1MB0A

Crystal structure of the response regulator divk at ph 8.0 in complex with mn2+
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
120
structure length
107
Chain Sequence
TKKVLIVEDNELNMKLFHDLLEAQGYETLQTREGLSALSIARENKPDLILMDIQLPEISGLEVTKWLKEDDDLAHIPVVAVTGGCEAYISKPISVVHFLETIKRLLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic and Biochemical Studies of DivK Reveal Novel Features of an Essential Response Regulator in Caulobacter crescentus.
pubmed doi rcsb
source organism Caulobacter vibrioides
molecule tags Signaling protein, cell cycle
molecule keywords cell division response regulator DivK
total genus 39
structure length 107
sequence length 120
ec nomenclature
pdb deposition date 2002-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1mb0A00
4MS1B 4NCBA 1BVHA 5D2CA 2N9UA 4O1IA 5FWXA 4M88A 3SG0A 4MS3A 8ABPA 1ZGGA 3C6QA 3A3KA 4N03A 4KPYA 3IPCA 4Q6WA 4F8JA 6CHYA 1MB0A 2FLKA 5ABPA 1UDRA 1Y1LA 4RWEA 1SXGA 4LE2A 5JNRA 3KLNA 1ZAYA 5DLEA 1GCGA 1USGA 4RDCA 1CYEA 3NNNA 2WY2D 4E7OA 4Z4IA 3CLKA 3H6GA 1FFGA 9ABPA 4YV7A 3TO5A 1EWVA 4W5OA 3MA0A 4MR8A 3OLZA 5JNSA 5CNKA 4D6XA 3L49A 1KRWA 3FFXA 3TX6A 4EYGA 4WXMA 3LTEA 1BAPA 5FBHA 4QYWA 1EWKA 3KCNA 4LE1A 4TLMB 4EYKA 2NZUG 4MRMB 1A0OA 4HNRA 4RZSA 4KMRA 3HO1A 3LUJA 5JS1A 4MQFA 3ROTA 3DZDA 4IF4A 4KQ9A 1KGSA 5TQ2B 4JASB 4Z4CA 1MAVA 1SD5A 5IULC 4G0ZA 4EVSA 3LUKA 3CG4A 4WZZA 3OMWA 1JX6A 1VLZA 2P9HA 2QR3A 5T7BA 2JRLA 4RY8A 1U2QA 1Z25A 2E4XA 1TJYA 2H3HA 4RK4A 2JBAA 1Z16A 4YS6A 5DGCA 2AYZA 2JVKA 3OM1A 4KVFA 4XXHA 3GT7A 3MIZA 2V0NA 3BREA 2FQWA 3QX9A 5EWLA 2A9PA 4OLAA 1TMYA 1PHRA 4B09A 3D8UA 4JB2A 2LPMA 1TM2A 5IBQA 3RVJA 4UHJA 3I5AA 4Y9TA 4P1ZA 3CRNA 4H60A 4LDAA 3H1EA 1EWTA 3MYYA 1LBHA 3UUGA 1DRJA 2WRZA 3N0XA 4YLEA 4NV3A 3A10A 3F73A 4JA2A 3TMYA 1YK0A 3N53A 4PYRA 2HJ9A 2E4VA 1K66A 1Z2EA 3OLWA 2QU7A 3N0RA 1NXWA 3IPAA 4MPTA 1AB6A 3G1WA 1NXVA 1FFSA 3I45A 3KYIB 4D6YA 4LE0A 4ZJPA 1JYEA 1RZRD 2FEKA 5DCLA 2FMHA 3QLVC 2IDMA 1M2EA 5EWMA 4OLBA 2PL1A 5IEJA 1GUBA 2HPHA 1NXXA 5EWMB 1CHNA 2H0AA 2QVGA 3HEBA 1JFTA 4Z99A 2BGGA 1PNTA 1Z2DA 4N47A 1B00A 4MQEA 3KTOA 2A9QA 5HQJA 2PUAA 3T95A 3JVDA 3O21A 1BDHA 5TQ0A 3HM9A 3K9CA 3N75A 4YP9A 1LJLA 2QV0A 1E2BA 1DCFA 3NNDA 3CS3A 3IP6A 4FE7A 3OQNA 1YK1A 2LP4Y 2PMCA 1FFWA 1W25A 1Z18A 4GPAA 4F3TA 3N0WA 3LUFA 4WUTA 1MVOA 1EAYA 3E3MA 3GA5A 2GWRA 4IILA 4EGSA 2GBPA 4KRFA 1T34A 5TQ0B 1NXPA 1P2FA 3NNSA 3D02A 4UHKA 2B1JA 3GYBA 1C0EA 1DBQA 4G0YA 4IMIB 2PLNA 3BRSA 4TMYA 4LRQA 1QQAA 4MQEB 2PL9A 1NY5A 1M5UA 4FB4A 2E4UA 4RY0A 4NICA 2HSGA 4KK4A 4ZPJA 1I3CA 3HSYA 3SQNA 3CFYA 7ABPA 5IX8A 3OQOA 4YWHA 5BR1A 3EQ2A 4WT7A 3P9YA 4G0XA 3JY6A 1IIBA 3S99A 3SM9A 4YR7A 3QELA 1RXEA 1M5TA 2PUBA 3RVPA 1OXBB 1E6KA 4PICA 3RVNA 1JHZA 2JVIA 3F7NA 4Z0NA 4G0PA 3DGEC 4G0MA 4EVRA 1E6MA 4ZMRA 1A2OA 3Q7TA 1BDIA 2JVJA 2FW0A 4O1HA 3UK0A 2L19A 4ML3A 3EGCA 4MYRA 3C3WA 3W9SA 4MR8B 3H5OA 3HXMA 2GKGA 3CHYA 3HV2A 1FSPA 2J48A 1QPZA 4MR7B 1ZITA 4RY9A 2QW1A 2FN8A 5CHYA 1CEYA 4Q6BA 3OQMA 2JBAB 4MS4B 5FWYA 3FFTA 1KMIY 4OATA 1ZDMA 3E61A 5KC9A 1QO0D 2CHEA 3KS9A 4Z4FA 3CNBA 2PUEA 1PEYA 1DCMA 3N6VA 1FQWA 4S05A 2RJOA 1D1PA 4W5QA 1DP4A 2VUHB 3DGFC 3O2QB 4RKQA 3KLOA 4EY3A 5B3JC 1P8AA 1GCAA 3FMVA 3H5TA 3RQIA 1ISSA 4EYOA 5KQGA 1ZH4A 2E4ZA 1A04A 5BRAA 3JPYA 2MSWA 3H5IA 2NZVG 1DG9A 2IOYA 4G0QA 2RJNA 1QNLA 2WJWA 3RVMA 2DRIA 4XLTA 3KJXA 5JNWA 1H9CA 1DC8A 3DBIA 2PE5A 4W5TA 4RXMA 3C97A 4EUKA 5BQ3A 2FQXA 1K68A 4KREA 2ID9A 2MSLA 4JP1A 3CKMA 1RPJA 4Q7EA 4N76A 3LUHA 3L6UA 3JPWA 2JK1A 5F64A 1D4ZA 2VYCA 4LDZA 3BRQA 4MS3B 2FMKA 3DLBA 4MS4A 5FWYB 3SAJA 1YIOA 1SRRA 3QK7A 4JAVC 3QLVA 1L5YA 5IUJC 1JFVA 2ZWMA 1U2PA 3O74A 4MR7A 1ZHHA 1NXSA 5C5CA 1D5WA 2GX6A 4P98A 4IRXA 1AB5A 3KSMA 4MR9B 1USKA 4EYQA 5HKOA 3O1IC 3EULA 3BILA 4GNRA 2IYNA 2RGYA 3Q7SA 3H5WA 3UKJA 2PKXA 2QSJA 5TE9A 5CNJA 1Z26A 4DQDA 1PUXA 5DTEA 1QO0A 2PJUA 2QXYA 5JS2A 2WB4A 1YS6A 2FSPA 1J56A 2A9OA 3IP7A 1ZESA 2LBPA 1NATA 4RSMA 5IC5A 4ETMA 2MYTA 2FMIA 3QELB 5ED4A 5KQLA 1DBWA 1DC7A 1QQBA 4Z4EA 4OBBA 3IP9A 6ABPA 1JLKA 1XWWA 2MYUA 3QEMA 3O2JA 3QX8A 1TVMA 3T6KA 1YMVA 5IUNC 3HK2A 3G85A 1LK0A 2ID7A 3RVQA 4F06A 4YRZA 5BRJA 3ILHA 5CNIA 2IPLA 3Q9SA 2PUDA 3LUDA 3IDOA 4L4UA 1QMPA 2QZJA 3A0UA 2MYNA 4MGEA 4WWHA 3T8YA 1XHEA 4Z9AA 1EHCA 3JVIA 5KQMA 1VPWA 1U8TA 4TLLB 2O20A 4ZYLA 3HUUA 5KQPA 4KNYA 1GUDA 3H6HA 1Z15A 1URPA 3HCWA 1GLGA 1MB3A 3VNBA 3O1JC 4WXEA 1QKKA 2R25B 3M6MD 3O2SB 1PNRA 1HEYA 4RK0A 4D74A 1DRKA 1RNLA 3KG2A 2W42A 2FVYA 4E7PA 4TN5A 3I09A 4HNQA 1ZN2A 3KKEA 4IGAA 4ETNA 1ZY2A 4N41A 1D2AA 1SXHA 3LFTA 2JB9A 2HQOA 3LUGA 4RK5A 5DKFA 5IEBA 5KC8A 1LBIA 3LMKA 5C5EA 2AYXA 3EQZA 3CZ5A 2E4YA 5GOTA 1JFSA 2MYPA 5CNMA 1L5ZA 3F6PA 3QLTA 2NUBA 1VKRA 4RXTA 3GBPA 3DLHA 3LKVA 2X7XA 2RDMA 2WJAA 2F8TA 1APBA 2A9RA 4Z9BA 1KRXA 2NT4A 3O75A 4PEVA 2LUOA 3URMA 2FTKE 2Q5CA 1NTRA 3VNAA 2WMYA 4RK6A 2FKAA 4MLCA 2IPAB 5TQJA 4DADA 3EODA 3NHMA 2HQRA 3C3MA 1U04A 3OO0A 4YCSA 3GBVA 1PEAA 3TB6A 1ABFA 1JBEA 1JL3A 1NXOA 2FEWB 1R8JA 1JWLA 1QP7A 4OG2A 4KFCA 5GQSA 2PAFA 2CWDA 2OENG 1P6QA 2WWVD 3TD9A 5EWLB 1M2FA 3KHTA 2CHFA 4QYMA 2FN9A 3I42A 3HUTA 2GI4A 3MF4A 3ROFA 