H 4K8YA 3EGKH 1Q31A 1LTOA 4FVBA 3BV9B 4NSYA 3SV9A 2CJIA 2GZ8A 2AMDA 2ZQ2A 4X2WA 3A82A 2BVXH 2Z94A 5PTPA 1SFIA 4AGJA 4B73A 4OGXA 1OWHA 4JYUH 4OS6A 3U9AH 3BEUA 1EZXC 5EG4A 2VVCA 1O2GH 3TLOA 2FOEA 3A7XA 1YGCH 1DT2A 3UTUH 4KTSA 1V6DA 1DX5M 3LONA 3BF6H 1ETRH 1KLIH 4ZXYH 3QX5H 3SNDA 1LHCH 1D3TB 1EUFA 5FPTA 1HCGA 1IHSH 3ZVAA 3UREA 3UR6A 2BY6X 1OSSA 2TGPZ 1O33A 1O2JA 3EA9A 1ARCA 3V13A 3CP7A 1P03A 2B8OH 3M7QA 1CQQA 1C5ZB 3OY5U 4BAQB 1V2OT 1SLXB 2BQ7B 3STIA 2ANMH 4ZAEA 5A0CA 3QO6A 3Q76A 5C1XA 1TX8A 1MQ5A 2GKVE 1FY4A 4FUJA 1GHAF 1DANH 1YYY1 2R2WU 3P92A 1YPLH 1P01A 1NM6A 8GCHG 1O5FH 1KXDA 1K21H 1V2NT 4NA8A 2XCFA 3M37A 3F1SB 4MNXA 3RXPA 4OS2A 1C1OA 2HGTH 1C9TA 2OTVA 1ELGA 1HJAB 1WYKA 2FS8A 2UUFB 2O8WA 3K2UA 1C2LA 2I6SA 1BBRH 2Y5HA 3GCOA 1NRSH 3PWBA 1NO9H 4XBDA 3MWIU 3T2NA 2P94A 5EW1H 1JIRA 2ZPSA 2FOHA 5E0HA 2OC7A 2PSYA 1CO7E 4DT7B 2OQUA 1QRWA 1AZZA 4TPIZ 3HK3B 1O3JA 2C4FH 8ESTE 1NRPH 3E0PB 3IWMA 1ZHRA 2CHAB 7GCHF 1G2MA 5C20A 3M3SA 1HAYB 3PV4A 4GCHF 4DGJA 2BLQA 3BTKE 1SOZA 1E0FD 1GBFA 2FXRA 4ZMAH 4ISIH 4X1RU 4AFQA 1UVTH 1C2JA 1S0QA 3OSYA 1UTJA 1VCPA 2LPRA 1HAIH 4UDWH 1HJAC 5JYIA 4MDSA 1XUFA 1UVPA 2QGRA 5EXLA 4K1TA 3VXEH 4DOQA 2ESTE 1E36B 1GHBG 1MTSA 1GBDA 1KLTA 4Z0KA 4B1TA 1SGNE 1C5LH 3KQBA 1W7XH 1F0UA 1GBKA 4NIWA 4K3JA 2CHAC 1E37B 3ZZ7A 1ZRKA 1FIWA 1HUTH 3MNSA 3RLWH 1C1MA 4FUHA 2NWNA 1QIXB 3BTGE 3D49H 1P2NA 1EJAA 4Y7AA 1IQKA 4AGKA 1YCPK 2C8WB 4RKJB 2BMGB 1BMLA 4TY6A 4B75A 2BLVA 2ZIQH 5SGAE 3RMLH 3LJOA 3TITA 2FZZA 1SR5C 4FU7A 2Y80A 2OCVB 3NK8A 5L2ZH 1AVXA 2Y6TA 1GBMA 5T3HA 4DG4A 2XYAA 3RXOA 1G3CA 3HATH 4NIXA 3RXUA 1GI2A 1ZPZA 3Q3KA 1WQVH 5JBBS 2ZHDA 1GJBB 1UO6A 4SGAE 1JRTA 4E06H 3HGNA 4CR9A 5HXFA 3BG4B 1W13U 1EOJA 3A89A 3U1JB 2NU1E 4WMDA 1NFYA 3AW0A 5DP9A 3ZVGA 3NZIA 7ESTE 1UVUH 4Y6DA 2TGAA 2UWOA 1O3AA 2ZGCA 