1MB0A

Crystal structure of the response regulator divk at ph 8.0 in complex with mn2+
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
120
structure length
107
Chain Sequence
TKKVLIVEDNELNMKLFHDLLEAQGYETLQTREGLSALSIARENKPDLILMDIQLPEISGLEVTKWLKEDDDLAHIPVVAVTGGCEAYISKPISVVHFLETIKRLLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic and Biochemical Studies of DivK Reveal Novel Features of an Essential Response Regulator in Caulobacter crescentus.
pubmed doi rcsb
source organism Caulobacter vibrioides
molecule tags Signaling protein, cell cycle
molecule keywords cell division response regulator DivK
total genus 39
structure length 107
sequence length 120
ec nomenclature
pdb deposition date 2002-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1mb0A00
2MYTA 5IBQA 2GKGA 1J56A 4NV3A 1BAPA 4ZYLA 2VYCA 3K9CA 3OQOA 1C0EA 2WRZA 3CNBA 1KMIY 2R25B 3BILA 1TLFA 5PNTA 3CHYA 2GBPA 4N0PA 1W25A 3RVLA 3JPWA 3BRQA 4RKRA 4P98A 1U2PA 2MYPA 5GQSA 4S05A 5B3JA 2RJNA 3C6QA 2FSPA 5KQPA 4W5QA 4MR7A 4KVFA 4RKQA 4HNSA 4PE5B 4JP1A 1Z2DA 1ZDMA 5TE9A 2CHEA 3C3WA 1Z17A 4MS4B 4W5TA 1L5YA 1I3CA 1EHCA 5DKFA 1JDPA 1P8AA 5DCLA 4F8JA 1KRWA 5FWYA 3TD9A 2FTKE 4MR9B 5KWSA 3NHMA 1SXGA 1PNRA 3HK2A 1NXVA 3CZCA 4O1HA 3RQIA 1AB6A 1JL3A 1ZGZA 1QO0D 3GBVA 3NHZA 4PEVA 5EWLA 3Q7RA 5EWMA 4OLAA 3HDGA 2QU7A 4P1ZA 4KK4A 1PEYA 1PUXA 1P2FA 1YMUA 3CS3A 4XAQA 1ZN2A 2FMKA 3IP5A 4JOQA 1HEYA 4RU1A 4RWEA 4L4UA 1GLGA 3CU5A 4Z4CA 4N76A 3UK0A 1DRKA 3VNAA 4KREA 1K68A 3OQMA 4YCSA 2M98A 3LUFA 3NNNA 1LBIA 4XXHA 1DCKA 3A3KA 1Z12A 1LBHA 4WXEA 4DQDA 1EWVA 4IMJB 4MS1A 1NXPA 2WY2D 3QEKA 3HDVA 5JNRA 1WETA 1U04A 1SXIA 3QK7A 4EY3A 4KRFA 1CYEA 5TQ2B 3LOPA 4MQFA 1YK1A 4WWHA 3CRNA 1F51E 1QP7A 2IPMA 3GYBA 4KNYA 1NXSA 2QXYA 2FLWA 1JFSA 2AYXA 2YHAA 1L5ZA 3GRCA 5BRAA 4G86A 1Z15A 4RXUA 3MYYA 2VUHB 6ABPA 3T95A 1EWTA 2GI4A 2MSKA 3R0JA 1YS7A 3HXMA 2PUFA 1DZ3A 3URMA 4XARA 3Q9SA 3M9WA 3ILYA 4YS6A 5KC8A 2V0NA 1PEAA 2IYNA 5FBKA 3LUAA 5B3JC 1MAVA 1Z13A 1K66A 3MQ4A 3N8IA 4MS4A 3HO1A 3A0RB 3O2SB 3HSYA 5E3JA 3T8YA 3C97A 2J48A 1U0SY 2LUOA 3MF4A 3A0UA 4Q6WA 4EGSA 1DG9A 3G85A 3H5OA 2FVYA 4WXMA 3LUHA 4D6XA 4MQEB 1DBWA 5I4CA 4LE0A 4MR8A 1NATA 1TVMA 3DBIA 1S8NA 2FN9A 2O20A 4MGEA 3H1GA 3N0WA 5JS2A 3O1HB 4EYQA 2HJ9A 3HZHA 4IMIB 2P9HA 3LKBA 5EWLB 5TQ0B 3TX6A 3IP6A 3SG0A 3L6UA 4RK0A 3QLVA 4OG2A 4KFCA 4Z99A 3DLBA 1GCGA 1U8TA 1LJUA 4N47A 4JAVC 4LRQA 2FMHA 4ETNA 3H75A 1QP0A 1BDJA 3MIZA 3N0XA 4QYMA 2JVKA 2ZWMA 1ABFA 3H5TA 4OBBA 2WMYA 3FMVA 4MR7B 4YP9A 1ISSA 1DCMA 5CNKA 4YWHA 1R8JA 5JNSA 2PL1A 3KJXA 1C4WA 1H9CA 1DJMA 4G0ZA 2FQXA 3EDCA 2CHFA 3CZ5A 4F06A 4Z4FA 1KRXA 1Z26A 3LUCA 3E3MA 5HSGA 2FQYA 4Q7EA 3JVIA 5C5CA 3SQNA 3QELB 1YIOA 1QKKA 5T3YA 3NNSA 4HNQA 2L2QA 1ZGGA 4DN6A 4LZLA 4W5OA 4UHKA 5IX8A 4KV7A 4QYWA 3KLNA 1DCFA 4H3KB 3K4HA 2A9PA 4GNRA 4IGAA 2CWDA 1E6LA 2E4WA 4WUTA 2QV0A 1ISRA 1ZY2A 1A2OA 3O21A 3OLXA 1EAYA 4G0QA 1E6MA 1FFWA 1Y1LA 3MA0A 1OXBB 5FWXB 3LUKA 4HNRA 3OO1A 1ZITA 1A04A 4DADA 2HQRA 1RPJA 3NBMA 1RZRA 4EYKA 1F4VA 3CTPA 4XFKA 5TPWA 4ETIA 2H3HA 5HKOA 1LK0A 1SXHA 3TO5A 3SM9A 2OQRA 3TMYA 2PUBA 2A9OA 3Q7TA 4FB4A 4G0PA 1JF8A 4MAAA 1JLKA 4GPAA 5DTEA 4YRZA 1QQBA 3KSMA 5EWJB 1VPWA 3QEMA 4LX8A 1M2FA 4EVSA 1FFGA 5KI6A 2P4UA 2PKXA 3C3MA 3P9YA 2IPNA 1DBQA 5TQ2A 2PMCA 4S04A 1APBA 1D1QA 1Z18A 1FFSA 5CNJA 1QPZA 3UUGA 4MRMB 4FE4A 1W9HA 3EQ2A 5DLEA 5IUJC 4ML3A 5HM6A 1Z16A 3E61A 3NNDA 1MIHA 4OTZA 2RGYA 5C5EA 2PUAA 1YTUA 1Z25A 2LBPA 3O2JA 1FQWA 1D2AA 1D4ZA 3DLHA 1GCAA 3QLUC 3CFYA 4QPJC 1JYFA 1JFVA 2LIVA 1JBEA 3H6HA 3I42A 4MS3A 2NT3A 4NCAA 2QVGA 3HEBA 3QEMB 1ZH4A 4E7PA 2MSLA 3OLZA 3LMKA 1CEYA 1PHRA 4KMRA 1VKRA 3H1FA 1GUDA 2QW1A 5F64A 2WJAA 3Q41A 1NXXA 3QLTA 4RDCA 4G0MA 2WWVD 4N0QA 4MPTA 3L49A 3W9SA 2QZJA 2FLKA 4Q6BA 1IIBA 3RVOA 1NXOA 1XHFA 3FFTA 3N0RA 3IP7A 1MB3A 4Z4HA 3MM4A 6CHYA 1Z2EA 3KKEA 4MLCA 4Z4EA 2L19A 3OLWA 5KQGA 4ZPJA 4RV5A 2GX6A 1TJYA 4JB2A 2LPMA 1E6KA 4RSMA 3Q7SA 3HS3A 3F7NA 3S99A 4JB0A 4Z4GA 5IUKC 1OXKB 3UKJA 5TPZA 3HM9A 3BBLA 1USIA 1NXTA 4L85A 1URPA 1USKA 2MYNA 4TN5A 3M9XA 4QICA 4WT7A 4MS3B 1RXEA 1TMYA 2FXIA 4RK1A 4RY0A 5TPWB 4E7OA 3OO0A 1B00A 2JVJA 2LP4Y 5FWYB 1JFTA 4RZSA 4ZMSA 1BDHA 4EUKA 3O1IC 2WB4A 2OENG 3EJWA 3I45A 4H3HB 1D1PA 1UDRA 4PICA 4NCBA 4MRMA 1JHZA 3IP9A 3HUTA 1QO0A 2FQWA 3H5WA 3KYJB 4XASA 1ZHHA 4KQCA 1ZVVA 3LKVA 3JPYA 3D02A 2R48A 3OM0A 1AB5A 2JB9A 2VUIB 3FFXA 3FGZA 3O1JC 3T38A 3Q15C 2HPHA 1YK0A 3BRSA 4G97A 1DBPA 7ABPA 2M1ZA 3VNBA 1YVUA 2NZUG 4JASB 4RK4A 4JA2A 1E2BA 5TQ0A 1P6QA 1JH9A 2JBAA 2NZVG 3RVKA 5IEBA 4D6YA 1M2EA 1FSPA 2VK2A 4IF4A 2FEPA 2CD7A 4RK5A 4MQFB 4KQ9A 5JNWA 2PUEA 3KCNA 3CLKA 3RVSA 5BR1A 1ZAYA 4Z0NA 3RVPA 4KK3A 2HSGA 3JTEA 3KS9A 4HYEA 1MVOA 3KLOA 3QX9A 1NY5A 1DC8A 4KPYA 4EYOA 3KYIB 2IDMA 4RK6A 4YLEA 3GA5A 1D5WA 5GOTA 1PNTA 3OMXA 4XLTA 2F8SA 2E4XA 5KQMA 3JS5A 4UHJA 1NXWA 2PAFA 2TMYA 2H0AA 2JVIA 2FMFA 1EWKA 1JYEA 3H5VA 2JBAB 1JWLA 1BVHA 2KYRA 2PJUA 3I09A 3HVRA 3CKMA 1YMVA 2IKSA 2A9RA 4M88A 3GV0A 1ZESA 3B2NA 3A10A 2E4ZA 4TMYA 2F8TA 3IDOA 2E4UA 2FW0A 2PUGA 4W5RA 2QVCA 4ZMRA 1XHEA 2PUDA 4IILA 2JK1A 3O2QB 2R47A 3OLYA 4IRXA 3F6CA 