3Q15C 4KV7A 4ETIA 3CTPA 2L17A 2NT3A 3RVOA 3JS5A 3FFWA 4KZKA 1Z13A 1VRVA 2M1ZA 1F4VA 4NQRA 2FXIA 3IP5A 3QLUA 4RS3A 1USIA 1ZH2A 3MMNA 4PZ0A 3GWGA 3RVSA 3OLXA 4MQFB 3F6CA 2F8SA 3HVRA 4RK7A 3FDFA 2R48A 3RVRA 3OLVA 4XASA 3O1HB 1F51E 4MRMA 4W5NA 3QLUC 1Z12A 3LOPA 3B2NA 1YVUA 3LUCA 3LUAA 3H75A 1YS7A 1E6LA 4H3KB 2PUCA 4W5RA 3H1GA 3GRCA 3EJWA 3FGZA 4XARA 1MIHA 1YMUA 2FMFA 4HNSA 3EDCA 3K4HA 4LZLA 4S04A 2YHAA 4DN6A 3KYJB 4G86A 1JDNA 2FQYA 4RU1A 3NBMA 4G0OA 2XDYA 3R0JA 2VUIB 5HM6A 5B3JA 3CU5A 2P4UA 2R47A 2PUFA 4RKRA 3BBLA 4HYEA 1QP0A 1DJMA 5IUKC 1LJUA 3RVKA 3RVLA 4Z4HA 1BA2A 2I6FA 3H1FA 1ISRA 3QEMB 1Z17A 4RV5A 3OMXA 3ILYA 2CD7A 4PE5B 5FWXB 3T38A 4Z4GA 3RH0A 4MS1A 1QP4A 2L2QA 5TQ2A 3OO1A 4L85A 3HDGA 3SY8A 5TPZD 2PUGA 1ZGZA 2R4QA 1WETA 1ABEA 5JNTA 3H5VA 4QICA 4N0QA 5JNUA 3HDVA 4MLDA 1YTUA 5TPWB 3EAFA 1XHFA 5KI6A 5EWJA 2MSKA 3CG0A 1U0SY 3GV0A 5E3JA 4RXUA 4O5AA 3A0RB 3N8IA 4FE4A 4RK1A 3SNKA 3MM4A 1TLFA 3LKBA 3NHZA 1SXIA 1S8NA 1ZVVA 4MR9A 3OM0A 3M9XA 1RXIA 4JB0A 2IKSA 2LIVA 1JF8A 1D1QA 4KQCA 2VK2A 3H5LA 1NXTA 1DBPA 4JOQA 4YGXB 1P6UA 1JH9A 5TPZA 3Q41A 3OLYA 3C3KA 2JCGA 4ZMSA 1C4WA 4YO7A 2YHBA 5KWSA 2FEPA 2L18A 5JNVA 3CZCA 4F11A 4EVQA 5T3YA 3HS3A 2ZAYA 3Q7RA 2KYRA 3GL9A 2TMYA 3QEKA 4H3HB 4F12A 1EFAA 3HJFA 2M98A 4IMJB 2E4WA 5FBKA 1JYFA 4MAAA 2HQBA 4XFKA 1DCKA 3HZHA 1JDPA 1BDJA 4QPJC 2IPNA 3M9WA 2B4AA 4LX8A 4CBVA 5I4CA 1RZRA 5EWJB 1W9HA 1OXKB 5PNTA 3JTEA 2OQRA 4N0PA 4OTZA 2IPMA 5TPWA 4NCAA 3MQ4A 4G97A 4XAQA 5HSGA 2QVCA 1DZ3A 2FLWA 4KK3A
chains in the Genus database with same CATH superfamily
3HM2A 1BVHA 5BV1A 4AS1A 2I1QA 2NYAA 3P94A 3V7YA 3Q7EA 4WLVA 4PNPA 3D6JA 4XGKA 3ZYCA 4E31A 1SRQA 3U9TA 2XYRA 4HP8A 3ZXSA 2ZJZA 3I9V6 3UJ6A 5K6TA 1PL6A 3AVVA 2I2CA 5JW6A 4MXDA 3IPCA 3D4IA 4V0OA 3OPXA 1XZBA 2DR3A 4I5IA 4QNNA 4G4SP 2WMNB 1AQUA 3F4LA 4RM3A 4DV6B 2E85A 4I50B 1C1YA 4QUGA 3FE2A 3ZZUA 2DFLA 4Z4IA 4EB6A 4ZT5A 2QK4A 1PKXA 1OWOA 3ED5A 1FXWA 1QK3A 2FG6C 4Z2YA 1ZO8A 5CB6A 1FJ2A 3ZDAA 1GPLA 1M6VB 2LXNA 1SOVA 2VI5A 2WHYA 3C24A 3C5EA 5CNKA 4YRQA 4LF4B 2ZRFA 4IDNA 4JJ8A 1J4AA 1KJIA 1UJ4A 1VIMA 1SWVA 1WDWB 2GVDC 2HY7A 2IW1A 2GK6A 2X9NA 3DWEX 5ICFA 5J59A 3V1TC 4ER6A 1R37A 1XZGA 3LHKA 4JBYA 4ZXFA 4F2DA 2WUDA 5KTYA 4MRMB 1B76A 3AIKA 3LLMA 1HSOA 1XVVA 2V98A 1USVA 5IC6A 4H77A 2Y0DA 4KQ9A 1Q44A 3AKCA 2FRDA 1SZDA 1Q0TA 3ZBUA 1JKJB 4M36A 1FFHA 4DXHA 3FB1A 3OJFA 1SUCA 2ZULA 1CUDA 3N8KA 4WERA 1JJFA 1GRCA 4IJKA 4J7CA 2JLQA 1K6IA 1KWGA 5KUTA 3NJ8A 1NVVR 4D4HA 4RUKA 3OCWA 5JQGA 3GG2A 2Q62A 3I9LA 4NOMA 5G4LA 2QBYA 1LPAB 1RMQA 1ZG3A 1OU4A 1Z6PA 2QR2A 4L22A 4R8KA 4X1OA 4NE2A 1ECGA 2PX5A 3HA5A 2PGIA 4D0SA 3WNDA 3JRWA 4RJTA 4YJFA 1NKTA 1ZPDA 3G1TA 4C06A 1BHQ1 1FK8A 3F71A 2GEJA 1TC2A 2BEJA 3QXCA 4X71A 3QWIA 4TYNA 1GSAA 1Q1ZA 1U9IC 1OGJA 2RHWA 821PA 2Q29A 2Q5FA 1E32A 1LPPA 3ETEA 3DPSA 3MCUA 4FZJA 4HF7A 3I01A 3KOZA 4BVAA 1VYTA 2PUJA 5EXXA 3N53A 3KQOA 5HG0A 1BXKA 5EPEA 2WHXA 4LGVA 4OQFA 3EJ6A 3T3DA 4BJ3A 1NLFA 1U6IA 3W6NA 1F0YA 4RTOA 3O8BA 1JT2A 2WM3A 4IJVA 3RYHB 4ID9A 2PUWA 3ZW9A 3U4DA 1TJNA 2VQDA 5H80A 4YYZA 3SQDA 5E38A 5DCLA 1M1UA 2R5FA 3IALA 2JFPA 5H1YA 4B34A 2QGFA 3WLIA 2QM0A 1NQ5A 4E30A 3B5IA 1KY5A 4U02A 2D1RA 4Y6PA 5T4EA 4B31A 3CX3A 2W4IA 5DBOA 5EIBD 2FN4A 3GQBA 2F1JA 5T6MA 3A9SA 3DMFA 2X9LA 1EP3B 2BGGA 4CTMA 3GLIE 1MH1A 1K8RA 1S4QA 3ELUA 4I55B 1YB6A 3NZEA 4NE9A 1UPTA 4O2LA 4GOMD 1XXHA 4CIVA 3N6XA 5E9JA 5HQJA 3V7UA 1VI5A 2NG1A 1Z5VA 3O7WA 4M49A 3T95A 3JZDA 2R6DA 3JQQA 3M4NA 1JR2A 3U6BA 1D6JA 1Z8FA 4B3XA 2VWQA 5C8VA 3CNQS 3W77A 1W2GA 1ZHOA 3SP1A 1UEJA 5F2KA 4YRBA 3GVHA 1CUYA 5DNCA 5BNZA 4ZN6A 2HTFA 3VZDA 2H1FA 3S0JA 5TQ0B 1K4MA 2OBMA 3WLAA 4NENB 4ZICA 2WINI 1T9BA 4DLUA 1EM8B 3R5HA 1OSNA 4G0YA 4TTIA 1I7DA 3JARB 3EEOA 1ABBA 4NU8X 4I55A 3SEQA 1FXWF 1I1HA 4LGCA 2FN3A 4A03A 1PT6A 4JSTA 2BF4A 2C31A 3C2QA 2H1LA 1H2XA 3ONDA 3ZCXA 5JH7A 4ZPJA 1ZNWA 3OQOA 3VSDA 4YWHA 2Z56A 4FKMA 4QDOA 2D4AA 3C6XA 4GLOA 4OIFA 4DCCA 1CEXA 2I7VA 5D3QA 3MELA 3I9JA 3RGWS 1U1EA 1ZKDA 3GCDA 2OV8A 1DO8A 2DHQA 2OBLA 1PR4A 1JAXA 3H18A 4ZODA 2IYZA 4N0DA 3W6PA 3TLKA 2R4TA 3OE5A 2GBFA 2JCXA 5G2OA 2I22A 1GU0A 1TAGA 1NJ2A 3B3JA 2QGNA 5A6SB 5KBYA 3AVXA 3RAGA 3BCSA 3P2OA 3W9SA 5HKLA 3NTRA 4MR8B 5AM4A 3CHYA 2ZYRA 5KYVA 1P9WA 4BFYA 3ZWXA 3KQNA 3OQ6A 3F5MA 3T5AA 1TKCA 5JAPA 4M0KA 2B83A 2IT1A 3OFSA 2WQZA 3LH5A 4U7GA 1RQ2A 3OG9A 3TXXA 2XT6A 5IMBA 2QW1A 4PAQA 4TT3A 1IN4A 1FJGB 2I9PA 2OYRA 3UT5A 1G5QA 1X1EA 3VSEA 4BKRA 2CZQA 4UDNA 4JJKA 3NBQA 1B0PA 4CW7A 4B3SB 1AQNA 1ZDMA 2H1IA 3BMOA 4PIPA 4PVDA 4YRPA 4G1FA 2P6NA 4K81B 1MHPA 1QO9A 1VCOA 4WZ6A 1NC1A 1RU3A 2CUNA 3EXFB 2OFFA 2MHCA 3GVIA 1COWD 1KJ9A 3M8KA 1E89A 1GZUA 3NATA 3PUJA 4BKQA 1O5OA 4O1MA 4XI9A 3TZLA 4E2XA 2NTNA 1K5HA 1WTCA 2WWGA 2GJ9A 4ITRC 3VHXA 4F60A 3L93A 3C5WP 3JZAA 2WT4A 4QSMA 4RPKA 2WZBA 4Q9DA 1NI4B 3IELA 5BWLA 5LKAA 4AJ9A 5CD1A 4Y6SA 2VF2A 4OHYA 3Q72A 1C9DB 4R3NA 3PLRA 3A36A 5L6MB 2ZB2A 3K7EA 4KIWA 1B42A 4XLTA 2R6AA 1LJ8A 2RAUA 2XRMA 3ABRB 5F52A 3M6IA 1WVIA 2RE8A 5BN4B 3VZSA 4C7OB 4O2BA 3GDHA 2XYHA 2AJCA 4DMUB 4RF5A 2VZ0A 5SY4A 3UW3A 2PX4A 2FQXA 3WLQA 4NCXA 3NUQA 1X92A 3ZK7A 3UKOA 4D56A 4F72A 1C14A 