1MBLA

A catalytically-impaired class a beta-lactamase: 2 angstroms crystal structure and kinetics of the bacillus licheniformis e166a mutant
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
256
structure length
256
Chain Sequence
DDFAKLEEQFDAKLGIFALDTGTNRTVAYRPDERFAFASTIKALTVGVLLQQKSIEDLNQRITYTRDDLVNYNPITEKHVDTGMTLKELADASLRYSDNAAQNLILKQIGGPESLKKELRKIGDEVTNPERFAPELNEVNPGETQDTSTARALVTSLRAFALEDKLPSEKRELLIDWMKRNTTGDALIRAGVPDGWEVADKTGAASYGTRNDIAIIWPPKGDPVVLAVLSSRDKKDAKYDDKLIAEATKVVMKALN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-LACTAMASE
publication title A catalytically-impaired class A beta-lactamase: 2 A crystal structure and kinetics of the Bacillus licheniformis E166A mutant.
pubmed doi rcsb
source organism Bacillus licheniformis
molecule tags Hydrolase
total genus 88
structure length 256
sequence length 256
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 1992-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1mblA00
2QPNA 2E8IA 2ZQCA 4QU3A 3IWIA 4DXCA 1JWZA 1K25A 1LL9A 2Y91A 3EQUA 2XFSA 3Q7VB 4YINA 5FQJA 2ZM8A 4GOGA 1MWRA 5CGWA 2J9PA 3WWXA 2ZLYA 3PAGA 3W8KA 2PU2A 4WZ5A 1YLWA 3ZHHA 4BLMA 1TEMA 2Y2LA 1J9MA 1NY0A 1LHYA 2WZXA 2JBFA 5M19A 1L0FA 2ZC4B 1YLJA 2UWXA 3M6BA 1YQSA 4KZ9A 1XA1A 1DJBA 3ITAA 5DF8A 3WS1A 1XP4A 1SHVA 5GLAA 1FSWA 1MWTA 5CECA 1FOFA 1HZOA 4JXWA 1RGZA 5HAIA 2FFFB 1NYYA 3GRJA 5GHYA 4E3KA 4U0XA 3DTMA 4JXGA 1NZOA 2XQZA 2Y2HA 1BLSA 2EX9A 3LO7A 2V1ZA 2XH9A 1ONHA 1H5XA 3DW0A 4YFMA 4EWFA 2WGVA 3A3DA 3SH7A 3BFEA 4HESA 5JYOA 4JPMA 1QMFA 5TR7A 2XD1A 3MZEA 3BYDA 5HW3A 4JF5A 2WKIA 3GQZA 3NY4A 5FAPA 3WS4A 1W79A 4UA6A 2HP6A 3LY4A 3V3SA 1G6AA 3M2JA 4C3QA 3ZG9B 3IHAA 5AQBA 5FQQA 1NXYA 3HLGA 2ZD8A 3Q7VA 3ZGAB 