4MR9A 3FFWA 1A0OA 1DC7A 3HV2A 4LE2A 1QQAA 3OM1A 1MB0A 3F73A 5KC9A 1DRJA 5FBHA 4W5NA 4Z9AA 2E4YA 2Q5CA 2PL9A 3H5LA 2YHBA 4LDZA 2AYZA 3QLUA 2NT4A 3LFTA 4PYRA 4Z9BA 3OQNA 3HJFA 5IULC 4WZZA 2WJWA 2L17A 3HUUA 3EODA 4FE7A 3IPCA 1VRVA 3KHTA 2BGGA 5TQJA 4OATA 3I5AA 2QSJA 2B1JA 4TLMB 3T6KA 4EVQA 3H6GA 3QX8A 2JCGA 2MYUA 4YO7A 2B4AA 3FDFA 3O74A 4CBVA 4EVRA 2FN8A 3ROTA 2DRIA 3D8UA 4OLBA 1LJLA 3M6MD 4N41A 2PUCA 3CG0A 4H60A 4MYRA 1CHNA 2QR3A 3EQZA 1QNLA 1SRRA 4MQEA 4NQRA 4G0XA 2A9QA 1EFAA 1BDIA 1ZH2A 3OMWA 4TLLB 5BQ3A 2I6FA 4G0YA 4KZKA 4D74A 5ABPA 5IUNC 2MSWA 3H1EA 5JNTA 1KGSA 3DZDA 3LUJA 4ETMA 4MS1B 5KQLA 3EULA 3RH0A 4O5AA 5ED4A 2RJOA 2IPAB 3TB6A 5TPZD 4RK7A 1XWWA 4EYGA 4LE1A 1JX6A 3HCWA 2ZAYA 3LUGA 3SAJA 1ABEA 2N9UA 5EWMB 4F3TA 3LTEA 4RXTA 1USGA 2X7XA 2W42A 3QLVC 1QP4A 1T34A 4Y9TA 2HQBA 4MR8B 2ID9A 2R4QA 2PLNA 3CG4A 4LDAA 3RVJA 4YV7A 1RNLA 5D2CA 3MMNA 3ROFA 4G0OA 1JDNA 5BRJA 3G1WA 4Z4IA 5DGCA 3H5IA 5IC5A 3DGFC 1QMPA 4O1IA 4PZ0A 9ABPA 4YGXB 2IPLA 4RS3A 5T7BA 3KG2A 5CNMA 5JNUA 3EGCA 1GUBA 2FEWB 5HQJA 2PE5A 2FEKA 4NICA 3GBPA 1YS6A 1TM2A 3RVMA 1RZRD 4F12A 3BREA 1M5TA 2E4VA 2RDMA 4YR7A 4MLDA 1U2QA 3LUDA 3OLVA 3RVQA 3RVNA 3N75A 3JY6A 1BA2A 3ILHA 3GT7A 3JVDA 4F11A 1NTRA 2GWRA 5IEJA 1VLZA 2NUBA 3N6VA 4RY8A 3C3KA 1M5UA 2XDYA 5EWJA 4N03A 4B09A 2HQOA 3QELA 8ABPA 3GL9A 4RXMA 3GWGA 3KTOA 3RVRA 3SNKA 3N53A 2JRLA 5CHYA 3DGEC 3O75A 5FWXA 4ZJPA 5CNIA 3SY8A 1SD5A 3F6PA 2FKAA 3IPAA 5JS1A 1DP4A 2IOYA 1RXIA 2ID7A 2FMIA 4RY9A 1P6UA 3EAFA 5JNVA 2L18A
chains in the Genus database with same CATH superfamily
1DAIA 1K6EA 5EYPA 2GKGA 1J56A 1Q0RA 2WM2A 4LXIA 4OYHA 3BH0A 1M2WA 2IIPA 5IKOA 1NBME 3M1YA 2WRZA 1A77A 3PSHA 2R96A 1JHQA 2WD7A 5KTKA 1FX0B 1JV2B 1J8YF 3RT9A 2B3DA 2NUTB 4GI3A 1LI7A 3ANXA 4MV8A 3ZJVA 4NHEA 2ZCUA 2PX3A 1KZHA 3UFBA 2C1EA 5D5QA 4F6RB 2X1MA 2O8FB 2GCPA 5DM2A 3VKHA 1WCYA 2WWIA 4XWOA 5DYTA 5CMLA 2BKEA 2VYVD 2JZCA 2X41A 1XE3A 1IIRA 2ZKIA 4M8NE 3I12A 3D2LA 4DILA 1JEOA 3S8EA 1XMQB 3DEJA 3IUBA 4WKNA 2QN1A 5E1BA 3E5HA 3WK9A 4EATA 3AHIA 1YR9A 2O2YA 3N8GA 3KOMA 1EJBA 4EA6A 3QVGB 3HWWA 3IMEA 1Z6PA 5JMWA 3ILSA 5INTA 4KPFC 4RIGA 5FWYA 1CUSA 1OVMA 3A1NA 4ZVTA 3LDAA 4OXRA 1G4UR 4PSCA 5JAMA 5F7ZA 5JSUA 4KHPB 2CF5A 4R2LA 2XLBA 3FE2A 1Y4DE 2P3LA 2VHWA 1Z0KA 4DMGA 1X3SA 5C1IA 4QX6A 3ZHTA 1IN1A 2ERXA 2WR8A 3C3EA 1DWOA 3I05A 1OX6A 3IODA 4HCJA 1J97A 4KWIA 4OHKA 2WUDA 4UVGA 2VXBA 3IEVA 2V7BA 4DLXA 4P1ZA 1G2OA 4BFVA 1COZA 2ZYAA 1V5GA 2IE8A 4U2BA 2AD5A 2IV2X 4MRNA 4BLQA 4MVJF 2AG5A 3GEEA 4X1OA 4B2YA 4EG4A 2ZTVA 4N76A 2PMBA 3IJ5A 1Y8RB 3V1TC 3ZU5A 4E1VA 3GFBA 2NW6A 3OIFA 1BE6A 3ESYA 3ORSA 1U6JA 3F2VA 4P35A 3CW8X 1ZOIA 2BPOA 4WBSA 4LSMA 3N76A 2BUBA 5ERYA 5DBEX 3KB2A 4QRIA 4BQNA 3MOIA 4TSFD 4UEOA 3X1YA 4F96A 1X86B 2BMFA 2G0TA 1AM4D 3QEKA 1C8KA 3OCWA 3RFCA 1K7SN 5ALPA 4HKTA 1QJCA 1M7BA 4JJIA 5K8LA 1W34A 4DUYB 2PH5A 1JRLA 5I9SA 1Q1AA 3BIJA 3ABSB 2A7QA 3R6WA 4DNOA 2R8YA 4JL6A 1YS2X 1L1EA 1XTBA 4ZVVA 3WNZA 3RS2A 1NXSA 2IJGX 3QF7A 3KJNA 5KNDH 3SHTA 2XA2A 3EJ6A 4BX0A 1F4PA 2FVXA 1DBVO 4DSZA 4GC9A 2HJHA 3C3CA 4IQ8A 4UZSA 3TXAA 2NMVA 1Z5ZA 2ZRBA 5FOVA 1C8BA 3QVKA 2P2NA 1J2EA 5BNWA 4WOJA 1MQ8B 1H69A 2R7AA 4YCBA 3PNQA 3ZV7A 4GHWA 4CI0B 1C3VA 3BFVA 5AW3A 1KF0A 3R5KA 3OKFA 2PIAA 5H80A 1WDWB 2YIVX 3FDIA 1OBHA 3MQFA 2PSFA 3DEFA 3O4FA 2JAOA 3E58A 1Y3AA 2CSUA 3CCCA 5MFZA 2IYNA 4PNZA 1TFRA 1TVCA 4HO1X 3V4PB 4NCBA 1EGHA 3Q1KA 3RSLA 3FR7A 1K66A 4M38A 4B3HA 3WDSA 5LD2B 1PJCA 2VR1A 3UMGA 1DKUA 2W5UA 2W6MA 1NUSA 1A4RA 1O5TA 4K28A 1XF1A 1N5RA 4M9ZA 4GGOA 4DSAA 5HJ5A 3BEDA 2O6HA 3G85A 2BBTA 4HS9A 1N1MA 3D9QX 2QLLA 1X8JA 4RCYA 1VTKA 3DMGA 1U31A 3GMDA 4EA8A 5C32A 4F3NA 1D6NA 4MR8A 4WZBA 1NJ2A 1SOMA 1TVMA 4Q47A 1AQIA 1UC8A 3FD8A 1DTWA 1BRMA 3L6DA 4KPUA 5JAQA 1KSFX 4HNVA 1E0AA 2ATVA 4GP6A 4YY3B 2J3DA 1ADCA 4YLGA 1OH6A 3NFYA 2IY7A 4XWGA 5JPCA 4JI0B 3M2PA 3C6BA 1MW8X 3R5TA 5KTNA 2Z2IA 2B4YA 2XZTA 2LVBA 3BFXA 4PN7A 3CF0A 1SNYA 1P7CA 3ZEAA 1BH6A 1XP5A 3ZY2A 3N05A 3VPBA 5G40A 1ODCA 3ND5A 1AKMA 3WKDA 2R7MA 4AY4A 4GOKA 4M98A 3HBFA 1NBEA 1A8SA 2KLBA 3H5TA 5DYGA 3EY9A 5DXFA 2W71A 3W5IA 4CV3A 2NSYA 3GEGA 1PK8A 3NVMB 3AUSA 4RMNA 1U7UA 1FVFA 4FD3A 3R0XA 5AW4A 4TKUB 3N8DA 4MW4A 3U19A 5L7YA 3QJGA 1CUBA 1G21E 4MWTA 4HH3C 3OF3A 1B4DA 4N7RA 4L0DA 5DN9A 1IEVA 5BW5A 3KETA 2IYRA 3BXHA 4RD4A 2RHBA 3HJCA 5JCXA 1KZ6A 3DE0X 4H1TA 2IY8A 4X6YA 1TMGE 3K09A 3DS8A 4JUFA 1NPDA 1W1IA 5TC4A 2P4EA 4EGCB 2C59A 4HNQA 2IUUA 2EFEB 2JKVA 4WVLA 5EESA 5F23A 3PT9A 1T8PA 3WYAA 3E22A 2CL7X 1GTJ1 3E9NA 4AJ2A 1Z74A 4NENA 3V4FA 3NTOA 2F62A 2QZSA 3VKGA 2JEZA 3Q2IA 4UZEA 4AO7A 4N65A 2W6JA 4ENUA 1AQNA 3RUAA 4V0RA 3HB4X 3OLXA 1RYZA 4GBJA 1H2BA 4HDRA 3IJPA 4I7EA 1AMNA 5CYGA 4D56A 3GDHA 5JJBA 5KNBD 1X7YB 2DUUA 3MJDA 1E9SA 5BN4A 1JIXA 1RAIA 4CKEA 5JOQA 1BG6A 2QY6A 3L41A 5D3ZA 1JSLA 4S1VA 4OIMA 2IPOA 4QFMA 5DHTA 4V1CB 3ZI7A 1BIFA 3FI0A 5JCOC 3OQJA 4L02A 4MQBA 3A6EA 8GPBA 1JG4A 4GAEA 4LGCA 2NVBA 4DGQA 4JYPA 1ZJ4A 3PUZA 5TR9A 4XVQA 3VKFA 2H17A 1AV7A 3F78A 2G0AA 3BIFA 1DC3A 3I8SA 3SR3A 3AKYA 3OIDA 1C1XA 2ZRLA 3USCS 1S8OA 1OC4A 5HA5A 4MV1A 2GO7A 4OAQA 4BNJA 1XVVA 3AERB 4G2NA 3TINA 4Q82A 1FFSA 