1TJ3A 3R3ZA 4XD7A 1DIAA 3ZJ4A 1ZMBA 3MBIA 4LRWA 1WAMA 4OGKA 2EKPA 4RD1A 1A96A 1M73E 1VA4A 4B3TB 3FDXA 3H2BA 2PYDA 2FX3A 3RC3A 1IATA 1CR6A 1PDOA 1RQRA 1U8EA 2VTDA 4FUTA 4CQNA 2C2KA 3C3AA 4J91A 4EEKA 4YV1A 3E9DA 3LY5A 2P6UA 4PGAA 1IXSB 1DAEA 3H5RA 4G84A 2Q6LA 3DM9B 2BIFA 4PZPA 3ZWPA 4MW0A 2P1RA 4R1TA 1V2HE 2X22A 4MA4A 1FSGA 4ES6A 2NP7A 2ZYHA 1I1QB 2C94A 2BEKA 3WZMA 4ARVA 4BLWA 5AOAA 4DQDA 5FXMA 2XMDA 2OHHA 4DSUA 1OBFO 1UF9A 5EGSA 4JV5B 1FTYA 1XJ5A 4A0HA 1RHRA 5J1SB 1SUPA 2WMDA 1MC5A 1JBQA 4ZOAA 4S1WA 3EXHC 2FMIA 2HBZA 2X8AA 2ZJYA 3HUDA 3I53A 4C01A 2E5FA 1IHOA 2VXCA 4BMOB 2SBTA 3OEWA 3N5KA 3SJZA 1SJ9A 1MUUA 2TECE 2XZDA 3OHMA 3GUCA 1QHGA 3WHPA 3QPWA 2NTVA 2N47A 3G85A 4K1LA 2PX3A 4Q12A 5AR1A 4BLQA 1DAKA 5CYGA 4JU8A 4M9ZA 3OZAA 3FFAA 5CNIA 3ZCRA 1QIEA 2OEPA 5C3MA 5K01A 2CUTA 5HUHA 5F98A 3Q11A 4N48A 5E7IA 3TLEA 3ZJ5A 3PGA1 1V16A 2I8CA 1GNRA 3HUUA 4N18A 5DULA 4BB5A 5KQPA 3WLFA 1WM1A 2CVZA 2G36A 4Q03A 5BSFA 3UMYA 2JAUA 3PXBA 4BVBA 2I1VB 1JFRA 2NYRA 3SZLA 3QOYA 4BZWA 3MTJA 3NKVA 1ZWKA 3HVJA 4QDUA 2PRZA 5LPNA 3G8DA 3VA7A 1Z2OX 2HR1A 2XSZD 1M74A 4WBXC 1T25A 1GPAA 2O2SA 4WCFB 5DO9A 4D81A 2V65A 1H5QA 2FDRA 3BCUA 1GQ2A 3TCKA 3X1MA 3HDQA 2HW8A 1TVEA 5EVJA 4YI3A 4AQ7A 5JD6A 1SXHA 4JB8A 5KMGA 4RTSA 4EPWA 4IDGA 2XB6A 3WOVA 4ME6A 3QY0A 3DDUA 2PNJA 1BRTA 1WDLA 1J1IA 3A9VA 3ENNA 3F96A 2V7EA 2AFIE 2J59A 1A9YA 2VG8A 4HPJB 1T8PA 3NTOA 1R4NA 2DU8A 3GFBA 1AUXA 4PFJA 5JQGF 1WE2A 2MYPA 2PNFA 2X5NA 4FFRA 1JLLA 5H68A 4RJ2A 1RJ9B 1L4UA 4Z7JA 2Q1WA 3KIPA 4QOGA 1XUOA 3CF0A 3DE0X 1MTOA 2ZQ5A 3G7NA 2NVUB 2B98A 4BEWA 5KQRA 1XA0A 1M6YA 5E8JA 4BLTA 2A9RA 3OQBA 3I0NA 5H59A 4QECA 5DP1A 5CFRA 4NPCA 3OTOB 1OB2A 3NEPX 4GKKB 5DDIP 5CM9C 1TA0A 3N59A 4TWIA 4LY9A 3UAGA 4XYGA 2QZ4A 5DSXA 2WTXA 5FI0B 1UXJA 3RDPA 1LDGA 3VVLA 1C1XB 1P0IA 4IZOA 2QRVB 4S2EA 5JMWA 2FPPB 1TYEB 3I8OA 1P77A 3LBHA 3PFIA 4HR7A 5FYDA 3DAYA 3PTLA 4L1KA 2WK1A 4IIUA 3FWNA 4QYMA 2C2WA 3QENA 1VZ3A 2WYUA 3ST7A 2HWKA 2GI4A 2E6UX 2GFHA 2HO4A 3B2EA 1PDVA 4E13A 3P4XA 3U9SA 2X8JB 3FYSA 4BJHB 1KJZA 3NHRA 3C48A 1II8A 3HFRA 4OEHA 4RCZA 2Y1FA 3AESA 1YF3A 5JXJA 4P2GA 2ZAGA 1YVRA 2GF9A 3QV2A 3ACBA 4UARA 5ERXA 1PV4A 1HNWB 3JATA 3RPEA 5LU8A 4JCCA 4M9CA 4BNHA 4JNCA 2HHJA 5KX5B 1U8ZA 3PCRB 4Y0VA 3NO4A 1YL6A 3E7WA 1HT2E 3N8NA 2HJRA 1JIIA 1WMDA 2OHFA 2G5PA 1M2OB 4I99A 4JC0A 1WF3A 3QLUC 5TY0A 3PR3A 3S5JA 4AAYA 3HN7A 4UDOA 2R1VA 3WQRA 4ZPXA 3WIBA 3SGLA 1VL8A 5C7OO 3KQMA 3FPEA 4HRVA 3NT5A 1ZVKA 4QOSA 1PW5A 5LBIA 3W5HA 4EHJA 1YBFA 1ZRHA 1J25A 3T9BA 3TSOA 2R8ZA 1TEXA 3IBYA 2V6JA 4FQ7A 4FJ2A 3ND7A 2F3SA 4HNSA 3TNDA 2YC2C 3GNSA 1E8NA 3OETA 4F45A 2TSYB 4LNAA 1NMZA 3FYUA 3HCAA 1L5WA 4G0OA 3DOFA 1EWYA 2OQVA 2HIMA 3V2IA 4MQMA 1J2RA 4ZT4A 2DBRA 1ZM7A 5CT4A 2Y4OA 3UMCA 3KKQA 3I9KA 2EQ5A 4XUGB 5DW0A 5JJLA 2I4IA 2C92A 4PQGA 3EGDB 3QEAZ 3SKVA 1UXIA 2FK7A 1EG7A 4ZIRA 4CLXA 3I6QA 3NHYA 2Y1KA 4EEXA 1MEOA 2Y6UA 5D87A 1U6JA 4UD6A 4G23A 4R51A 2IXTA 4Z1MA 2ODTX 5E7QA 2XT9A 2JKVA 2L2QA 3O8OB 3OO1A 4C2AA 4KHPB 3AG6A 2Z9BA 1IJKA 1P2VA 3GH3A 1KBOA 4HVCA 4I4NA 5CDYA 4TXMA 1DWUA 2AWOA 1ACLA 3IPLA 3PUVA 4U8GA 3EAFA 3L8EA 4RD4A 2MR6A 2IHYA 3ET4A 4W63A 4FINA 4ZQBA 2IYAA 3CPJB 5C32A 4KOAA 5CH5A 5LYJB 3VSAA 4P36A 4K6MA 3LJKA 4PO9A 3HNRA 3DC2A 4MYSA 3H2YA 2ZS8A 4QWWA 1OB5A 2QTAA 4LXIA 2HN9A 5IAKA 3PNLA 2QUBA 4Q02A 4WASA 1L9KA 2Z1MA 3DT8A 3L7NA 5CX1B 4URVR 3ZDYB 4ZYXA 1YJXA 3ASUA 2B5OA 1SCNE 1G66A 2GF0A 1C50A 4UNIA 4DY4A 4MYDA 1P62B 1B1AA 3FHJA 1E7WA 2P5TB 3H2KA 3Q41A 5FEUA 1JH9A 3ICCA 4FIDA 2R6ZA 4HDRA 4KPUB 1SG0A 1XAGA 3VYTB 4R0VA 1J1UA 1OI7A 1Y5RA 3VSBA 3RBAA 3QPBA 1WU7A 2BJHA 1GQFA 5FUVA 4CV0A 4EVQA 3M81A 5BW5A 5T3YA 2BHSA 2VRWA 5TDHA 1MB9A 4E5NA 4B3DA 4EVIA 1AK1A 3IMCA 4GQAA 4RJLA 4UUQA 1OJLA 5IH7A 3FB4A 4EM6A 1GV1A 1Z4KA 1WXXA 3ABIA 1USUA 2RI1A 1GUFA 3O8QA 4IIJF 2IV7A 4B48A 1QTRA 3BWVA 2OO7A 5D8DA 2F1RA 3JQAA 5TB5A 1NOKA 4Q7LA 1UP6A 4MAFA 3QVUA 2QLBA 3DULA 4MKXA 4B76A 3MQ4A 4OIMA 3D5TA 2NXNA 3PA6A 1G5FA 2BCGY 3PF8A 4IG9A 4Q3LA 3DBOB 3GJ7A 3O8DA 1W88A 2HREA 1Y48E 2CC2A 4KGXA 1GAEO 2VNKA 1QV6A 1ECLA 2HQSA 2XQVA 3JALB 1NLMA 3LF2A 4CM8A 1JJIA 5B7NA 3WC4A 1MIOA 5D2CA 1U5CA 2C8VA 3ECSA 5FWXA 1QV7A 3W3ZB 4NZOA 1KIFA 3PR1A 2AXEA 4J3JA 2A14A 2A9FA 4KJZA 5KX5F 1JVBA 2VTBB 1EUQA 4HH1A 4EHHA 3K1TA 5C7LO 4Y1EA 4P83A 4IOJA 4Q6WA 1W0KD 5F2NA 5BP7A 2F3UA 3R5JA 1H4TA 2C7BA 4OAPA 4U0KA 3ZE7A 1UL1X 2MINB 2ZYGA 3OMLA 4QEDA 3WGLA 2QJTA 5JV5A 3VDMA 6YASA 1PQUA 1JG7A 1NR5A 1RXCA 4C0LA 5C8ZA 1IMOA 4FR5A 4JJFA 1K2VN 2G63A 2KW5A 3ANNA 4G5XA 3N74A 4TLBA 3BQNB 2V55B 5EJ5A 3CUUA 1IY1A 1QC5A 4FSDA 1S4MA 1TCAA 2FW6A 1HA3A 1VKHA 2A9JA 2WIAA 4NU5A 4UREA 3S7TA 4EMBA 1OT3A 1JR3A 2DFPA 4WOPA 1Y9AA 5DHFA 1UFKA 1Q20A 3SYRA 2D59A 4QLAA 1PZHA 2C7VA 4EX6A 2RFLA 4Q66C 2IJGX 4TTAA 1TZJA 4DQUA 4YLYA 1ZNZA 3C3YA 3PK0A 1F1BA 2JFFA 1NTOA 4TMZA 1W76A 1Z75A 4NFLA 1N0UA 1T3SA 2DCUA 3DW1X 4OP2A 4F86A 1E5DA 2ENUA 1ONBA 3ROTA 1V8BA 4JZYA 3K0CC 4HWRA 4UOZA 1M0SA 1SELA 4WLOA 1W48A 3BORA 1GLNA 2QRQA 1BQEA 2ZWAA 1W30A 1N5RA 3L4EA 5KNLA 4CG0A 1G2PA 2HZ7A 4WCVA 4PYJA 2O5EA 3ESZA 3AJRA 3KQHA 2QR3A 3QX3A 2DT5A 4B3FX 2HWUA 4JCOA 4YS6A 4P35A 3ZDDA 