1MBLA

A catalytically-impaired class a beta-lactamase: 2 angstroms crystal structure and kinetics of the bacillus licheniformis e166a mutant
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
256
structure length
256
Chain Sequence
DDFAKLEEQFDAKLGIFALDTGTNRTVAYRPDERFAFASTIKALTVGVLLQQKSIEDLNQRITYTRDDLVNYNPITEKHVDTGMTLKELADASLRYSDNAAQNLILKQIGGPESLKKELRKIGDEVTNPERFAPELNEVNPGETQDTSTARALVTSLRAFALEDKLPSEKRELLIDWMKRNTTGDALIRAGVPDGWEVADKTGAASYGTRNDIAIIWPPKGDPVVLAVLSSRDKKDAKYDDKLIAEATKVVMKALN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-LACTAMASE
publication title A catalytically-impaired class A beta-lactamase: 2 A crystal structure and kinetics of the Bacillus licheniformis E166A mutant.
pubmed doi rcsb
source organism Bacillus licheniformis
molecule tags Hydrolase
total genus 88
structure length 256
sequence length 256
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 1992-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1mblA00
2ZMAA 5FSRA 3LY3A 2EFUA 3BECA 3MZDA 1KDWA 2R9WA 3AGEA 1HZOA 1TDGA 4IVKA 4ZJ3A 3I7JA 3UE0A 3A3IA 4R0QA 3HL9A 2P74A 2Y2HA 2ZJ9A 3G32A 2Y2GA 4OPRA 4X6TA 5TR7A 2DNSA 2G2WA 4NETA 2JC7A 3O87A 4IVIA 4UA6A 1MWUA 3IF6A 3OCLA 2ZC4B 3GTCA 5FQ9A 3RXXA 3BEBA 1HVBA 2P9VB 4YFMA 3VOZA 1YLPA 2HP5A 1KGGA 4KG6A 2V1ZA 1K4EA 3NY4A 5FAOA 1HD8A 5JYOA 4JLFA 1PWDA 4R4RA 4X56A 3IHBA 1Z6FA 3UO9A 5KSHA 3D4FA 3SH9A 3VOYA 4ID4A 3VP4A 2ZD8A 5FAQA 2XFTA 3V50A 5I94A 4DE2A 1NJ4A 4JKTA 1OMEA 4DE3A 1FR6A 3Q7ZA 1ALQA 1KE0A 5EVIA 4KQQA 2EX2A 3VP3A 3NI9A 4WEJA 1FCNA 5DF7A 4K0WA 4QHCA 4KZ6A 1K6RA 4FH4A 4X68A 3ITBA 4GOGA 3C5AA 1FCMA 1W7FA 2XQZA 5F1GA 4JF6A 1LL9A 2WKIA 3WS4A 4DRTA 1S0WA 2WUQA 1EI5A 2WAFA 3N6IA 4JPMA 1K54C 1DY6A 4PM6A 2E8IA 4LV3A 1IELA 1W8QA 2V2FF 3E2KA 2OLVA 3UE3A 5KSCA 5BOHA 3S22A 3ZFZA 3M6BA 4FCFA 1JTGA 1PI4A 5CRFA 1XA1A 1FR1A 4JBFA 3VMAA 4JF5A 4EWFA 3DWZA 1LL5A 3W4PA 4E3JA 1JWVA 4FH2A 5EOEA 4GNUA 2J9PA 5FDHA 4S2KA 1MWSA 5GLCA 3W8KA 4ZDXA 3P09A 3ZDJA 4S2LA 3ZG8B 3BM6A 1S6RA 1TDLA 2Y4AA 1NYYA 2ZQDA 4PPRA 4JXVA 4UA7A 5E43A 4EBLA 4B88A 2EX6A 3HLEA 3NIAA 5HAQA 3G30A 4JXSA 4CPKA 2ZC5B 1JTDA 1JVJA 3ZG7B 2EX9A 1JWZA 1ES4A 1PW1A 4KZ9A 4EV4A 1L2SA 1IKGA 5GLDA 1U60A 3VFHA 3W4QA 1MXOA 3LY4A 1CI8A 2A49A 3NDEA 3PBSA 5F82A 3P98A 2EX8A 1XXMA 4RYEA 3V5MA 4U3TA 3MZEA 5FQQA 5HFOA 4F94A 1FOFA 1MWRA 3Q7VB 1G6AA 4MBKA 4S2NA 3BFFA 5AQAA 2QMIA 4KQRA 4QJGA 3VP1A 4D2OA 2V20A 4WELA 3V39A 5CTMA 4C3QA 3HVFA 5CEDA 1Q2QA 5CTNA 2PU2A 2RL3A 4E6WA 2HP9A 4Z9QA 3ZGAB 1GHPA 5G18A 3M2KA 3G2ZA 4E3MA 3TSGA 4P0MA 1PI5A 2H5SA 1H5XA 5A92A 2Y2QA 4GN2A 4X53A 1ESIA 2HP6A 4UAAA 1ZG6A 3RJUA 4WMCA 5KZHA 5IHVA 3BRMA 4BENA 3HLFA 1LLBA 1AXBA 2EFXA 3HLDA 2PBYA 1K6SA 2Q9NA 2C5WB 4LV2A 2QPNA 4KENB 4OP8A 4S2JA 3SOIA 3VFFA 3ZVWA 4PMAA 5CHJA 3FZCA 3G4PA 3C7UA 3QNBA 3HUMA 3GVBA 3HBRA 3RXWA 1IYSA 2WZZA 1GHMA 4MNRA 4LV0A 3SS5A 1GA0A 1L0FA 2OSUA 3EQVA 4KQOA 1WYBA 2H10A 3ITAA 3PBRA 2Y2NA 4IEDA 2XEPA 3SH8A 1ERQA 4OH0A 5DTSA 3NC8A 4JXWA 4R3BA 5U47A 2XDMA 1XP4A 4E3LA 3QHYA 5FQJA 4OPQA 4R4SA 5TGFA 3WS1A 1DJAA 4OQGA 3S1YA 2WAEA 3AGDA 1FSYA 5CGSA 1K54A 4X55A 5DF8A 2HDSA 5A90A 3IF6B 3CZDA 4S2PA 1I2SA 3BFEA 2UWXA 4OP5A 1XPBA 3CG5A 4PM7A 2ZM8A 2Y2IA 4BJPA 1ES5A 4R23A 2WGVA 3OC2A 4HBUA 4KZ4A 1IYQA 2P9VA 3M2JA 2WGIA 5DVAA 2XH9A 2XD5A 5FI6A 1N4OA 3CJMA 2XK1A 2Y2LA 5CECA 1O7EA 3MZFA 4QY5A 1SHVA 4C75A 4E6XA 4JF4A 3GV9A 1SDNA 2WKEA 5EVID 3GSGA 2BG1A 3CMZA 1IYOA 5E2EA 3N4IA 5FQIA 1I2WA 1GA9A 1NZUA 2ZQ7A 4XUZA 3UY6A 5HAPA 1ZG4A 5E2FA 5EVIB 1YMXA 4E3NA 1TEMA 5EUAA 3C4PA 2WK0A 4E3OA 1GCEA 2X02A 3IWIA 3M6HA 3ZVTA 4UHUA 2Y2PA 5M19A 3FV7A 3UPPA 1CEGA 2XD1A 5EPHA 2WKHA 3IH8A 3OPLA 4HBTA 4RVAA 1K55A 4R1GA 2ZM2A 3IF5A 4N9LA 5CGXA 3ZG5A 1K57C 3IXBA 1ONGA 3Q82A 2DCFA 4OQHA 1YLYA 4PM8A 1NXYA 3IXDA 5GL9A 4KZ8A 1M6KA 3G34A 2Y55A 3IWOA 2J8YA 3AGFA 1Q2PA 2XLNA 3PBOA 3GR2A 4OONA 3UPNA 2QZ6A 3ISGA 5EOOA 2ZC3B 1H8ZA 4N1HA 4LCLA 4WM9A 4Y7PA 2Y2KA 3NDGA 4OOMA 4ZJ1A 3A3JA 4GB7A 5JYPA 2X71A 4P87A 4R3JA 2WZXA 3MFDA 1ES3A 1Y54A 4OLGA 3BLSA 4ZBEA 4ZJ2A 1BTLA 2R9XA 1SCWA 5GHZA 3ZCZA 2VGKA 3C4OA 2FFYA 1ESUA 1M40A 3NBLA 4KZ3A 1ERMA 1BUEA 4BL3A 5M1AA 4QY6A 4GDBA 1DJBA 3VP2A 1JWPA 4H8RA 4RX3A 4WZ5A 5HX9A 1KDSA 1YMSA 3HUNA 3G2YA 4OOYA 2H0TA 4Y0UA 5D3OA 1NY0A 4GD8A 5A93A 1K56A 1NRFA 4E3KA 3OPHA 4WZ4A 5AQ7A 3HREA 4QB8A 1K56D 1FQGA 1BLCA 2EXBA 2IWDA 4BD1A 3WRZA 3MXSA 4FSFA 4WBGA 1MBLA 3HLCA 4DXBA 1L0DA 1YLTA 2Y2MA 4IBXA 3GQZA 1G68A 3HLWA 1MWTA 4KZ5A 3WS5A 4EBPA 4Q8IA 1K38A 3SH7A 1O07A 1YT4A 2OLUA 3PAEA 2Z2LB 3TG9A 5CEBA 3JYIA 1BLPA 4GDNA 2WADA 2J7VA 1H8YA 3N8LA 4WMCD 4MLLA 1KVMA 3MKEA 5GLBA 4DE0A 1XKZA 4BL2A 4OQIA 5L2FA 1PW8A 1YM1A 5AQBA 5EVLA 4U0TA 4WYYA 4M3KA 3FYZA 2X01A 2WGWA 3SS3A 1BLSA 3PTEA 2IWCA 2Q9MA 1QMFA 5FA7A 3UDFA 4IBRA 1E3UA 1YLZA 4HEFA 5FATA 1PWCA 3PBQA 1PZPA 4N1XA 1BT5A 1E3UD 1CI9A 1SDEA 2DRWA 4X69A 4XUXA 1N9BA 2BLSA 1WYCA 4K0XA 4L0LA 4KZBA 3O86A 4Y0OA 5FI2A 4BD0A 2ZQ9A 1LI9A 3G35A 3IQAA 4MBFA 5CHMA 3BFGA 4ZAMA 1CEFA 2JBFA 4KG5A 4OVDA 3Q07A 3UN7A 4EQIA 4WEKA 4DE1A 4P85A 1MKIA 2ZM0A 3O88A 1PZOA 4HESA 4DDSA 1FSWA 3A3DA 4N92A 3WRTA 1BSGA 4LV1A 4GZBA 4RA7A 1K57A 2XFSA 2Y2OA 5HARA 1VQQA 4JXGA 3HLBA 2JCHA 4CJNA 3LO7A 3VP0A 4S2IA 4DF6A 4EBNA 1RP5A 4S2OA 3NCKA 3FWLA 1I5QA 3DTMA 1LI0A 3OPPA 5FQKA 2VGJA 4O7DA 4U0XA 3UDIA 1WE4A 1MPLA 4ZTKA 1ZC2A 3MKFA 4KG2A 1ONHA 2ZQAA 2GDNA 3BYDA 5F83A 3VSLA 1BLHA 3GMWA 2J9OA 1SKFA 3IXGA 5KMWA 3UDXA 3ZNYA 3LCEA 4FD8A 1CK3A 4LENA 5A91A 4B4ZA 2XGNA 5CHUA 1QMEA 1TVFA 1KGFA 3SS4A 2ZQ8A 4QD4A 2XF3A 1E25A 4QU3A 4BLMA 4BQMA 3DW0A 4B4XA 1MY8A 3BLMA 1E4DA 2JE5A 3OZHA 4EUZA 2B5RA 3BFDA 1KGEA 1W5DA 1FCOA 4OPYA 1IEMA 3C7VA 3IF6C 3FKWA 3IT9A 3GRJA 3HUOA 4A5RA 5E2GA 1KE4A 3N8RA 3IH9A 3OPRA 5DTKA 2HDRA 3ZHHA 3PBTA 2ZQCA 1LHYA 3IXHA 4PM9A 5DTTA 1ZKJA 1DJCA 5CXWA 1YQSA 2A3UA 1EROA 1L0EA 1NYMA 3G31A 5GHYA 5GHXA 3DWKA 1J9MA 3EQUA 2PU4A 3ZNTA 1L0GA 5FQMA 4DDYA 3PAGA 5HW3A 2XR0A 2ZC6B 5FAPA 1XGJA 2EXAA 3N8SA 5EVIC 5CGWA 1IYPA 2HDUA 5E2HA 3S4XA 1HTZA 1KE3A 5DF9A 1XA7A 4DKIA 5EE8A 2ZLYA 3N7WA 4MEZA 3V3SA 1ES2A 1PWGA 4Y0TA 3WS2A 1NZOA 1XGIA 3MBZA 3UPOA 3Q7VA 3IWQA 4OQ0A 4XXRA 4C6YA 2ZC7A 1K4FA 4OLDA 3W4OA 2OV5A 5F1FA 2I72A 1RCJA 1K55C 2H0YA 2HDQA 3PBNA 1VM1A 4NK3A 1RGYA 5AQ9A 4DXCA 5FI7A 1RGZA 3ZG9B 3A3FA 1C3BA 4OKPA 3O3VA 3E2LA 3UE1A 1GHIA 1K25A 4YINA 1XX2A 3WS0A 4MBHA 3Q1FA 5TFQA 2IWBA 1YLJA 5HL1A 3ZG0A 4LCMA 5J8XA 2Z2MB 4OPZA 3BFCA 3QNCA 1PIOA 2C6WB 3B3XA 4UA9A 1W8YA 3A3EA 1IKIA 4P6BA 5FASA 1PYYA 4KZAA 1KVLA 4N9KA 3MXRA 4K91A 2WYXA 3HLGA 4RX2A 2RCXA 4KZ7A 3UNWA 1BZAA 3FKVA 5EECA 5GLAA 2CC1A 2WGWB 4WZ5C 3LEZA 3IHAA 2HPBA 1BULA 4GKUA 2Y59A 3TOIA 2Y2JA 2FFFB 5CERA 3VSKA 4S2MA 4S2NC 1YLWA 4GD6A 5HAIA 4PM5A 2Y91A 4OOLA 1W79A 1EWZA 3Q81A 4E3IA 5M18A 3OCNA 3WWXA 2G2UA 3V3RA
chains in the Genus database with same CATH superfamily