2DR2A 3O7MA 5J4VA 1UAAA 1YJ5A 4WNAA 1NBMA 1EDOA 3QU2A 1NOJA 5CBPB 3R6LA 5FADA 5IUJC 2WQ6A 2QGNA 4F38A 3TGWA 1UK8A 1DEAA 5FTWA 2RGUA 5SY6A 3ER9A 4TXMA 3GDOA 4TMWA 3AZPA 1RWKA 4E4TA 4LF7B 3GMIA 2Z95A 1OOEA 2P78A 2WSSD 2VQ6A 2A58A 3N2LA 4KFSA 3U60B 4C6TB 1I8TA 1QV9A 2A6PA 4DYDA 3DJFA 4TL7A 2AYYA 3A7EA 3PGKA 1GRVA 2ZU6A 4QULA 3TLMA 4ANFA 4R71A 2YOGA 4XFDA 5KJ1A 5KHLB 1CEQA 2OCLA 3UWDA 1SEPA 3RRZA 2BCGY 4DC9A 2PUVA 3IAXA 1WW8A 4TYQA 4GO1A 4DJTA 4DDTA 4V1CI 4FWTA 4IV5A 3H9QA 1CEYA 5KAMA 2C9OA 1Z0IA 3PXCX 3RCBA 1L4KA 3U62A 5LFAA 1Q7BA 1UJCA 5FFFA 2QLMA 1SWWA 3WR5A 1XVIA 3B3AA 4MP8A 4AMBA 3BB3A 4JT8A 5KJFA 2O05A 1K97A 1BGVA 2BUAA 2HHHB 3KQQA 3PA8A 2OCGA 3QVSA 3OZVA 3UQYS 5HUQA 5LQUA 1JFRA 4TRJA 2P68A 4D4JA 1W4LA 2X0RA 4W9NA 5HR5A 3GLUA 4ALJA 4DABA 1HORA 2WPDD 1VYTA 1G1AA 1N6OA 1CR2A 1GSOA 1PEDA 1T6ZA 1Z2EA 2RHJA 3ED5A 3EUEA 5AW7A 3DV9A 1V5WA 1YBHA 4UEQA 5JMTA 2GX6A 3IUJA 3SOPA 1DJLA 4B7ZA 4YUZA 4Z0TA 2O8CA 1SC3A 2VHYA 4IQGA 2GYVA 4EY7A 1FMTA 4FOPA 2VF7A 2CVHA 4NBLA 4ABTA 3H97A 3IALA 1XXHE 2RHDA 4LHWA 5IX8A 3RASA 1QIKA 4LYEA 1KZ9A 4H6XA 1C0PA 4HX2A 2ZZMA 1FSZA 1FX0A 3P71T 2X6QA 5FUVA 1O6BA 4FI3F 1GPDG 5HUHA 4M55A 1E3IA 1FIUA 4R41A 2Q8QA 1E2PA 3M4ZA 1P44A 3HSSA 1PTJC 4ZDWA 3HXTA 2UZ1B 1JHMA 1PTKA 2G09A 3BTOA 1TLLA 2YWCA 4Y67A 3W1EA 4DLTA 1EAMA 2GERA 1G1MA 2GEVA 3DLTA 4CEIA 2WUFA 5K7SA 2BRUA 2YJ6A 5A5DA 4R01A 5JATA 4KO3S 5K2MA 2Z3VA 1M74A 2JB9A 3FFXA 3K1ZA 4KXQA 2NU8A 2PANA 1IQRA 1OBCA 2D5IA 2YY5A 4KYVA 2JAPA 4DQXA 2ODNA 4BLPA 2YYZA 2HLHA 1B14A 1QQ6A 4Y1GA 4B4OA 5CEJA 1PG5A 2YUTA 1QRRA 1XZAA 4JA2A 3NKLA 1SU7A 3JQGB 1VSBA 1AOXA 5DNVA 4OQNA 4F1KA 2TSYB 4F9TA 3HKBA 1IQPA 4R6WA 4CG1A 3T61A 1YQ9A 4ZJUA 2FEPA 1PS0A 5HBGA 3HH8A 5KQRA 1NOKA 2LWIA 4KWEA 3V5NA 2O2EA 1H0KA 3UPTA 5KTPA 1TQHA 2QJRA 2UZ3A 3BMXA 5K0GA 1CC1S 1P1KA 1E59A 1CY7A 1KP9A 2IEZA 3GGJA 3PG5A 1M2KA 2X13A 2XT6A 1NOIA 3L7NA 1MA3A 3PI7A 1S1MA 2A30A 2XCQA 1Z68A 3GA5A 3JQ9C 3CVOA 3P0FA 1M6NA 5BYBA 5CCDA 2P2CA 4K05A 4URUR 3PR2B 4K9DA 4MAFA 2HCTA 1KAOA 4W82A 4JROA 4DV1B 2VJNA 1FEZA 1U2GC 4MGKR 4NU8X 1MOQA 2AC2A 3WIOA 4CG3A 1VHQA 5KSWB 2ZRHA 2XHEA 3RKSA 3GOHA 1A8HA 3WYDA 1YA8A 3ENNA 1QWSA 4V3CA 3FYUB 4YRGA 2F8TA 1TKRA 5M5BA 1XDWA 2WWTA 4DRYA 4HEHA 4ETWA 2PUDA 2BLLA 4YREA 5E8JA 4QFDA 1FS6A 1TL7C 2W6JD 2FN4A 1S96A 2J3LA 3EH1A 3GBSA 3HWX1 4AECA 1ZU4A 1K2WA 3K2QA 2DECA 4MUYA 3QH4A 3DP7A 1DUVG 1Q95A 5BT9A 3COWA 4F8YA 3HJFA 1VFPA 2X23A 2XA1A 1Z38A 3DVQX 2X14A 4CTJA 3QNUA 3G0OA 1YZ3A 3VMMA 2QVBA 3ITEA 4ZN6A 3BTSA 2BGGA 1NNUA 4JL8A 4L5CA 3KVNA 4PYIA 3I39X 1BEZA 1BXZA 4KVZA 4C87A 3UJ6A 4C0AC 4O63O 3KZ1E 1LLQA 1NQXA 1PW7A 4DRZA 5IKMA 2D2FA 2JAWA 3L05A 3OQ1A 1PW5A 4RMGA 2GF9A 2HSJA 3CG0A 1TXGA 3VTKA 2MMGA 4MQ6A 1NKVA 2AMYA 2I8AA 4MI1A 4MUXA 5FQOA 2ZSUA 3EF1A 4OYLA 3LXMA 4TM8A 5ABPA 2P75A 1SBTA 2W2LD 1N7HA 1YAHA 3H8SA 5EIEA 2G8NA 2VJPA 1H2YA 1E9FA 1OWPA 2C58A 2PGOA 2XB9A 2YFHA 2JDIA 3Q10A 3GH3A 1Q2XA 3NHLA 2GO1A 4MARA 3AKZA 1H1TA 3ANMA 3FCXA 1PF7E 1N92A 1VPTA 2EKQA 4LE1A 3A31A 4OYYA 4UNNA 4XYGA 1ACMA 4DSUA 4N54A 1YNOA 2F1RA 1ABEA 3AFNA 2YVLA 4LOJA 4PWZA 3QXXA 4LF5B 3OEED 4XYEA 2IWRA 2QXTA 3ORQA 1W1UA 1FNDA 3GK3A 2YXEA 4NIMA 3UFXB 1QP4A 5CHEA 2W43A 4A26A 5MFPA 2Z8ZA 2HQBA 3DR3A 3QW2A 1FYDA 4MWSA 4O2LA 2XDQA 3SBOA 4ZGWA 4X1YB 4FLEA 1O77A 5JJLA 3BHIA 3LAWA 2VK8A 4L9WA 2ZYVX 4KYTA 3G1WA 3C6YA 4KFRA 4BPRA 4CHTA 3H65A 5JAIA 3IT0A 4GXTA 4YGXB 2ZROA 13PKA 4RVUA 1OGIA 2OBLA 4TYMA 1XVLA 2WT4A 4RIHA 5CVTA 5U4QA 2FPPA 3A6JA 1HL7A 1MUUA 2ZYSA 1GUBA 4UM7A 4HVCA 3CNNA 3H1AA 2FEKA 2YV1A 3QVWA 4KBYA 5CK4A 3ZLTA 4BO8A 4I4IA 1P9NA 1GNPA 5DBOA 4QLOA 5K0SA 4F12A 121PA 1QRUA 1WHSB 3OMLA 1JPJA 1C1XB 3GP5A 3R7BA 3ZHBA 3QEOA 5C8ZA 5CX1A 3KQLA 1WW3A 1ZL2A 2VNHA 3G3EA 1M8JA 1GUAA 4YYZA 2PGNA 3KTDA 4DLVA 4Z9XA 4EY6A 5IEJA 2Q9AA 2QTHA 1P0PA 3BQMB 1KI8A 3OCJA 1A4IA 3QX7A 1LK7A 2OHFA 2SICE 4B09A 2REQB 4XZ3A 3JQ7B 4RXMA 3HA3A 1RXWA 3QPAA 4FFDA 1U63A 3ND8A 4QBTA 4MPRA 1GUYA 3BF7A 4P8RA 1GADO 4ZJPA 1IXYA 2CV0A 4YV2A 3AY3A 2JBWA 2NTEA 2HQ1A 2QYTA 3U13A 1I51A 4Q1BA 2FMIA 1FXUA 3GRFA 3O92A 3EAFA 1ADJA 3PUHA 3QBEA 2Z09A 2HV8A 4MRSA 4ZQFA 3TR6A 4BGUA 3V3TA 3ZOZA 1K86A 1GG8A 4ND4A 3V8MA 1CUFA 1C0EA 1Y5LA 4D3SA 4EUSA 1RI5A 1KE2A 5PNTA 3KT6A 1HLPA 4BKOA 1XELA 2C00A 4HGRA 1DVRA 3PC6A 4X9XA 2I6UA 2Z5FA 3AM5A 3BIXA 5EZ5A 2ZM6B 5IK2A 1NMQA 1U0BB 2XZOA 4YRAA 1L5HA 2EZ4A 4B8YA 2JEYA 3FHLA 2P5UA 4DCSA 1M5RA 1NW6A 2VZ0A 3C6QA 2WLTA 2I3GA 1UDBA 1VJTA 2PMKA 1QE3A 1IHOA 5JPIA 1MJGM 4CLRA 4N8DA 4ZVPA 1NW3A 4L95C 3N2ZB 2WF7A 3GZNA 1VMDA 4ZO9A 4KOEC 4B9EA 1LY1A 4FKMA 2FPPB 3P45A 3EG5A 5KOJA 2FV8A 5CPBA 3GA0A 5E2AA 5T5QA 3ROMA 4NL4H 4CLOB 1WP9A 4XUGB 2IYLD 1NVWQ 4OF4A 2NO7A 4PYNA 3O95A 3TD9A 2H7CA 1W85B 1TYDE 2VUTA 2VYQA 2ZI5A 1N8SA 2ZIUB 2YFYA 5AHWA 2ZJZA 3TEJA 5KWSA 1XQ9A 2II6A 3OE5A 4IVNA 1RJGA 2YICA 1CPYA 2DCMA 2HPZA 2OG1A 3E9RA 1TA4A 4FFNA 4HGYA 4JYBA 1ZN7A 4FQ7A 4IWNA 3LIPA 4L75A 1U3GA 3NATA 4M1YA 3FGPA 3SD7A 2QT0A 3ZD6A 1QO0D 2FWBA 3R6DA 4EFLA 4GRDA 2IXDA 3F2IA 4G1CA 2C20A 4MZXA 4Z9FA 5EN4A 3R9IA 4Z6KA 1PEYA 1P2TA 5I9MA 1PSZA 4BFUA 4RH0A 2QRVA 1JQ3A 2A5LA 5FBVB 2CYAA 3IOBA 4OJTA 