4LZNA 1YQ9A 1UDXA 4MW4A 1GTG1 1G291 3M1LA 5E4JA 1OKKA 1YS1X 1M2NA 5BSGA 2IWRA 1SUWA 4UPVA 5CHEA 3FOFC 2TYSB 4TL8A 3RUHA 1MJFA 3UA3A 4D9CA 1U81A 1U2GA 5LYJF 1B23P 3UMVA 2BEWA 3VKFA 3ZDRA 1PT9A 4HGPA 4CVNA 5JAIA 1QU3A 3N8GA 4BX9A 2O6LA 1FDSA 4P1ZA 2XX3A 2QRJA 3EDOA 1DV1A 4YRJA 1J07A 3IAUA 3RSQA 1U5BA 1PW7A 1D03A 4LSWA 4AWXA 4B3IA 1ZM9A 5B7QA 5LQKA 4X64B 1NGSA 2GBIA 4JA2A 1CS0B 3C1AA 4PBRA 2IP4A 2BFEB 3ZI4A 4DFDA 1W5AA 2CMKA 4J0FA 1BS2A 1K66A 1Z2EA 4AK9A 2R1TA 4DV1B 4H7DA 3JAKB 3ZD6A 3WLJA 5KINB 1A1VA 3E1KA 1CE8A 4P32A 4DCUA 3H7AA 3JYLA 2B35A 1XEXA 4TX1A 4LFCB 3LX5A 2DBYA 5JROA 5EG5A 2VZ9A 2ZZNA 4L8WB 3C98A 3UQYS 2GHRA 3IMGA 4LOHA 3NCTA 3E9YA 3QVOA 5CBPA 4C0HA 2VHQA 1B00A 3P9NA 4RD3A 3TH5A 3EX7C 1M8JA 1G20B 1VJDA 5I9MA 1WZEA 1KO1A 5EZYF 3B1ZA 3S29A 4XVCA 2BFEA 1U3DA 2OZKA 1DWPA 1N5OX 2WFZA 3K0EA 4GM0A 4OI4A 5DT9A 3SEFA 3ZNOA 2GUGA 2PRIA 2Z57A 2CNLA 5DIZA 1BSVA 2PZKA 4EUEA 5DNEA 3ZWOA 2JAWA 1X3LA 5GJBA 4EFKA 2HCBA 6Q21A 2Y1XA 1CZLA 2YL2A 4IYJA 4K9SA 4AWBA 1H42A 5JVDF 1CUFA 1KXZA 3U4QA 4X41A 2NSYA 3M3DA 4EGSA 3VM6A 3T7EA 3W7AA 3WRXC 1NXPA 2ZPAA 3H16A 3PC3A 2QL7A 4IQ0A 3GRKA 4AZSA 1GN9A 1GZ3A 3NIDB 3EGXB 3D54D 2UUOA 3D5QA 4NONA 5LZ7A 4LRQA 3DJFA 2GZMA 5CLJA 3K9NA 2C2XA 2OKCA 1Q77A 2PJZA 3QNUA 1M5UA 2ODBA 4X0EA 4BNXA 3NTLA 1ADJA 1QVAA 1R15A 2LCFA 1ES9A 4KR3A 4ZAGA 1CUHA 3DL0A 1QQ6A 3AP3A 1GTZA 3NANA 4WX2B 1PJSA 3OJCA 4EG5A 1VXRA 1FTSA 2QRPA 3BB1A 3AR9A 5LXTF 7ABPA 4UOEA 2AZTA 2OORA 4O4LA 1ONNA 1FVOA 4MGIR 1BU8A 1R9MA 4R7GA 3WLLA 3ZHCA 1B8NA 4MA0A 1DPFA 3HVHA 5DTQA 1E9SA 2E0IA 2E21A 5KOHA 4GOKA 5KSWB 2J5KA 5I8ZA 3UMMA 2ACEA 2CDNA 2XVZA 3LHDA 2RMKA 3WQQA 5KYNA 3NWBA 3L9WA 1HOTA 1XCMA 4G6ZA 4ZMBA 3DVLA 3KM0A 3R7BA 4CMEC 2JCVA 2FU5C 2OXFA 3EDRA 5JS7A 2H4WA 5GONB 1AGNA 1GDHA 1U9JA 1UBHS 4GZ6A 3GEDA 4Y2RA 1VC2A 3K2BA 2YZ7A 4B32A 2B9EA 2J41A 2YYYA 3WWCA 2DUMA 4LYDA 3EXIB 4O6VA 2GESA 4JLWA 4EW2A 4YJ3A 3W8NA 4DNFA 2IZ7A 4UEOA 4YRNA 3MWKA 2GPWA 2C2OA 2VNHA 3EOAI 3OQMA 3QPUA 7YASA 1KI9A 1QWSA 1Z68A 3GR6A 2B0JA 4ND1A 4YP5A 2HJSA 2V6GA 5F5NA 1BCSB 2CHEA 2FSGA 3HLTA 4YHBA 2G83A 2NO6A 3W4IA 1Z0ZA 5CUQA 1FQWA 3P4UA 3G9XA 3S81A 5EHZA 3D8RA 3CW8X 1J97A 1K5PA 3SJCA 5K0JA 4W5QA 3QWBA 4PX5A 2ZIFA 5BN3A 2LIPA 4GMHA 5A4IS 5D3MB 2R96A 4PM4A 2IK8A 4XLLA 4A0RA 4B3RB 5FUWA 4MNTA 4Z53A 4IDQA 1NVWQ 4E5MA 1S3SA 1XZCA 4OHWA 2LWIA 4JIMA 4I3HA 3FSGA 3RSLA 3DKIA 3JWIA 3U0VA 2ZBVA 1Q0RA 3FOEC 3K0AB 2ZRJA 2AR0A 1OMOA 3MG9A 3YASA 5BQ3A 4MV5A 5D84A 1V96A 4GRIA 3V1YA 2XE7A 5LL6P 1NBMD 2HRZA 3ZR4B 1RPJA 4H0CA 4MOWA 4OUDA 1BE1A 1TXGA 3ZGXA 3U4AA 4EQZA 1ZMOA 1I7PA 1K08A 3QKSB 3RS7A 5BORA 2ZRBA 1V95A 4MS4A 2Y1OA 3CPEA 2ZREA 1J9GA 3QKSA 1O95D 1TQ4A 4H9GA 4LPSA 5DGHA 3RKUA 3HXOA 5IUJC 4BCDA 3DO5A 1CJCA 4X45A 1MQ8B 4MVJD 4YR9A 5HRCA 1GQQA 1KYWA 1L3CA 4B80A 1R3UA 3DLPX 1D5WA 1XRRA 2A7QA 5CB4F 3ZU5A 3K0BA 2BSQA 2FPXA 3ADKA 2AI1A 4GM1A 4TUYA 1GYQA 4LV6A 2IYNA 4HI0E 2REBA 2XHZA 4MZDA 3SCZA 2Q1SA 1C1DA 1PV2A 2EQAA 4R2XA 2P2ZA 3I5YA 2FWPA 2PU5A 3IA2A 4WK4B 2C5FA 4A8PA 3R3YA 5JJ5A 3HRHA 1IHYA 1U1DA 4PLWA 4UE2A 4EQ6A 1GVHA 1T0HB 5IC5A 5EHIA 4LF7B 3QFCA 3ZZMA 1PT8A 3VX3A 5JS8A 3IVRA 1EDEA 1SKYB 3ZY5A 1ZJ5A 2ZBEA 4X20A 5EZQA 1B2LA 3R5KA 4PF1A 1P2DA 3NFYA 3T6KA 3O2JA 1UBRS 1TVMA 1EIZA 4N6OA 5FLEX 1EB8A 1IVSA 3GU3A 4DMGA 4JKOA 2PUDA 2ZUWA 1SBHA 4TZTA 3WA7A 1JYSA 3WR5A 1BHSA 4HVAA 2Q3DA 4WWHA 5CX4A 1NW6A 1NSFA 3ETLA 5B1DA 1U5AA 1U8TA 3M5DA 4FGWA 2VL7A 2XNDD 1WPXA 4GXTA 1KY2A 4PG5A 3S55A 1GUDA 4WECA 4I8IA 4W1RA 4LV8B 3VHRA 3O2SB 3O7MA 1I4LD 4O2BF 1SULA 5IAOA 2YTZA 2GN9A 5GONA 4JI4B 4EHFA 1IWBB 1RWQA 3QXHA 5DBFA 3TOXA 2FY8A 3TSZA 1TEVA 5DP2A 3LXMA 2GN4A 4UCFA 2OL4A 1LRJA 4S35A 3KKEA 2J45A 1MFPA 4ETNA 3WGTA 1IL0A 1J2JA 5KOHB 3LC1O 1DAHA 4B1FA 2Z6QA 3TEFA 1C0LA 1A7KA 2EEPA 3BHJA 4CEHA 3NALA 3AUUA 1NIJA 3BB4A 4MB6A 3TQRA 4TMFA 3V33A 4YT2A 1KF0A 4LXUA 4YA6A 1CK4A 3DMDA 2EL9A 1FYWA 1LW6E 5BT8A 3VC2A 1JFSA 3DE3X 1K6XA 1UC9A 2Y99A 4C04A 3DZ8A 1I0LA 2JLXA 3P19A 1HZZC 3ADBA 3USES 4G25A 2FETA 4KR0A 4RHUA 1XPJA 3W5UA 3DEIA 3RG8A 3GLUA 3ESCA 3ASVA 4QBFA 2P40A 4B79A 2VQEB 4N5NA 4XIIA 3EGXA 3B89A 1ZH6A 4C4SA 2IEDA 5ICCA 3UJ7A 3C3MA 5L4LA 3ELDA 4E70A 4FYIA 4CZ2A 2DUNA 3U4QB 2X41A 1N75A 4G63A 1JL3A 1LA2A 5B1SA 1ESNA 2AQ8A 3QPDA 1CU1A 1UAGA 5HUJA 5ELLA 3W2GA 3TX2A 4LAFA 4D2IA 5M34A 1GEGA 4FYYA 3LYUA 4NU0A 1VSUA 2H7VA 3COWA 4ZFNA 2FN9A 1R0WA 2XCOA 1G8AA 2M1XA 2ZJBA 4N0MA 4NARA 4L4YA 1S8FA 1N1GA 3GLGA 1CZHA 1ZN7A 4W6ZA 2CNDA 1HDCA 2GK4A 2B5WA 4TSFD 3AF6A 3TIIA 4GYWA 4WJLA 3QU2A 2QM3A 3RS5A 1UBEA 5K3BA 2C5AA 2HWXA 2PK3A 3DOOA 1XZNA 16PKA 2B36A 2F3RA 4UVGA 3AEQA 4BJ5A 2PZGA 2ZT5A 1D9ZA 4ZHQB 1INLA 2EOAA 2ZDGA 4C88A 3G5MA 3IUPA 4OA5A 4RJJA 2JA1A 3E0XA 3KZVA 3MJDA 4R98A 4M60A 5FWNA 2B78A 4F1KA 1JLSA 2QEQA 2IHJA 1NFRA 1WW8A 1XEWX 2AIRA 3ETNA 1QUFA 2HF9A 4G26A 4LXXA 2FHSA 3CLSC 3IHLA 1R66A 1VOTA 1XQXA 4HYYA 3BGSA 4LS3A 3LSTA 1QKJA 3IQGX 5DLDA 1E1RA 3HDYA 5F12A 1HOXA 3T7SA 2DQSA 3EBLA 3FDZA 3QUCA 1OPXA 3DAFA 1XVTA 2HRBA 2JK0A 2C9DA 4HY3A 2FEAA 1XC7A 2RHDA 3ND8A 3GPDG 3Q3JB 4P8RA 4KYVA 4LZLA 1YI1A 3PKIA 4ALIA 4URUR 1JWBB 1KXJA 1UPUA 1V3QE 4JLDA 3E70C 