4EXOA 3LY3A 4IVKA 4X25A 1TS8A 3A3IA 3HL9A 2P74A 2Y2HA 1OTDA 4EU0A 5FQ9A 3GTCA 3VOZA 3T50A 1YLPA 1S66L 3MSHA 3LR0A 1KGGA 2V1ZA 4BBVA 5DKLA 5FAOA 4I3IA 1TS0A 1V9ZA 2YKHA 1F5MA 2L4RA 3VP4A 5I94A 3UB8A 2XFTA 3MXQA 4I39A 4EESA 4NKPA 4JKTA 3EEHA 1ALQA 4KQQA 3NI9A 5DF7A 3GDIA 4Y5FA 4FH4A 4P6ZM 4B9OA 2A24A 3C5AA 1YSPA 1DP9A 1S0WA 2J80A 1EI5A 2WAFA 2V2FF 3E2KA 3S22A 2QJ5A 1XA1A 3DWZA 4LRZE 4FH2A 4GNUA 5GLCA 3W8KA 4ARZA 2Y4AA 2ZQDA 4UA7A 4EBLA 4JXSA 4KZ9A 1L2SA 4XT2B 2LB5A 2A49A 1EW0A 2EX8A 3MZEA 2O9BA 4F94A 1FOFA 1MWRA 3CAXA 2I9VA 3KSIA 1Q2QA 2RL3A 2K2NA 2WKRA 5G18A 1NRJA 4E3MA 1PI5A 4GN2A 4X53A 2VA0A 1ESIA 5DFYA 2HP6A 5KZHA 5IHVA 1XJ6A 3BRMA 3LICA 3HLDA 2PBYA 4LV2A 2C5WB 2QPNA 3U2AA 5CHJA 2XSSA 3G4PA 4G3KA 3CPTB 4I3JA 3GVBA 2PAVP 2WKQA 1GA0A 3E4OA 2OSUA 3EQVA 4KQOA 3T4SA 3NC8A 1PRQA 4R3BA 4LRXC 3C8CA 3QHYA 4OPQA 3BY9A 1LSVA 3S1YA 4WLAA 3AGDA 5CGSA 5F68A 1K54A 2J3TC 5DF8A 1FILA 3IF6B 3CZDA 1ES5A 2WGVA 4KZ4A 3M2JA 4FOFA 5FI6A 4DJ2A 4C75A 4JF4A 1SDNA 2WKEA 2BG1A 5E2EA 1NZUA 4CQHA 2ZQ7A 4X1MA 5A8BA 2W27A 5K5BA 2Y2PA 5M19A 2XD1A 3IH8A 1K55A 1K57C 3LYXA 1YLYA 4Z1WA 1G5UA 3VE3A 4ZRRA 1VETB 4WF0A 5EOOA 1H8ZA 4N1HA 1OJGA 1DP8A 4OOMA 1TF1A 1BTLA 2R9XA 1S4SA 4YOFA 5M1AA 1JWPA 4WZ5A 3B42A 1YMSA 4FTXA 3QP1A 3G2YA 5DKKA 1NY0A 3H82B 1BLCA 3IBRA 4BD1A 5AVFA 4WBGA 2PBDP 2W1TA 3CUEA 2Y2MA 3EOIA 1G68A 2HJEA 1MWTA 3WS5A 3R4KA 4EBPA 4Q8IA 2PDRA 4PHTA 3TE8A 4GW9A 2WADA 4WMCD 5GLBA 3MS6A 4BL2A 5L2FA 4HP4A 3T1RA 5EVLA 4F3LA 4U0TA 3LIFA 4JGOA 4M3KA 4WL9A 3PTEA 2IWCA 5FA7A 2INWA 1E3UA 1PWCA 4N1XA 1BT5A 1E3UD 1CI9A 4DJ3A 3T4TA 4KZBA 2W3EA 2ZQ9A 1LI9A 3G35A 3IQAA 5CHMA 3BFGA 3DAVA 2JBFA 4WEKA 2CMNA 4Q0JA 1MKIA 2V8CA 2K7SA 2G7UA 4LV1A 4YWZA 5HARA 3IX8A 4UQIS 3IBJA 2PD8A 2VGJA 1WE4A 1ONHA 3VSLA 1XJ3A 3LCEA 4B4ZA 1CK3A 5CHUA 1QMEA 1TVFA 1KGFA 2XF3A 3LUQA 4BQMA 4EETB 1Y4OA 2JE5A 2B5RA 1FCOA 4OPYA 3FKWA 1W63Q 2D01A 3IT9A 4GHIA 2HDRA 1LHYA 5CXWA 1DJCA 3W2ZA 2OAP1 1J9MA 3S7QA 3EQUA 2VX8A 3ZNTA 5AVEA 3BJNA 5FAPA 3F1OB 5EVIC 3RFBA 4BBUA 1TD5A 4MEZA 3V3SA 3NULA 4HIAA 3MBZA 4C6YA 1N9NA 1SZVA 5AQ9A 4KUKA 3H7WB 4II7A 3ZG9B 1RGZA 3A3FA 4OKPA 4PKYG 3UE1A 2V0UA 2K31A 2W3DA 5IS1A 4YINA 5HL1A 1AWIA 3QP8A 3B3XA 1KVLA 3MXRA 4IJGA 4RX2A 3K2NA 2CC1A 1OTBA 3IHAA 2HPBA 5CERA 4GD6A 4K08A 4R6LA 4OOLA 1EWZA 3Q81A 4E3IA 5M18A 1W63M 4L9GA 4LPZA 1DP6A 3V3RA 5EFWA 5FSRA 2EFUA 1H3QA 1KDWA 3I7JA 2EA9A 5C5KA 4R0QA 4O0PA 3HJKA 3G32A 4X6TA 2DNSA 5HSQA 2R78A 1X0OA 2ZC4B 1G6OA 2ZOIA 2P9VB 4KG6A 5HD3A 4X56A 3IHBA 1NLZA 1Z6FA 5KSHA 3D4FA 3SH9A 3DTIA 1OMEA 4DE3A 1FR6A 3ZYTA 4E04A 4LRYC 5L07A 3SW1A 1K6RA 3BW6A 1FIKA 3F1PB 1FCMA 2XQZA 1LL9A 2PRFA 5EM1A 1MC0A 5HWTA 3WS4A 2WUQA 3F1NB 2E8IA 1XJ4A 4LV3A 5BOHA 4FCFA 5CRFA 4CLCD 1F2KA 2GX5A 3W4PA 5EOEA 4CLCB 4S2KA 3P09A 3BM6A 2XA7S 1LL8A 5E43A 3ZG7B 4B93A 1IKGA 4GS9A 5GLDA 3LR3A 1CI8A 5F82A 4IHQA 3P98A 1XXMA 2V9AA 3Q7VB 1G6AA 4MBKA 1BYWA 1GSWA 5AQAA 2V20A 3V39A 5CEDA 1CF0A 4Z9QA 1GHPA 3PYPA 2V1AA 3M2KA 4BMWA 4CLCC 1Z09A 3D9YA 4UAAA 5HDCA 4EEPA 1LLBA 1AXBA 2EFXA 3UMDA 2Q9NA 3IS2B 4S2JA 3ZVWA 2ZL1B 3HUMA 3R7WB 1L0FA 2Y2NA 5KIZA 1ERQA 2XDMA 1XP4A 1OPXA 4JGRA 3WS1A 3PXPA 2V8FA 2WAEA 4X55A 1Y28A 3KYZA 4S2PA 2UWXA 4OP5A 4BJPA 4HBUA 1IYQA 2KDKA 1NLYA 1V9YA 4L9FA 4O8GA 3S7NA 3CMZA 1YAXA 5FQIA 1I2WA 4XUZA 4FUWA 5E2FA 1YMXA 1TEMA 1GCEA 2ZMVA 1MKMA 2KLIA 3OBFA 3ZVTA 4UHUA 3FV7A 1CEGA 2A24B 2ZM2A 3ZG5A 3UB9A 1ONGA 4PM8A 1NXYA 1OT9A 4KZ8A 3G34A 2Y55A 3IWOA 3NECA 3GR2A 3U4LP 2Y2KA 3A0SA 4GB7A 2X71A 4P87A 2WZXA 1ES3A 4BWIA 4ZBEA 4ARZB 5HL6A 1M40A 4KZ3A 4BL3A 4EERA 1DJBA 4H8RA 4RX3A 3MF0A 2VK3A 5D3OA 4GD8A 2VV7A 4XT2A 1K56A 1NRFA 3OPHA 3G6OA 5AQ7A 1K56D 4I3AA 3HLCA 1D7EA 4IBXA 3GQZA 2KX6A 3HLWA 1O07A 4H6JB 2OLUA 3JYIA 2PYRA 1BLPA 4GDNA 2Y79A 2J7VA 3MKEA 4OQIA 5L8MA 1YM1A 2L1MA 2FH5A 2Q9MA 1QMFA 4HEFA 4D60A 1N9BA 2BLSA 1WYCA 4K0XA 4L0LA 3CPTA 3O86A 4DN0A 4BD0A 3LIEA 1XFNA 4ZAMA 3UN7A 3Q07A 3O88A 3BWLA 1FSWA 4N92A 4RA7A 1K57A 2XFSA 4BBTA 4CJNA 2JCHA 5TBMA 2O0YA 2BTFP 2VJWA 4NXFA 4EBNA 1RP5A 2P08A 4S2OA 5FQKA 2W1RA 3BY8A 4ZTKA 1SKFA 3CWFA 4MCWA 2ZQ8A 4QD4A 4GCZA 3UB5P 2W3GA 3OZHA 3BFDA 2B95A 3C7VA 3IF6C 4ETXA 1KE4A 3T1QB 3IH9A 3E4QA 3OPRA 2ZQCA 1ZKJA 5HDSA 5GHXA 2XROA 2PU4A 2Q0OA 1ODVA 3VOLA 5EV0A 1T18A 2ZC6B 1XGJA 5CGWA 5E2HA 4DKIA 1XA7A 5EE8A 4UQIM 3N7WA 4MN5A 1T1BA 4Y0TA 3NOPC 2WKPA 3EWKA 3IWQA 4OQ0A 2ZC7A 1K4FA 5J4EA 3W4OA 4MN6A 4PKYA 3H82A 1WA9A 1RCJA 1K55C 1S1ZA 1TS7A 2H0YA 2HDQA 1RGYA 1C3BA 3O3VA 3E2LA 1GHIA 2W1TB 3WS0A 1OTEA 3Q1FA 5TFQA 3RTYA 1YLJA 2JKRM 3FPVA 3IX4A 5J8XA 2Z2MB 4OPZA 3BFCA 2QYBA 1PIOA 2C6WB 3FG8A 4P6BA 3LFVA 5I5LA 5FASA 1PYYA 4KZAA 4K91A 4L9EA 2V1BA 4KZ7A 3UNWA 4F3LB 2ZOHA 4LFUA 2XRNA 4WZ5C 3VV4A 3LEQA 3VSKA 4S2NC 1YLWA 5HAIA 5J3WA 5EVEA 3OCNA 3WWXA 1P9RA 2G2UA 3MQ0A 2ZMAA 4ESPA 1YKDA 3MZDA 4ZJ3A 1HZOA 1TDGA 3UE0A 1XJ2A 3P01A 4OPRA 2Y2GA 2G2WA 4NETA 3RXXA 1OT6A 3EEAA 1UWPX 2HP5A 1K4EA 1HD8A 3T4JA 2VGLM 1DRMA 4JLFA 3VOYA 3FC7A 4ID4A 3V50A 2GNXA 4DE2A 1NJ4A 4EUVA 3Q7ZA 5L10A 1KE0A 5EVIA 2EX2A 3VP3A 4WEJA 4QHCA 4KZ6A 5HWVA 2O99A 3LI8A 4GOGA 1W7FA 3C30A 4EEUA 4DRTA 3N6IA 4PM6A 3T1SA 1DY6A 1IELA 1W8QA 1F98A 2OLVA 5KSCA 2W0NA 3KSGA 4GHIB 3M6BA 1JTGA 2PHYA 2JKFA 3UE6A 1FR1A 4JBFA 3VMAA 4JF5A 4EWFA 2AVXA 1LL5A 1GSXA 1JWVA 5F69A 1MWSA 4ZDXA 3ZDJA 4S2LA 3ZG8B 1TDLA 4PPRA 4B88A 3HLEA 5CX7A 5HAQA 3G30A 4CPKA 2ZC5B 1JTDA 1JVJA 3F1OA 1U60A 1LT0A 3LIBA 5HD5A 4GJ4A 1MXOA 3NDEA 3PBSA 3V5MA 1ACFA 4RYEA 5IT5A 5HFOA 4HH2A 3A0VA 1H8MA 3BFFA 2QMIA 2ZBBA 4KQRA 3BQAA 4QJGA 4WELA 3T1XA 5CTMA 4C3QA 3HVFA 2PU2A 1YPRA 4E6WA 2HP9A 4Q0IA 4I38A 2B18A 3ZGAB 1L3LA 3G2ZA 3TSGA 5A92A 4LLOB 3FPWA 3LIAA 4BENA 3HLFA 1VEUA 3SOIA 2P7JA 2GJ3A 3NOUC 3P7NA 3QNBA 4HJ6A 3HBRA 3RXWA 1IYSA 2WZZA 4MNRA 1CJFA 4LV0A 3JPUA 2B02A 2H10A 3ITAA 4IEDA 2XEPA 4OH0A 5DTSA 4JXWA 5U47A 2HV1A 4EQ1A 1DJAA 3EGXC 1F9IA 4M4XA 1I2SA 3BFEA 3CG5A 4PM7A 2ZM8A 2Y2IA 3NHQA 5HDDA 2P9VA 2WGIA 5DVAA 2XH9A 3B33A 2Y2LA 5CECA 4QY5A 2IA2A 2JKRI 1OJ5A 1IYOA 2JHEA 3N4IA 3UY6A 1GA9A 1S1YA 3MMHA 1ZG4A 4E3NA 5EUAA 3C4PA 2WK0A 1STZA 3K3CA 2X02A 3IWIA 3T4LA 4Y2FA 2WKHA 3OPLA 4HBTA 3IF5A 5CGXA 1CQAA 3IXBA 2EWVA 3Q82A 3IXDA 1P9WA 5G4YA 2M7UA 1M6KA 2ACGA 2J8YA 3AGFA 2XLNA 3KX0X 3LR5A 4OONA 3UPNA 2QZ6A 3ISGA 4EW7A 1ZHHB 4LCLA 2JN7A 4ZJ1A 2VLGA 3DTEA 1N9LA 2PT7A 2A2LA 4R3JA 5JYPA 1Y54A 2E8JA 3ZCZA 3BLSA 1SCWA 4Y17A 2VGKA 1ERMA 1BUEA 5FL3A 3KYQA 3VP2A 3QP2A 1GSVA 5HX9A 1KDSA 4GS9B 2JKGA 4Y0UA 3UB7A 4RQ9A 3HREA 4QB8A 1S67L 2M1CA 1FQGA 5AJGA 1SKOA 3QP5A 2FZ0A 4FSFA 1MBLA 5F5YA 4DXBA 1L0DA 1YLTA 4LGWA 2QJ7A 1K38A 1YT4A 3PAEA 2Z2LB 4G3WA 5CEBA 5DJUA 2Y8HA 3N8LA 4MLLA 4DE0A 1PW8A 3MQQA 2OOLA 4IUKA 2WGWA 1BLSA 1YSQA 3UDFA 5FATA 1PZPA 2NUPC 1SDEA 2OWJA 2DRWA 4X69A 4HY8A 2VZWA 4Y0OA 3B47A 5FI2A 1CEFA 4KG5A 1PZOA 4HESA 3A3DA 2Z6DA 3WRTA 2Y2OA 3HLBA 3VP0A 3MFXA 4NXEA 4NXBA 3NCKA 3FWLA 1I5QA 1LI0A 3ZQ5A 1PNEA 3E0YA 4O7DA 3UDIA 1MPLA 4KG2A 2ZQAA 5F83A 2GDNA 1XFQA 3MR0A 4MN7A 2J9OA 5FDSA 1G28A 3UDXA 4LENA 3E98A 2HJ9C 