3BFCA 3UO9A 4Z9QA 5EOEA 4N1XA 4OONA 5DF9A 4K0WA 1YLPA 4XUXA 4P85A 5DTTA 5F83A 3IXGA 2EX8A 4M3KA 1MPLA 3FV7A 1GCEA 5CTNA 4R1GA 1PI5A 3MZFA 1BLHA 1BSGA 2EXAA 2IWCA 3OPRA 3NCKA 5E2FA 5EVID 3FZCA 4ZAMA 4EBPA 3VP4A 1GA9A 2Y55A 4H8RA 4E3JA 4X55A 5GL9A 4R4RA 3A3JA 3N8SA 3G2YA 4U3TA 1ES3A 3G31A 5CHMA 4GN2A 4OP5A 5E2GA 2PBYA 2WK0A 1MWSA 2Y2KA 4MBKA 1FCOA 3DWKA 3PTEA 3VP2A 3N8RA 2A3UA 4KZAA 4Y0OA 4BD1A 3NC8A 3EQVA 4OH0A 1ES4A 3UPNA 4IVKA 1ZKJA 1TVFA 2ZC3B 4S2JA 5IHVA 1H8YA 3O87A 4OPQA 4E6XA 2EX6A 3OPLA 4PM8A 1XX2A 1I2SA 1K4EA 3PBTA 5FQKA 1HVBA 2HP5A 1H8ZA 3G30A 3E2KA 1JTDA 2Y2MA 1K6SA 4R23A 3IXDA 3WS5A 4DF6A 4R4SA 1CEFA 2P74A 2A49A 3AGFA 3CG5A 3HL9A 4NETA 4Y7PA 1ZC2A 3NBLA 1C3BA 4LENA 4KZBA 3V5MA 1ONGA 4JXSA 2HDQA 3HLWA 3HLEA 1W7FA 3VMAA 4KZ5A 2ZQAA 4N9LA 1PYYA 3NDGA 4DDYA 3VSLA 2C5WB 3BFGA 3GSGA 5KSHA 4Q8IA 3VP1A 4ZJ2A 4EUZA 5L2FA 1ZG6A 3ZNYA 1SCWA 3M2KA 4OLDA 3RXXA 3PAEA 4S2NA 4WM9A 4QJGA 2JC7A 1AXBA 1ESIA 1KE3A 2CC1A 4FCFA 3IF6C 4WBGA 4OOYA 2Z2LB 2ZJ9A 4ZBEA 3BLMA 3BEBA 1KDWA 1TDLA 1E25A 2H5SA 5CXWA 5E2EA 1XGJA 3HLBA 4E6WA 3CJMA 1ERQA 1PZPA 5EPHA 4JXVA 4OPZA 4WELA 4XXRA 3UE0A 2P9VB 5EUAA 4OPRA 4WYYA 4IBRA 3IQAA 3AGEA 2HDUA 3HUNA 1SDEA 1PWGA 1YMXA 4DXBA 2C6WB 4JF4A 1YLYA 2HPBA 3OPPA 1CI8A 1JWPA 2Y2QA 2WGWA 2HDRA 4FH2A 5GLDA 3VOYA 1G68A 5F1FA 5AQAA 1TDGA 3UPPA 3VSKA 2V20A 4LCLA 3MFDA 3MXSA 1K54A 4FD8A 4IBXA 4N9KA 4S2NC 2QZ6A 4QY5A 4WMCA 5HARA 3D4FA 2Q9MA 1VQQA 4P6BA 4RA7A 4RX3A 2J9OA 3WRZA 3UNWA 5FASA 3S22A 2ZC5B 2ZQ8A 3VFHA 1VM1A 4ID4A 2ZC6B 4DRTA 5CEBA 2ZM2A 4KZ8A 2RCXA 4GZBA 5EVIA 5HAPA 4KZ4A 5D3OA 4RYEA 4ZDXA 5DF7A 4LV3A 3RXWA 2Y2PA 1YMSA 4EBNA 1BLCA 3I7JA 5BOHA 2X01A 4E3OA 2P9VA 5EECA 1K55C 1MXOA 4QD4A 3VP3A 2OV5A 1PW1A 1GHPA 1BTLA 4OP8A 