3PWZA 4V1CB 5JNLA 1CVRA 4LISA 3O82A 1QKIA 5I51A 1E18A 1FPQA 4UMDA 2IHZA 1G41A 4A91A 1MB4A 4HYEA 5HMMA 2IL1A 4DCMA 2Q5LA 3EXG2 5DYNA 4YRDA 1RPNA 1CJBA 2CK3D 1J20A 2CNOA 4OREX 1QAOA 1PYGA 1QG2A 1Z17A 3EQ8A 3MGKA 5DM0A 3WSTA 1XAJA 2A0FA 2VQ3A 4J94A 4BNZA 4MMYB 4LDQA 4F2GA 1P2SA 4YMLA 1XAIA 3HDVA 3KELA 1Z45A 2A33A 3V8BA 4HWOA 2WTMA 3ANXA 1ORRA 3F5SA 5LB4A 2P91A 1ECJA 2C88A 1PZXA 4FHDA 1ULZA 2JRCA 2DKFA 4QA9A 3HGQA 5LLTA 3Q0EA 2GO7A 1MX1A 2AG1A 3NEAA 1IEWA 1ITZA 1Z7YA 4C4PA 3KQSA 5A7HA 1KIAA 3HA2A 2F43B 4KXUA 4C89A 3DXFA 1SU6A 1YRLA 4XGQA 3INYA 4WRRA 4OHPA 5F1PA 2R8XA 3D3NA 2WHEA 4F97A 1MQAA 2CEKA 1HE5A 2Q0SA 1A3CA 4J16A 4RDIA 3AR8A 3OPVA 4NXNB 3C43A 2A0YA 3LIIA 4TTTS 2C54A 4YH1A 4JI1B 3ZV4A 3CLRD 2CNKA 1M34E 3PQ3A 2A67A 2FEPA 2H9IA 3FMOB 3W3AD 2QXTA 1WSBA 4QWMA 5JC8A 1XTJA 2CDAA 2G40A 4BO4A 4U8HA 4WXPA 1S2GA 1W88B 2OHVA 4NFYA 2FSVC 1XJ0A 3L7LA 2HI0A 2V74B 2CLIB 4MV3A 3RQSA 3RJMA 4MAAA 4OQXA 5U9CA 3BH6A 4PFKA 2BBSA 2Q3HA 3I6YA 3IBGA 4FJ0A 2FWJA 1IXZA 3IPRA 1QX4A 4L08A 4BMVA 2OPBA 3N05A 5D7BA 3D0KA 1CW2B 1AZLA 3TLGB 2H2GA 4LW8A 1RE1A 2OQRA 5T6BA 4OHZA 3RYFA 1DC6A 2MWMA 2QY6A 3EC2A 1GGKA 4UQOA 3VYRB 4D43A 1DZ3A 3IE1A 2UVQA 2RHCA 1C8LA 4RV4A 3CGGA 1P74A 3JASA 1Z63A 1A7UA 1WLYA 5IJZA 2WM9B 1G8GA 4FT2A 3UXHA 4FCWA 1X9GA 2VNIA 5CG1A 3HB1A 2I55A 4HGZA 2HMSA 3UGTA 3ZJVA 2R8EA 1P2GA 3SG0A 4ED9A 4A8JA 4U00A 3UENA 4RZUA 4ZQEA 3RRZA 3W9BA 2X14A 4IVQA 4KPYA 4C1BA 4UBMA 1CF2O 1ATIA 1R88A 2FFHA 2CSXA 1H2HA 1ONOA 3TFOA 4WBSA 4DXDA 4L51A 4YROA 3BIJA 4RWEA 2VDNB 4QZVA 3BB3A 1B74A 5CX1A 2FHPA 4QXRA 2CLOB 4TT8A 4BFVA 3A3YA 5NLLA 1NBOA 1C7FA 4JC5A 1S8OA 4Z0TA 4BFTA 4L76A 2X76A 1ZKMA 4OV6B 5DBHX 1KH2A 1EWVA 2IF0A 3D1VA 3WJ7A 3UUEA 3X2EA 2F8MA 3FGNA 1BRMA 4J4BA 3KKZA 1HDZA 4KFTA 4BNJA 2GD2A 2BKAA 1ODTC 4EYGA 3AZPA 1TM3E 3HJTA 3J7TA 1BAPA 2VS1A 1M2WA 1TF2A 1CCWA 2CFSA 2K2QB 1V8FA 3LDFA 4XM1A 5ALHA 4C0SA 1NZJA 2AG5A 2YXLA 3DMTC 4KMRA 2ZJFA 3GQVA 2IHUA 3AWIA 3IBCA 4L73A 3PUKA 4ZZ2A 1EK0A 5FF9A 4G1CA 2C95A 3OOHA 4DYVA 4G0ZA 2Q5JA 4EVSA 2ZPUA 1P4RA 2J6HA 2YASA 4H1UA 4QOEA 3CRQA 3A2LA 4EZBA 3WAJA 3S1AB 2GF2A 5T7BA 3KEGA 1GNPA 5DVZA 5FULA 3KJHA 5J5AA 4XWYA 4BNDB 5JAOA 4DKXA 4RGYA 1Z88A 2G80A 2GZHA 4PNZA 4XGRA 3R0IA 1PR0A 3PLAE 2CWWA 4ARSA 2XYVA 1QLHA 5LFAA 3FHCB 1EM8A 3A27A 3FWKA 2XI4A 4D46A 2A9PA 3EZ9A 4JJAA 4JKYA 4K46A 2QQ5A 3D0QA 4JVMA 4P84A 2X0EA 2G7ZA 4G4JA 4GKAA 2I62A 4DR2B 1QAQA 4ZQIA 3K0FB 2Q0QA 5EXTA 4MVJM 3WYNA 3MYYA 3AB8A 2PKYX 1T8YA 1K0UA 2OV4A 2OZLA 3VR6H 5A9SA 2AFIA 3FTCA 3CUKA 4IJ5A 2SECE 4UNQA 1W87A 1VSQA 1XDZA 3C4QA 3G0BA 3U19A 3CO5A 4H7HA 2PXHA 1SXJB 1CC1S 5KTNA 1DUSA 1KC1A 4LUCA 4F71A 3P5SA 5FLYA 4M7OA 4QBGB 4EO9A 4CKWA 3D2AA 5KX5A 4CIBA 1REQA 5D5PA 3WVNA 3ADDA 2YWRA 3JVEA 2CLFB 2OCGA 4C0XA 1BX0A 4CNQA 1LEHA 1P1IA 1WDKA 3TGLA 4ZO6A 3AESB 2YUTA 3ROXA 1LBEA 3OZTA 2YVLA 2X0NA 4QNRA 3AR2A 3KTOA 2ZUDA 2BM0A 3B3GA 5K99A 2QSYA 2BYTA 4HMOA 4MJ3A 1FTGA 4LXQA 4YMHA 3RTGA 1JHAA 2LP4Y 3W8FA 1KDPA 2X2FA 2GKSA 3BIFA 4OB8A 5CA1B 3BDAA 3ZBQA 1IQUA 3K96A 2X0DA 2P68A 3U56A 3ZVNA 1PZEA 3U4IA 4XJSA 3BXXA 3GA5A 1L5MA 3AI3A 5AOVA 4PRZA 4UEQA 3PX2A 5EFOA 3Q6MA 5KIAA 3C3EA 4WVFA 4CUJA 3UANA 1CY0A 4MVJH 1THTA 4I2NA 1QYDA 4X8MA 4BDTA 3AHJA 5CLLA 1X9HA 3J81A 3AVTA 3CCCA 1PHPA 4FGSA 5ALSA 4YONB 3ZK9A 3FYDA 1WY7A 1FU4A 3GAZA 3HQ4O 5KTSA 4YJ2A 2Q1YA 1RJ9A 1ZSYA 2W2KA 4TQAA 4YLGA 4J7AA 4A10A 1T4BA 1J09A 2QLTA 3E2PA 4UBLA 2BP7B 4AJ1A 1R0ZA 2DCMA 2PFGA 3JY6A 4OX9Y 3GI1A 4HAXA 5TGTA 1OTXA 3HCBA 1X1SA 4BWFB 2I1WA 4E2FA 2QTRA 3CZ9A 4FI3F 3UM9A 2JKZA 1T24A 2VDJA 2E7ZA 2ZIGA 3BRCA 3PCXA 1P0FA 3UXYA 3PQDA 4EAQA 5I5EA 4LC9A 3EUFA 4I8DA 1BVRA 3QQPA 4PZAA 4DWJA 4X6XA 1GT91 3G1UA 4LZPA 1GU7A 2F64A 3Q8LA 2ZWVA 2JVJA 2ZJ1A 3OJEA 4XRGA 2G88A 3FLBA 1AA9A 3OT1A 2BDUA 3WGHA 2QT0A 4E12A 4UHEA 5F77A 2C97A 1DO2A 1P44A 4L9AA 4M98A 4ND5A 1UPBA 4Y18A 4B7CA 5FTWA 1QLWA 3HV2A 4XDGA 3WRVA 4CM6A 1L2TA 1ZR4A 1J0AA 2P3OA 1DTWB 3F2IA 4J90A 3GP5A 2VP9A 2HH9A 3QFHA 4TTJA 4FB5A 1V1RB 3MMZA 5KB3A 2PBLA 2C84A 3BH0A 3ZGOA 4TYPA 1C3VA 3MLEA 2IKQA 1E59A 4MUBA 2JBAB 1PZFA 1Y7HA 4RQUA 3HXPA 1D0VA 3FPJA 3ZCQA 4BMYA 5DU2A 5I8PA 2H63A 2I9KA 4QC2A 2XUPA 3DMRA 1DCMA 3FGPA 5G3YA 4NHEA 4S05A 4FP9A 2XOKA 1Y9ZA 1OYWA 2D0DA 2OXCA 4M6WA 4RKQA 4DV4B 3KVNA 1P8AA 3DE7X 2FDCA 3H8WA 4OBEA 1B16A 4UUNA 1MD9A 2GDJA 1MORA 3AL0C 4PINA 3WFJA 4ZTZB 1SB8A 1S2MA 1Z6AA 2XITA 4FCCA 3MLBA 4ZOBA 4E5DA 1L4FA 1Z7WA 5EI5A 3ZHOA 3DV0A 1FDIA 2QWXA 3KCQA 2EU8A 2YNMC 3QXSA 2H52A 2DERA 2NM0A 1QNLA 2ZRPA 2QVLA 3C0KA 4TS3A 5EERA 5JG7A 4CM3A 3IR5A 1L4HA 3A2MA 3OH8A 4JP2A 4CG1A 4C07A 2B3TA 2PKCA 2D0PB 3UIEA 1QFYA 3KEOA 1X8LA 1Y81A 3T12A 4ZO7A 1RM3A 4HGNA 3EA0A 1AOXA 1IMJA 2D0OB 2O5CA 3VPFA 1A5SB 1QHNA 1ISIA 3G2NA 4Q7EA 3L4BC 5CTJA 3QFSA 2RHRA 3JPWA 1JT9A 4C6TB 2A5DA 3RC8A 5TARA 4MS3B 1UZUA 3ZWBA 3OICA 4FHGA 5AM0A 4AZTA 3P71T 1YIOA 3KJEA 1MC4A 3W0LB 4KDRA 1XRPA 5HKBA 2NPOA 4GU5A 2ZWOA 2PG3A 3PNPA 3ZOKA 5M29A 1FP7A 4BX0A 2OAGA 3E8SA 1O6GA 2VYVD 3O74A 4AJPA 1ETHA 1BKYA 2V5VA 3G17A 4XIFA 1FU7A 4UMVA 4EG1A 2CW5A 4F84A 2VSOA 3H8VA 4O2BB 2HMWA 3BILA 3B7WA 5JY6A 2PCJA 3F8WA 2XB2A 4HFJA 3UKJA 3L1HA 