4BLMA 3LI9A 3S7PA 4EUZA 3JVUA 1W5DA 1IEMA 3DTKA 2QKPA 4JGQA 3GRJA 4A5RA 3N8RA 3ZHHA 4PAUA 2LB9A 3IXHA 4PM9A 5DTTA 2A3UA 1EROA 4UEYA 1L0EA 2KOIA 3G31A 5GHYA 3V67A 2NUTC 4DDYA 3CITA 2EXAA 4ME4A 3N8SA 2HDUA 3LR4A 3S4XA 3ICYA 1ES2A 1PWGA 4HHDA 5DJTA 4HH3A 4NEED 3WS2A 1NZOA 1XGIA 4XXRA 1IFQA 4OLDA 2OV5A 5F6AA 5F1FA 2I72A 3PBNA 1VM1A 2VV6A 4CLCE 5FI7A 3MJQA 3T4KA 1XX2A 2IWBA 4NG2A 1OTIA 1HLUP 3O5YA 4LCMA 5IU1A 3ZG0A 2J3TD 4H6JA 4UA9A 2BASA 2W3HA 1W8YA 3A3EA 2J3WA 3UB6A 4HI4A 2WYXA 4P6ZS 5LBRA 2QWSA 2RCXA 1KOUA 3FKVA 2D02A 5EECA 5GLAA 3DBAA 3D3OA 5HWWA 2HZ5A 3TOIA 2Y2JA 2FFFB 1A0KA 4S2MA 3LGOA 4PM5A 1NWZA 3BECA 3HCYA 2R9WA 3AGEA 3LIDA 2ZJ9A 5DFXA 5TR7A 4KQDA 2JC7A 3O87A 4IVIA 4UA6A 1MWUA 3IF6A 3OCLA 3BEBA 5TBMB 1HVBA 4YFMA 3NY4A 5JYOA 1PWDA 4R4RA 3UO9A 2HGVA 1LSXA 2ZD8A 5FAQA 4QWOA 4X1LA 3L9KA 3H9WA 1FCNA 4K0WA 4X68A 3ITBA 5F1GA 4JF6A 3TJZC 2WKIA 2YKFA 4O01A 4JPMA 1K54C 3UE3A 4MDZA 1VETA 2Z6CA 3ZFZA 2VV8A 1ZTUA 1PI4A 4E3JA 2EWWA 2J9PA 5FDHA 3T12B 4HQAA 1S6RA 3BQ8A 1NYYA 4JXVA 3OOVA 2EX6A 3NIAA 3NJAA 1PFLA 3K3DA 2EX9A 1JWZA 1ES4A 1PW1A 4EV4A 4DMZA 3VFHA 4I5SA 2PD7A 4R3AA 3W4QA 5HPIA 3LY4A 4WN5A 4U3TA 5FQQA 1T1CA 4S2NA 3VP1A 4D2OA 5CTNA 4YNRA 1H0MA 3NOTC 4HOIA 4P0MA 2H5SA 1H5XA 2Y2QA 5TJJA 1J3WA 1ZG6A 3RJUA 4WMCA 3ULFA 2PR6A 2VEAA 1K6SA 4KENB 4OP8A 3VFFA 2ZMFA 4PMAA 3FZCA 3C7UA 5FEGA 1GHMA 3SS5A 1JNUA 2W3FA 2DMWA 1WYBA 3CUEC 3PBRA 3SH8A 5HPFA 2O9AA 1P97A 4MMNA 4E3LA 2OWHA 5FQJA 1N9OA 1VHMA 4R4SA 5TGFA 4HP9A 1D1JA 4R70A 4OQGA 1FSYA 3T4OA 5A90A 2HDSA 1XPBA 4R23A 3OC2A 2VKSA 1VB6A 2XD5A 1N4OA 3CJMA 2XK1A 1O7EA 3MZFA 1SHVA 4E6XA 3GV9A 5EVID 3GSGA 3QP6A 5HAPA 5EVIB 4E3OA 1D06A 3M6HA 4R38A 5HZHA 3QP4A 3UPPA 3CLOA 5EPHA 4RVAA 4R1GA 4N9LA 1UWNX 2DCFA 4OQHA 5GL9A 3SZTA 3PBOA 1Q2PA 2QHKA 3E4PA 2ZC3B 4WM9A 4Y7PA 2O9CA 3NDGA 2GZAA 3A3JA 3MFDA 2JKTM 4OLGA 4ZJ2A 5GHZA 5L09A 3C4OA 2FFYA 1ESUA 3L7HA 3NBLA 4G3VA 4QY6A 4GDBA 4ETZA 3GECA 3KSHA 3HUNA 4OOYA 2H0TA 5A93A 4E3KA 4WZ4A 3HJIA 4Y13A 2EXBA 3H7WA 4QPRA 2IWDA 3WRZA 1IOUA 3MXSA 1UGUA 4KZ5A 3S7OA 3SH7A 3D72A 3TG9A 2VGLS 3T4QA 1H8YA 1KVMA 1XKZA 3C38A 5AQBA 4WYYA 1OTAA 3FYZA 2X01A 3SS3A 1VEUB 2PYPA 4IBRA 2XA7M 1YLZA 3PBQA 4XUXA 4AFIA 1T19A 4MBFA 1P0ZA 4IUHA 4JGPA 4OVDA 4EQIA 4DE1A 3PR6A 4P85A 1T1AA 2ZM0A 5MC7A 4GLQA 4DDSA 1BSGA 4GZBA 5J7EA 1VQQA 4JXGA 1K0KA 3LO7A 4S2IA 4DF6A 3PHYA 3DTMA 3OPPA 2PR5A 5FEFA 4U0XA 1MZUA 1ZC2A 3MKFA 3BYDA 3TW8A 1BLHA 3GMWA 4WUJA 3IXGA 5KMWA 3ZNYA 4FD8A 3MQOA 5A91A 2XGNA 4Y3IA 3KYEA 3F1PA 3SS4A 4NXGA 1E25A 4QU3A 3DW0A 4B4XA 1MY8A 3BLMA 1E4DA 3F1NA 1KGEA 4KUOA 3HUOA 5E2GA 5DTKA 2H28A 3PBTA 3EGDC 2P04A 1YQSA 4CLCA 1NYMA 3DWKA 4HJ3A 1L0GA 5FQMA 3CI6A 3PAGA 5HW3A 2XR0A 4Y15A 3VE4A 1IYPA 2HF6A 1HTZA 1KE3A 4HJ4A 5DF9A 2M7VA 2ZLYA 3KO6A 2OAQ1 3UPOA 3Q7VA 2V0WA 3IX3A 1TS6A 4DXCA 4NK3A 1S4RA 5G4ZA 1SKOB 3JVVA 1K25A 4MBHA 3QNCA 2L0WA 4HNBA 3A0RA 1IKIA 2UV0E 2MJ6A 4N9KA 3KSFA 4Q0HA 3HLGA 3C2WA 3UMEA 3CHWP 1LSWA 3IS2A 1BZAA 2ZL1A 2WGWB 3LEZA 3R7WA 1BULA 4GKUA 5EM0A 2Y59A 3TRCA 2JKTI 3OLOA 2Y91A 1W79A 3RH8B
chains in the Genus database with same CATH topology
2ZMAA 5FSRA 3LY3A 2EFUA 3BECA 3MZDA 1KDWA 2R9WA 3AGEA 1HZOA 1TDGA 4IVKA 4ZJ3A 3I7JA 3UE0A 3A3IA 4R0QA 3HL9A 2P74A 2Y2HA 2ZJ9A 3G32A 2Y2GA 4OPRA 4X6TA 5TR7A 2DNSA 2G2WA 4NETA 2JC7A 3O87A 4IVIA 4UA6A 1MWUA 3IF6A 3OCLA 2ZC4B 3GTCA 5FQ9A 3RXXA 3BEBA 1HVBA 2P9VB 4YFMA 3VOZA 1YLPA 2HP5A 1KGGA 4KG6A 2V1ZA 1K4EA 3NY4A 5FAOA 1HD8A 5JYOA 4JLFA 1PWDA 4R4RA 4X56A 3IHBA 1Z6FA 3UO9A 5KSHA 3D4FA 3SH9A 3VOYA 4ID4A 3VP4A 2ZD8A 5FAQA 2XFTA 3V50A 5I94A 4DE2A 1NJ4A 4JKTA 1OMEA 4DE3A 1FR6A 3Q7ZA 1ALQA 1KE0A 5EVIA 4KQQA 2EX2A 3VP3A 3NI9A 4WEJA 1FCNA 5DF7A 4K0WA 4QHCA 4KZ6A 1K6RA 4FH4A 4X68A 3ITBA 4GOGA 3C5AA 1FCMA 1W7FA 2XQZA 5F1GA 4JF6A 1LL9A 2WKIA 3WS4A 4DRTA 1S0WA 2WUQA 1EI5A 2WAFA 3N6IA 4JPMA 1K54C 1DY6A 4PM6A 2E8IA 4LV3A 1IELA 1W8QA 2V2FF 3E2KA 2OLVA 3UE3A 5KSCA 5BOHA 3S22A 3ZFZA 3M6BA 4FCFA 1JTGA 1PI4A 5CRFA 1XA1A 1FR1A 4JBFA 3VMAA 4JF5A 4EWFA 3DWZA 1LL5A 3W4PA 4E3JA 1JWVA 4FH2A 5EOEA 4GNUA 2J9PA 5FDHA 4S2KA 1MWSA 5GLCA 3W8KA 4ZDXA 3P09A 3ZDJA 4S2LA 3ZG8B 3BM6A 1S6RA 1TDLA 2Y4AA 1NYYA 2ZQDA 4PPRA 4JXVA 4UA7A 5E43A 4EBLA 4B88A 2EX6A 3HLEA 3NIAA 5HAQA 3G30A 4JXSA 4CPKA 2ZC5B 1JTDA 1JVJA 3ZG7B 2EX9A 1JWZA 1ES4A 1PW1A 4KZ9A 4EV4A 1L2SA 1IKGA 5GLDA 1U60A 3VFHA 3W4QA 1MXOA 3LY4A 1CI8A 2A49A 3NDEA 3PBSA 5F82A 3P98A 2EX8A 1XXMA 4RYEA 3V5MA 4U3TA 3MZEA 5FQQA 5HFOA 4F94A 1FOFA 1MWRA 3Q7VB 1G6AA 4MBKA 4S2NA 3BFFA 5AQAA 2QMIA 4KQRA 4QJGA 3VP1A 4D2OA 2V20A 4WELA 3V39A 5CTMA 4C3QA 3HVFA 5CEDA 1Q2QA 5CTNA 2PU2A 2RL3A 4E6WA 2HP9A 4Z9QA 3ZGAB 1GHPA 5G18A 3M2KA 3G2ZA 4E3MA 3TSGA 4P0MA 1PI5A 2H5SA 1H5XA 5A92A 2Y2QA 4GN2A 4X53A 1ESIA 2HP6A 4UAAA 1ZG6A 3RJUA 4WMCA 5KZHA 5IHVA 3BRMA 4BENA 3HLFA 1LLBA 1AXBA 2EFXA 3HLDA 2PBYA 1K6SA 2Q9NA 2C5WB 4LV2A 2QPNA 4KENB 4OP8A 4S2JA 3SOIA 3VFFA 3ZVWA 4PMAA 5CHJA 3FZCA 3G4PA 3C7UA 3QNBA 3HUMA 3GVBA 3HBRA 3RXWA 1IYSA 2WZZA 1GHMA 4MNRA 4LV0A 3SS5A 1GA0A 1L0FA 2OSUA 3EQVA 4KQOA 1WYBA 2H10A 3ITAA 3PBRA 2Y2NA 4IEDA 2XEPA 3SH8A 1ERQA 4OH0A 5DTSA 3NC8A 4JXWA 4R3BA 5U47A 2XDMA 1XP4A 4E3LA 3QHYA 5FQJA 4OPQA 4R4SA 5TGFA 3WS1A 1DJAA 4OQGA 3S1YA 2WAEA 3AGDA 1FSYA 5CGSA 1K54A 4X55A 5DF8A 2HDSA 5A90A 3IF6B 3CZDA 4S2PA 1I2SA 3BFEA 2UWXA 4OP5A 1XPBA 3CG5A 4PM7A 2ZM8A 2Y2IA 4BJPA 1ES5A 4R23A 2WGVA 3OC2A 4HBUA 4KZ4A 1IYQA 2P9VA 3M2JA 2WGIA 5DVAA 2XH9A 2XD5A 5FI6A 1N4OA 3CJMA 2XK1A 2Y2LA 5CECA 1O7EA 3MZFA 4QY5A 1SHVA 4C75A 4E6XA 4JF4A 3GV9A 1SDNA 2WKEA 5EVID 3GSGA 2BG1A 3CMZA 1IYOA 5E2EA 3N4IA 5FQIA 1I2WA 1GA9A 1NZUA 2ZQ7A 4XUZA 3UY6A 5HAPA 1ZG4A 5E2FA 5EVIB 1YMXA 4E3NA 1TEMA 5EUAA 3C4PA 2WK0A 4E3OA 1GCEA 2X02A 3IWIA 3M6HA 3ZVTA 4UHUA 2Y2PA 5M19A 3FV7A 3UPPA 1CEGA 2XD1A 5EPHA 2WKHA 3IH8A 3OPLA 4HBTA 4RVAA 1K55A 4R1GA 2ZM2A 3IF5A 4N9LA 5CGXA 3ZG5A 1K57C 3IXBA 1ONGA 3Q82A 2DCFA 4OQHA 1YLYA 4PM8A 1NXYA 3IXDA 5GL9A 4KZ8A 1M6KA 3G34A 2Y55A 3IWOA 2J8YA 3AGFA 1Q2PA 2XLNA 3PBOA 3GR2A 4OONA 3UPNA 2QZ6A 3ISGA 5EOOA 2ZC3B 1H8ZA 4N1HA 4LCLA 4WM9A 4Y7PA 2Y2KA 3NDGA 4OOMA 4ZJ1A 3A3JA 4GB7A 5JYPA 2X71A 4P87A 4R3JA 2WZXA 3MFDA 1ES3A 1Y54A 4OLGA 3BLSA 4ZBEA 4ZJ2A 1BTLA 2R9XA 1SCWA 5GHZA 3ZCZA 2VGKA 3C4OA 2FFYA 1ESUA 1M40A 3NBLA 4KZ3A 1ERMA 1BUEA 4BL3A 5M1AA 4QY6A 4GDBA 1DJBA 3VP2A 1JWPA 4H8RA 4RX3A 4WZ5A 5HX9A 1KDSA 1YMSA 3HUNA 3G2YA 4OOYA 2H0TA 4Y0UA 5D3OA 1NY0A 4GD8A 5A93A 1K56A 1NRFA 4E3KA 3OPHA 4WZ4A 5AQ7A 3HREA 4QB8A 1K56D 1FQGA 1BLCA 2EXBA 2IWDA 4BD1A 3WRZA 3MXSA 4FSFA 4WBGA 1MBLA 3HLCA 4DXBA 1L0DA 1YLTA 2Y2MA 4IBXA 3GQZA 1G68A 3HLWA 1MWTA 4KZ5A 3WS5A 4EBPA 4Q8IA 1K38A 3SH7A 1O07A 1YT4A 2OLUA 3PAEA 2Z2LB 3TG9A 5CEBA 3JYIA 1BLPA 4GDNA 2WADA 2J7VA 1H8YA 3N8LA 4WMCD 4MLLA 1KVMA 3MKEA 5GLBA 4DE0A 1XKZA 4BL2A 4OQIA 5L2FA 1PW8A 1YM1A 5AQBA 5EVLA 4U0TA 4WYYA 4M3KA 3FYZA 2X01A 2WGWA 3SS3A 1BLSA 3PTEA 2IWCA 2Q9MA 1QMFA 5FA7A 3UDFA 4IBRA 1E3UA 1YLZA 4HEFA 5FATA 