1MB8A

Crystal structure of the actin binding domain of plectin
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
243
structure length
243
Chain Sequence
SHMAVIRIADERDRVQKKTFTKWVNKHLIKHWRAEAQRHISDLYEDLRDGHNLISLLEVLSGDSLPREKGRMRFHKLQNVQIALDYLRHRQVKLVNIRNDDIADGNPKLTLGLIWTIILHFQISDIQVSGQSEDMTAKEKLLLWSQRMVEGYQGLRCDNFTSSWRDGRLFNAIIHRHKPLLIDMNKVYRQTNLENLDQAFSVAERDLGVTRLLDPEDVDVPQPDEKSIITYVSSLYDAMPRVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Plectin
publication title Structural and Functional Analysis of the Actin Binding Domain of Plectin Suggests Alternative Mechanisms for Binding to F-Actin and Integrin Beta4
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 92
structure length 243
sequence length 243
ec nomenclature
pdb deposition date 2002-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00307 CH Calponin homology (CH) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.418.10 Mainly Alpha Orthogonal Bundle Actin-binding Protein, T-fimbrin; domain 1 Calponin-like domain 1mb8A02
1.10.418.10 Mainly Alpha Orthogonal Bundle Actin-binding Protein, T-fimbrin; domain 1 Calponin-like domain 1mb8A01
2EYNA 1BHDA 3JAKM 4TXIA 1WYRA 2D85A 3KMWB 2WA5A 5A38A 3REPB 3JALM 1WYPA 2R8UA 2WA7A 2D86A 5J8EA 1V5KA 5L0OA 4EDMA 2YRNA 3F7PA 1WIXA 1PXYA 3KY9A 1RT8A 3FERA 1P5SA 1VKAA 5A36A 2L3GA 1P2XA 4TXKA 1PA7A 1MB8A 2D88A 4Q57B 1DXXA 2E9KA 4B7LA 3HOCA 2WA6A 4EDNA 3JARM 1WYLA 1H67A 1AOAA 1WYNA 2QJZA 1SH5A 2VZDA 1WJOA 1SH6A 5A37A 2K3SA 1UJOA 1WYMA 2VZCA 2RR8A 5BVRA 2VZIB 2EE7A 3I6XA 2R0OA 3HOPA 1QAGA 4Q59A 1WKUA 2DK9A 2WFNA 2JV9A 3KMUB 1UEGA 5A4BA 4Q58A 3HORA 4EDLA 1WYOA 2D89A 3CO1A 2D87A 1AA2A 2EYIA 1BKRA 2VZGB 1TJTA 2K2RA 1WYQA 2QJXA
chains in the Genus database with same CATH superfamily
2EYNA 4LVRA 1BHDA 3JAKM 4TXIA 1WYRA 2D85A 3KMWB 2WA5A 5A38A 3REPB 3JALM 1WYPA 2R8UA 2WA7A 2D86A 5J8EA 1V5KA 5L0OA 4EDMA 2YRNA 3F7PA 1WIXA 1PXYA 3KY9A 3FERA 1RT8A 1P5SA 1VKAA 5A36A 2L3GA 1P2XA 4TXKA 1PA7A 3VP7A 1MB8A 2D88A 4Q57B 1DXXA 2E9KA 2EQOA 1EUVA 4B7LA 3HOCA 2WA6A 4EDNA 3JARM 1WYLA 1H67A 1AOAA 1WYNA 5FMTA 2QJZA 1SH5A 2VZDA 1WJOA 1SH6A 5A37A 2K3SA 2VE7C 1UJOA 2WE6A 1WYMA 2VZCA 2HL8A 2RR8A 4DDPA 5BVRA 2VZIB 2EE7A 3I6XA 2R0OA 2VE7A 3HOPA 1QAGA 4Q59A 1WKUA 2DK9A 2WFNA 4LVPA 2HL9A 2JV9A 3KMUB 3EAYA 1UEGA 5A4BA 4Q58A 3HORA 4EDLA 1WYOA 2D89A 3CO1A 2D87A 1AA2A 2EYIA 1BKRA 5FMUA 2IGPA 2VZGB 2HKPA 2WDTA 1TJTA 2K2RA 1WYQA 2QJXA
chains in the Genus database with same CATH topology
2EYNA 1BHDA 3JAKM 4TXIA 1WYRA 2D85A 3KMWB 2WA5A 5A38A 3REPB 3JALM 1WYPA 2R8UA 2WA7A 2D86A 5J8EA 1V5KA 5L0OA 4EDMA 2YRNA 3F7PA 1WIXA 1PXYA 3KY9A 1RT8A 3FERA 1P5SA 1VKAA 5A36A 2L3GA 1P2XA 4TXKA 1PA7A 1MB8A 2D88A 4Q57B 1DXXA 2E9KA 4B7LA 3HOCA 2WA6A 4EDNA 3JARM 1WYLA 1H67A 1AOAA 1WYNA 2QJZA 1SH5A 2VZDA 1WJOA 1SH6A 5A37A 2K3SA 1UJOA 1WYMA 2VZCA 2RR8A 5BVRA 2VZIB 2EE7A 3I6XA 2R0OA 3HOPA 1QAGA 4Q59A 1WKUA 2DK9A 2WFNA 2JV9A 3KMUB 1UEGA 5A4BA 