3OZIA 5I9IA 1COWA 3A37A 4P0QB 2VZEA 1MAUA 4K9MA 1JT2A 1AUXA 4R84A 3HDTA 5FNZA 4RZ3A 5T6BA 2AH5A 2R8PA 4TYWA 1ZSYA 4IMJB 4GL4A 2FGKA 3W6PA 7REQB 2GJ4A 1S3SA 1Y5NA 1NDHA 5FORA 4EY3A 2WG2A 5EIHA 3BRWA 5LP6B 3IIJA 5KOIA 4BB5A 2JLVA 2P5SA 3I3SR 1J33A 5DM0A 3I6ZA 3B7GA 1E61A 3CZRA 3K1AA 3EA5A 3R5FA 3RK1A 3TX2A 1C3XA 4ZVQA 5J4LA 4IXWA 2I9PA 2B82A 4MRRA 4HY3A 1JILA 1QIJA 4NE7A 4Q4AA 2H2AA 3KEGA 1CCWA 4AD8A 4A0SA 1Q19A 2D0PB 3EIEA 2YNMD 4DBZA 5TMPA 4YCNA 2UYGA 4UDOA 2X0FA 2FEAA 4MP6A 2GAAA 1O57A 1RVV1 4MOWA 1N9KA 1Y8AA 1W85A 3JWGA 3QE0A 4J6EA 3JZAA 3E4CA 3FOWA 1GTVA 1QYXA 3OI7A 4MWEA 5BVHA 2FEMA 2EBHX 5AP9A 4F3KA 3W3AD 4MA0A 5A3VA 1FPMA 4AUNA 3S68A 4MDFA 3EX7C 2CXUA 3L7IA 2O8EB 4WNAB 3M70A 1N9GB 3BG5A 4OV6B 4ZODA 5KYUA 3WLFA 5CLHA 1AQYA 1WCV1 3BXPA 4ICIA 2F1KA 1ZUNA 2ILVA 2DG2A 3MS4A 1KI6B 4FFMA 4LGYA 4XFJA 1A4XA 3NT2A 1RXCA 1Z9BA 2WOJA 1M2VA 1NATA 3AB8A 2IZ1A 1YBAA 4FCTA 2N3ZA 4QYIA 4YAGA 4MWBA 1NBWB 1GN8A 4XUDA 4HWKA 2NZYA 2QNIA 3TUIC 3VDQA 3P96A 2DULA 4RK0A 4HHEA 4WE3A 3ZHOA 1XP8A 1YC5A 4M1EA 1U8TA 1A69A 2HBZA 2EWMA 1NVUQ 1M1YB 4HB3A 4DDUA 3UWPA 3D4PA 4PPYA 3CZQA 3HKCA 2X19A 3IDQA 4JXXA 4D81A 1GARA 4BY9E 5CRIA 3PGJA 3D43A 2NSLA 1FDUA 3LI2A 4CUJA 3C85A 5FJJA 4AZ3A 1TJ3A 3SHVA 4GXRA 1G38A 3BK1A 2NXEA 3DBLA 1WXHA 1H9CA 2HBRA 3ZHQA 4BJ3A 3EDCA 5I7OA 2CE7A 3CZ5A 3K2BA 3NJ8A 2KBEA 3TQFA 3ASUA 4N0EA 4ID9A 1L5SA 3KR2A 2Y05A 3RAJA 2JJ8A 4R51A 1L5NA 5F5XA 5H9WA 2AZXA 2R6R1 3FNIA 3CLRD 5F7JA 1Y6JA 5T3YA 1S7CA 3ANSA 3OJCA 1T15A 3DF7A 2B4QA 1GNRA 1MZVA 1ZGGA 4K6FA 2VBCA 5ELLA 3T3IA 3NBXX 4W9MC 5DWDA 3IHTA 4GU5A 5EVJA 4FFPA 3WMRA 3LG2A 4F7WA 1R0LA 1V8PA 4N5IX 1E6LA 3IEXA 1KTIA 2HF2A 1PL7A 2H9YA 4UQPA 4WUTA 1A8QA 4GXNA 1BHJA 3I9OA 2AS0A 4XX1A 3W3ZB 4D41A 3EMVA 4QQ8A 1B6SA 1DEKA 4Q0MA 4XUCA 1XCOA 1QTIA 2QVXX 4OQMA 2XUKA 1KSHA 3KM0A 3T3GA 1EE1A 5U1PA 1PJLA 4EBBA 5KPDA 1KQFA 2IUTA 3II6X 3PDJA 2XTAA 3TO5A 1N36B 1AG9A 3JQCA 2F2TA 2RHGB 1N32B 1WWKA 2AZ4A 2HRBA 3LBHA 1GM5A 2Q5IA 3AHCA 3T0GA 2PWYA 2OO7A 4HAVA 4YRBA 1S8FA 4LJ9A 4UEKA 3UC5A 3KSMA 4J6FA 1NVEA 5EWJB 1VPWA 1E7WA 1PN3A 2WF8A 4K2AA 4PHTA 2IYYA 5IVIA 3PNYA 1RFGE 2QX4A 1KKUA 1NF3A 3CMMA 3UMFA 1TAUA 1JXOA 4TWAA 3AMVA 3RGWS 4DV4B 2D5AA 2WFMA 3GRUA 3P9YA 4AKSA 3L7MA 3CZ9A 4EG6A 1PO7A 2Z1DA 3IRVA 1A8UA 3STYA 4ESEA 5JSFA 4ZVKA 4S04A 5EMJA 1DGQA 4DWWA 2OAQ1 2YS7A 4EFNA 4YMVA 5BNZA 1E69A 4UTRA 3CWZA 4G9EA 4D9BA 4JI2B 2QOEA 3E61A 5FWAA 5LLDA 2P35A 2FDCA 4MXDA 2EAUA 4CDGA 2IVFA 3WLLA 1CERA 1EVZA 3R3HA 4F8EA 3WWCA 3MLBA 3G0HA 1DKOA 2AVDA 2OAEA 10MHA 4X66B 3D6AA 1YU9A 4GMGA 3SQXA 4ZC1A 2W2VA 3EDQA 3ORHA 3HYRA 4P34A 3E9MA 1S02A 4YQFA 2I4LA 2MSLA 4UBKA 2PVSA 3TAXA 4ZCIA 3DR5A 3R3VA 4UFOA 4R2MA 4MA4A 1HDOA 3F8TA 2HH9A 5K3BA 1Z33A 3PLRA 1IG0A 4PG4A 3UCXA 4QFCA 2ZBDA 1KQOA 1KAGA 3BK7A 4RZ2A 2QP3A 3PF8A 2WM3A 4ZXFA 4E2XA 3K72B 4EJ6A 1W0JA 2BEWB 2FFJA 2OWDA 5E6SB 2Y6VA 4K3VA 4OGLA 3AUFA 4Z4EA 1G8SA 5EKXA 2DM6A 3TLJA 1QGOA 1TT5A 2FW9A 3EGDB 3KAKA 4PBSA 4ZPJA 2C8JA 1WQ3A 4RSMA 1T4DA 1G6Q1 1JE0A 1JU4A 1MENA 3N2GA 1R12A 3J80A 2WYWA 2IUSA 2W48A 2YWDA 3EGXB 3GI1A 4UCWA 4W1PA 3AKDA 1Q2UA 3G0BA 1KNQA 5CG1A 1CZHA 3EXG1 1GFWA 4JKYA 1PK9A 3BUSA 4OI1A 3WLSA 4TXNA 3C2QA 5HBRA 3RB8A 2CNWA 3BRCA 1OV4A 4MS3B 1TMYA 4RK1A 3BEOA 3KSZO 4O6VA 4YJ3F 5DM4A 3U56A 2D4AA 3EZ2A 2XY4A 4NX2A 1HRDA 1B00A 4ZDJA 3NAMA 2Y0EA 3LBNA 2I80A 3WQSB 5AW9A 1RM3A 3F9CA 2XMZA 1JNYA 2PPLA 3ZHSA 1BCSA 4AUKA 5LL6P 4HDRB 3SXJA 2MOKA 1NVVQ 4IIJF 4R1NA 5JXWA 1DAEA 1T4CA 4MCAA 1UDRA 2Q4OA 4NV0A 3NYRA 2QTVA 2H5IA 3H9CA 2WJ3A 5LA6B 4BZZA 4P33A 4EW6A 3GLFA 4QDZA 3DMPA 1ZVVA 1C50A 2XQGA 4Q7MB 5IBCA 4UMEA 3VVCA 1O6FA 2OCYC 3AF0A 3M9LA 3A4VA 4NFLA 3VAAA 4E22A 1E8DA 2NTYC 5B2FA 3HCFA 4U8GA 4IH1A 3WGYA 7ABPA 4M1SA 2ZIXB 3NKVA 1B7GO 4FKZA 5FV7A 5IXSA 3ZNNA 2AOXA 4DR1B 5HM8A 1QRAA 3D81A 1Q5PA 3VC7A 1JSXA 3H9GA 5IEBA 3FZGA 3CRMA 1VPVA 2JBHA 3FNRA 1DHTA 1GEEA 2I8CA 3GEDA 4J3FA 4QRDA 4BVKA 1MIOA 1JHUA 4FFWA 3D7RA 5GY7A 1XPJA 2GEBA 3HA7A 1JLMA 1BXGB 3TIVA 5JSHA 1PFYA 4U02A 1Z4OA 4RA9B 2IZ6A 3EXEA 1VRCA 3KS9A 2FUG6 3TH5A 1IATA 1TT7A 4B73A 3B5EA 3DHVA 4ZVNA 4XQGA 1E2QA 3B2QA 5DNUA 1SUEA 1A95A 3COYA 4DQKA 4KKXB 1W73A 2AE1A 4ZAXA 4P82A 1TAGA 4P3KA 4C4RA 2C4HA 3H5VA 2K7FA 2GR9A 1T0BA 1LC3A 4JVNA 4LTNA 4NZYA 3KVVA 4PINA 4XTRA 4B6QA 2CJYA 2DR0A 2HHAA 4IZ6A 4L8VA 5JJIA 3H13A 5IMSA 2FWAA 2P0YA 4QOEA 3HKDB 2GTPA 2F7SA 3B36A 4XGQA 4YIHA 1P75A 5GZ6A 1I4EB 4PQRA 3CSDA 3K53A 1QM5A 1GL3A 1XTIA 1YRWA 2CUTA 2FW0A 2OBNA 3CNOA 1WE2A 2F4NA 3MB8A 1EE2A 3OLYA 2PSDA 1N2CA 3TL2A 3WLAA 4RSRA 2LIPA 1KI4A 1MB4A 1V8ZA 3AQIA 2DLCX 1ORRA 4P5DA 1W48A 3DBVO 3D4LA 4FWIB 4GLLA 4ZIRB 1QCZA 2D2XA 1R7RA 3HKCB 4TS4A 1EP3B 2J5KA 4FKBA 3U0VA 3A1VA 3BGSA 3CVWA 2F6RA 1OFUA 4WJKB 5CH3A 4ZARA 4A73A 3PEWA 3OQNA 2VSNA 2KMLA 2TECE 3ORRA 3NTVA 3WNQA 3IQIX 2JIRA 1LWNA 2C3UA 5EHQA 3SNHA 2C4UA 3DAHA 1MJHA 3QX8A 1Y6RA 3QU5A 4G8CA 2D54A 4F6RA 2O8FA 2JNWA 1PKXA 821PA 2NWQA 3O74A 1JR2A 2CMGA 4JP3A 4MV6A 2B99A 3I72A 4AJIA 2VTEA 2UUCB 4JJZA 3MLAA 1KJYA 2ORIA 3LSTA 2OL4A 1KI6A 1HFJA 4J43A 2FDRA 1W4RA 2RI1A 4E46A 1VJDA 3KXDA 3AFMA 3DMYA 4RA6A 1CNEA 4ZCPA 1RHKA 5IUNC 