1PWCA 3PBQA 1PZPA 4N1XA 1BT5A 1E3UD 1CI9A 1SDEA 2DRWA 4X69A 4XUXA 1N9BA 2BLSA 1WYCA 4K0XA 4L0LA 4KZBA 3O86A 4Y0OA 5FI2A 4BD0A 2ZQ9A 1LI9A 3G35A 3IQAA 4MBFA 5CHMA 3BFGA 4ZAMA 1CEFA 2JBFA 4KG5A 4OVDA 3Q07A 3UN7A 4EQIA 4WEKA 4DE1A 4P85A 1MKIA 2ZM0A 3O88A 1PZOA 4HESA 4DDSA 1FSWA 3A3DA 4N92A 3WRTA 1BSGA 4LV1A 4GZBA 4RA7A 1K57A 2XFSA 2Y2OA 5HARA 1VQQA 4JXGA 3HLBA 2JCHA 4CJNA 3LO7A 3VP0A 4S2IA 4DF6A 4EBNA 1RP5A 4S2OA 3NCKA 3FWLA 1I5QA 3DTMA 1LI0A 3OPPA 5FQKA 2VGJA 4O7DA 4U0XA 3UDIA 1WE4A 1MPLA 4ZTKA 1ZC2A 3MKFA 4KG2A 1ONHA 2ZQAA 2GDNA 3BYDA 5F83A 3VSLA 1BLHA 3GMWA 2J9OA 1SKFA 3IXGA 5KMWA 3UDXA 3ZNYA 3LCEA 4FD8A 1CK3A 4LENA 5A91A 4B4ZA 2XGNA 5CHUA 1QMEA 1TVFA 1KGFA 3SS4A 2ZQ8A 4QD4A 2XF3A 1E25A 4QU3A 4BLMA 4BQMA 3DW0A 4B4XA 1MY8A 3BLMA 1E4DA 2JE5A 3OZHA 4EUZA 2B5RA 3BFDA 1KGEA 1W5DA 1FCOA 4OPYA 1IEMA 3C7VA 3IF6C 3FKWA 3IT9A 3GRJA 3HUOA 4A5RA 5E2GA 1KE4A 3N8RA 3IH9A 3OPRA 5DTKA 2HDRA 3ZHHA 3PBTA 2ZQCA 1LHYA 3IXHA 4PM9A 5DTTA 1ZKJA 1DJCA 5CXWA 1YQSA 2A3UA 1EROA 1L0EA 1NYMA 3G31A 5GHYA 5GHXA 3DWKA 1J9MA 3EQUA 2PU4A 3ZNTA 1L0GA 5FQMA 4DDYA 3PAGA 5HW3A 2XR0A 2ZC6B 5FAPA 1XGJA 2EXAA 3N8SA 5EVIC 5CGWA 1IYPA 2HDUA 5E2HA 3S4XA 1HTZA 1KE3A 5DF9A 1XA7A 4DKIA 5EE8A 2ZLYA 3N7WA 4MEZA 3V3SA 1ES2A 1PWGA 4Y0TA 3WS2A 1NZOA 1XGIA 3MBZA 3UPOA 3Q7VA 3IWQA 4OQ0A 4XXRA 4C6YA 2ZC7A 1K4FA 4OLDA 3W4OA 2OV5A 5F1FA 2I72A 1RCJA 1K55C 2H0YA 2HDQA 3PBNA 1VM1A 4NK3A 1RGYA 5AQ9A 4DXCA 5FI7A 1RGZA 3ZG9B 3A3FA 1C3BA 4OKPA 3O3VA 3E2LA 3UE1A 1GHIA 1K25A 4YINA 1XX2A 3WS0A 4MBHA 3Q1FA 5TFQA 2IWBA 1YLJA 5HL1A 3ZG0A 4LCMA 5J8XA 2Z2MB 4OPZA 3BFCA 3QNCA 1PIOA 2C6WB 3B3XA 4UA9A 1W8YA 3A3EA 1IKIA 4P6BA 5FASA 1PYYA 4KZAA 1KVLA 4N9KA 3MXRA 4K91A 2WYXA 3HLGA 4RX2A 2RCXA 4KZ7A 3UNWA 1BZAA 3FKVA 5EECA 5GLAA 2CC1A 2WGWB 4WZ5C 3LEZA 3IHAA 2HPBA 1BULA 4GKUA 2Y59A 3TOIA 2Y2JA 2FFFB 5CERA 3VSKA 4S2MA 4S2NC 1YLWA 4GD6A 5HAIA 4PM5A 2Y91A 4OOLA 1W79A 1EWZA 3Q81A 4E3IA 5M18A 3OCNA 3WWXA 2G2UA 3V3RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZMA A;  5FSR A;  3LY3 A;  2EFU A;  3BEC A;  3MZD A;  1KDW A;  2R9W A;  3AGE A;  1HZO A;  1TDG A;  4IVK A;  4ZJ3 A;  3I7J A;  3UE0 A;  3A3I A;  4R0Q A;  3HL9 A;  2P74 A;  2Y2H A;  2ZJ9 A;  3G32 A;  2Y2G A;  4OPR A;  4X6T A;  5TR7 A;  2DNS A;  2G2W A;  4NET A;  2JC7 A;  3O87 A;  4IVI A;  4UA6 A;  1MWU A;  3IF6 A;  3OCL A;  2ZC4 B;  3GTC A;  5FQ9 A;  3RXX A;  3BEB A;  1HVB A;  2P9V B;  4YFM A;  3VOZ A;  1YLP A;  2HP5 A;  1KGG A;  4KG6 A;  2V1Z A;  1K4E A;  3NY4 A;  5FAO A;  1HD8 A;  5JYO A;  4JLF A;  1PWD A;  4R4R A;  4X56 A;  3IHB A;  1Z6F A;  3UO9 A;  5KSH A;  3D4F A;  3SH9 A;  3VOY A;  4ID4 A;  3VP4 A;  2ZD8 A;  5FAQ A;  2XFT A;  3V50 A;  5I94 A;  4DE2 A;  1NJ4 A;  4JKT A;  1OME A;  4DE3 A;  1FR6 A;  3Q7Z A;  1ALQ A;  1KE0 A;  5EVI A;  4KQQ A;  2EX2 A;  3VP3 A;  3NI9 A;  4WEJ A;  1FCN A;  5DF7 A;  4K0W A;  4QHC A;  4KZ6 A;  1K6R A;  4FH4 A;  4X68 A;  3ITB A;  4GOG A;  3C5A A;  1FCM A;  1W7F A;  2XQZ A;  5F1G A;  4JF6 A;  1LL9 A;  2WKI A;  3WS4 A;  4DRT A;  1S0W A;  2WUQ A;  1EI5 A;  2WAF A;  3N6I A;  4JPM A;  1K54 C;  1DY6 A;  4PM6 A;  2E8I A;  4LV3 A;  1IEL A;  1W8Q A;  2V2F F;  3E2K A;  2OLV A;  3UE3 A;  5KSC A;  5BOH A;  3S22 A;  3ZFZ A;  3M6B A;  4FCF A;  1JTG A;  1PI4 A;  5CRF A;  1XA1 A;  1FR1 A;  4JBF A;  3VMA A;  4JF5 A;  4EWF A;  3DWZ A;  1LL5 A;  3W4P A;  4E3J A;  1JWV A;  4FH2 A;  5EOE A;  4GNU A;  2J9P A;  5FDH A;  4S2K A;  1MWS A;  5GLC A;  3W8K A;  4ZDX A;  3P09 A;  3ZDJ A;  4S2L A;  3ZG8 B;  3BM6 A;  1S6R A;  1TDL A;  2Y4A A;  1NYY A;  2ZQD A;  4PPR A;  4JXV A;  4UA7 A;  5E43 A;  4EBL A;  4B88 A;  2EX6 A;  3HLE A;  3NIA A;  5HAQ A;  3G30 A;  4JXS A;  4CPK A;  2ZC5 B;  1JTD A;  1JVJ A;  3ZG7 B;  2EX9 A;  1JWZ A;  1ES4 A;  1PW1 A;  4KZ9 A;  4EV4 A;  1L2S A;  1IKG A;  5GLD A;  1U60 A;  3VFH A;  3W4Q A;  1MXO A;  3LY4 A;  1CI8 A;  2A49 A;  3NDE A;  3PBS A;  5F82 A;  3P98 A;  2EX8 A;  1XXM A;  4RYE A;  3V5M A;  4U3T A;  3MZE A;  5FQQ A;  5HFO A;  4F94 A;  1FOF A;  1MWR A;  3Q7V B;  1G6A A;  4MBK A;  4S2N A;  3BFF A;  5AQA A;  2QMI A;  4KQR A;  4QJG A;  3VP1 A;  4D2O A;  2V20 A;  4WEL A;  3V39 A;  5CTM A;  4C3Q A;  3HVF A;  5CED A;  1Q2Q A;  5CTN A;  2PU2 A;  2RL3 A;  4E6W A;  2HP9 A;  4Z9Q A;  3ZGA B;  1GHP A;  5G18 A;  3M2K A;  3G2Z A;  4E3M A;  3TSG A;  4P0M A;  1PI5 A;  2H5S A;  1H5X A;  5A92 A;  2Y2Q A;  4GN2 A;  4X53 A;  1ESI A;  2HP6 A;  4UAA A;  1ZG6 A;  3RJU A;  4WMC A;  5KZH A;  5IHV A;  3BRM A;  4BEN A;  3HLF A;  1LLB A;  1AXB A;  2EFX A;  3HLD A;  2PBY A;  1K6S A;  2Q9N A;  2C5W B;  4LV2 A;  2QPN A;  4KEN B;  4OP8 A;  4S2J A;  3SOI A;  3VFF A;  3ZVW A;  4PMA A;  5CHJ A;  3FZC A;  3G4P A;  3C7U A;  3QNB A;  3HUM A;  3GVB A;  3HBR A;  3RXW A;  1IYS A;  2WZZ A;  1GHM A;  4MNR A;  4LV0 A;  3SS5 A;  1GA0 A;  1L0F A;  2OSU A;  3EQV A;  4KQO A;  1WYB A;  2H10 A;  3ITA A;  3PBR A;  2Y2N A;  4IED A;  2XEP A;  3SH8 A;  1ERQ A;  4OH0 A;  5DTS A;  3NC8 A;  4JXW A;  4R3B A;  5U47 A;  2XDM A;  1XP4 A;  4E3L A;  3QHY A;  5FQJ A;  4OPQ A;  4R4S A;  5TGF A;  3WS1 A;  1DJA A;  4OQG A;  3S1Y A;  2WAE A;  3AGD A;  1FSY A;  5CGS A;  1K54 A;  4X55 A;  5DF8 A;  2HDS A;  5A90 A;  3IF6 B;  3CZD A;  4S2P A;  1I2S A;  3BFE A;  2UWX A;  4OP5 A;  1XPB A;  3CG5 A;  4PM7 A;  2ZM8 A;  2Y2I A;  4BJP A;  1ES5 A;  4R23 A;  2WGV A;  3OC2 A;  4HBU A;  4KZ4 A;  1IYQ A;  2P9V A;  3M2J A;  2WGI A;  5DVA A;  2XH9 A;  2XD5 A;  5FI6 A;  1N4O A;  3CJM A;  2XK1 A;  2Y2L A;  5CEC A;  1O7E A;  3MZF A;  4QY5 A;  1SHV A;  4C75 A;  4E6X A;  4JF4 A;  3GV9 A;  1SDN A;  2WKE A;  5EVI D;  3GSG A;  2BG1 A;  3CMZ A;  1IYO A;  5E2E A;  3N4I A;  5FQI A;  1I2W A;  1GA9 A;  1NZU A;  2ZQ7 A;  4XUZ A;  3UY6 A;  5HAP A;  1ZG4 A;  5E2F A;  5EVI B;  1YMX A;  4E3N A;  1TEM A;  5EUA A;  3C4P A;  2WK0 A;  4E3O A;  1GCE A;  2X02 A;  3IWI A;  3M6H A;  3ZVT A;  4UHU A;  2Y2P A;  5M19 A;  3FV7 A;  3UPP A;  1CEG A;  2XD1 A;  5EPH A;  2WKH A;  3IH8 A;  3OPL A;  4HBT A;  4RVA A;  1K55 A;  4R1G A;  2ZM2 A;  3IF5 A;  4N9L A;  5CGX A;  3ZG5 A;  1K57 C;  3IXB A;  1ONG A;  3Q82 A;  2DCF A;  4OQH A;  1YLY A;  4PM8 A;  1NXY A;  3IXD A;  5GL9 A;  4KZ8 A;  1M6K A;  3G34 A;  2Y55 A;  3IWO A;  2J8Y A;  3AGF A;  1Q2P A;  2XLN A;  3PBO A;  3GR2 A;  4OON A;  3UPN A;  2QZ6 A;  3ISG A;  5EOO A;  2ZC3 B;  1H8Z A;  4N1H A;  4LCL A;  4WM9 A;  4Y7P A;  2Y2K A;  3NDG A;  4OOM A;  4ZJ1 A;  3A3J A;  4GB7 A;  5JYP A;  2X71 A;  4P87 A;  4R3J A;  2WZX A;  3MFD A;  1ES3 A;  1Y54 A;  4OLG A;  3BLS A;  4ZBE A;  4ZJ2 A;  1BTL A;  2R9X A;  1SCW A;  5GHZ A;  3ZCZ A;  2VGK A;  3C4O A;  2FFY A;  1ESU A;  1M40 A;  3NBL A;  4KZ3 A;  1ERM A;  1BUE A;  4BL3 A;  5M1A A;  4QY6 A;  4GDB A;  1DJB A;  3VP2 A;  1JWP A;  4H8R A;  4RX3 A;  4WZ5 A;  5HX9 A;  1KDS A;  1YMS A;  3HUN A;  3G2Y A;  4OOY A;  2H0T A;  4Y0U A;  5D3O A;  1NY0 A;  