4Q58A 3HORA 4EDLA 1WYOA 2D89A 3CO1A 2D87A 1AA2A 2EYIA 1BKRA 2VZGB 1TJTA 2K2RA 1WYQA 2QJXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EYN A;  1BHD A;  3JAK M;  4TXI A;  1WYR A;  2D85 A;  3KMW B;  2WA5 A;  5A38 A;  3REP B;  3JAL M;  1WYP A;  2R8U A;  2WA7 A;  2D86 A;  5J8E A;  1V5K A;  5L0O A;  4EDM A;  2YRN A;  3F7P A;  1WIX A;  1PXY A;  3KY9 A;  1RT8 A;  3FER A;  1P5S A;  1VKA A;  5A36 A;  2L3G A;  1P2X A;  4TXK A;  1PA7 A;  1MB8 A;  2D88 A;  4Q57 B;  1DXX A;  2E9K A;  4B7L A;  3HOC A;  2WA6 A;  4EDN A;  3JAR M;  1WYL A;  1H67 A;  1AOA A;  1WYN A;  2QJZ A;  1SH5 A;  2VZD A;  1WJO A;  1SH6 A;  5A37 A;  2K3S A;  1UJO A;  1WYM A;  2VZC A;  2RR8 A;  5BVR A;  2VZI B;  2EE7 A;  3I6X A;  2R0O A;  3HOP A;  1QAG A;  4Q59 A;  1WKU A;  2DK9 A;  2WFN A;  2JV9 A;  3KMU B;  1UEG A;  5A4B A;  4Q58 A;  3HOR A;  4EDL A;  1WYO A;  2D89 A;  3CO1 A;  2D87 A;  1AA2 A;  2EYI A;  1BKR A;  2VZG B;  1TJT A;  2K2R A;  1WYQ A;  2QJX A; 
#chains in the Genus database with same CATH topology
 2EYN A;  4LVR A;  1BHD A;  3JAK M;  4TXI A;  1WYR A;  2D85 A;  3KMW B;  2WA5 A;  5A38 A;  3REP B;  3JAL M;  1WYP A;  2R8U A;  2WA7 A;  2D86 A;  5J8E A;  1V5K A;  5L0O A;  4EDM A;  2YRN A;  3F7P A;  1WIX A;  1PXY A;  3KY9 A;  3FER A;  1RT8 A;  1P5S A;  1VKA A;  5A36 A;  2L3G A;  1P2X A;  4TXK A;  1PA7 A;  3VP7 A;  1MB8 A;  2D88 A;  4Q57 B;  1DXX A;  2E9K A;  2EQO A;  1EUV A;  4B7L A;  3HOC A;  2WA6 A;  4EDN A;  3JAR M;  1WYL A;  1H67 A;  1AOA A;  1WYN A;  5FMT A;  2QJZ A;  1SH5 A;  2VZD A;  1WJO A;  1SH6 A;  5A37 A;  2K3S A;  2VE7 C;  1UJO A;  2WE6 A;  1WYM A;  2VZC A;  2HL8 A;  2RR8 A;  4DDP A;  5BVR A;  2VZI B;  2EE7 A;  3I6X A;  2R0O A;  2VE7 A;  3HOP A;  1QAG A;  4Q59 A;  1WKU A;  2DK9 A;  2WFN A;  4LVP A;  2HL9 A;  2JV9 A;  3KMU B;  3EAY A;  1UEG A;  5A4B A;  4Q58 A;  3HOR A;  4EDL A;  1WYO A;  2D89 A;  3CO1 A;  2D87 A;  1AA2 A;  2EYI A;  1BKR A;  5FMU A;  2IGP A;  2VZG B;  2HKP A;  2WDT A;  1TJT A;  2K2R A;  1WYQ A;  2QJX A; 
#chains in the Genus database with same CATH homology
 2EYN A;  1BHD A;  3JAK M;  4TXI A;  1WYR A;  2D85 A;  3KMW B;  2WA5 A;  5A38 A;  3REP B;  3JAL M;  1WYP A;  2R8U A;  2WA7 A;  2D86 A;  5J8E A;  1V5K A;  5L0O A;  4EDM A;  2YRN A;  3F7P A;  1WIX A;  1PXY A;  3KY9 A;  1RT8 A;  3FER A;  1P5S A;  1VKA A;  5A36 A;  2L3G A;  1P2X A;  4TXK A;  1PA7 A;  1MB8 A;  2D88 A;  4Q57 B;  1DXX A;  2E9K A;  4B7L A;  3HOC A;  2WA6 A;  4EDN A;  3JAR M;  1WYL A;  1H67 A;  1AOA A;  1WYN A;  2QJZ A;  1SH5 A;  2VZD A;  1WJO A;  1SH6 A;  5A37 A;  2K3S A;  1UJO A;  1WYM A;  2VZC A;  2RR8 A;  5BVR A;  2VZI B;  2EE7 A;  3I6X A;  2R0O A;  3HOP A;  1QAG A;  4Q59 A;  1WKU A;  2DK9 A;  2WFN A;  2JV9 A;  3KMU B;  1UEG A;  5A4B A;  4Q58 A;  3HOR A;  4EDL A;  1WYO A;  2D89 A;  3CO1 A;  2D87 A;  1AA2 A;  2EYI A;  1BKR A;  2VZG B;  1TJT A;  2K2R A;  1WYQ A;  2QJX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...