1SCKA 1JH8A 3FUXA 4X1KB 2V65A 1PV4A 3EGDA 3UA3A 5KVSA 3SI7A 2VN8A 3CX8A 2V6MA 3IVGA 4NCHA 2WBLC 2OM2A 4P4LA 5A6SB 4R16A 4RV5A 2YOFA 1SQSA 3HBNA 1R6TA 5FAKA 1XEWX 4FGJA 5KOJB 2PT7A 2FYTA 3HE3A 4O0MA 5HGXA 3SU8A 4DJDC 4Q7JB 2UYHA 4V2UA 2XSZA 2YV2A 3AWIA 1WSDA 2EXXA 2O2GA 4K9RA 4EAQA 4II3A 4LY0A 1P1CA 1XK6A 3UMSA 3EIHA 4RXTA 2CMHA 5EL0A 5C37A 4I8IA 1G60A 1ZWLA 2WMDA 2GPYA 3A3YA 5FI5A 5A03A 1WTCA 4FHCA 1HC7A 1UFOA 3IPLA 3CG4A 2QW8A 2VF4X 4KSCA 5AJYA 3MMNA 1ZRMA 3GF4A 3HXKA 3QPUA 4AF6A 4Z4IA 5ITWA 4OKNA 1DARA 4JT2A 2WK1A 1E96A 1QFJA 3D6FA 2FW8A 2ZYTX 4X00A 4UVEA 5DRYA 4RZIA 1RQGA 2G4LA 3A8TA 3OZWA 1UZAA 4Q21A 1JDTA 3TD6A 4C0HA 4OHRA 5AVUA 1ZMTA 1O5OA 2QNBA 1VP9A 2R1ZA 3B1KA 5F1PA 5CLFA 4NH4A 3ZZ1A 2OV3A 5JCZA 3DZ8A 1G8AA 3SEZA 1XZGA 4HAUA 5DV9A 3AHHA 1S5PA 3PX7A 3IEMA 2EW1A 4ZOLB 1JG3A 2XBUA 1N2SA 1U98A 3JAKB 1DPGA 2DUWA 2QJWA 2BM8A 4QJIA 3DXZA 3K0EA 5ICMA 3MWEA 3WZLA 4Z3OA 1FDTA 3N53A 2P30A 5CJPA 2OV6A 5TARA 5FWXA 1O6CA 1YDFA 3MPUA 2YDYA 4ZANA 3EEOA 1TUBA 1V1JA 3W2EA 4KO1S 2XBLA 2PX4A 2GN8A 1OILA 2OK7A 1TU3A 2FKAA 1C1DB 3PWSA 4CNQA 3T5PA 3UOAB 2ZULA 4AAYA 4KQFA 3GZNB 1JLRA 4TROA 3TG2A 2HA3A 4O0LA 2OGWA 2HX1A 3GG2A 4LI0A 4BWFB 3LXXA 1VE9A 1TTQB 1XXHB 3RGGA 1KOFA 1IRIA 1O5IA 4JEMA 1BJKA 4LNUB 1YKFA 4CCSA 2VDVE 5F51A 3KU4A 4MVJP 4IG4A 3JPWA 3GUCA 1T36B 3DQZA 2GCNA 2GM3A 2ZDHA 3BC1A 2VT7A 4JQYA 4YVFA 1FRNA 3SDZA 2G07A 3PPVA 1Z45A 1NYRA 1H3EA 1RAFA 4MQLA 3VPXA 5CPFA 5K0EA 3HACA 1PP4A 1TZJA 3AB3A 2HCBA 3CRRA 5JSZB 5ADUS 1DCTA 3QNMA 1KC1A 3O8RA 2XB8A 3LLVA 1PUJA 1KIAA 3MQ2A 5TE9A 1U1FA 2AUNA 4YMTA 2Z2JA 1T5HX 1N7JA 3BGOS 1I32A 3AM3A 1I3CA 3ZHYA 2VJLA 3KR9A 1NONA 2Z5GA 4HX9A 4J7XA 2WU0A 1P8AA 2QR2A 4GMXA 1KRWA 2RFLA 4K9LA 4Q12A 4Q34A 3CVUA 2NSHA 3N8NA 4MKHA 2P1RA 4A8JB 2B8JA 3KL4A 3QWIA 4Y2XA 1NBHA 1PGPA 1WR8A 2DQKA 2AI2A 1KI3A 2HMYB 3KPWA 4YK7A 1L3BA 3RJ5A 5JT1A 4TLAA 5TNXA 3L7DA 1T5IA 2X4GA 4NJEA 3HDGA 4DA9A 1K0FA 4FFSA 4H18A 5IARA 1QBKC 2ID8A 1YS4A 4U9UA 2X0EA 3VH1A 4EW3A 3H0KA 2JLCA 3LQ2A 4UUOA 3DOIA 1NBOA 3EEFA 1XXHA 2Q21A 2HMAA 1DRUA 4ZEVA 2PFKA 1FUKA 1IHUA 1GZSA 1X9GA 3EVZA 2W2XA 3H9UA 3IQXA 4MPPA 3KO8A 4RELA 5DBHX 5BUZA 2I6QA 3EUAA 3QMPA 4MJ3A 4WXEA 2QE7D 1VJ0A 5BSTA 3RJMA 4EG5A 2AF3C 3B1ZA 4JP5A 1KFCB 4OBWA 1H94A 2GN9A 3HDVA 3FBWA 1DXQA 3FRHA 5JNRA 4DDMA 1E2UA 1F9AA 5JRZA 2QTCA 1ZEJA 2H07A 1YK1A 2P6NA 3ZDZB 4ZV4A 5JSQA 1WP4A 5LXTA 1GIAA 2HT1A 2AEFA 2VYNA 4FT2A 3COSA 4I50A 4ISCA 4PZDA 5AJZA 4S0ZA 2V3CC 4JXKA 2IYAA 2VFAA 4K6HA 5AQ1A 2B8TA 1L1QA 1Z73A 3F90A 2XUHA 4K9PA 4X3PA 3THXA 3P4XA 1IQUA 1DBSA 1WUTA 4PLZA 5DOVA 4UQOA 3FUCA 2VKQA 3N39C 1T2DA 4JI1B 2GM4A 4OQEA 1KO5A 4B71A 2FR0A 4MHTA 2FG6C 2WAXA 1QX4A 4LX0A 4AICA 3WC4A 4BPBA 3K1AB 3HXMA 2JGIA 4RKFA 2C7RA 4XQ0A 3ZWBA 3OOSA 1C7ZA 1IH8A 4Q03A 1VM6A 5AW5A 1EVEA 5BT8A 2H7VA 3TQCA 3G9QA 4YS6A 2VDOB 3OX2A 1PEAA 1FMLA 1KHTA 2P2ZA 4LMBA 4OGKA 5I7VA 3KXKA 1SVWA 4ZQBA 1Z13A 4WKPA 3PFKA 2DJIA 4OPMA 1ODFA 4OOFA 1ITZA 3T8YA 4KPEC 1O08A 2ZRFA 3SMQA 4Q6WA 3RW9A 3U40A 5AT1A 2DERA 2NPFA 1GV0A 1DS6A 1N8KA 1PCXA 1Q12A 1UEJA 2QMHA 1BFDA 1Z0FA 2H54A 3K0AB 3UV6A 1IY9A 4INJA 5I4CA 4DUGD 4ZI7F 1PZEA 2NAPA 3PVCA 1V4BA 1RKXA 3N0WA 3PT5A 3TECE 4JNKA 4WQMA 3L5OA 4PC3A 3IUMA 1UXGA 3LPAA 3FX2A 1GRCA 3BSYA 4Z7OB 3QTTA 4QYTA 5IC4A 3JTMA 1SQGA 4X71A 4TYYA 1XFAA 1W8DA 1PT6A 3CW9A 4U6NA 2XYVA 3U7IA 4LRQA 5C1DA 2BMVA 4AURA 4GSYA 5K3FA 3B9BA 4ZVUA 4EABA 1XRLA 3D6TB 3V4OA 4J3JA 3EVCA 3A4IA 2YWJA 4LPKA 2ZJ4A 1UZUA 1P1HA 1C9MA 4M49A 4NRDA 2CZCA 3IAS6 3H4MA 1L4FA 1Q44A 3PHJA 1O97D 3MJEA 4IJUA 1Y1SA 1Z4QA 4DUPA 4JQCA 4DE5A 2PZAA 2W2PA 1KO7A 1CY6A 1M83A 5A1TA 1Z26A 1JE1A 2B7BA 2FCAA 3LUCA 4PANA 1RI2A 5KEIA 3B53X 4NZ9A 2ZTUA 1G5TA 5CT8A 2Y3IA 3AESA 5EXDA 3NH6A 4XIIA 5DISB 4EG3A 2AZDA 2O7SA 5LQKA 4N6NA 1BZYA 3IO3A 3DYIA 1BKSB 1SXJE 4XA8A 1DSSG 3ETCA 1U2TA 1L5RA 1BOOA 2CBXA 2JI4A 2XW6A 1WSWA 2P9FA 2UYQA 4OB8A 4ENVA 4UQLA 1JHVA 4R81A 4MEBA 2VHZA 3OHMA 3GNTA 4KVGA 3PQ4A 4YXWD 2F67A 3PK0A 4ZZ1A 4R5MA 3FFAA 2FFRA 4MKIA 2HK9A 3HMQA 4DA0A 1X0XA 3BORA 4QQNA 3WE7A 1N0UA 3MA0A 1RE0A 3VXKA 4EHLA 3NI2A 2DF8A 1A71A 1TC1A 2P6MA 4RHXA 4PZZA 4KXFB 3OP4A 2OGSA 2R6JA 4EYKA 4LXQA 4HDKB 3E7PA 3T1YB 2XR1A 1PR0A 3I1IA 2ODPA 1I30A 2XJ4A 1DI0A 3N8HA 4FYWA 4MVJD 4WCFC 5D7NA 5SYMA 5AVSA 5A0FA 1D0VA 2O2XA 4W9RA 3RKRA 1MFPA 2EU8A 4MI9A 1O4VA 2J09A 4B3XA 1E5QA 1CP3A 1CF2O 1A9XB 4R2XA 2C7BA 1E2KA 4TT3D 4RENA 4AO8A 3JD3A 4TWIA 4KI7A 3TFQA 1JLHA 1K8ZB 2SNIE 1K4YA 1XZEA 4CUZA 3AINA 4GBGA 3B60A 3PNMA 3F4BA 4YJHB 3UWOA 2O7VA 1FP6A 4MPJA 4YGYA 1H5QA 2O8DA 1P19A 2GN0A 2IY9A 5ALGA 5KNBH 1N7GA 4JT4A 3DOEA 4F5YA 2RGEA 3COVA 1W9HA 4BAUA 2PNFA 4L9AA 5CBPA 1V8DA 2K2WA 1R0XA 2ZBUA 1Y1QA 3L40A 4J4TA 5FUWA 4X7BA 4B75A 3B1YA 2JFPA 1VBMA 1T4MA 2R68A 1D2AA 3GY0A 3W7BA 5KWJA 4LISA 2HPVA 4H3VA 4LNHA 4O4HF 3U4IA 3P2YA 1ZXLA 4I5GA 3PENA 1W2GA 3SZMA 4WDQA 4QRHA 3LVQE 3L6CA 2VPQA 2QVGA 4FDLA 3WYBA 3KELA 4KQMA 1S2GA 1BVYF 1NG1A 3CISA 1ZJ6A 1TQ4A 1VQ1A 2WJ4A 2WHRA 3DVAA 4GZ5A 3QUAA 4UVIA 2IS1A 2VI5A 2I2FA 4O1HA 3ZTYA 5JNLA 1UQRA 2ZJ2A 4KCGA 3WLIA 4B6JA 1HF3A 1QH9A 4KAXA 3L49A 5I01A 4NNPA 3PFHA 2PKYX 5JMOA 2CLHB 1HZJA 