3GTCA 3ZVTA 3P98A 1U60A 1NRFA 3WS2A 3OCLA 4PMAA 4FH4A 3DWZA 3OC2A 5CGXA 1ES2A 1K54C 3TG9A 1SKFA 2WAFA 4KZ7A 3ZG0A 4WZ5C 4DE2A 4P0MA 3BFDA 2XFTA 3HLCA 2FFYA 1W8QA 4WMCD 2JE5A 4OQ0A 5FATA 5FI7A 3ZNTA 5I94A 1S0WA 1K56D 1FSYA 4GD6A 1K6RA 3QNBA 4GB7A 3HVFA 5EVIC 4E3MA 3GR2A 3PBQA 2Y2GA 1KGFA 3LY3A 3ITBA 1N9BA 3N8LA 2DNSA 4BL3A 1DJAA 3UPOA 3UN7A 4KQOA 3Q1FA 4KZ6A 4UAAA 3BECA 3W4QA 2EX2A 1Q2PA 3M6HA 3QNCA 4N1HA 3PBNA 1PW8A 1RP5A 5CERA 4KG6A 1L2SA 2XD5A 2ZQ9A 5EOOA 4JLFA 4OQGA 5CHUA 5TFQA 1EI5A 4LV0A 1KGGA 5FDHA 5EE8A 5HX9A 1Y54A 1K57A 1BLPA 5FQMA 1SDNA 4RX2A 3FKVA 2ZM0A 4Y0UA 4LV2A 3CZDA 5DTKA 1WYCA 5A92A 1KDSA 3MZDA 4S2KA 4RVAA 2OLVA 3N6IA 4IEDA 1RCJA 3C7VA 3C7UA 3C5AA 1GHMA 3TSGA 2B5RA 3VFFA 3ZDJA 1I2WA 1JTGA 2Y2JA 3UE1A 3S1YA 2Y59A 2XEPA 4JKTA 5AQ7A 3OZHA 3FYZA 4UA7A 1OMEA 3ZG7B 1MKIA 5KSCA 1MWUA 5EVLA 1FQGA 4IVIA 1ESUA 1KGEA 1XGIA 3IXHA 5JYPA 4BJPA 4P87A 1CI9A 1IEMA 4N92A 5F82A 4WEJA 4A5RA 1KVMA 5U47A 3RJUA 3C4OA 1XXMA 3Q82A 4QY6A 3W4PA 4OQHA 1K57C 5CHJA 5FAQA 3G4PA 1FR6A 2OLUA 3MKFA 3IH8A 4KENB 4MEZA 3SH9A 4C6YA 3SS4A 3O3VA 3QHYA 5DTSA 3V3RA 5CGSA 3IXBA 4JBFA 4CJNA 1YLZA 3ZVWA 1IKGA 2JCHA 4PM9A 3PBOA 2EFXA 5HL1A 3G34A 3A3IA 2V2FF 1YM1A 3B3XA 4GD8A 1FCMA 5M1AA 3FKWA 3IWQA 3HREA 1XPBA 4ZJ3A 3UY6A 3G32A 4PM7A 2OSUA 4R0QA 4HEFA 3IWOA 4S2IA 4X6TA 5CTMA 5FQIA 2X71A 3WS0A 5GLCA 2ZC7A 2G2UA 3VOZA 3HBRA 2Y4AA 2XR0A 1KE4A 3MXRA 4OOLA 3A3FA 1M40A 1IYPA 2DCFA 5AQ9A 1K56A 1MY8A 2WADA 5CRFA 5E2HA 5FSRA 3W4OA 2J7VA 1M6KA 4D2OA 1FCNA 4PM5A 4PM6A 2ZMAA 3OCNA 1E3UD 3FWLA 4K91A 2J8YA 3E2LA 4DE0A 3HLDA 3N7WA 5HFOA 1S6RA 3N4IA 3SS3A 3UDXA 1DY6A 1L0DA 5J8XA 2WZZA 1IYQA 2HDSA 2IWDA 1HTZA 4OQIA 3GVBA 4BENA 4HBUA 2BG1A 2X02A 1MBLA 5TGFA 4LCMA 1PZOA 4EQIA 