4GD8 A;  5A93 A;  1K56 A;  1NRF A;  4E3K A;  3OPH A;  4WZ4 A;  5AQ7 A;  3HRE A;  4QB8 A;  1K56 D;  1FQG A;  1BLC A;  2EXB A;  2IWD A;  4BD1 A;  3WRZ A;  3MXS A;  4FSF A;  4WBG A;  1MBL A;  3HLC A;  4DXB A;  1L0D A;  1YLT A;  2Y2M A;  4IBX A;  3GQZ A;  1G68 A;  3HLW A;  1MWT A;  4KZ5 A;  3WS5 A;  4EBP A;  4Q8I A;  1K38 A;  3SH7 A;  1O07 A;  1YT4 A;  2OLU A;  3PAE A;  2Z2L B;  3TG9 A;  5CEB A;  3JYI A;  1BLP A;  4GDN A;  2WAD A;  2J7V A;  1H8Y A;  3N8L A;  4WMC D;  4MLL A;  1KVM A;  3MKE A;  5GLB A;  4DE0 A;  1XKZ A;  4BL2 A;  4OQI A;  5L2F A;  1PW8 A;  1YM1 A;  5AQB A;  5EVL A;  4U0T A;  4WYY A;  4M3K A;  3FYZ A;  2X01 A;  2WGW A;  3SS3 A;  1BLS A;  3PTE A;  2IWC A;  2Q9M A;  1QMF A;  5FA7 A;  3UDF A;  4IBR A;  1E3U A;  1YLZ A;  4HEF A;  5FAT A;  1PWC A;  3PBQ A;  1PZP A;  4N1X A;  1BT5 A;  1E3U D;  1CI9 A;  1SDE A;  2DRW A;  4X69 A;  4XUX A;  1N9B A;  2BLS A;  1WYC A;  4K0X A;  4L0L A;  4KZB A;  3O86 A;  4Y0O A;  5FI2 A;  4BD0 A;  2ZQ9 A;  1LI9 A;  3G35 A;  3IQA A;  4MBF A;  5CHM A;  3BFG A;  4ZAM A;  1CEF A;  2JBF A;  4KG5 A;  4OVD A;  3Q07 A;  3UN7 A;  4EQI A;  4WEK A;  4DE1 A;  4P85 A;  1MKI A;  2ZM0 A;  3O88 A;  1PZO A;  4HES A;  4DDS A;  1FSW A;  3A3D A;  4N92 A;  3WRT A;  1BSG A;  4LV1 A;  4GZB A;  4RA7 A;  1K57 A;  2XFS A;  2Y2O A;  5HAR A;  1VQQ A;  4JXG A;  3HLB A;  2JCH A;  4CJN A;  3LO7 A;  3VP0 A;  4S2I A;  4DF6 A;  4EBN A;  1RP5 A;  4S2O A;  3NCK A;  3FWL A;  1I5Q A;  3DTM A;  1LI0 A;  3OPP A;  5FQK A;  2VGJ A;  4O7D A;  4U0X A;  3UDI A;  1WE4 A;  1MPL A;  4ZTK A;  1ZC2 A;  3MKF A;  4KG2 A;  1ONH A;  2ZQA A;  2GDN A;  3BYD A;  5F83 A;  3VSL A;  1BLH A;  3GMW A;  2J9O A;  1SKF A;  3IXG A;  5KMW A;  3UDX A;  3ZNY A;  3LCE A;  4FD8 A;  1CK3 A;  4LEN A;  5A91 A;  4B4Z A;  2XGN A;  5CHU A;  1QME A;  1TVF A;  1KGF A;  3SS4 A;  2ZQ8 A;  4QD4 A;  2XF3 A;  1E25 A;  4QU3 A;  4BLM A;  4BQM A;  3DW0 A;  4B4X A;  1MY8 A;  3BLM A;  1E4D A;  2JE5 A;  3OZH A;  4EUZ A;  2B5R A;  3BFD A;  1KGE A;  1W5D A;  1FCO A;  4OPY A;  1IEM A;  3C7V A;  3IF6 C;  3FKW A;  3IT9 A;  3GRJ A;  3HUO A;  4A5R A;  5E2G A;  1KE4 A;  3N8R A;  3IH9 A;  3OPR A;  5DTK A;  2HDR A;  3ZHH A;  3PBT A;  2ZQC A;  1LHY A;  3IXH A;  4PM9 A;  5DTT A;  1ZKJ A;  1DJC A;  5CXW A;  1YQS A;  2A3U A;  1ERO A;  1L0E A;  1NYM A;  3G31 A;  5GHY A;  5GHX A;  3DWK A;  1J9M A;  3EQU A;  2PU4 A;  3ZNT A;  1L0G A;  5FQM A;  4DDY A;  3PAG A;  5HW3 A;  2XR0 A;  2ZC6 B;  5FAP A;  1XGJ A;  2EXA A;  3N8S A;  5EVI C;  5CGW A;  1IYP A;  2HDU A;  5E2H A;  3S4X A;  1HTZ A;  1KE3 A;  5DF9 A;  1XA7 A;  4DKI A;  5EE8 A;  2ZLY A;  3N7W A;  4MEZ A;  3V3S A;  1ES2 A;  1PWG A;  4Y0T A;  3WS2 A;  1NZO A;  1XGI A;  3MBZ A;  3UPO A;  3Q7V A;  3IWQ A;  4OQ0 A;  4XXR A;  4C6Y A;  2ZC7 A;  1K4F A;  4OLD A;  3W4O A;  2OV5 A;  5F1F A;  2I72 A;  1RCJ A;  1K55 C;  2H0Y A;  2HDQ A;  3PBN A;  1VM1 A;  4NK3 A;  1RGY A;  5AQ9 A;  4DXC A;  5FI7 A;  1RGZ A;  3ZG9 B;  3A3F A;  1C3B A;  4OKP A;  3O3V A;  3E2L A;  3UE1 A;  1GHI A;  1K25 A;  4YIN A;  1XX2 A;  3WS0 A;  4MBH A;  3Q1F A;  5TFQ A;  2IWB A;  1YLJ A;  5HL1 A;  3ZG0 A;  4LCM A;  5J8X A;  2Z2M B;  4OPZ A;  3BFC A;  3QNC A;  1PIO A;  2C6W B;  3B3X A;  4UA9 A;  1W8Y A;  3A3E A;  1IKI A;  4P6B A;  5FAS A;  1PYY A;  4KZA A;  1KVL A;  4N9K A;  3MXR A;  4K91 A;  2WYX A;  3HLG A;  4RX2 A;  2RCX A;  4KZ7 A;  3UNW A;  1BZA A;  3FKV A;  5EEC A;  5GLA A;  2CC1 A;  2WGW B;  4WZ5 C;  3LEZ A;  3IHA A;  2HPB A;  1BUL A;  4GKU A;  2Y59 A;  3TOI A;  2Y2J A;  2FFF B;  5CER A;  3VSK A;  4S2M A;  4S2N C;  1YLW A;  4GD6 A;  5HAI A;  4PM5 A;  2Y91 A;  4OOL A;  1W79 A;  1EWZ A;  3Q81 A;  4E3I A;  5M18 A;  3OCN A;  3WWX A;  2G2U A;  3V3R A; 
#chains in the Genus database with same CATH topology
 4EXO A;  3LY3 A;  4IVK A;  4X25 A;  1TS8 A;  3A3I A;  3HL9 A;  2P74 A;  2Y2H A;  1OTD A;  4EU0 A;  5FQ9 A;  3GTC A;  3VOZ A;  3T50 A;  1YLP A;  1S66 L;  3MSH A;  3LR0 A;  1KGG A;  2V1Z A;  4BBV A;  5DKL A;  5FAO A;  4I3I A;  1TS0 A;  1V9Z A;  2YKH A;  1F5M A;  2L4R A;  3VP4 A;  5I94 A;  3UB8 A;  2XFT A;  3MXQ A;  4I39 A;  4EES A;  4NKP A;  4JKT A;  3EEH A;  1ALQ A;  4KQQ A;  3NI9 A;  5DF7 A;  3GDI A;  4Y5F A;  4FH4 A;  4P6Z M;  4B9O A;  2A24 A;  3C5A A;  1YSP A;  1DP9 A;  1S0W A;  2J80 A;  1EI5 A;  2WAF A;  2V2F F;  3E2K A;  3S22 A;  2QJ5 A;  1XA1 A;  3DWZ A;  4LRZ E;  4FH2 A;  4GNU A;  5GLC A;  3W8K A;  4ARZ A;  2Y4A A;  2ZQD A;  4UA7 A;  4EBL A;  4JXS A;  4KZ9 A;  1L2S A;  4XT2 B;  2LB5 A;  2A49 A;  1EW0 A;  2EX8 A;  3MZE A;  2O9B A;  4F94 A;  1FOF A;  1MWR A;  3CAX A;  2I9V A;  3KSI A;  1Q2Q A;  2RL3 A;  2K2N A;  2WKR A;  5G18 A;  1NRJ A;  4E3M A;  1PI5 A;  4GN2 A;  4X53 A;  2VA0 A;  1ESI A;  5DFY A;  2HP6 A;  5KZH A;  5IHV A;  1XJ6 A;  3BRM A;  3LIC A;  3HLD A;  2PBY A;  4LV2 A;  2C5W B;  2QPN A;  3U2A A;  5CHJ A;  2XSS A;  3G4P A;  4G3K A;  3CPT B;  4I3J A;  3GVB A;  2PAV P;  2WKQ A;  1GA0 A;  3E4O A;  2OSU A;  3EQV A;  4KQO A;  3T4S A;  3NC8 A;  1PRQ A;  4R3B A;  4LRX C;  3C8C A;  3QHY A;  4OPQ A;  3BY9 A;  1LSV A;  3S1Y A;  4WLA A;  3AGD A;  5CGS A;  5F68 A;  1K54 A;  2J3T C;  5DF8 A;  1FIL A;  3IF6 B;  3CZD A;  1ES5 A;  2WGV A;  4KZ4 A;  3M2J A;  4FOF A;  5FI6 A;  4DJ2 A;  4C75 A;  4JF4 A;  1SDN A;  2WKE A;  2BG1 A;  5E2E A;  1NZU A;  4CQH A;  2ZQ7 A;  4X1M A;  5A8B A;  2W27 A;  5K5B A;  2Y2P A;  5M19 A;  2XD1 A;  3IH8 A;  1K55 A;  1K57 C;  3LYX A;  1YLY A;  4Z1W A;  1G5U A;  3VE3 A;  4ZRR A;  1VET B;  4WF0 A;  5EOO A;  1H8Z A;  4N1H A;  1OJG A;  1DP8 A;  4OOM A;  1TF1 A;  1BTL A;  2R9X A;  1S4S A;  4YOF A;  5M1A A;  1JWP A;  4WZ5 A;  3B42 A;  1YMS A;  4FTX A;  3QP1 A;  3G2Y A;  5DKK A;  1NY0 A;  3H82 B;  1BLC A;  3IBR A;  4BD1 A;  5AVF A;  4WBG A;  2PBD P;  2W1T A;  3CUE A;  2Y2M A;  3EOI A;  1G68 A;  2HJE A;  1MWT A;  3WS5 A;  3R4K A;  4EBP A;  4Q8I A;  2PDR A;  4PHT A;  3TE8 A;  4GW9 A;  2WAD A;  4WMC D;  5GLB A;  3MS6 A;  4BL2 A;  5L2F A;  4HP4 A;  3T1R A;  5EVL A;  4F3L A;  4U0T A;  3LIF A;  4JGO A;  4M3K A;  4WL9 A;  3PTE A;  2IWC A;  5FA7 A;  2INW A;  1E3U A;  1PWC A;  4N1X A;  1BT5 A;  1E3U D;  1CI9 A;  4DJ3 A;  3T4T A;  4KZB A;  2W3E A;  2ZQ9 A;  1LI9 A;  3G35 A;  3IQA A;  5CHM A;  3BFG A;  3DAV A;  2JBF A;  4WEK A;  2CMN A;  4Q0J A;  1MKI A;  2V8C A;  2K7S A;  2G7U A;  4LV1 A;  4YWZ A;  5HAR A;  3IX8 A;  4UQI S;  3IBJ A;  2PD8 A;  2VGJ A;  1WE4 A;  1ONH A;  3VSL A;  1XJ3 A;  3LCE A;  4B4Z A;  1CK3 A;  5CHU A;  1QME A;  1TVF A;  1KGF A;  2XF3 A;  3LUQ A;  4BQM A;  4EET B;  1Y4O A;  2JE5 A;  2B5R A;  1FCO A;  4OPY A;  3FKW A;  1W63 Q;  2D01 A;  3IT9 A;  4GHI A;  2HDR A;  1LHY A;  5CXW A;  1DJC A;  3W2Z A;  2OAP 1;  1J9M A;  3S7Q A;  3EQU A;  2VX8 A;  3ZNT A;  5AVE A;  3BJN A;  5FAP A;  3F1O B;  5EVI C;  3RFB A;  4BBU A;  1TD5 A;  4MEZ A;  3V3S A;  3NUL A;  4HIA