3B1VA 4QXMA 1L6RA 1MO3A 2JPDA 2HIAA 1U9ZA 3L05A 3NWPA 2VUTA 2YWDA 2GN8A 1LQUA 3QLEA 3GEEA 2IYLD 1U0NA 5FOTA 1YFLA 3KALA 1J0XO 1AGYA 1PTKA 3N9IA 3EG5A 4FCVA 2YWEA 2FMXA 2ACWA 3VVMA 2BPOA 3MGGA 2AMVA 1T8SA 2ET6A 4ASUA 5CM2Z 3SC6A 3KSRA 1FYVA 4R9VA 2J6IA 2TMGA 2C5BA 3GY0A 5DLQC 3MMPA 3K9BA 1NX6A 3QEJA 3V7NA 5BMVF 4I1OA 4BXOA 5DGDA 4AJHA 5L6LB 2V6BA 5AIBA 4N6GA 4Z86A 1W5SA 4ARCA 2ECFA 2A57A 4F06A 2FSVA 4BNLA 4EI8A 4YRZA 1FZQA 1TTTA 3ACDA 2FF7A 1Q1AA 3D1LA 3O4HA 1J24A 2H57A 4AURA 5J3JA 5JY1A 1IEVA 1ZMRA 2PS1A 1THGA 1GNVA 2B2CA 2R11A 3JD4A 3P2YA 4NDAA 5F5LA 5BNFA 3SDBA 5KQMA 4QUHA 4KXQA 2LCQA 1P5JA 1VRCA 1Y1TA 1Y34E 4BAUA 1URPA 4RY2A 4MGHA 2IS2A 4GC9A 4L3OA 3O1JC 1CDDA 2EARA 1NN5A 1QF9A 3DKPA 1IZ7A 3PZRA 3QMPA 3WIEA 3UATA 2V5UA 4CKXA 4G2NA 5CDFA 4D02A 3JX9A 1T35A 4QOIA 5AI9A 3E84A 1KOFA 1TNDA 5EIFA 3U31A 1JG1A 2EP7A 3A4LA 4MVXA 1SEPA 2NPFA 4N41A 4S3MA 4JJ6A 3GIWA 4HEA6 2UZ1A 2FVXA 3SI7A 2IYTA 4KN8A 1R4AA 2JHAA 2HADA 4XUEA 2E4YA 1NVFA 1QYWA 2WTAA 3A1CA 3WQHA 5CDUA 5AKHA 4UUMA 1SKUA 1GZHB 2CJPA 2H7CA 1REQB 3I05A 5EKXA 2IC5A 1DXQA 4ERXA 3WYDA 2RDMA 3E8MA 3DNFA 3QEBZ 3WZLA 5IYZF 3FSJX 5I01A 2H07A 3JARA 3NUGA 4QLBA 3U3KA 2FE4A 4O4JA 3RJ9A 1KQFA 5AHXA 2I71A 4P3YA 2PD3A 1KOJA 3C6YA 4RTKA 2JHGA 1QHFA 2O1XA 3OO0A 4JBWA 1PEAA 1UK8A 2HV9A 1UH5A 3GZJA 1NXOA 2QL6A 3TPZA 2UZIR 1O0BA 1NQTA 1MJNA 3A2NA 3PL5A 2JG3A 1YXMA 2WWRA 4IM7A 4CCSA 3QVMA 4E4RA 1O87A 1TU3A 3ILVA 4HUTA 4K0RA 1P6QA 4ECAA 1T5LA 1XLVA 2CFIA 3K1AA 3TW8A 3NG1A 4MROA 2NSDA 4RE6A 4W1QA 2NX2A 3AHCA 2HK7A 3F7OA 3MEQA 4P9NA 2XRFA 1G9TA 4J1TA 1CZNA 5CMLA 3CGWA 1Y3CE 4RE5A 2F17A 1W85A 3HFGA 4TTPA 2H29A 4AMGA 3OT5A 1YZTA 2DKNA 2O8NA 1DQPA 2CJWA 2Z43A 3MUFA 3B6ZA 1M6EX 2VQ6A 2CV0A 1VM6A 5BWNA 5HCUA 1P5HA 4L6CA 1W96A 3K30A 4BQQA 6REQA 1BVUA 2P8JA 1RWMA 1VCHA 5IH3A 3ZHZA 4P5EA 1I3MA 2Y3IA 4TV9F 2EVWX 5AQEA 2BGUA 5KNBA 3P7MA 2R62A 3D2LA 1EDZA 2CDRA 4XASA 3T1OA 5L9AA 4JEHA 3COJA 1Z36A 1O96B 1RTKA 2IUUA 3DBHB 4L75A 1EFKA 1KK0A 2CUKA 1UBUS 2D5CA 1QAMA 2ZJ4A 1L4LA 1ZNXA 1W5EA 2A4KA 2OCAA 1BMTA 2G9ZA 2GASA 2QJWA 1ODIA 2XCIA 3MAJA 4EL5A 4G9GA 5FBWB 2J1LA 1F2VA 2HLDA 2G1JA 1YMUA 2AQHA 2W2TA 3IJ5A 3NBUA 3PWSA 5FBQB 1KJNA 1VL1A 2BH9A 3HP7A 2XNHA 1E2JA 2PA0A 5I4IA 3TOVA 2DYKA 5TMPA 4YAJA 4KRYA 2OGZA 5LQCA 1LNSA 4C7JA 4WZAA 3TRFA 1W59A 5B3JA 3RG2A 4EUSA 4R1LA 3UB4A 1NJFA 3P0HA 1QDLB 2FWBA 3ROZA 3V4PB 1JSCA 2JZCA 1DLIA 2NU6B 1M5RA 5KSZA 3L02A 3GLSA 4UPDA 1VJ1A 2YWGA 1G7RA 3EIEA 4M9QA 5LQDA 4BXOB 2VDPB 3V8PA 1IY9A 1Z82A 2WM2A 4LJAA 1Z4NA 3KT6A 1PYOA 1Z2CA 2BL4A 3Q3HA 2QR5A 2O2CA 3TR6A 1Y1QA 1G6HA 1ZGZA 4DA0A 3I2YX 2GN2A 1RR6A 1OF1A 3G8YA 3IUEA 2GZRA 4QQRA 4Y6LA 3CPSA 4Y2JA 4YREA 5LDDC 5KNDH 3GRYA 4HXYA 2ODNA 2OLKA 3KTDA 3P9ZA 4XEUA 4XSGA 2GPSA 5GM2A 1YJ5A 3AV3A 3ICOA 5BQ5A 4C0BA 4CR8A 4D7AA 1QHHA 1EPUA 5HK9A 3T7TA 2NAPA 2VLBA 4I1YA 4RXUA 2FAXA 1IBCA 4BO2A 5C81A 2J33A 3B20A 1UC4B 1G7CA 2PUTA 5G4KB 5JARA 4LOJA 4IOMA 2DH5A 1TLFA 1HLGA 2WYOA 1Y7PA 4WN9B 1ZYUA 4GPZA 2GT1A 4EATA 3N2EA 4GICA 5AK0A 5EE3A 3TGWA 5KU1A 3LZ6A 3ZY4A 1DQSA 4TPKA 3UWDA 1HT3A 1D4AA 3E05A 1D7AA 4B5KA 2A94A 4LI3X 4P4LA 1QR2A 2GPBA 3DEKA 2BFAA 3T4EA 4FHCA 3IAXA 2YV3A 4B47A 5IDXA 2IHVA 1KYXA 1C4WA 1KR2A 3GFFA 1JEJA 4OMDA 4QDJA 4C6TA 4O8CA 4PRLA 4U63A 4UCQA 4AS3A 1L0BA 5IVDA 1YZNA 3JQBA 4FQ8A 1KYZA 4UZEA 2Z1NA 2NO7A 3M6FA 1AUOA 5ICGA 5AUNB 4CUZA 2NVOA 4IDDA 1XYYA 3IILA 4LCJA 5AVRA 1Y4UA 5BQOA 5F5XA 3FSEA 2QN1A 2HQBA 3DE6X 3M6XA 5KNCD 4Q7KA 3AF5A 2JGDB 1QGUA 4U9IS 1T6BY 5JYEA 4FYPA 3TTSA 1YD7A 2EJVA 5LMCA 2EIXA 4FLMA 2D0IA 2RAFA 1YBMA 1ESMA 3L82B 4KO3S 4N5HX 2ZWPA 4Q82A 1LC3A 1R8YA 1RYDA 1GRNA 4FFWA 2GB4A 4IV5A 2CXUA 4X62B 1ZZEA 2H7XA 1FXSA 2ZYSA 1G7SA 4BQFA 4ENPA 2C9BA 3KNZA 4N49A 4WNIA 4RGQA 3AEKB 2EP8A 4NCBA 2NSJA 4RSRA 1PRYA 1XQYA 2MMCA 2YV1A 4HB3A 2N9UA 4JSRA 4LJKA 4NRDA 3S1LA 4CIYA 1B6TA 1T36A 1D6MA 2AR9A 2UYYA 3FTQA 2I4RA 4C3OB 1MPTA 2HKIA 4MIKA 2NLOA 5B3KA 3EHEA 1UZMA 2PWYA 1ZN8A 1IRIA 5LA6B 1I5EA 4G5SA 3WX0A 3JQDA 3ZZ1A 1GA1A 4DKJA 1SMKA 5L3SA 1TT5B 3BERA 3GMTA 4L7VA 2CEAA 5E95A 2VYQA 1JJVA 1XTQA 2P2LA 2Q6IA 4Z3OA 4NQZA 4LE2A 3LCUA 1R0XA 3BWMA 4QQ8A 5AKEA 1WSWA 1N2ZA 3NHUA 5T5QA 1P1HA 2EW1A 4S2UA 4BQSA 2BTEA 1FFGA 3GFQA 3DZFA 2HRRA 2YICA 1JHVA 4HQLA 1L7NA 4HS4A 4M8NE 4CHTA 4Q9HA 1OFUA 3LPDA 3LVRE 4D6XA 2D2VA 2QORA 2P62A 2NP6A 2KB0A 1WXGA 3LTEA 3PIDA 3TE7A 2IXEA 1VMIA 1ECPA 2PMBA 2VWGA 3BAZA 3O0TA 3KUCA 3K53A 1ZZGA 4QXPA 1U80A 1A0OA 2AHOA 3WKDA 1BOOA 2NGRA 3L7AA 2IEBA 5FB3A 2IIPA 3K9GA 1SUIA 2ZM5A 1H8EA 3OIGA 2Y1CA 3KWFA 4JASB 2VDMB 2BFFB 1FRVA 5FI3A 4C14A 3FCYA 3JD0A 4Z4CA 1ISPA 1IJEA 4KVZA 5FV4A 5IULC 1H1DA 1KO8A 4KYUA 4ER0A 1V4NA 1G1AA 1ORTA 3CM0A 3VZPA 3GEGA 1Z25A 4NJEB 1TJYA 2JJQA 3ZD8A 2QLNA 4PQEA 3BM5A 4AJKA 2Q3LA 4YCAA 2JASA 4KVFA 2V0CA 5FRDA 2V9PA 1HT1E 4BX2A 4K1XA 1LX6A 2AYYA 1GCIA 3AJ8A 2IWHA 1DTWA 1ZIXA 2BBOA 1H0RA 2XTAA 3D8UA 3ZV6A 1AM4D 5D01A 2R7LA 3ZV5A 1YHNA 5KYYA 5A1JA 1NVDA 1F38A 1IG0A 1PEDA 1EWTA 4IDPA 4IVRA 4DG8A 2VTBA 3CVVA 4D4LA 5E2IA 5DYTA 4KPFC 1Z2PX 2V8OA 1C30B 2HU8A 1GXSA 3HMKA 1EWQA 1PWXA 1XZJA 1SQ6A 2HJ9A 2Y2VA 1QRDA 3I9V1 1VMKA 1LLUA 5K05A 