4C7OB 4CMAA 3O4GA 3E03A 3DMTA 1CRLA 3AW9A 4F4JA 1U3WA 2I3ZA 4DR5B 5A3SA 4FOSA 3H17A 1J7KA 1CJSA 3EZNA 4BEWA 5A5FA 3X3HA 3VZSA 1UPXA 2AOUB 4TVOA 4AJKA 5AHXA 4Z1MD 1U8XX 4NENB 5L7TA 3TW0A 5TMDA 1RKVA 2HF7A 2OE2A 1EFHA 2ZUFA 5FUMA 1NJ8A 3FM9A 4RANA 1E2HA 1Y37A 4LWPA 1C0LA 5IUKC 2O54A 4HNUA 4FNAA 3BBLA 5EA2A 1FY2A 1NP3A 2JD1A 2W70A 4WASA 1TMOA 2J0VA 3CINA 5IFKA 4BZXA 4CM9D 2V0CA 4YIKA 2OA0A 1QVZA 5AI8A 1RWNA 2Q49A 1R4AA 2O2DA 2BRUC 3WBJA 1HEUA 4EUKA 3W2HA 3RFUA 1CRWG 3ND7A 2TMKA 1G8HA 4XGRA 4D97A 4YJ2F 3RC7A 3HBAA 4L5BA 4PICA 5FV4A 2XMRA 3CRQA 1QTQA 4DDWA 3IP9A 3I9NA 1X7GA 5DW0A 4KWTA 4KX3A 4NOJA 3L82B 3ZHVA 4YUXA 1XRSB 4INAA 3USES 4FJ0A 2UV8A 4KBGA 4UBJA 3L6OO 2R48A 3L07A 1AB5A 1Y3FE 4YNBA 3IBTA 2XD9A 2F48A 2E1PA 2ODEA 2C99A 2XKBA 3C8DA 2PZ8A 5GONA 4EGAA 3DE7X 4BVLA 2OZPA 3TL6A 3W77A 3U9LA 3HB9A 1KY4A 4C6SA 2GJ8A 1CUGA 3ENWA 4GI5A 1GRNA 1YVDA 4RJJA 4ZWNA 5K99A 2JBAA 3ID6C 1Y8ZA 1VL5A 1IBRA 4R0NA 2B7LA 2R6GA 3BCSA 5GGYA 4XSHA 4XKJA 5FPQA 2R1VA 4RK5A 3FWYA 2W2QA 4JBYA 4D8XA 4XQEA 2AOUA 2BE7A 3HM2A 3IP1A 1N1DA 4PZUA 4X8OA 2XRMA 1ZYUA 3K5WA 5F2OA 4HAOA 4NU6A 3V3KA 5BWCA 3RS7A 1WM1A 4XD2A 5BWBA 1U3VA 2JC3A 4M53A 1NY5A 3AW8A 3WIUA 2FRDA 4E13A 4F9EA 5KJ6A 4FQ8A 4AS2A 3W2FA 5GV7A 4AG3A 4PNPA 3RQSA 3JASB 3CMCO 3Q6IA 3Q7IA 4L8GA 4U00A 5DI3B 3T9BA 5JJKA 2BKVA 1T9AA 1D03A 2EZUA 3B8HA 1YUBA 3N87A 1U2DA 2PRKA 4PSAA 1GA6A 4BZWA 1J0DA 3ECCA 4BMDA 2JBAB 2WD8A 3A6KA 4M88A 3GV0A 2FZCA 5BYJA 4B6OA 3A10A 2Y66A 4CTOA 3M1LA 4GYKA 1L4UA 1H6AA 1P31A 1T5TA 3R3ZA 3AEKB 4W5RA 2H6EA 3Q3EA 4Z54A 4POAA 3CSSA 1EM8A 1OASA 4PG7A 4IRXA 5FNVB 1T3LA 1DT5A 4RTJA 3DW3X 1WKBA 3S4YA 1UC5B 4A8HA 5E9QA 1ULTA 1LNQA 3V48A 3VJLA 5DYYA 1ML3A 2HLPA 3CXRA 3KOOA 4IG9A 4DHWA 1MABB 1CULC 2JJYA 1Q17A 3ELBA 4RQUA 5FEUA 3D6UA 1J09A 4UPDA 4ZHSA 4PYRA 2GQ0A 2H57A 2N0SA 5A02A 5KDDA 4LPSA 1X7WB 4FE7A 4X97A 5DSXA 1FTQA 1MC1A 4L16A 4NPCA 3FLAA 621PA 4OATA 3LD9A 3OY7A 3I28A 4PWYA 1M1UA 3H5NA 3NX4A 1HDEA 1T91A 3VVMA 1XRMA 1H23A 2YVQA 5LP6C 1YB1A 3TAUA 4J0IA 4ZA2A 4GOND 4GMFA 1OI7A 3GEBA 4I4NA 3D8UA 4ZK2A 3QSYA 4LHVA 1NC1A 1N9ZA 1P7PA 1TU4A 3CB4A 1QYWA 3U9TA 1CQPA 1LLFA 2CFOA 3DSRA 5I7AA 2PM8A 1SH7A 4KXWA 4O59O 4CKCA 4LZOA 4TLLB 2BHLA 3KAJA 1RXYA 3LCRA 1TQ6A 1GVNB 1QRTA 3C5CA 4CKXA 1RI3A 1VDZA 2COKA 3GLTA 4TWJA 1I4DD 2HJSA 4RYLA 3WWZA 2Y0PA 4D5EA 1Z2AA 1R9NA 4L07A 5AJTA 1DQZA 4B4WA 5IVKA 2PO7A 1CZKA 1MFZA 4PW0A 3O8QB 1EPUA 3VTZA 5JRJA 5AXCA 1VDMA 3LECA 4KAFA 1UJ2A 3WNBA 2PXCA 1LQUA 4HX5A 1JU9A 2ZI4A 4FZ5A 4MW2A 5BOSB 5KNBA 4BZPA 3REGA 2WWRA 1IJFA 1FP4A 5MGNA 2HMVA 3FCAA 1P2UA 4RL6A 1U1IA 3W8NA 3DA8A 1W4ZA 3NS7A 5CB8A 3RWBA 3W78A 4CU5A 2GDJA 5HOQA 2YVKA 4WXYB 1M2VB 1D6JA 2O3TA 1YFZA 2NQ8A 3R5XA 5KBYA 2VQFB 2G70A 3FJYA 4YV7A 4O3MA 4M36A 3GUVA 3NH9A 4OXQA 1ZD1A 3H83A 5B2EA 2LV8A 4NFSA 4ND5A 4QGBA 1JIQA 3PJDA 5EIWA 3U7QB 1MC8A 1YI1A 9ABPA 3THWA 1CVIA 1W36C 5JAZA 1KDTA 4ZCMA 3ASZA 4HI0E 5IKEA 4D57A 4FB4A 1XAIA 4GVXA 1CG6A 4OCZA 1YT5A 1N5JA 3V8QA 1I9CA 3WWEA 4DMLA 2ZXUA 4FDMA 3JQ6A 2RAPA 1AQLA 5L51A 3ICCA 3MWGA 3HHPA 3GBPA 4ZVLA 2UVPA 1QIEA 3MMPA 4AMYA 3D8SA 2ONCA 2X15A 1XTUA 3ETNA 3I9LA 1Q1NA 3LVRE 4WZBE 5EFOA 2PX0A 4ER0A 4YJHA 1XLVA 2E4VA 3OOWA 3K8OE 5ETJA 4G09A 4X63A 2WWYA 1ECGA 1RU3A 2JLAA 2XOKA 3DEKA 4RIIA 2H1CA 5TSDA 3TRJA 2VC2B 2C3YA 3LT2A 2C2HA 1ZMXA 4NH0A 5FD8A 5FRDA 4DR4B 2XVAA 4UU1A 2CNLA 5TLSA 2QAJA 3MWDB 4BMPB 5CAEA 3RRFA 4AW9A 1W59A 4TZKA 4WOBA 1KVTA 3IE1A 1RZVA 3GL9A 2PZGA 3OZUA 4I50F 1RMQA 4FT4A 4GWLA 3Q3IA 4ROSA 2NVUA 4UUNA 2JGJA 3GNQA 1OGJA 2O9JA 2ONJA 4WVFA 4KUGA 3R4VA 1QCDA 3GEHA 3NUGA 3ZV5A 1I3NA 8ADHA 5LZ2A 1SD5A 4GH5A 5KKCA 1HURA 2BFCA 1IWBB 4CIAA 1KL7A 1VG0B 3CLVA 2BONA 4ZAYA 4KOAA 1Q1GA 4C0BA 1ULZA 2JGMA 3DMHA 4EY4A 4P0PB 4IEFB 1U7PA 1QNFA 1BAPA 1K7EB 2P77A 2C4KA 3OT5A 1R9MA 1EXDA 1E3WA 4Q24A 5BV2P 3G9UA 4J75A 1R6BX 1IXSB 4BU1A 1VE6A 3BRQA 2AK2A 3BFJA 1G3UA 1CFJA 2V7EA 5I8WA 2MYPA 1L1RA 3OSUA 1E5XA 1YVRA 2AZTA 2RJNA 2IP1A 2X2OA 3N07A 3QBJA 5DHSA 3TR0A 1YI8A 3GUUA 5D3QA 1L7VC 5AVRA 4D0GA 1GRQA 1QHSA 2FOXA 1X7HA 3CWQA 1PJ4A 1Y63A 1P4GA 5JCPA 2P8SA 3K16A 2IW3A 3ZBPA 3MCTA 5CFPA 4JKOA 2CHEA 4ACAA 4B2PA 1Z4IA 3H04A 5B64A 1DBRA 3WKAA 4FFBA 1GDHA 4FOOA 4C2BA 3GGDA 3GT0A 5JTUA 1EHCA 1G20E 1SIUA 1Y1PA 3D5TA 1QQ7A 5DKFA 2QWXA 2HDOA 4HVTA 2BEWA 1LRLA 2JKZA 4DZRA 1GGKA 1U4OA 5I4IA 2J0QA 2B37A 2B3TA 1SVNA 4FEEA 4U3JB 4ZAFA 1TW2A 2D2EA 2ERYA 1AS2A 1NXVA 4ZOCA 3MCZA 4DCVA 4NMLA 1BNCA 4QD3A 1AKTA 1ZGZA 3BB1A 7ADHA 2QQ0A 2IU6A 4ZALA 3K3PA 3MJ4A 4AMZA 3WHPA 5HZMA 1I33A 3KOYA 1ZM7A 3C7AA 1XWFA 4X1IA 3M3DA 1K8XB 3I53A 4LHEA 3K0KA 2Q07A 4JDUA 3K6SB 3U44A 4DARA 3EA4A 4UAVA 3ZWWA 4E3ZA 3VNAA 2RONA 3AJDA 3DAYA 4PG8A 2VYFA 1JA0A 5IN5A 3QA9A 5D7BA 5DRTA 1DCKA 3QG1A 1CE8A 3AUKA 1HT3A 2HGSA 1AKYA 4OBEA 1R9GA 5IH7A 1EWVA 3AP3A 3VYSB 3R7WA 3IEIA 1YA4A 4W5HA 1E66A 1U9YA 2XDAA 3TEMA 1QO9A 1RPAA 4REMA 4PAWA 2V8BA 4YMGA 4US1R 4WWHA 1L5KA 2Y76A 4LY9A 4KN6A 2DPYA 1XOIA 2SCUA 2O50A 2CHVA 2VK4A 2R1UA 4UHCA 3EOBI 4ER7A 4XM0A 3E84A 5B1EA 7MDHA 4I81A 3I5MA 1JT9A 3CJTA 3NQ41 5DSTA 4CCYA 1ZL0A 2CXRA 5C52B 5ARBA 2GLXA 3K92A 1QHGA 3DONA 4I9FA 3OICA 