4S2LA 1JWVA 1N4OA 2Z2MB 3IH9A 4MBHA 3IT9A 3NI9A 4BQMA 3CMZA 2G2WA 3TOIA 1BT5A 3P09A 5GHXA 4B4ZA 3HLFA 1BUEA 1BZAA 5DVAA 2WKEA 3G35A 1CK3A 1W8YA 1KE0A 4XUZA 5KMWA 1W5DA 4QHCA 1EWZA 4X68A 1LL5A 4MNRA 3ZCZA 1IYSA 5FI6A 2GDNA 1ALQA 3UE3A 2VGKA 1QMEA 2R9XA 2VGJA 1FR1A 1NZUA 2Y2IA 4JF6A 4BD0A 1IELA 2IWBA 1WE4A 4Y0TA 4EBLA 3IF6B 3LCEA 3SS5A 2XGNA 3VP0A 1E4DA 1IKIA 1EROA 5CEDA 4WZ4A 2BLSA 4R3JA 1K38A 4S2PA 4WEKA 1L0EA 2H10A 4OPYA 5E43A 3WRTA 4CPKA 4UHUA 4OKPA 3AGDA 5G18A 1LLBA 4GDBA 3V39A 2WAEA 3NIAA 4NK3A 4R3BA 5FQ9A 5GHZA 1WYBA 4L0LA 3O88A 1CEGA 1L0GA 3BRMA 4KG5A 2XLNA 4MBFA 3A3EA 4X53A 5A90A 3ZG8B 2DRWA 2ZQ7A 4EV4A 5GLBA 3G2ZA 1NJ4A 3Q7ZA 2WGIA 4QB8A 4GKUA 1YLTA 1I5QA 3PBSA 4BL2A 5FAOA 4KQRA 5KZHA 1Q2QA 2RL3A 3GMWA 4ZJ1A 3LEZA 1XKZA 4UA9A 1IYOA 2PU4A 2WUQA 3OPHA 1GHIA 4LV1A 3IF6A 3ISGA 4DDSA 2WKHA 5FI2A 4F94A 3IHBA 3PBRA 4E3NA 2Y2OA 3UDFA 1K4FA 3NDEA 2Y2NA 1NYMA 1O07A 3BFFA 3SH8A 1KVLA 2H0TA 2WGWB 3IF5A 1DJCA 4KG2A 4S2OA 4B88A 4X69A 1PI4A 3BM6A 3ZG5A 4C75A 4U0TA 4S2MA 1E3UA 3V50A 3MBZA 1HD8A 1ZG4A 2R9WA 5HAQA 1RGYA 4E3LA 2XF3A 3UDIA 5A91A 3BLSA 3Q07A 1BULA 3JYIA 4KZ3A 4MLLA 1ERMA 3ZFZA 4GNUA 3Q81A 2EXBA 3MKEA 4DKIA 4DE1A 3GV9A 1O7EA 5M18A 4FSFA 4KQQA 4O7DA 3C4PA 2XK1A 5FA7A 3SOIA 1XA7A 4OOMA 1ES5A 5EVIB 2I72A 4GDNA 2H0YA 4E3IA 1PIOA 1PWCA 2Q9NA 3HUMA 1PWDA 1LI9A 5A93A 2QMIA 2EFUA 1YT4A 2XDMA 4X56A 1GA0A 4ZTKA 3S4XA 4DE3A 4HBTA 1LI0A 2WYXA 4OVDA 1JVJA 3HUOA 5F1GA 4B4XA 2ZQDA 4K0XA 1Z6FA 4PPRA 2HP9A 4OLGA 1K55A 3O86A
chains in the Genus database with same CATH superfamily