4XCQA 3A4TA 3DTYA 2YRWA 3K8ZA 3R6LA 3X1JA 1W47A 3TMAA 2GTPA 2OFOA 4V24A 4C08A 4O4LF 2A5LA 3RBVA 2BEVB 3EB9A 3M7IA 3EOZA 1MAHA 3CZPA 3RM3A 3WIUA 1RYFA 1Z5GA 3EEQA 4L02A 3ZWMA 2VK1A 2PX8A 3T0GA 1ZSVA 2A59A 1TK2A 1A50B 1KZGB 1ZS9A 1PNTA 2P2CA 3UJPA 3TPCA 1EQUA 4BB0A 2IIVA 5AI8A 1OQAA 3FZGA 2GK3A 4BKOA 3MUEA 4YDHB 1EYZA 1QZTA 1G9XA 3KZMA 2PXXA 1SXJA 3DG9A 4HB4A 3BMXA 1RJFA 2PX2A 4P5DA 3A6DA 4HKTA 3I0MA 1KHTA 3FKSA 3ONNA 3TQOA 4BX3A 4ER7A 1QRSA 3K9CA 2PLWA 3BD9A 3VR4A 3HEAA 3OP4A 4K9QA 4FE7A 3NNDA 2I3ZA 3D6MA 2QUKA 2ATXA 2PJDA 1E64A 2P4SA 4QIHA 4PHCA 3K0FA 4GPAA 3QIVA 1U3CA 4JK3A 4WUTA 2VCHA 2BGWA 4RD0A 4FMBB 4L0DA 5LQAA 3FNIA 1NBAA 2HNKA 4E6PA 1N7IA 4CL0A 1PFYA 1Q7EA 4PSUA 1M76A 3PNQA 4WLFA 2H1VA 4KO4S 2PGDA 3W2IA 4QBHA 3AWDA 2O8DA 3W5JA 2GVZC 3I64A 1GNSA 3BA1A 2IITA 5LIRA 3CFYA 1N36B 2FN7A 2PZLA 4WT7A 5EZYB 3USZA 4FYJA 2IS1A 1R6AA 3X1YA 4JP3A 2CY0A 3MFQA 1NUTA 1ZRSA 1K7SN 1WMBA 1M5TA 2EBFX 2GN6A 2IEIA 3H4VA 4H3SA 1FMFA 1ISJA 1TOAA 1LK5A 2IE0A 1B3BA 1G21E 4NJMA 4V03A 4ZVOA 3UGKA 4GI7A 3M6VA 1AXEA 1NYLA 3QTBA 1C9YA 1Q74A 3Q7PA 2WZCA 2OE2A 1IUOA 1TM1E 3F78A 3INRA 3L0SA 1XTTA 3NASA 5LC1A 1PL8A 2WAYA 4PONA 1W6UA 4FFNA 3SZMA 3FZNA 4UBOA 2AJTA 5H3CA 3OJ0A 1JILA 5L3VA 4L78A 1T8RA 3SQLA 4DCTA 4N5IX 4ZZ1A 1IY2A 1ULBA 5LXTB 5B1HA 3KYCB 2FN8A 5CHYA 1J70A 5ALIA 1X7YA 2IY9A 1I6KA 2VP3A 3UEOA 3W1WA 2LV8A 4OLFA 1ZGCA 1DMRA 3E61A 3PT5A 4M87A 4UULA 4HNTA 2WJYA 3TNYA 3THYA 2ZOSA 4DREA 1BCRB 4MWCA 2PUEA 3OOJA 1NVVQ 1ORVA 1GAJA 3G9QA 4G8CA 4OHCA 1TQ8A 5IAGA 2BN4A 5IPFA 3EDYA 4BFXA 2ODPA 1BE0A 2XTNA 3S2UA 3CX8A 3GGDA 4NEHB 2YZGA 1ISSA 4O0LA 2R79A 3RARA 1ZH4A 2E4ZA 2J3LA 3TZQA 5B7PA 1A04A 3AR5A 3CY6A 1E7RA 1TD1A 1XYGA 2PIDA 3IAS1 1BFDA 4ZREA 2RI0A 3IP8A 1HDXA 5AJXA 5IDVA 1HE1C 4X85A 2VJDA 1U8FO 3CWQA 3RS4A 1G42A 1HV8A 4PV7A 4BO1A 3I0ZA 2D3TA 2OHGA 1P60A 3C97A 5BV8A 1N9GA 4NC9A 3HN2A 1X6VA 4M0MA 4C4XA 1Y82A 2D5IA 1GT6A 3KB2A 3V8MA 4J07A 4PN3A 5B6PA 4ALJA 4N76A 3HEMA 2P1DA 1ADFA 3BICA 5LBUA 2XAAA 3KAJA 2VTKA 4EF5A 2I65A 1H4SA 2VSQA 3C8UA 5ILGA 4BMZA 4I4LA 3QK7A 2I66A 1A2KC 5BPHA 3E23A 4EJSA 5CCEA 3QLVA 2HRCA 3DBRB 4KTVE 3ZBPA 3EMKA 3BAFA 3H1AA 5ANRB 1H69A 3WTCA 4D9IA 1F0KA 1KZYC 4H7IA 4D41A 4DR3B 3I1FA 1ETUA 3FD8A 1KQ3A 4PZCA 4X3CA 2AFRA 1XNHA 4BP8A 1F12A 4GNRA 2RGYA 4O33A 1K4YA 1UOQA 5FH9A 1MJHA 3DW3X 4RHXA 1ZC3A 2FPSA 3DDHA 3PDIA 5TE9A 4BWYA 4CMIA 4U5XA 4MAMA 5EA2A 5ENZA 3U80A 3P2EA 2FNAA 5I7RA 1QO0A 4Y9SA 1YNSA 2PKEA 2WIFA 3CT6A 3B6KA 1OLXA 3P96A 1RYZA 2A9OA 4K26A 4NAVA 5JMOA 2VH1A 3E8XA 2VJQA 4L6IA 1E1NA 4ZXPA 3RAPR 1EGMB 3ZCSA 1NVAA 2RG1A 2G09A 1DZIA 3LOQA 3OE7A 2JGEA 2I2DA 3DFIA 2XMRA 2EF1A 3WB1A 2C3MA 3ZDBA 1EFPA 1JHUA 4L5AA 3KSUA 2MYUA 2FSHA 4R3UC 1JEOA 1JHRA 1YAJA 3URKA 5JEDA 1KQPA 1Q22A 5AKIA 2H59A 2KSQA 3HO8A 2WJJA 1AO0A 1DTSA 1M6NA 3LUDA 1DAOA 3HP1A 3C6ZA 1B6RA 1HF3A 2VXOA 4OJKA 4OI1A 2W2LA 4JDPA 4RA9B 5IWAB 3TQTA 1DJPA 4ZYLA 5C37A 4F5EA 4NAHA 2ZYTX 1CY6A 3UT0A 4BEVA 3NVDA 3J80A 1EVKA 3L07A 2NTEA 3HJAA 3DFZA 1W8DA 4YAOA 3THXA 1XTRA 2O2ZA 1X7XA 2R2AA 4XSVA 3WTBA 1X7WA 1LWNA 2WA2A 3CKLA 2ID8A 1V0JA 2KWIA 3OPYA 3E9NA 4R8VA 2F1OA 3FNFA 4HNQA 1ZN2A 1NN0A 1NJGA 2W4MA 3NYWA 3T3GA 3NXKA 1IVYA 3E7PA 1G20A 1R0BA 3PDWA 1WCIA 2ZCUA 1ZH0A 2I76A 2PRYA 4Y2GA 1IUNA 1GQSA 4GWKA 4YJDA 3SSAA 1DEAA 5HKAA 2I7XA 2VJAA 4JI5B 4IFBA 3CVWA 4DV2B 2QN8A 4J0KA 1N78A 3LBIA 2FCRA 3KQQA 1L5ZA 5C51B 1DE0A 3F6PA 5AHRA 6ADHA 1M7HA 2ZR7A 2XPCA 1X1RA 4WA7A 1AMNA 2F8TA 2EDCA 1S3FA 2PVPA 3SF0A 1K6EA 1PSDA 1YDWA 4DSTA 4C2TA 1QTNA 1EK2A 2FTKE 2FW1A 4R1MA 4U2BA 2H3EA 3I92A 4NBKA 1L5GB 3VNAA 5CB8A 4RVFA 2OAQ1 4MQ6A 3EODA 3HH8A 3HKCB 2C5EA 4BN0A 1DKMA 2WJHA 4YCSA 1J9EA 4KXWA 2QE7D 2J46A 1ZHFA 2PL5A 3LT5A 4IKOA 4PRKA 1O6CA 5JATA 2Y0CA 4GSLA 3FCXA 4ZYVA 5C52B 1WDTA 2VA8A 3FY4A 2QSUA 3PC4A 2PMDA 5BSUA 4JLKA 3F1KA 3WADA 3UKDA 2Q4BA 4RFSA 3UQZA 3W4JA 3GUYA 1A4RA 1EE2A 1Z62A 2FPKA 4PLFA 1KSGA 2Y68A 4OK5A 4AJIA 1K6MA 1PR2A 4WZBA 1LWOA 4YK7A 4BB9A 3CSDA 3G5UA 1AN0A 1CJMA 4DNPA 4W7IA 4ZHQA 3Q3EA 1JEAA 1SHTX 3HWRA 3LPAA 4J1NA 4MV1A 4NBNA 4OQNA 4G56A 3ZGVA 4Y98A 1JXAA 2Q4DA 1Q3HA 3ICPA 4UHBA 1TIKA 1R0KA 1VRVA 2Q8QA 4NV0A 2GPJA 1XNQB 1F4VA 1PBNA 1YULA 1FW8A 3IP5A 4NQRA 5GVRA 3WMFA 4EABA 2XUIA 5A62A 1ZIPA 3GLFE 2EZ4A 1RIFA 2VAVA 2YJ6A 3COPA 4Q9JA 4AIIA 1T5HX 5JWHA 4I4IA 2HT6A 4V0ME 4H6WA 3ZY6A 1R4MA 3IEMA 5CXXA 1G64A 1MLDA 4W5NA 1BS1A 1L4KA 4Q7MB 1ZICA 4FPXA 3LUCA 2JH3A 1LPBB 1Y3FE 1WXFA 3MBKA 2X6QA 2IEYA 4X24A 2C9YA 4H3KB 3SHWA 3CLHA 1TQ6A 4YRCA 2H48A 3D2CA 3P4YA 3GAMA 5LP6B 3NDIA 4PX3A 4KXLA 1LBQA 3GRFA 2GEVA 5A2GA 5JD3A 2IODA 5IS2A 2GRAA 4LZOA 4M22A 4JYAB 4B6EA 5KNDD 2HT1A 4RZXA 4B6GA 4Y2VA 5HOEA 1EK5A 4CKBB 1EVJA 3UCXA 3W6OA 3QKRB 3NWOA 5J23A 1IHPA 3RASA 4NJOA 3KPJA 3U4MA 1MVLA 1ODFA 4E2YA 1C8BA 4G5FA 3ZU2A 1ZNYA 4KWIA 1PX2A 3FPAA 3UPDA 4MQ4A 5DX0A 1Q50A 3NU1A 1J06A 4KN9S 3SJAA 3TQHA 4KVAA 5FWXB 3ZLJA 4CE6A 4MCIA 2J4CA 1V9LA 4FNOA 2CFRA 3TBFA 1WUKS 2XWSA 2ZE5A 3HCOA 4KUGA 1JB9A 2BGTA 2QYOA 3FWPA 3LM8A 4JOSA 2XA9A 4RSGA 1A9OA 3KVVA 4EQ6B 1EEXB 5BYAA 4UC0A 2FZCA 1E8MA 3B6IA 5TPWB 1SHJA 2WW8A 4FHEA 5AW2A 1GSHA 1D0SA 1Z3CA 3M1IA 