4K60A 2RDLA 4BTUB 1CGHA 1A61H 1SOTA 4GHQA 4X2XA 1Y8TA 2ZCHP 4THNH 2XWAA 4X1PU 6GCHG 2FLBH 1QL8A 2TPIZ 1SGFA 5T6DA 3BN9A 8LPRA 1L4ZA 4D7GA 1UTQA 3FVFB 5FHTA 2ZA5A 2XXLA 3BG4C 2ZCLP 2M5TA 1PYTC 4NZQA 1UVOA 3WY8A 1P09A 5LPFA 4Y8ZA 4BXWA 1Y3VA 1O3NA 2UUKB 4DVAU 3MO9A 1K22H 1G3BA 3L33A 3PTNA 2HOBA 4YLQH 2VH0A 1O3MA 1LVBA 2ZPRA 4Q7ZA 3RXCA 3HKJB 4AN7A 1AN1E 4O03A 1QNJA 1NS3A 1L1GA 3QTVH 3FP8E 3QGJA 3TK6A 3MH7A 3UFAA 1YLCA 1DICA 1AUTC 1BCUH 2OBOA 2HWLB 4I8LA 4CH2B 3TU7H 1F0TA 1GBHA 2IJOB 1FIZA 3MU8A 1CU1A 1UHBB 2ALVA 2R3UA 1GDNA 5L30H 3K65B 1FQ3A 4MQAA 1TPOA 4ISHH 3MTYA 2BOKA 1D3QB 3MNBA 4JYTA 4ZKSU 3S0NA 1ANBA 3SORA 5EGMA 4ZHMU 3TH3H 1MCTA 2ZTZA 1YPHE 3F6UH 1LHGH 2BX4A 3E16B 1BRCE 2EC9H 4FUIA 4MPXA 1GWAA 3PMJA 3BIUH 3L3TA 4NFFA 3SZNA 4FU8A 1ESBA 1VR1H 4DJZB 4AYYB 1EZUC 1LPKB 3M61U 1TPAE 1G36A 1WTHD 2XBWA 1NRQH 3SNCA 5EODA 1LHFH 3E0NB 1MAXA 1UTKA 3W94A 1LHDH 4INHA 1ETTH 2XTTB 1YPEH 4D76A 3TGJE 2SGFE 2IOTA 3RXHA 2CGAA 2GT7A 4OS1A 7LPRA 3GOVB 1QRZA 2ANKH 4UFDH 1FAXA 2GDDA 4Y76A 1HLTH 3SUDA 3PLBA 4HGCA 1MKXK 2EI8A 1V2ST 5B6OA 1DITH 1HAHH 7KMEH 1VITF 2A1DB 4Q7YA 1C2MA 1NC6A 2NU3E 1D3PB 2J95A 2HNTE 3I78A 1MD8A 1YKTA 2ZHQH 1DUEA 2AH4X 1PPBH 3MMGA 2A4OA 3H7TA 2BZAA 1G30B 5I25A 4KKDA 1TNGA 2G55A 1L2EA 1O5AB 3S7HB 1DUAA 2ZGBH 1O30A 3SNEA 1IQNA 1J8AA 2HVXA 1ETSH 1TGNA 4B74A 2UUYA 2G4UA 5L2YH 4WY3A 1GMHF 3LGIA 1GBJA 1T4UH 1GJ7B 1W3CA 4FUDA 1BQYA 1GMDF 1YPHC 4INKA 2QIQA 2G4TA 3V7TA 4CHAB 1A46H 2ZU3A 1UCYK 2D8WA 2SFAA 4I32A 1QFKH 3KQEA 1FY1A 1C1WH 1CE5A 1O5BB 2W7UA 1EZSC 1GHYH 1FLEE 3EYDA 1V2LT 1C1TA 2GX4A 1SVPA 4U32A 1DY8A 3T29A 1C2KA 3T5FH 3QGNB 3DFLA 1DWEH 1FPHH 1O34A 3B8JA 1TNLA 4UFFH 4ISOA 2J38A 3TH2H 1D9IA 3MOCA 1XMNB 2FI5E 2QYIA 3MNXA 3UNQA 1RXPA 4AFUA 2F83A 4TWWA 1B0FA 1FXYA 3O8DA 1SC8U 1A3EH 1KSNA 1QRXA 