A;  3MBZ A;  4C6Y A;  1N9N A;  1SZV A;  5AQ9 A;  4KUK A;  3H7W B;  4II7 A;  3ZG9 B;  1RGZ A;  3A3F A;  4OKP A;  4PKY G;  3UE1 A;  2V0U A;  2K31 A;  2W3D A;  5IS1 A;  4YIN A;  5HL1 A;  1AWI A;  3QP8 A;  3B3X A;  1KVL A;  3MXR A;  4IJG A;  4RX2 A;  3K2N A;  2CC1 A;  1OTB A;  3IHA A;  2HPB A;  5CER A;  4GD6 A;  4K08 A;  4R6L A;  4OOL A;  1EWZ A;  3Q81 A;  4E3I A;  5M18 A;  1W63 M;  4L9G A;  4LPZ A;  1DP6 A;  3V3R A;  5EFW A;  5FSR A;  2EFU A;  1H3Q A;  1KDW A;  3I7J A;  2EA9 A;  5C5K A;  4R0Q A;  4O0P A;  3HJK A;  3G32 A;  4X6T A;  2DNS A;  5HSQ A;  2R78 A;  1X0O A;  2ZC4 B;  1G6O A;  2ZOI A;  2P9V B;  4KG6 A;  5HD3 A;  4X56 A;  3IHB A;  1NLZ A;  1Z6F A;  5KSH A;  3D4F A;  3SH9 A;  3DTI A;  1OME A;  4DE3 A;  1FR6 A;  3ZYT A;  4E04 A;  4LRY C;  5L07 A;  3SW1 A;  1K6R A;  3BW6 A;  1FIK A;  3F1P B;  1FCM A;  2XQZ A;  1LL9 A;  2PRF A;  5EM1 A;  1MC0 A;  5HWT A;  3WS4 A;  2WUQ A;  3F1N B;  2E8I A;  1XJ4 A;  4LV3 A;  5BOH A;  4FCF A;  5CRF A;  4CLC D;  1F2K A;  2GX5 A;  3W4P A;  5EOE A;  4CLC B;  4S2K A;  3P09 A;  3BM6 A;  2XA7 S;  1LL8 A;  5E43 A;  3ZG7 B;  4B93 A;  1IKG A;  4GS9 A;  5GLD A;  3LR3 A;  1CI8 A;  5F82 A;  4IHQ A;  3P98 A;  1XXM A;  2V9A A;  3Q7V B;  1G6A A;  4MBK A;  1BYW A;  1GSW A;  5AQA A;  2V20 A;  3V39 A;  5CED A;  1CF0 A;  4Z9Q A;  1GHP A;  3PYP A;  2V1A A;  3M2K A;  4BMW A;  4CLC C;  1Z09 A;  3D9Y A;  4UAA A;  5HDC A;  4EEP A;  1LLB A;  1AXB A;  2EFX A;  3UMD A;  2Q9N A;  3IS2 B;  4S2J A;  3ZVW A;  2ZL1 B;  3HUM A;  3R7W B;  1L0F A;  2Y2N A;  5KIZ A;  1ERQ A;  2XDM A;  1XP4 A;  1OPX A;  4JGR A;  3WS1 A;  3PXP A;  2V8F A;  2WAE A;  4X55 A;  1Y28 A;  3KYZ A;  4S2P A;  2UWX A;  4OP5 A;  4BJP A;  4HBU A;  1IYQ A;  2KDK A;  1NLY A;  1V9Y A;  4L9F A;  4O8G A;  3S7N A;  3CMZ A;  1YAX A;  5FQI A;  1I2W A;  4XUZ A;  4FUW A;  5E2F A;  1YMX A;  1TEM A;  1GCE A;  2ZMV A;  1MKM A;  2KLI A;  3OBF A;  3ZVT A;  4UHU A;  3FV7 A;  1CEG A;  2A24 B;  2ZM2 A;  3ZG5 A;  3UB9 A;  1ONG A;  4PM8 A;  1NXY A;  1OT9 A;  4KZ8 A;  3G34 A;  2Y55 A;  3IWO A;  3NEC A;  3GR2 A;  3U4L P;  2Y2K A;  3A0S A;  4GB7 A;  2X71 A;  4P87 A;  2WZX A;  1ES3 A;  4BWI A;  4ZBE A;  4ARZ B;  5HL6 A;  1M40 A;  4KZ3 A;  4BL3 A;  4EER A;  1DJB A;  4H8R A;  4RX3 A;  3MF0 A;  2VK3 A;  5D3O A;  4GD8 A;  2VV7 A;  4XT2 A;  1K56 A;  1NRF A;  3OPH A;  3G6O A;  5AQ7 A;  1K56 D;  4I3A A;  3HLC A;  1D7E A;  4IBX A;  3GQZ A;  2KX6 A;  3HLW A;  1O07 A;  4H6J B;  2OLU A;  3JYI A;  2PYR A;  1BLP A;  4GDN A;  2Y79 A;  2J7V A;  3MKE A;  4OQI A;  5L8M A;  1YM1 A;  2L1M A;  2FH5 A;  2Q9M A;  1QMF A;  4HEF A;  4D60 A;  1N9B A;  2BLS A;  1WYC A;  4K0X A;  4L0L A;  3CPT A;  3O86 A;  4DN0 A;  4BD0 A;  3LIE A;  1XFN A;  4ZAM A;  3UN7 A;  3Q07 A;  3O88 A;  3BWL A;  1FSW A;  4N92 A;  4RA7 A;  1K57 A;  2XFS A;  4BBT A;  4CJN A;  2JCH A;  5TBM A;  2O0Y A;  2BTF P;  2VJW A;  4NXF A;  4EBN A;  1RP5 A;  2P08 A;  4S2O A;  5FQK A;  2W1R A;  3BY8 A;  4ZTK A;  1SKF A;  3CWF A;  4MCW A;  2ZQ8 A;  4QD4 A;  4GCZ A;  3UB5 P;  2W3G A;  3OZH A;  3BFD A;  2B95 A;  3C7V A;  3IF6 C;  4ETX A;  1KE4 A;  3T1Q B;  3IH9 A;  3E4Q A;  3OPR A;  2ZQC A;  1ZKJ A;  5HDS A;  5GHX A;  2XRO A;  2PU4 A;  2Q0O A;  1ODV A;  3VOL A;  5EV0 A;  1T18 A;  2ZC6 B;  1XGJ A;  5CGW A;  5E2H A;  4DKI A;  1XA7 A;  5EE8 A;  4UQI M;  3N7W A;  4MN5 A;  1T1B A;  4Y0T A;  3NOP C;  2WKP A;  3EWK A;  3IWQ A;  4OQ0 A;  2ZC7 A;  1K4F A;  5J4E A;  3W4O A;  4MN6 A;  4PKY A;  3H82 A;  1WA9 A;  1RCJ A;  1K55 C;  1S1Z A;  1TS7 A;  2H0Y A;  2HDQ A;  1RGY A;  1C3B A;  3O3V A;  3E2L A;  1GHI A;  2W1T B;  3WS0 A;  1OTE A;  3Q1F A;  5TFQ A;  3RTY A;  1YLJ A;  2JKR M;  3FPV A;  3IX4 A;  5J8X A;  2Z2M B;  4OPZ A;  3BFC A;  2QYB A;  1PIO A;  2C6W B;  3FG8 A;  4P6B A;  3LFV A;  5I5L A;  5FAS A;  1PYY A;  4KZA A;  4K91 A;  4L9E A;  2V1B A;  4KZ7 A;  3UNW A;  4F3L B;  2ZOH A;  4LFU A;  2XRN A;  4WZ5 C;  3VV4 A;  3LEQ A;  3VSK A;  4S2N C;  1YLW A;  5HAI A;  5J3W A;  5EVE A;  3OCN A;  3WWX A;  1P9R A;  2G2U A;  3MQ0 A;  2ZMA A;  4ESP A;  1YKD A;  3MZD A;  4ZJ3 A;  1HZO A;  1TDG A;  3UE0 A;  1XJ2 A;  3P01 A;  4OPR A;  2Y2G A;  2G2W A;  4NET A;  3RXX A;  1OT6 A;  3EEA A;  1UWP X;  2HP5 A;  1K4E A;  1HD8 A;  3T4J A;  2VGL M;  1DRM A;  4JLF A;  3VOY A;  3FC7 A;  4ID4 A;  3V50 A;  2GNX A;  4DE2 A;  1NJ4 A;  4EUV A;  3Q7Z A;  5L10 A;  1KE0 A;  5EVI A;  2EX2 A;  3VP3 A;  4WEJ A;  4QHC A;  4KZ6 A;  5HWV A;  2O99 A;  3LI8 A;  4GOG A;  1W7F A;  3C30 A;  4EEU A;  4DRT A;  3N6I A;  4PM6 A;  3T1S A;  1DY6 A;  1IEL A;  1W8Q A;  1F98 A;  2OLV A;  5KSC A;  2W0N A;  3KSG A;  4GHI B;  3M6B A;  1JTG A;  2PHY A;  2JKF A;  3UE6 A;  1FR1 A;  4JBF A;  3VMA A;  4JF5 A;  4EWF A;  2AVX A;  1LL5 A;  1GSX A;  1JWV A;  5F69 A;  1MWS A;  4ZDX A;  3ZDJ A;  4S2L A;  3ZG8 B;  1TDL A;  4PPR A;  4B88 A;  3HLE A;  5CX7 A;  5HAQ A;  3G30 A;  4CPK A;  2ZC5 B;  1JTD A;  1JVJ A;  3F1O A;  1U60 A;  1LT0 A;  3LIB A;  5HD5 A;  4GJ4 A;  1MXO A;  3NDE A;  3PBS A;  3V5M A;  1ACF A;  4RYE A;  5IT5 A;  5HFO A;  4HH2 A;  3A0V A;  1H8M A;  3BFF A;  2QMI A;  2ZBB A;  4KQR A;  3BQA A;  4QJG A;  4WEL A;  3T1X A;  5CTM A;  4C3Q A;  3HVF A;  2PU2 A;  1YPR A;  4E6W A;  2HP9 A;  4Q0I A;  4I38 A;  2B18 A;  3ZGA B;  1L3L A;  3G2Z A;  3TSG A;  5A92 A;  4LLO B;  3FPW A;  3LIA A;  4BEN A;  3HLF A;  1VEU A;  3SOI A;  2P7J A;  2GJ3 A;  3NOU C;  3P7N A;  3QNB A;  4HJ6 A;  3HBR A;  3RXW A;  1IYS A;  2WZZ A;  4MNR A;  1CJF A;  4LV0 A;  3JPU A;  2B02 A;  2H10 A;  3ITA A;  4IED A;  2XEP A;  4OH0 A;  5DTS A;  4JXW A;  5U47 A;  2HV1 A;  4EQ1 A;  1DJA A;  3EGX C;  1F9I A;  4M4X A;  1I2S A;  3BFE A;  3CG5 A;  4PM7 A;  2ZM8 A;  2Y2I A;  3NHQ A;  5HDD A;  2P9V A;  2WGI A;  5DVA A;  2XH9 A;  3B33 A;  2Y2L A;  5CEC A;  4QY5 A;  2IA2 A;  2JKR I;  1OJ5 A;  1IYO A;  2JHE A;  3N4I A;  3UY6 A;  1GA9 A;  1S1Y A;  3MMH A;  1ZG4 A;  4E3N A;  5EUA A;  3C4P A;  2WK0 A;  1STZ A;  3K3C A;  2X02 A;  3IWI A;  3T4L A;  4Y2F A;  2WKH A;  3OPL A;  4HBT A;  3IF5 A;  5CGX A;  1CQA A;  3IXB A;  2EWV A;  3Q82 A;  3IXD A;  1P9W A;  5G4Y A;  2M7U A;  1M6K A;  2ACG A;  2J8Y A;  3AGF A;  2XLN A;  3KX0 X;  3LR5 A;  4OON A;  3UPN A;  2QZ6 A;  3ISG A;  4EW7 A;  1ZHH B;  4LCL A;  2JN7 A;  4ZJ1 A;  2VLG A;  3DTE A;  1N9L A;  2PT7 A;  2A2L A;  4R3J A;  5JYP A;  1Y54 A;  2E8J A;  3ZCZ A;  3BLS A;  1SCW A;  4Y17 A;  2VGK A;  1ERM A;  1BUE A;  5FL3 A;  3KYQ A;  3VP2 A;  3QP2 A;  1GSV A;  5HX9 A;  1KDS A;  4GS9 B;  2JKG A;  4Y0U A;  3UB7 A;  4RQ9 A;  3HRE A;  4QB8 A;  1S67 L;  2M1C A;  1FQG A;  5AJG A;  1SKO A;  3QP5 A;  2FZ0 A;  4FSF A;  1MBL A;  5F5Y A;  4DXB A;  1L0D A;  1YLT A;  4LGW A;  2QJ7 A;  1K38 A;  1YT4 A;  3PAE A;  2Z2L B;  4G3W A;  5CEB A;  5DJU A;  2Y8H A;  3N8L A;  4MLL A;  4DE0 A;  1PW8 A;  3MQQ A;  2OOL A;  4IUK A;  2WGW A;  1BLS A;  1YSQ A;  3UDF