1CUWA 2ANBA 2FWIA 2OV1A 5DCYA 1UWCA 3QMWA 3TCKA 4CIXA 5J1SB 4G3XA 1VE1A 1WHSA 4BOYA 4UOEA 2PUFA 2YJ5A 3L7OA 4AXXA 1ADYA 3CPEA 3Q1LA 3FNBA 5CLQA 2Q5FA 5IYZA 2I2XB 1R5JA 4HRAA 1HE3A 2G9RA 2QP9X 4DRXB 1O0BA 4RWZA 1CUDA 2BV3A 2ETVA 4CM8B 4E1AA 3UBMA 4BMNA 1JUDA 3CBQA 3M81A 3VR1A 1MTOA 5DGTA 3UJ8A 3NGXA 1TDJA 5LZ8A 4AY6A 4BV3A 1PFVA 3LY8A 4EHAA 5IJXA 1P72A 2PZBA 3ILVA 2QA5A 1Q6YA 3EW7A 4I8XA 3KT0A 4GXQA 4Q1FA 1FYXA 4QUJA 3DLAA 5B7PA 1X70A 2FN9A 4X7MA 2WFLB 1HTWA 1TCAA 3H1GA 4AQYB 3TIXB 3ZDAA 3QX3A 1QIIA 3NW9A 1XPOA 3BB4A 2XGJA 3MTIA 1N75A 2BKLA 5I6DA 4CGYA 1K98A 3RUEA 1EVIA 4LXGA 5DEIA 3TWOA 2QX7A 3K20A 2ZSBA 2G5PA 1WSBA 3PFWO 2C57A 4C43A 3OF5A 3CX3A 2PRYA 4YXFA 2CLSA 4TTRA 3L79A 1FP1D 3LKZA 4YRLA 2HBYA 2OXEA 2DH5A 1UBOS 4XTCS 3UNXA 1R4MB 1XEFA 2Q4BA 2XWBF 4EPYA 3T3OA 1YRHA 3PGLA 1H65A 3E7DA 4LYJA 2H08A 2Z5VA 4KQIA 4QU8A 1IUOA 3VYRB 4YRMA 1ISSA 1R50A 3EOAI 5CW1A 3WWDA 3WLEA 1TGVA 1SKBA 4WCFB 1C4WA 1GV1A 4D4IA 4ZYUA 4YN3A 1Y7HA 1E1QA 2ADOA 4LRWA 4R8MA 5HSGA 4TZTA 1GQ2A 4JLVA 1KMHB 2O0JA 5DTRA 3SYRA 1MV8A 2A92A 2IOQA 5HMMA 1ZK1A 4C0SA 5FPSA 1FVXA 3IDZA 4U39A 1L5GB 4ARAA 3HBJA 1QIFA 4XI9A 3WFZA 5HX7A 1SCUA 3KEQA 4HFMA 5ICGA 1RXVA 2NUAB 4DQ0A 1VA5A 1J8VA 2AG0A 3GLRA 2IS2A 2V98A 3HVJA 3KQMA 1PL8A 1DCFA 2IF0A 1WZEA 3NXSA 1G8YA 2IZZA 4X45A 2CWDA 5KC8A 1XJ0A 1QLJA 2CFTA 1IEWA 2GAFA 3SICE 2VG8A 2I7DA 2KM1A 3EZXA 4QJ3A 1SB8A 2B0JA 2PEYA 3AL0C 3OHSX 5AVOA 4PRZA 4KL8S 1I2CA 2ACEA 4G26A 3LUKA 2I71A 4MUNA 3RC2A 3W7VA 2HTFA 1TEHA 2W93A 4KAAA 4CQMA 4Q9DA 1CYDA 1I6WA 1MMFB 1GSAA 1FXWF 1G7CA 1W581 4C14A 4MV3A 2VF5X 4G5YA 1OKKA 1Q7RA 2QTTA 3SM9A 4FBGA 2K5UA 4NAUA 3EUFA 1DTEA 4G0PA 4ZHQB 4NMMA 5A9RA 3O38A 4MULA 4RVGA 3P27A 3MTEA 4D7AA 3R4CA 3UT6A 4G81A 1BFKA 2D1TA 5IDXA 5LOVA 1K7CA 5B1YA 4OHYA 1FFGA 3SKXA 1Z22A 5DPMA 3D6NB 4JQZA 1NAHA 2QEQA 3O4RA 4NG4A 5HF8A 5K8VA 1M1YE 5DN6A 1KU6A 2PVPA 5BOSA 1V11A 1WV0A 4N8EA 1B2RA 3UUGA 4K0RA 1SBQA 1UT5A 3PHIA 2YWBA 4PR3A 5TF0A 1MOPA 3KYDB 3PJRA 2OXIA 3LT0A 4QUBA 3K1YA 1YR8A 3AFHA 4C4ZA 2VDLB 4MV9A 3SC4A 1LDEA 3N6XA 1XA0A 1I4OA 4LHZA 3P0HA 4R8VA 3DKPA 1ZH6A 4LJAA 3EZGA 4TUYA 3DUFB 2CJFA 1ZNQO 3RABA 3H6HA 1N0WA 3ZZUA 4D0LB 2O52A 2C2YA 4RPGA 3S7ZA 1WB9A 5LOVB 3AL2A 5AR1A 4N6OA 3GRRA 4Y6OA 1OLXA 1RC1A 4R7TA 1J5XA 5KHAA 1UOQA 4FEGA 3TCXB 1IPFA 1F0NA 1XMJA 4DJAA 4N0QA 2M9MA 1GZ7A 3CH7A 1QCYA 1G8MA 1I3OA 2ZB4A 4UUAA 4CQMB 3W34A 3RHTA 4BKRA 1NYTA 2PZJA 2E85A 4QXMA 5JC8A 4Q6BA 1IXZA 1DMRA 3EIWA 2BN4A 3FSEA 4L5AA 1A82A 4LXYA 5FLYA 1OAOC 3W8FA 1HDRA 2GXQA 4MW5A 3V2IA 2E4AA 1U5AA 2E7ZA 4Q16A 2JI7A 6CHYA 2VJDA 1E1RA 3IKJA 5GTDA 3VR0A 2ILTA 4IX9A 3ZKWA 4YR9A 3OOHA 5IXJA 4A0QA 2JKYA 1LV8A 1P60A 1TJYA 2HO4A 1I36A 2WFZA 1Y3CE 3HB0A 3PXBA 2RG7A 5AYVA 7MHTA 1TUEA 5KYKA 5KMGB 3IPYA 2FOIA 2YWEA 5BUQA 1LGYA 5I9BA 2P9EA 1PT5A 2WIKA 1EBFA 4GPD1 2O8BA 4Z3DA 3ER8A 4DCUA 1ST2A 1ND5A 4C7KA 1AKNA 1KQGA 1U6IA 4DTCA 3KU1A 1YC2A 4JJFA 5EE5B 1GJRA 1OFGA 5FWYB 1GL7A 3HKEB 4DR7B 2CLCX 4I1RA 3KB6A 5A7GA 4MIKA 2ETXA 3ZCUA 2F8LA 2QZZA 4WCFA 3K71B 4KO8A 3TJRA 2C1ZA 1NHGA 1E1KA 4PIMA 3EASA 4F2PA 5I7HA 4ZIRA 2JFVA 3I34X 4JX8A 4XEHA 1K3UB 4BB9A 5DT9A 5GJWC 4DPLA 3H5WA 1UOPA 2GZHA 3IUPA 1GU7A 3JAWA 4RV9A 4XASA 4OMCA 3CRVA 3X2SA 1M1NA 1U11A 3D02A 2OQVA 4Y2VA 2IDZA 3STUA 2BF4A 2IHVA 1U8FO 2WSYB 1E1YA 1Z2CA 2W2NA 3B82A 1JZQA 4EHJA 5K4HA 4AFNA 2QPOA 1W52X 4I5DA 3E05A 3UWSA 4BAGA 5JC1A 1U3TA 4MUAA 3WJAA 4GL2A 3KXLA 4RHEA 1DAFA 4MK4A 3DTVD 1U2GA 4K88A 5K8CA 1P4RA 4J1SA 4QHSA 4JD5A 2ZK7A 1JB1A 2O0LA 1CNFA 1D6MA 4L3OA 2Q7DA 3UN1A 3PNKA 1BXKA 1DRVA 2OQIA 2FU5C 2W6QA 4MQFB 3DO6A 4WZ6A 3SYTA 4E12A 2N1BA 4RKWA 5ESDA 3E2PA 3LP6A 4N0MA 2PUEA 2J32A 4YP7A 2VWHA 4HEQA 2ZQYA 3L9XA 3V9PA 3JQ8A 3FMIA 3TZBA 3UT5B 4ED9A 1NFFA 5HILA 4ASUA 4A15A 2EBWA 3FTPA 3REQB 2D0OB 4MGHA 1HV8A 1DAHA 4MW0A 3HP7A 1M2NA 2AXEA 2ICAA 4JC4A 3S1AA 1P77A 1P0MA 2B9EA 1Y82A 2FPOA 1S7GA 4BRWA 1VJRA 3EEIA 2QUJA 1N5DA 4MUBA 1S01A 1LK5A 1GAEO 1QVRA 3TN7A 2ORED 4GRAA 1NE2A 1L9XA 2GM5A 2IFTA 1I01A 1MAWA 2QAGC 3HR4A 3KZVA 1OLOA 4BNHA 5KYYB 1GILA 2EX0A 4P58A 4FYKA 2OHVA 4FGSA 2NVWA 5BR8B 1XZIA 1Y89A 1DTWB 4LYFA 2JH9A 2C5HA 2WIFA 4MVJH 1XQYA 3LQKA 3AU9A 5LXTF 5AJHA 2MR6A 3CA8A 1J0BA 1KDVA 1OFVA 2ATEA 1WEKA 3SC2A 1DRJA 1HWYA 5FBHA 3K0FB 1J8MF 3D7KA 4BQSA 4DLSA 2AFRA 2PL9A 1W0CA 1MC5A 5BR7A 2PLRA 2QP4A 2IEIA 2VHXA 1GKKA 1EWQA 5IULC 5DHRA 1VI6A 2WJWA 3HUUA 4I5EA 4V0KA 3VPFA 3PPWA 4MVYA 4J9VA 4BQOA 3CT4A 5IW8A 4F04A 2QSJA 3U61B 3NHWA 3W4KA 4BMOB 2FW7A 3H6GA 5KKAA 1NJ6A 1RP7A 2ECOA 1KMNA 1TX4B 3ZIDA 2SHKA 1N2JA 2Z8YA 1MVLA 4UHHA 3SMVA 2NO4A 3UK1A 3RADC 4IUYA 3GJSA 4S1PA 3ROTA 3EWNA 4FMBB 4RL4A 2OV2A 2ZUUA 1E8NA 4D26A 2KX7A 1FPQA 1YB6A 1EVKA 1REQA 1YQXA 2QTAA 2PTGA 3MMXA 4TV9A 4WKGA 5DYWA 1ZH2A 5CIQA 3JARA 1U0HC 1OI2A 3RYHB 4RZHA 1I1QB 1SUAA 5AVKA 3Q6NA 1WZNA 4X92A 4EHHA 3T9AA 3C1TA 2H51A 5C4GB 3UICA 2CJWA 3WRXC 3DFUA 5G4KB 5EIAA 4IIJB 4JLOA 1F14A 2RGXA 3RS5A 4N5LA 2QRNA 5ED4A 2Z3ZA 3TB6A 2I9KA 1I7PA 4CDMA 1OU4A 4NE2A 3INTA 1QYCA 4RY2A 2FPSA 3GFVA 1P3Y1 5F9HA 1LW6E 5JV5A 3NEPX 4HSEA 5EJEA 3LC1O 4NEHB 2WYHA 5G0TA 1E18A 5HRAA 1HSOA 1U1GA 1HK7A 1T34A 