4DXCA 1JWZA 3EEHA 2Y91A 5FQJA 4GOGA 3E4QA 2K2NA 1YLWA 2Y2LA 1J9MA 1XJ3A 1NY0A 3LR0A 2JBFA 5M19A 2ZC4B 4I39A 5GLAA 5CECA 3DTKA 1FOFA 4JXWA 2FFFB 4EXOA 3GRJA 3LEQA 2Y2HA 2EX9A 3K3DA 2V1ZA 4P6ZM 1ONHA 4YFMA 2HGVA 2WGVA 5F5YA 3SH7A 3TRCA 1QMFA 2XD1A 3MZEA 4JF5A 3NY4A 1S67L 2HP6A 4Y17A 4C3QA 5HD5A 3IHAA 5AQBA 1NXYA 4DMZA 2D02A 3HLGA 4HH2A 3ZGAB 3UO9A 3MSHA 1J3WA 5DF9A 4IJGA 2EX8A 1PI5A 2BASA 1BLHA 2EXAA 4ZAMA 5EVID 3BQ8A 2VV8A 3NCKA 5E2FA 3VP4A 4H8RA 4E3JA 2XA7S 4X55A 3T4TA 4R4RA 5CHMA 4OP5A 5E2GA 2PBYA 1LSVA 1MWSA 3QP5A 4FUWA 3PTEA 3VP2A 4KZAA 1ES4A 3FC7A 4OPQA 2Z6CA 3OPLA 3DBAA 1XX2A 1K4EA 3G30A 3IX8A 3E2KA 1JTDA 4LRXC 2Y2MA 3IXDA 3HL9A 3VV4A 1C3BA 4KZBA 3HLWA 4AFIA 3HLEA 1G6OA 3VMAA 1UWNX 4N9LA 4DDYA 1T1AA 3GSGA 3K3CA 3VP1A 5L2FA 1P97A 3M2KA 1NLZA 3PAEA 4WM9A 4EEPA 4QJGA 2JC7A 2CC1A 4OOYA 2H5SA 4WL9A 1XGJA 2VGLS 4E6WA 1ERQA 4JXVA 4OPZA 4OPRA 4Y13A 1PWGA 4Q0HA 3SW1A 1EW0A 3TE8A 4KUOA 5GLDA 2VV6A 3NHQA 3VSKA 3MXSA 4N9KA 4QY5A 4NXEA 4WMCA 5J3WA 3IS2B 2Q9MA 4RA7A 3WRZA 3UNWA 2ZQ8A 3VFHA 4KZ8A 2RCXA 2XA7M 2E8JA 2QHKA 4KZ4A 1STZA 3HJKA 1YMSA 4EW7A 1OTIA 3IX4A 1DRMA 3VP3A 3UB9A 3VE4A 1PW1A 1BTLA 1U60A 5L09A 3WS2A 5CGXA 3OC2A 4DE2A 3TG9A 1SKFA 3ZYTA 3BW6A 3T1XA 4OQ0A 5FI7A 4ETZA 1S0WA 1FSYA 4GD6A 4GB7A 5HWVA 3DAVA 3LY3A 3R4KA 3N8LA 1DJAA 3UN7A 4KZ6A 1W63Q 3DTEA 5TFQA 1EI5A 1KGGA 1Y54A 1BLPA 5FQMA 1SDNA 2ZM0A 4LV2A 4D60A 5DTKA 4Y3IA 4R6LA 3MZDA 2JKGA 3N6IA 1GHMA 1XJ6A 3CHWP 4LRYC 1OMEA 5KSCA 1MWUA 1FQGA 1KGEA 1XGIA 4WEJA 3MR0A 3UB8A 3SZTA 4OQHA 1K57C 3GECA 5FAQA 4BMWA 4MEZA 3T1RA 3IH8A 3SS4A 3ZVWA 1IKGA 3FPWA 2EFXA 3FKWA 3HREA 3RTYA 4R0QA 2ZMVA 4S2IA 5TJJA 4X6TA 5CTMA 5GLCA 4IUHA 3F1OA 2Y4AA 1KE4A 4CLCD 5CRFA 2WADA 2K31A 2J7VA 3E0YA 4PM6A 3NJAA 2J8YA 2QYBA 4L9EA 3SS3A 1F98A 1IYQA 2WZZA 3VOLA 1HTZA 4BENA 5TGFA 4EQIA 4S2LA 1N4OA 1S4SA 1BT5A 1BUEA 1DP6A 1CK3A 4HQAA 5HSQA 4QHCA 1PFLA 4JF6A 2VGJA 3E4OA 3QP4A 4EBLA 