A;  5FAT A;  1PZP A;  2NUP C;  1SDE A;  2OWJ A;  2DRW A;  4X69 A;  4HY8 A;  2VZW A;  4Y0O A;  3B47 A;  5FI2 A;  1CEF A;  4KG5 A;  1PZO A;  4HES A;  3A3D A;  2Z6D A;  3WRT A;  2Y2O A;  3HLB A;  3VP0 A;  3MFX A;  4NXE A;  4NXB A;  3NCK A;  3FWL A;  1I5Q A;  1LI0 A;  3ZQ5 A;  1PNE A;  3E0Y A;  4O7D A;  3UDI A;  1MPL A;  4KG2 A;  2ZQA A;  5F83 A;  2GDN A;  1XFQ A;  3MR0 A;  4MN7 A;  2J9O A;  5FDS A;  1G28 A;  3UDX A;  4LEN A;  3E98 A;  2HJ9 C;  4BLM A;  3LI9 A;  3S7P A;  4EUZ A;  3JVU A;  1W5D A;  1IEM A;  3DTK A;  2QKP A;  4JGQ A;  3GRJ A;  4A5R A;  3N8R A;  3ZHH A;  4PAU A;  2LB9 A;  3IXH A;  4PM9 A;  5DTT A;  2A3U A;  1ERO A;  4UEY A;  1L0E A;  2KOI A;  3G31 A;  5GHY A;  3V67 A;  2NUT C;  4DDY A;  3CIT A;  2EXA A;  4ME4 A;  3N8S A;  2HDU A;  3LR4 A;  3S4X A;  3ICY A;  1ES2 A;  1PWG A;  4HHD A;  5DJT A;  4HH3 A;  4NEE D;  3WS2 A;  1NZO A;  1XGI A;  4XXR A;  1IFQ A;  4OLD A;  2OV5 A;  5F6A A;  5F1F A;  2I72 A;  3PBN A;  1VM1 A;  2VV6 A;  4CLC E;  5FI7 A;  3MJQ A;  3T4K A;  1XX2 A;  2IWB A;  4NG2 A;  1OTI A;  1HLU P;  3O5Y A;  4LCM A;  5IU1 A;  3ZG0 A;  2J3T D;  4H6J A;  4UA9 A;  2BAS A;  2W3H A;  1W8Y A;  3A3E A;  2J3W A;  3UB6 A;  4HI4 A;  2WYX A;  4P6Z S;  5LBR A;  2QWS A;  2RCX A;  1KOU A;  3FKV A;  2D02 A;  5EEC A;  5GLA A;  3DBA A;  3D3O A;  5HWW A;  2HZ5 A;  3TOI A;  2Y2J A;  2FFF B;  1A0K A;  4S2M A;  3LGO A;  4PM5 A;  1NWZ A;  3BEC A;  3HCY A;  2R9W A;  3AGE A;  3LID A;  2ZJ9 A;  5DFX A;  5TR7 A;  4KQD A;  2JC7 A;  3O87 A;  4IVI A;  4UA6 A;  1MWU A;  3IF6 A;  3OCL A;  3BEB A;  5TBM B;  1HVB A;  4YFM A;  3NY4 A;  5JYO A;  1PWD A;  4R4R A;  3UO9 A;  2HGV A;  1LSX A;  2ZD8 A;  5FAQ A;  4QWO A;  4X1L A;  3L9K A;  3H9W A;  1FCN A;  4K0W A;  4X68 A;  3ITB A;  5F1G A;  4JF6 A;  3TJZ C;  2WKI A;  2YKF A;  4O01 A;  4JPM A;  1K54 C;  3UE3 A;  4MDZ A;  1VET A;  2Z6C A;  3ZFZ A;  2VV8 A;  1ZTU A;  1PI4 A;  4E3J A;  2EWW A;  2J9P A;  5FDH A;  3T12 B;  4HQA A;  1S6R A;  3BQ8 A;  1NYY A;  4JXV A;  3OOV A;  2EX6 A;  3NIA A;  3NJA A;  1PFL A;  3K3D A;  2EX9 A;  1JWZ A;  1ES4 A;  1PW1 A;  4EV4 A;  4DMZ A;  3VFH A;  4I5S A;  2PD7 A;  4R3A A;  3W4Q A;  5HPI A;  3LY4 A;  4WN5 A;  4U3T A;  5FQQ A;  1T1C A;  4S2N A;  3VP1 A;  4D2O A;  5CTN A;  4YNR A;  1H0M A;  3NOT C;  4HOI A;  4P0M A;  2H5S A;  1H5X A;  2Y2Q A;  5TJJ A;  1J3W A;  1ZG6 A;  3RJU A;  4WMC A;  3ULF A;  2PR6 A;  2VEA A;  1K6S A;  4KEN B;  4OP8 A;  3VFF A;  2ZMF A;  4PMA A;  3FZC A;  3C7U A;  5FEG A;  1GHM A;  3SS5 A;  1JNU A;  2W3F A;  2DMW A;  1WYB A;  3CUE C;  3PBR A;  3SH8 A;  5HPF A;  2O9A A;  1P97 A;  4MMN A;  4E3L A;  2OWH A;  5FQJ A;  1N9O A;  1VHM A;  4R4S A;  5TGF A;  4HP9 A;  1D1J A;  4R70 A;  4OQG A;  1FSY A;  3T4O A;  5A90 A;  2HDS A;  1XPB A;  4R23 A;  3OC2 A;  2VKS A;  1VB6 A;  2XD5 A;  1N4O A;  3CJM A;  2XK1 A;  1O7E A;  3MZF A;  1SHV A;  4E6X A;  3GV9 A;  5EVI D;  3GSG A;  3QP6 A;  5HAP A;  5EVI B;  4E3O A;  1D06 A;  3M6H A;  4R38 A;  5HZH A;  3QP4 A;  3UPP A;  3CLO A;  5EPH A;  4RVA A;  4R1G A;  4N9L A;  1UWN X;  2DCF A;  4OQH A;  5GL9 A;  3SZT A;  3PBO A;  1Q2P A;  2QHK A;  3E4P A;  2ZC3 B;  4WM9 A;  4Y7P A;  2O9C A;  3NDG A;  2GZA A;  3A3J A;  3MFD A;  2JKT M;  4OLG A;  4ZJ2 A;  5GHZ A;  5L09 A;  3C4O A;  2FFY A;  1ESU A;  3L7H A;  3NBL A;  4G3V A;  4QY6 A;  4GDB A;  4ETZ A;  3GEC A;  3KSH A;  3HUN A;  4OOY A;  2H0T A;  5A93 A;  4E3K A;  4WZ4 A;  3HJI A;  4Y13 A;  2EXB A;  3H7W A;  4QPR A;  2IWD A;  3WRZ A;  1IOU A;  3MXS A;  1UGU A;  4KZ5 A;  3S7O A;  3SH7 A;  3D72 A;  3TG9 A;  2VGL S;  3T4Q A;  1H8Y A;  1KVM A;  1XKZ A;  3C38 A;  5AQB A;  4WYY A;  1OTA A;  3FYZ A;  2X01 A;  3SS3 A;  1VEU B;  2PYP A;  4IBR A;  2XA7 M;  1YLZ A;  3PBQ A;  4XUX A;  4AFI A;  1T19 A;  4MBF A;  1P0Z A;  4IUH A;  4JGP A;  4OVD A;  4EQI A;  4DE1 A;  3PR6 A;  4P85 A;  1T1A A;  2ZM0 A;  5MC7 A;  4GLQ A;  4DDS A;  1BSG A;  4GZB A;  5J7E A;  1VQQ A;  4JXG A;  1K0K A;  3LO7 A;  4S2I A;  4DF6 A;  3PHY A;  3DTM A;  3OPP A;  2PR5 A;  5FEF A;  4U0X A;  1MZU A;  1ZC2 A;  3MKF A;  3BYD A;  3TW8 A;  1BLH A;  3GMW A;  4WUJ A;  3IXG A;  5KMW A;  3ZNY A;  4FD8 A;  3MQO A;  5A91 A;  2XGN A;  4Y3I A;  3KYE A;  3F1P A;  3SS4 A;  4NXG A;  1E25 A;  4QU3 A;  3DW0 A;  4B4X A;  1MY8 A;  3BLM A;  1E4D A;  3F1N A;  1KGE A;  4KUO A;  3HUO A;  5E2G A;  5DTK A;  2H28 A;  3PBT A;  3EGD C;  2P04 A;  1YQS A;  4CLC A;  1NYM A;  3DWK A;  4HJ3 A;  1L0G A;  5FQM A;  3CI6 A;  3PAG A;  5HW3 A;  2XR0 A;  4Y15 A;  3VE4 A;  1IYP A;  2HF6 A;  1HTZ A;  1KE3 A;  4HJ4 A;  5DF9 A;  2M7V A;  2ZLY A;  3KO6 A;  2OAQ 1;  3UPO A;  3Q7V A;  2V0W A;  3IX3 A;  1TS6 A;  4DXC A;  4NK3 A;  1S4R A;  5G4Z A;  1SKO B;  3JVV A;  1K25 A;  4MBH A;  3QNC A;  2L0W A;  4HNB A;  3A0R A;  1IKI A;  2UV0 E;  2MJ6 A;  4N9K A;  3KSF A;  4Q0H A;  3HLG A;  3C2W A;  3UME A;  3CHW P;  1LSW A;  3IS2 A;  1BZA A;  2ZL1 A;  2WGW B;  3LEZ A;  3R7W A;  1BUL A;  4GKU A;  5EM0 A;  2Y59 A;  3TRC A;  2JKT I;  3OLO A;  2Y91 A;  1W79 A;  3RH8 B; 
#chains in the Genus database with same CATH homology
 2ZMA A;  5FSR A;  3LY3 A;  2EFU A;  3BEC A;  3MZD A;  1KDW A;  2R9W A;  3AGE A;  1HZO A;  1TDG A;  4IVK A;  4ZJ3 A;  3I7J A;  3UE0 A;  3A3I A;  4R0Q A;  3HL9 A;  2P74 A;  2Y2H A;  2ZJ9 A;  3G32 A;  2Y2G A;  4OPR A;  4X6T A;  5TR7 A;  2DNS A;  2G2W A;  4NET A;  2JC7 A;  3O87 A;  4IVI A;  4UA6 A;  1MWU A;  3IF6 A;  3OCL A;  2ZC4 B;  3GTC A;  5FQ9 A;  3RXX A;  3BEB A;  1HVB A;  2P9V B;  4YFM A;  3VOZ A;  1YLP A;  2HP5 A;  1KGG A;  4KG6 A;  2V1Z A;  1K4E A;  3NY4 A;  5FAO A;  1HD8 A;  5JYO A;  4JLF A;  1PWD A;  4R4R A;  4X56 A;  3IHB A;  1Z6F A;  3UO9 A;  5KSH A;  3D4F A;  3SH9 A;  3VOY A;  4ID4 A;  3VP4 A;  2ZD8 A;  5FAQ A;  2XFT A;  3V50 A;  5I94 A;  4DE2 A;  1NJ4 A;  4JKT A;  1OME A;  4DE3 A;  1FR6 A;  3Q7Z A;  1ALQ A;  1KE0 A;  5EVI A;  4KQQ A;  2EX2 A;  3VP3 A;  3NI9 A;  4WEJ A;  1FCN A;  5DF7 A;  4K0W A;  4QHC A;  4KZ6 A;  1K6R A;  4FH4 A;  4X68 A;  3ITB A;  4GOG A;  3C5A A;  1FCM A;  1W7F A;  2XQZ A;  5F1G A;  4JF6 A;  1LL9 A;  2WKI A;  3WS4 A;  4DRT A;  1S0W A;  2WUQ A;  1EI5 A;  2WAF A;  3N6I A;  4JPM A;  1K54 C;  1DY6 A;  4PM6 A;  2E8I A;  4LV3 A;  1IEL A;  1W8Q A;  2V2F F;  3E2K A;  2OLV A;  3UE3 A;  5KSC A;  5BOH A;  3S22 A;  3ZFZ A;  3M6B A;  4FCF A;  1JTG A;  1PI4 A;  5CRF A;  1XA1 A;  1FR1 A;  4JBF A;  3VMA A;  4JF5 A;  4EWF A;  3DWZ A;  1LL5 A;  3W4P A;  4E3J A;  1JWV A;  4FH2 A;  5EOE A;  4GNU A;  2J9P A;  5FDH A;  4S2K A;  1MWS A;  5GLC A;  3W8K A;  4ZDX A;  3P09 A;  3ZDJ A;  4S2L A;  3ZG8 B;  3BM6 A;  1S6R A;  1TDL A;  2Y4A A;  1NYY A;  2ZQD A;  4PPR A;  4JXV A;  4UA7 A;  5E43 A;  4EBL A;  4B88 A;  2EX6 A;  3HLE A;  3NIA A;  5HAQ A;  3G30 A;  4JXS A;  4CPK A;  2ZC5 B;  1JTD A;  1JVJ A;  3ZG7 B;  2EX9 A;  1JWZ A;  1ES4 A;  1PW1 A;  4KZ9 A;  4EV4 A;  