2BM2A 2OC1A 5F8XA 1MMJN 3MYWA 1H1BA 3ZZCA 5FBEA 3NWUA 1FY8E 2H5CA 4CHAC 1B0EA 3DUXH 4HI3A 4ZHLU 2C3SA 5AVDA 2O8TA 2H5DA 1K1LA 1GMCF 3GDSA 2QF3A 2TIOA 5DP3A 3ZYDA 1UHBA 2BY8X 3RXGA 1O3BA 9LPRA 1O5EH 3U8TH 1QA0A 2GVFA 3SJOA 4X1SU 1WOFA 2FX6A 1EP6A 3A85A 1BTHH 2A7JA 3LGTA 2UWPA 1YBWA 1UK2A 1C5OH 1C5XB 4OS7A 5DP4A 3H5CB 2AFQB 1EP5A 2ZFRH 3ZVFA 1GI8B 3A7ZA 5TCCA 1Y5BT 3ZZAA 4K8BA 4ABEA 3RUOA 2ZGJA 1VJ9U 1VJAU 1GHVH 1MQ6A 3AAUA 1HJ8A 2OQ5A 3TNSA 4DIHH 1C1RA 3DA9B 1DWDH 1THSH 1BIOA 5J4SA 3KNXA 4U30A 1Z6EA 1O3CA 1LPGB 4JMYA 5ETXA 1HBTH 4DW2U 4IW4E 4KGAA 1YCPM 3KEEA 1GI0A 5CE1A 1F5KU 3Q00A 1XUJA 5LGOA 1UTOA 1V2WT 4YOJA 1RS0A 2PKSC 3RM2H 1RJXB 1K2I1 2GDEH 2STBE 3ITIA 1OXGA 1K1NA 2BOHB 3QTOH 2FP7B 1O2SA 2TRMA 3ESTA 2O9QA 2PV9B 3C27B 1AVGH 1C5TA 2AGGX 1MTVA 2ZU2A 1A0LA 4BAMB 3SUFA 1TNIA 1XVMA 1O2KA 1V2JT 4HFPB 2CV3A 4IC5A 5T6GA 1HAOH 5EQSA 3RMMH 4IS5A 1AD8H 1AFQB 1FPCH 2BB4A 2ZFPH 1OYTH 1DLKB 4H42U 3SJ8A 4AZ2B 2BYAX 2FOGA 4ISNA 2GP9B 1G37A 2CF8H 2XBVA 5EW2H 4X6NA 4AB9A 1Y3XA 1ELFA 1P12E 1AU8A 1LHEH 4GHTA 3U8RH 1GCDA 3M36A 1SG8B 3E90B 2ANYA 4JZ1A 1JRSA 4JK5A 3M7UA 2WV4A 3A8BA 1KXCA 1DSTA 2FOAA 5JBCS 1GHAG 1ESAA 2QXGA 3UQVA 1BRBE 1AMHA 1QB1A 1RTFB 5DO4H 1ELDE 3BTFE 3MH6A 1XUGA 1V2UT 1O2IA 1Z1JA 3GY6A 5F8TA 2VIVA 1AFQC 3UOUA 1YM0A 4Y10E 4X6OA 1O3FA 2XC0A 1TGCA 3SJKA 1XXDA 4WXIA 3QN7A 3SUGA 1TONA 3ZZ5A 2FX4A 2TGDA 4D9QA 1AQ7A 3MNCA 1P2OA 1ZRBA 3A88A 5K7RA 5A8XA 3GDVA 3QDZB 1CGIE 4YOGA 5L6NH 1O37A 4Z6AH 5A09A 3FP7E 1C5SA 4FUFA 1FN6A 3LIWA 3EA8A 1SGYE 4GLYA 4MTBA 1HDTH 1HFDA 4O3TA 1GBIA 7GCHG 1TFXA 4JZIA 4O9VA 2YNAA 4A1TA 1C2EA 4NIVA 1BA8B 1XKAC 3RU4T 2JETB 1C2FA 3SUEA 1BMAA 2WPLS 2GD4B 1S5SA 4BXSA 1BDAA 4ZKOU 3A86A 3ZVCA 1NFXA 3FP6E 1IQEA 2WUCA 3K6ZA 4WXVA 1DWBH 3T26A 1ELBA 3U69H 2BVRH 1CGJE 1BJUA 3O8CA 2GCTB