2BMDA 3C4JA 3QITA 1LDNA 1YFJA 5BQ3A 1ZXBA 1X39A 2HJRA 2PQ6A 5EEGA 2PMWB 5KKNB 3EMKA 1BVUA 1TADA 1EUZA 4MYDA 3QP9A 2VL7A 1IWPB 4ZT3A 5TGTA 5BRJA 4BE4A 2V7TA 2FA9A 3H5IA 2ST1A 3DGFC 1I80A 3GPCA 4WY8A 2XCRB 4NI5A 4E2FA 2YXNA 1L0BA 4DCPA 5KYXA 4R0MA 1QVAA 1IJBA 3CLRC 3NHAA 2OZEA 4FHEA 4ZI5A 1IMOA 4MAMA 1NWHA 5DTQA 1ISMA 1ZCJA 3G9ZA 5IAOA 1G17A 2G77B 2J9FA 2W4MA 5AM0A 3SSOA 1EE9A 3GRZA 3N0VA 1ZP6A 3G2KA 4IICA 5JRDS 1RZRD 3EXHA 2X0JA 3BL5A 1HNNA 1GCUA 5LQRA 4KMOA 2F9MA 1J24A 2I66A 3D4BA 1KEKA 1H9BA 3RFTA 4QODA 1F0KA 2VDJA 4BX3A 1D1SA 4A0HA 4DCCA 1U7XA 2HIMA 3AXTA 1L4LA 2XF2A 5JBQA 1IN8A 2VA9A 1QAOA 1GTG1 3IRUA 1M5UA 1SKUA 2LR0A 3FPCA 5CAEB 3TSYA 4LF9B 5FA8A 4F91B 2CDRA 2XQJA 1F17A 1J90A 3H86A 2P9YA 3ELDA 3FPKA 2J59A 2QLTA 5AK5A 3VBEA 3DGEC 4UW9A 1W76A 1NSTA 4H0CA 1U0EA 4FS3A 1J2UA 5KJEA 4E5UA 5T67A 1N34B 1NRJB 1PU2A 4GZ3A 2QSYA 3L4BC 1MEEA 4J49A 2H52A 3NWJA 1LPSA 4D9IA 2PEZA 3Q7QA 2FQWA 1RE1A 2VSOA 3Q3VA 3TTWA 4ZZIA 1GZ4A 1MXFA 2X7HA 5CXQA 1AGYA 1JKIA 1SCDA 4B4DA 1VCMA 2Q1YA 1KMIY 5GAJA 3VO8A 4DNFA 3O91A 4MWGA 2OXFA 5HZKA 2JH3A 3LCCA 3I9V1 3R3XA 1I3LA 4NFHA 4AP5A 5C1OA 2BGMA 3PV0A 4PSKA 4HFJA 3HRHA 5CH8A 4MQUA 3ENKA 4YRKA 5G41A 3L8FA 3T5MA 5HZHA 3OZTA 4OHOA 2PJZA 3ICWA 2VT6A 4JI4B 1EYZA 1NVGA 2ZIXA 4WA7A 2GBFA 4QDXA 3UMMA 4U2EA 2HAEA 3C8MA 3VBCA 2O3JA 2FQQA 2GVZC 1NSYA 3UF0A 1Z5WA 3FBGA 2XMSA 1ZDMA 2B5OA 1Q16A 3EIOA 1ZU5A 4Y6QA 5DNEA 3PJGA 5JD3A 4TTJA 2NO0A 2PTHA 2RHCA 4M9QA 4H77A 2OC4A 3PA6A 3ZU6A 1RHRA 3G0GA 2JGDB 3CX7A 2G88A 1GKUB 3FZEA 1NX6A 1ML4A 2OBXA 2ZGVA 4FYPA 3LQFA 2BMAA 2J07A 2WHPB 3NHFA 4MKXA 3RF6A 3SZ3A 1DMSA 2NADA 2YYAA 2TRSB 4I1PA 4BRUA 2Q2OA 4ZQEA 3C87A 1HMYA 4JLAA 2Z56A 3QEJA 1JL3A 1WUIS 3CLSD 5CH5A 4ARUA 3AI1A 2VBGA 1E3MA 1EFPB 2P2LA 2Q3MA 4MRVA 1QE0A 4ND7A 2YJZA 2CZGA 1L6RA 4CF4A 3DHWC 2ZOSA 4RCZA 1P1JA 2G4CA 3S2GA 5TEVA 5DM1A 3I32A 4IDQA 1K7XB 4G89A 3OC0A 1G7RA 4L4UA 2NU8B 4LRTB 3LYLA 4FVTA 4XYBA 5A7HA 4OIFA 1MQSA 1XLUA 4IH9A 1I0IA 3R7AA 1NBAA 1RBZA 3BGIA 3UB4A 4RTNA 1DWPA 4H08A 4FDAA 1TJNA 2QPAA 4Q4DA 1NM5C 2ACKA 4M89A 1W4BA 4JP2A 5FLKA 1ZHOA 1Q0ZA 2M6RA 5BVHB 1EH5A 4OL9A 3GNLA 1I13A 3MHPA 1JXQA 1U0JA 2PX8A 3F3MA 4LCBA 3FWKA 3MUNA 4CTMA 1KR2A 5ALVA 1JDZA 2B4RO 1FSSA 4OUDA 3DTTA 4Q1DA 1XI2A 4RD0A 2EL7A 2ZUEA 2VAXA 4PO3X 1G16A 1E2IA 2N1MA 3OTWA 4RLSA 3CB2A 1M8GA 3UUWA 1HT1E 1WXQA 1WQ4A 3PVSA 1EXMA 1L5ZA 2GTIA 4KQ1A 4Y98A 2IYEA 4AJPA 5I4KA 2H3EA 2HIAA 2WKPA 2X8WA 1I5OA 4RXUA 5GM1A 3RT1A 1FB5A 1P81A 4DREA 1MO3A 3T95A 4JZKA 2PUHA 3NWEA 1U28C 3KKQA 5D1HA 3JXEA 3VJKA 3URMA 4X20A 2X0KA 4II2A 1VE5A 4FN4A 3T7DA 1NMSA 3P2JA 4HRXA 4NF2A 3LK7A 1N2EA 1XZNA 1WPRA 1Z83A 6ADHA 5ALSA 3G89A 4WK0B 2GASA 5F7OA 1T4CB 3G9XA 1PDVA 2WSMA 4QTXA 4Y8VA 3IERA 1XU7A 2E21A 2EJTA 3SJAA 4EB6B 1IBMB 4OX9B 2XODA 4V3BA 2BZGA 3WLMA 3EF0A 1RYNA 4UAGA 5ALMA 4CL3A 3DNMA 4D6XA 3QY0A 4X3OA 3WOVA 5DHFA 3GLQA 3K6SA 3AEZA 4H6WA 1VG9B 3V4SA 3QQ5A 1S8NA 2PWAA 3FPFA 4ESOA 5K0JA 1DJOA 4D44A 1UK7A 1DJPA 2HUNA 4CM4B 4DZZA 4L6AA 1JFFB 3GC6A 1Y81A 2VUUA 5H0IA 2NO1A 2YZGA 3AF3A 3ZE9A 4BP8A 1N0HA 3WQRA 2ZBQA 1IBCA 4PLYA 3KCQA 2HPAA 4PS1A 5FQNA 3L4JA 1ISIA 2CXOA 2C04A 1G9SA 1TOAA 3QXSA 4JAVC 1FNBA 4TQAA 4BNKA 3RU7A 1ZICA 2YINC 3H75A 3VDNB 3C4QA 4AJ4A 2JLZA 2NZ8A 2OB1A 1UPTA 3X1DA 2BBSA 4DYHA 1RCTE 4WN3A 2QMOA 1XXLA 2I2CA 3KUKA 3I52A 1D3AA 1IHYA 1EFTA 4E2WA 4DVJA 2RIRA 4TMXA 2BFAA 4NCIA 4UASA 3BICA 3O1LA 5FOWA 4CU2A 5IS2A 1Z47A 4QC2A 4DM3A 2IEBA 3T35A 4PFKA 1QFZA 4JN6B 4S0XA 1Q0LA 1JJ7A 2GZ1A 2CLLB 3FCSB 3JVIA 5AVJA 4AMGA 1UKZA 3EZ7A 4BAZA 2BEUA 4FNGA 1U0NA 4JZYA 3VYUB 1DIOB 1U5CA 4QGHA 5LR6A 4A5SA 2PH7A 3JV7A 5JVDB 1XQVA 3BQ9A 3VR5D 3UJAA 3FHJA 3G6KA 2NG1A 2ZREA 3K6JA 5DNAA 2XXBA 1HYEA 3TLAA 3LO8A 3Q9NA 4R1MA 2PH3A 4QPZA 4RACA 4V39A 2H1OA 5EQFA 5GINE 4PN3A 3CE6A 3CUUA 1Z08A 1YL6A 2PCLA 1G4AE 2WWHA 4YFYA 5GGXA 2ZB8A 4GDFA 2V9CA 4JJ6A 2FRDC 4IGAA 4RNCA 3N7AA 4O2AB 3R7WB 1E2GA 2F3RA 2O4CA 2VJYA 3HCCA 3JQPA 3K35A 2K87A 1G8JA 4GC5A 4YRPA 1EESA 3G68A 3SQLA 4QTZA 2NNLD 1RCUA 1FFWA 1Q3KA 1L4NA 2XYQA 4KI0A 3D0OA 4N3BA 1E6CA 4R9SA 2W4IA 5CVEA 3RS4A 5B55A 5JBNA 3B6JA 3OZRA 4O08A 4ZT7A 1RI1A 5C8XA 4WOKA 2P3OA 4O4HB 3HJTA 3L7CA 2LTAA 3KUUA 1DKPA 1YJBA 1HLDA 5UKDA 1SXHA 2CXXA 3RS9A 2R0QC 5FIUA 4F5WA 3L01A 3Q7TA 4HK4A 2HDHA 2BGIA 1RXSA 2WJJA 2WV7A 2LZ0A 3PRKE 5F77A 3G5MA 1DKRA 4KE6A 1FUUA 4QYIB 3S3TA 3UHFA 1ABBA 2COEA 1P18A 2NYUA 3HFSA 2XRZA 2X5NA 2PQ2A 2ZRPA 3TPFA 4M0MA 4BGEA 4EF4A 3NM6B 4EVSA 4LUCA 1TF7A 2WTBA 1RYYA 4XCXA 1GQQA 2P4UA 3CZPA 5BSRA 2XTJA 4BBPA 4YUWA 4B3RB 1B3RA 2QSZA 1T0HB 2GTHA 3WYNA 1PR6A 1BYIA 4RM2A 2GRUA 4PLWA 2BHTA 5CNJA 4F4IA 1JNXX 3AF2A 1LTKA 1T13A 1TK3A 3M6AA 1MT3A 1VYVA 2DTEA 2XYHA 5AHRA 3KE9A 2Z58A 4CKZA 5D3MA 4DM7A 4OB7A 2BCJQ 3AEUB 1WXGA 3I9V6 3I9MA 2PD4A 1NQTA 5BV8A 5HM6A 4II7A 2FSSA 1ID1A 5MGBA 4KQEA 1NUQA 4HGZA 2WKQA 4Z7NB 3QOFA 2BGRA 2Z1MA 2Q46A 3CFYA 4D3FA 2HSWA 2NUPA 1P1BA 5E4FA 1MJFA 2B36A 5A3QA 5JQGF 5B5SA 3ZVKA 1ZH4A 3QOWA 3ZY5A 3JWJA 1ULUA 3HN2A 1JG1A 4YDHB 3QKIA 3OQHA 4BTLA 4EHDA 4LWQA 2YJGA 4HH0A 1D9ZA 4Y6GB 3H1FA 2FFHA 2VSYA 2C7OA 3P8ZA 2C2XA 2VHQA 2W8BB 2X9GA 2H1RA 4G5RA