1L2S A;  1IKG A;  5GLD A;  1U60 A;  3VFH A;  3W4Q A;  1MXO A;  3LY4 A;  1CI8 A;  2A49 A;  3NDE A;  3PBS A;  5F82 A;  3P98 A;  2EX8 A;  1XXM A;  4RYE A;  3V5M A;  4U3T A;  3MZE A;  5FQQ A;  5HFO A;  4F94 A;  1FOF A;  1MWR A;  3Q7V B;  1G6A A;  4MBK A;  4S2N A;  3BFF A;  5AQA A;  2QMI A;  4KQR A;  4QJG A;  3VP1 A;  4D2O A;  2V20 A;  4WEL A;  3V39 A;  5CTM A;  4C3Q A;  3HVF A;  5CED A;  1Q2Q A;  5CTN A;  2PU2 A;  2RL3 A;  4E6W A;  2HP9 A;  4Z9Q A;  3ZGA B;  1GHP A;  5G18 A;  3M2K A;  3G2Z A;  4E3M A;  3TSG A;  4P0M A;  1PI5 A;  2H5S A;  1H5X A;  5A92 A;  2Y2Q A;  4GN2 A;  4X53 A;  1ESI A;  2HP6 A;  4UAA A;  1ZG6 A;  3RJU A;  4WMC A;  5KZH A;  5IHV A;  3BRM A;  4BEN A;  3HLF A;  1LLB A;  1AXB A;  2EFX A;  3HLD A;  2PBY A;  1K6S A;  2Q9N A;  2C5W B;  4LV2 A;  2QPN A;  4KEN B;  4OP8 A;  4S2J A;  3SOI A;  3VFF A;  3ZVW A;  4PMA A;  5CHJ A;  3FZC A;  3G4P A;  3C7U A;  3QNB A;  3HUM A;  3GVB A;  3HBR A;  3RXW A;  1IYS A;  2WZZ A;  1GHM A;  4MNR A;  4LV0 A;  3SS5 A;  1GA0 A;  1L0F A;  2OSU A;  3EQV A;  4KQO A;  1WYB A;  2H10 A;  3ITA A;  3PBR A;  2Y2N A;  4IED A;  2XEP A;  3SH8 A;  1ERQ A;  4OH0 A;  5DTS A;  3NC8 A;  4JXW A;  4R3B A;  5U47 A;  2XDM A;  1XP4 A;  4E3L A;  3QHY A;  5FQJ A;  4OPQ A;  4R4S A;  5TGF A;  3WS1 A;  1DJA A;  4OQG A;  3S1Y A;  2WAE A;  3AGD A;  1FSY A;  5CGS A;  1K54 A;  4X55 A;  5DF8 A;  2HDS A;  5A90 A;  3IF6 B;  3CZD A;  4S2P A;  1I2S A;  3BFE A;  2UWX A;  4OP5 A;  1XPB A;  3CG5 A;  4PM7 A;  2ZM8 A;  2Y2I A;  4BJP A;  1ES5 A;  4R23 A;  2WGV A;  3OC2 A;  4HBU A;  4KZ4 A;  1IYQ A;  2P9V A;  3M2J A;  2WGI A;  5DVA A;  2XH9 A;  2XD5 A;  5FI6 A;  1N4O A;  3CJM A;  2XK1 A;  2Y2L A;  5CEC A;  1O7E A;  3MZF A;  4QY5 A;  1SHV A;  4C75 A;  4E6X A;  4JF4 A;  3GV9 A;  1SDN A;  2WKE A;  5EVI D;  3GSG A;  2BG1 A;  3CMZ A;  1IYO A;  5E2E A;  3N4I A;  5FQI A;  1I2W A;  1GA9 A;  1NZU A;  2ZQ7 A;  4XUZ A;  3UY6 A;  5HAP A;  1ZG4 A;  5E2F A;  5EVI B;  1YMX A;  4E3N A;  1TEM A;  5EUA A;  3C4P A;  2WK0 A;  4E3O A;  1GCE A;  2X02 A;  3IWI A;  3M6H A;  3ZVT A;  4UHU A;  2Y2P A;  5M19 A;  3FV7 A;  3UPP A;  1CEG A;  2XD1 A;  5EPH A;  2WKH A;  3IH8 A;  3OPL A;  4HBT A;  4RVA A;  1K55 A;  4R1G A;  2ZM2 A;  3IF5 A;  4N9L A;  5CGX A;  3ZG5 A;  1K57 C;  3IXB A;  1ONG A;  3Q82 A;  2DCF A;  4OQH A;  1YLY A;  4PM8 A;  1NXY A;  3IXD A;  5GL9 A;  4KZ8 A;  1M6K A;  3G34 A;  2Y55 A;  3IWO A;  2J8Y A;  3AGF A;  1Q2P A;  2XLN A;  3PBO A;  3GR2 A;  4OON A;  3UPN A;  2QZ6 A;  3ISG A;  5EOO A;  2ZC3 B;  1H8Z A;  4N1H A;  4LCL A;  4WM9 A;  4Y7P A;  2Y2K A;  3NDG A;  4OOM A;  4ZJ1 A;  3A3J A;  4GB7 A;  5JYP A;  2X71 A;  4P87 A;  4R3J A;  2WZX A;  3MFD A;  1ES3 A;  1Y54 A;  4OLG A;  3BLS A;  4ZBE A;  4ZJ2 A;  1BTL A;  2R9X A;  1SCW A;  5GHZ A;  3ZCZ A;  2VGK A;  3C4O A;  2FFY A;  1ESU A;  1M40 A;  3NBL A;  4KZ3 A;  1ERM A;  1BUE A;  4BL3 A;  5M1A A;  4QY6 A;  4GDB A;  1DJB A;  3VP2 A;  1JWP A;  4H8R A;  4RX3 A;  4WZ5 A;  5HX9 A;  1KDS A;  1YMS A;  3HUN A;  3G2Y A;  4OOY A;  2H0T A;  4Y0U A;  5D3O A;  1NY0 A;  4GD8 A;  5A93 A;  1K56 A;  1NRF A;  4E3K A;  3OPH A;  4WZ4 A;  5AQ7 A;  3HRE A;  4QB8 A;  1K56 D;  1FQG A;  1BLC A;  2EXB A;  2IWD A;  4BD1 A;  3WRZ A;  3MXS A;  4FSF A;  4WBG A;  1MBL A;  3HLC A;  4DXB A;  1L0D A;  1YLT A;  2Y2M A;  4IBX A;  3GQZ A;  1G68 A;  3HLW A;  1MWT A;  4KZ5 A;  3WS5 A;  4EBP A;  4Q8I A;  1K38 A;  3SH7 A;  1O07 A;  1YT4 A;  2OLU A;  3PAE A;  2Z2L B;  3TG9 A;  5CEB A;  3JYI A;  1BLP A;  4GDN A;  2WAD A;  2J7V A;  1H8Y A;  3N8L A;  4WMC D;  4MLL A;  1KVM A;  3MKE A;  5GLB A;  4DE0 A;  1XKZ A;  4BL2 A;  4OQI A;  5L2F A;  1PW8 A;  1YM1 A;  5AQB A;  5EVL A;  4U0T A;  4WYY A;  4M3K A;  3FYZ A;  2X01 A;  2WGW A;  3SS3 A;  1BLS A;  3PTE A;  2IWC A;  2Q9M A;  1QMF A;  5FA7 A;  3UDF A;  4IBR A;  1E3U A;  1YLZ A;  4HEF A;  5FAT A;  1PWC A;  3PBQ A;  1PZP A;  4N1X A;  1BT5 A;  1E3U D;  1CI9 A;  1SDE A;  2DRW A;  4X69 A;  4XUX A;  1N9B A;  2BLS A;  1WYC A;  4K0X A;  4L0L A;  4KZB A;  3O86 A;  4Y0O A;  5FI2 A;  4BD0 A;  2ZQ9 A;  1LI9 A;  3G35 A;  3IQA A;  4MBF A;  5CHM A;  3BFG A;  4ZAM A;  1CEF A;  2JBF A;  4KG5 A;  4OVD A;  3Q07 A;  3UN7 A;  4EQI A;  4WEK A;  4DE1 A;  4P85 A;  1MKI A;  2ZM0 A;  3O88 A;  1PZO A;  4HES A;  4DDS A;  1FSW A;  3A3D A;  4N92 A;  3WRT A;  1BSG A;  4LV1 A;  4GZB A;  4RA7 A;  1K57 A;  2XFS A;  2Y2O A;  5HAR A;  1VQQ A;  4JXG A;  3HLB A;  2JCH A;  4CJN A;  3LO7 A;  3VP0 A;  4S2I A;  4DF6 A;  4EBN A;  1RP5 A;  4S2O A;  3NCK A;  3FWL A;  1I5Q A;  3DTM A;  1LI0 A;  3OPP A;  5FQK A;  2VGJ A;  4O7D A;  4U0X A;  3UDI A;  1WE4 A;  1MPL A;  4ZTK A;  1ZC2 A;  3MKF A;  4KG2 A;  1ONH A;  2ZQA A;  2GDN A;  3BYD A;  5F83 A;  3VSL A;  1BLH A;  3GMW A;  2J9O A;  1SKF A;  3IXG A;  5KMW A;  3UDX A;  3ZNY A;  3LCE A;  4FD8 A;  1CK3 A;  4LEN A;  5A91 A;  4B4Z A;  2XGN A;  5CHU A;  1QME A;  1TVF A;  1KGF A;  3SS4 A;  2ZQ8 A;  4QD4 A;  2XF3 A;  1E25 A;  4QU3 A;  4BLM A;  4BQM A;  3DW0 A;  4B4X A;  1MY8 A;  3BLM A;  1E4D A;  2JE5 A;  3OZH A;  4EUZ A;  2B5R A;  3BFD A;  1KGE A;  1W5D A;  1FCO A;  4OPY A;  1IEM A;  3C7V A;  3IF6 C;  3FKW A;  3IT9 A;  3GRJ A;  3HUO A;  4A5R A;  5E2G A;  1KE4 A;  3N8R A;  3IH9 A;  3OPR A;  5DTK A;  2HDR A;  3ZHH A;  3PBT A;  2ZQC A;  1LHY A;  3IXH A;  4PM9 A;  5DTT A;  1ZKJ A;  1DJC A;  5CXW A;  1YQS A;  2A3U A;  1ERO A;  1L0E A;  1NYM A;  3G31 A;  5GHY A;  5GHX A;  3DWK A;  1J9M A;  3EQU A;  2PU4 A;  3ZNT A;  1L0G A;  5FQM A;  4DDY A;  3PAG A;  5HW3 A;  2XR0 A;  2ZC6 B;  5FAP A;  1XGJ A;  2EXA A;  3N8S A;  5EVI C;  5CGW A;  1IYP A;  2HDU A;  5E2H A;  3S4X A;  1HTZ A;  1KE3 A;  5DF9 A;  1XA7 A;  4DKI A;  5EE8 A;  2ZLY A;  3N7W A;  4MEZ A;  3V3S A;  1ES2 A;  1PWG A;  4Y0T A;  3WS2 A;  1NZO A;  1XGI A;  3MBZ A;  3UPO A;  3Q7V A;  3IWQ A;  4OQ0 A;  4XXR A;  4C6Y A;  2ZC7 A;  1K4F A;  4OLD A;  3W4O A;  2OV5 A;  5F1F A;  2I72 A;  1RCJ A;  1K55 C;  2H0Y A;  2HDQ A;  3PBN A;  1VM1 A;  4NK3 A;  1RGY A;  5AQ9 A;  4DXC A;  5FI7 A;  1RGZ A;  3ZG9 B;  3A3F A;  1C3B A;  4OKP A;  3O3V A;  3E2L A;  3UE1 A;  1GHI A;  1K25 A;  4YIN A;  1XX2 A;  3WS0 A;  4MBH A;  3Q1F A;  5TFQ A;  2IWB A;  1YLJ A;  5HL1 A;  3ZG0 A;  4LCM A;  5J8X A;  2Z2M B;  4OPZ A;  3BFC A;  3QNC A;  1PIO A;  2C6W B;  3B3X A;  4UA9 A;  1W8Y A;  3A3E A;  1IKI A;  4P6B A;  5FAS A;  1PYY A;  4KZA A;  1KVL A;  4N9K A;  3MXR A;  4K91 A;  2WYX A;  3HLG A;  4RX2 A;  2RCX A;  4KZ7 A;  3UNW A;  1BZA A;  3FKV A;  5EEC A;  5GLA A;  2CC1 A;  2WGW B;  4WZ5 C;  3LEZ A;  3IHA A;  2HPB A;  1BUL A;  4GKU A;  2Y59 A;  3TOI A;  2Y2J A;  2FFF B;  5CER A;  3VSK A;  4S2M A;  4S2N C;  1YLW A;  4GD6 A;  5HAI A;  4PM5 A;  2Y91 A;  4OOL A;  1W79 A;  1EWZ A;  3Q81 A;  4E3I A;  5M18 A;  3OCN A;  3WWX A;  2G2U A;  3V3R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...