4X6YA 4KO8A 5EWJA 3FPSA 4KR9A 2OLJA 1MPXA 4AX4A 4E51A 1P3Y1 4XEHA 4UJ3A 3IEPA 1G6OA 4QQKA 3T5CA 3KFXA 1GPDG 1V11B 3TJRA 3FLAA 2NN3C 2OT3B 2QIOA 3FKQA 4MVJF 1MC8A 1KYVA 3CLTC 3G2PA 3Q0TA 1OLUA 1CQPA 2ZROA 3QVGB 4IXWA 2FUG1 1VJCA 2YW9A 1K97A 1LRKA 2LIVA 2MSDB 2YY5A 4FSHA 2VHVA 4QAQA 3SHFA 1Q7RA 3NOQA 2COEA 4X94A 1OZFA 3O4RA 4KI0A 3SFTA 1GEEA 4GGPA 4RVSA 4CHGA 2R8BA 1YQUA 3OCZA 3ZWDA 5KPDA 1I2DA 2A0KA 1NMQA 2WD7A 3PRKE 4GQBA 1XF1A 2O4CA 2GTIA 2R86A 4AY2A 5JNVA 4XIJA 2JC3A 1MW9X 1TLTA 5GVSA 3KP1A 5ER6A 3QEKA 3CR7A 4BO9A 3VR5A 3ABZA 4FN4A 13PKA 1OLUB 1RWNA 4ZKDA 5BV7A 3JYOA 1EXWA 3KAQA 4ZVMA 4NBTA 2AX4A 5ALPA 1GPH1 1I33A 3LGXA 1LB1B 4BV9A 2P77A 4BE4A 2CYCA 2VAWA 1BTOA 1IONA 3ETDA 5GINE 3JQCA 1SQFA 5LYJA 5K8CA 1C1DB 3PQ7A 4CBVA 8MHTA 1A8PA 2H2DA 4LK2A 1BWPA 2J85A 2W6QA 4TZKA 4OTZA 1E3QA 5DHAA 1GDDA 3LQKA 5CAEB 4H6XA 5JALA 2UUBB 1KL7A 3RSFA 4EUFA 3EWIA 3IB6A 3PGLA 1K0FA 1R5JA 1WKVA 3N39C 3V4LA 5ISMA 2FLWA 2A86A 3NLLA 2YXEA 4P7KA 3G2LA 2TRSB 4Z9FA 4TWZA 4ILEA 2P5SA 1U28C 1PFWA 2H6EA 5JI2E 3BD7A 4DA9A 5DBIA 2XJ9A 5CLQA 1WLSA 4K9DA 3ZGNA 3ZJUA 3EQ6A 3MAGA 1XJQA 3IH5A 4M88A 1CUAA 3E2IA 1C29B 1OXTA 4CMGA 4I6EA 5I7OA 4EITA 4FR0A 4G5YA 1AN9A 1YFJA 1QG4A 3H2ZA 1OXUA 1F0NA 5DV9A 2CE2X 5CP8A 4AUEA 4RKWA 1PJAA 2CMDA 4PY2A 5KHLB 3DHVA 1EZZA 3H3FA 3JQBC 3V3KA 1UEIA 2QI9F 3WL5A 3ANLA 1J9ZA 4G2TA 3I12A 3D31A 5LJLA 3NNNA 1UP4A 1P19A 3GFOA 1CUIA 2WEKA 2HF7A 1RZ3A 3G9TA 3HKEB 4YMWA 1EGHA 3U7RA 2BGJA 3QVGA 1TGVA 4RZIA 4G81A 1WHTA 4OQDA 5E0KB 3KEFA 4IX1A 2BKEA 2Z9CA 5E4YA 4E3ZA 4ZD6A 5LP6A 1P0QA 3TIVA 2O2DA 4ZQGA 3KSAC 3LOUA 3OD5A 3EIOA 3IMFA 5I3CA 1B73A 1K1EA 1M0TA 1PJTA 1VLMA 1KGDA 2HEIA 2YHIB 3I52A 1H2AS 3JRNA 1MA0A 2Q9CA 3FNEA 1M2OA 3BCHA 3EYAA 2VP6A 4RZSA 1RRGA 4DDWA 1R4MB 5REQA 1KAHA 2JJ8A 1UOEA 2WJ4A 5L40A 4AULA 3F8TA 4GT1A 1QYCA 2C8JA 4GR4A 4JITA 5BWOA 2ZDHA 3MOSA 1TK3A 2XW6A 4O4LB 3LUKA 4AIRA 4RF4A 2VDQB 1IHUA 2EQBA 4HCJA 4FIZA 5CM8B 2IOFK 4RMJA 3PEEA 3I28A 3JZFA 2PT5A 3UMFA 5LZ5A 3D0OA 1GP2A 3MMXA 4QU9A 3ZE8A 1VP3A 3WGOA 2IUFA 5HWSA 5K4HA 4JUIA 4Y9DA 5ALEA 2JI9A 1R6DA 3L7DA 4DSOA 4YPOA 3ZE2B 1PKEA 3V46A 4BZPA 4Q1EA 4OLAA 1MRZA 1PHRA 1LSSA 1R6XA 2ZKLA 3BSSA 3KJQA 5IBQA 4MHOA 3DZJA 2HK6A 3R74A 2QRVA 1CY4A 2PT9A 3INNA 1OXVA 2HWYA 3QHAA 4H60A 4TXNA 1FDRA 4UVDA 2AFHB 1UBLS 3B6JA 3MS2A 4WD3A 4MRNA 2WRZA 3WDSA 3Q7IA 5A0TA 3B7GA 4MW1A 2QVYX 4NV3A 4KQKA 4NECA 3MCTA 4OK3A 4M0CA 1Q1QA 3RS9A 4ZC8A 1YB4A 1CERA 4XWKA 1E0SA 5LZ2A 2YDXA 2B37A 4OB6A 1JYEA 4NVRA 5E1BA 2R0QC 3S2IA 4W5JA 2VJBA 2GO1A 1NUPA 2H5IA 2AVDA 3A9TA 1A9SA 1HL7A 4ROSA 1IVNA 1XMOB 2VLIA 2VR1A 4M54A 4ND3A 4C0QC 3E0QA 3GC6A 1L3BA 3LW7A 1SZCA 5ARDA 3OKFA 1G55A 2Q5OA 3A14A 3NW9A 1E1QD 4AMUA 4IMRA 4CQJA 5A4JA 5LOVB 4Q47A 3I61A 1VL2A 1V1MA 3UAYA 1RXSA 1LI7A 4F0JA 5B2ZA 1X19A 3VO9A 2Q49A 3PQ8A 3DE5X 1I1OA 2CBGA 3ILSA 2OXTA 1V8PA 4H0NA 5ICEA 3SZUA 3PG5A 3T1TA 5ADWA 5F7OA 5I9NA 2E3JA 2RH5A 3L8HA 1YK1A 1TZKA 5K20A 2DGDA 4NYJQ 3THXB 1W25A 2DUUA 2OP0A 2A1TS 4C30A 5KPJA 3LUFA 3M3HA 3IV7A 1E6UA 3U7FB 2O2XA 3GCZA 3C7CB 3HKCA 4H7JA 2XHEA 3ROMA 5LM3A 3RYCB 2EXXA 3NNSA 4PLYA 1FCJA 1FNNA 3EGVA 3LF1A 3I72A 4GZMA 2D62A 3U62A 3ZV7A 1Z5PA 1LS6A 2WPDA 3CWZA 4EMSA 1ZUNA 3K73O 2FR1A 5HE8A 4FB4A 4GD3Q 4TMKA 5KTMA 1OAAA 1N7HA 4D25A 3MFYA 2HSGA 2PH1A 3I58A 1XX6A 2A35A 3L6RA 4EL0A 2WG0A 3QMMA 4NE7A 3BGVA 4CJXA 4AN0A 1SXJC 3ZGZA 1FVXA 4OBXA 4F3NA 3ZI0A 4I46A 1GV0A 3R4CA 4I36A 3RVNA 4Q9AA 2JKYA 1L5HA 1R27A 3KYDB 4DMRA 1NI3A 5DWVA 3RC1A 4II7A 4AF8A 1W8IA 4GYJA 3LX8A 4ZTUB 4LJ4A 2AW3A 4BE9A 1X7XB 3GJ4A 5E6RB 3STXA 1QTIA 1NQAO 2OQIA 2RAVA 3EGCA 3GCXA 4FWBA 4MO2A 4QJIA 3VPGA 4BZZA 1V39A 1GG9A 3HXMA 2GAFA 5CEJA 1N5MA 2VSXA 3OAAA 3U7QB 4KWTA 2O8EA 4B3BA 4L7QA 1XKXA 2AC2A 2ZUSA 3GMIA 3E9QA 2NSHA 1NR1A 1IRXA 4EI7A 2ZYWX 4BIMA 1NMYA 5IG2A 4W5HA 3VBCA 4O4IF 1TCVA 4UVIA 2KLHA 2DX7A 1R4ZA 2CLMB 2QP4A 4WBNA 4Z4FA 5KVCA 1GKIA 2BZSA 3KS9A 4GI1A 4F96A 1KP3A 3OIUA 3BVPA 1Q0SA 4QGGA 5A2QA 4QFBA 5F4ZA 1E62A 5JAUA 3GAAA 3R7LA 3L6BA 3L4SO 3DMHA 1T9DA 1ZUHA 3F98A 4HZUA 4ZA2A 4QM6A 3KLOA 3VYVA 3NUZA 1GCAA 1I6MA 2RGEA 1L4MA 1SIOA 3QU5A 4Q39A 4DUGA 3FYUC 3EMVA 1G4HA 1R6TA 3C14C 3TM5A 2MCFA 4XQCA 1PQPA 3BL6A 3JPYA 1YIAA 2PLRA 1RJDA 2IOYA 1KEKA 1O6ZA 5KYUB 2RJNA 4J7XA 3ORQA 3M70A 4JXXA 4XQ0A 4ZT2A 4V39A 2DPMA 1FJHA 1CUZA 1QFMA 4AZ0A 2RK3A 4P33A 4MUXA 5LDGA 3O4GA 1JHXA 2POQX 4EW3A 2PE5A 4IDAA 4JYZA 4AS2A 1HQCA 4BBZA 1TA9A 2PQ6A 2EZTA 1K68A 1SK8A 3G79A 2ODEA 3UK7A 4EG6A 3HFSA 1JLHA 4MEAA 4YT8A 2NUAB 5KYTA 3FHTA 2JEZA 3LQRA 1VE3A 4K7JA 1GL9B 3GLHB 5A3JA 1ZQ1A 2N1BA 3CMMA 4M0DA 3OZBA 3K9FC 2IOFA 1ZJ6A 2KQUA 1J7JA 4HDRB 1LLFA 4KPUA 4ANFA 3MQ2A 3E35A 3MYRA 4HBGA 1N4DA 2GZAA 2J7PD 1UP7A 2VYNA 2QD3A 4QYXA 2WFLB 3EEFA 4YB8A 1NDQA 1UMDA 1PS8A 1V26A 4BGIA 2BE9A 3DWFA 4AU1A 4LDPA 2OWEA 3W4KA 3RE1A 2GX6A 3R0ZA 3MPOA 1KEEB 4LTNA 4LY3A 4PCLA 5AVWA 2BUAA 4QPCA 3ZBTA 1OBOA 2PGLA 2VRBA 3A7EA 2HJWA 3DHEA 3HR7A 4RVCA 5CAEA 4D4MA 4FWIB 4O2AA 3L4BA 3BTSA 2Q2WA 3IS3A 4UU7A 5CNJA 5EEHA 2PZBA 5FR2A 3TVTA 4EKNB 5AVTA 3OBIA 3ZK8A 3C7KA 4WLEA 3R8FA 4PSCA 4Y6OA 3O8QB 4BQOA 2PJUA 4E15A 2WB4A 3A6JA 3TSWA 2VPPA