3MFXA 3LCEA 1N9OA 2EA9A 1IKIA 2BLSA 4R3JA 1L0EA 2H10A 4OPYA 2VK3A 5E43A 2KDKA 3UB5P 1WYBA 4PHTA 3F1PB 1L0GA 3BRMA 4KQDA 4MBFA 3EGDC 3KSFA 2ZQ7A 3JPUA 5GLBA 1NJ4A 2HJ9C 1HLUP 4DJ3A 3PBSA 1VETA 4BL2A 3OLOA 5KZHA 1H8MA 3T50A 4UA9A 3NULA 3OPHA 4MMNA 4Y2FA 5K5BA 4LV1A 4X1MA 1N9NA 1K4FA 2L0WA 2WGWB 2H0TA 4KG2A 3BM6A 4B9OA 1KOUA 4EEUA 3F1PA 2P04A 1ZG4A 5A91A 3NOTC 1IFQA 5M18A 4KQQA 5FA7A 1XA7A 5EVIB 4BBUA 1PIOA 1PWCA 1PWDA 5HPIA 5DJUA 1GA0A 3QP6A 4EU0A 3S4XA 2B95A 2WYXA 3HUOA 5F1GA 4JGPA 3C8CA 2HP9A 4OLGA 4HJ6A 3LR3A 2E8IA 2ZQCA 3EOIA 5G4ZA 3IWIA 1K25A 1LL9A 3Q7VB 3EQUA 5CGWA 3LYXA 2J9PA 4GJ4A 3HCYA 2WZXA 2PYRA 1L0FA 2INWA 1YLJA 3M6BA 1YQSA 5DF8A 1XP4A 1SHVA 4G3KA 1FSWA 1RGZA 1H0MA 3DTMA 4JXGA 1BLSA 3MS6A 5IT5A 1XJ4A 1H5XA 3DW0A 3A3DA 3BFEA 4HESA 4I3AA 4JPMA 3O5YA 2J3TC 2WKIA 3GQZA 3WS4A 4UA6A 3T4JA 3V3SA 3MJQA 3ZG9B 4MN7A 1MKMA 5FQQA 4MN6A 3Q7VA 3W2ZA 5HDCA 3KSIA 4K0WA 1YLPA 5DTTA 5F83A 4M3KA 1GCEA 4R1GA 3D3OA 4MN5A 2Y55A 5GL9A 1TF1A 4GLQA 2P7JA 4WN5A 5G4YA 3EQVA 1V9ZA 4IVKA 1ZKJA 4E6XA 2J80A 3E98A 2O0YA 2HP5A 3LICA 1MZUA 3TW8A 3B47A 4R4SA 1CEFA 3AGFA 2A49A 3CG5A 4JGRA 4Y7PA 1GSXA 2K7SA 2JKRM 3V5MA 4JXSA 1W7FA 3MXQA 4KZ5A 4BWIA 1PYYA 2C5WB 5KSHA 4Q8IA 5DFYA 4OLDA 3RXXA 1AXBA 1NRJA 2ZJ9A 4ZBEA 3BEBA 5E2EA 3CJMA 2GJ3A 1T19A 4WYYA 4L9FA 4IBRA 4EUVA 3IQAA 3AGEA 1YMXA 1S4RA 4DXBA 4JF4A 1YLYA 4CQHA 1GSVA 3T4LA 2HDRA 3VOYA 1TDGA 3UPPA 5HZHA 2V20A 3MFDA 4S2NC 1A0KA 4FD8A 3MQQA 2O9BA 4I3JA 1UWPX 4P6BA 1P0ZA 4RX3A 2ZC5B 2ZC6B 5CEBA 2ACGA 2ZM2A 4Z1WA 5HAPA 5D3OA 4RYEA 5FDSA 4ZDXA 5DF7A 3RXWA 4EBNA 1F5MA 5EECA 1GHPA 4OP8A 3GTCA 3P98A 2VLGA 4FH4A 2LB9A 3ZG0A 2WAFA 2Q0OA 3LIFA 3BFDA 3HLCA 2FFYA 2W3GA 1K56D 4UQIM 3HVFA 5EVIC 2PBDP 3GR2A 3ITBA 4KQOA 3FG8A 3BECA 3R7WB 3W4QA 2ZOHA 4CLCB 1Q2PA 4N1HA 3PBNA 1PW8A 1RP5A 1L2SA 5CHUA 5FDHA 2W3DA 1K57A 4RX2A 4QWOA 3CZDA 5FEGA 5A92A 2PT7A 2QWSA 3S7PA 4RVAA 3KYZA 1RCJA 5L8MA 3C7VA 2NUPC 3C7UA 3G6OA 2B5RA 2H28A 3VFFA 3ZDJA 1I2WA 3UB7A 5AQ7A 4HJ4A 1VB6A 3OZHA 3FYZA 4UA7A 1F9IA 5JYPA 4N92A 3R7WA 1XXMA 3Q82A 4CLCA 1TS8A 5TBMB 3MKFA 4C6YA 1S1ZA 1YAXA 1YKDA 3O3VA 2YKHA 3KYEA 3QHYA 5DTSA 5CGSA 3IXBA 4CJNA 3LIAA 4PM9A 3PBOA 1L3LA 3A3IA 1YM1A 3CWFA 1FCMA 5M1AA 4HP4A 2Y79A 2X71A 4E04A 3WS0A 4R70A 2ZC7A 2G2UA 3MXRA 3PYPA 4OOLA 2DCFA 1M6KA 4D2OA 5DKKA 1P9WA 2ZMAA 5TBMA 3OCNA 3FWLA 3KX0X 2CMNA 3A0VA 2OAQ1 3N7WA 3N4IA 3UDXA 1L0DA 2HDSA 2V1AA 2R78A 3GVBA 2BG1A 2X02A 1MBLA 4IUKA 4NXGA 1DP8A 4MBHA 3IT9A 1CJFA 3NI9A 4GHIB 4BQMA 5GHXA 4B4ZA 2P08A 5DVAA 4XUZA 4X68A 1IYSA 3L9KA 3LR4A 5C5KA 5FI6A 1ALQA 3IS2A 2VGKA 3UE3A 1IELA 1WE4A 1Z09A 1YPRA 3SS5A 3VP0A 1E4DA 2JKTM 2M1CA 2O99A 4WEKA 3WRTA 4CPKA 4ESPA 1AWIA 5G18A 1OJGA 3C38A 3NIAA 3BQAA 3T12B 3T1QB 5HPFA 3O88A 2M7VA 2VGLM 4KG5A 5A90A 3A3EA 3ZG8B 4GHIA 3BJNA 4HP9A 4QB8A 1LL8A 4KQRA 1Q2QA 1V9YA 4BBVA 4ZJ1A 2PR5A 4X1LA 4DDSA 2Y2OA 4HIAA 3UDFA 3BFFA 1OTDA 4O01A 4B88A 4O0PA 3ZG5A 1W63M 4U0TA 4S2MA 1E3UA 3MBZA 4E3LA 2XF3A 1BULA 4MLLA 1ZTUA 1FILA 3MKEA 3GV9A 1O7EA 4O7DA 3C4PA 1ES5A 4PAUA 4GDNA 2H0YA 1NWZA 5AVEA 3HUMA 1ACFA 2LB5A 3HJIA 5A93A 2QMIA 1N9LA 2XDMA 4CLCC 4WUJA 4ZTKA 2W3FA 1LI0A 1H3QA 4HI4A 4B4XA 4K0XA 1Z6FA 4LRZE 4PPRA 1YSPA 1K55A 3O86A 5IS1A 5I5LA 4QU3A 2PRFA 2XFSA 4YINA 1G28A 4R38A 3WWXA 2ZLYA 3PAGA 3W8KA 2WKRA 2PU2A 4ZRRA 3ZHHA 4B93A 1TEMA 1T18A 2UWXA 4F3LB 4KZ9A 1XA1A 3WS1A 2XROA 1MWTA 3S7QA 1HZOA 3LIBA 5HAIA 5GHYA 4E3KA 4U0XA 1UGUA 4H6JB 4EWFA 5JYOA 3EGXC 2JHEA 3NECA 3BYDA 3QP2A 2I9VA 4I3IA 5F6AA 5FAPA 2JKRI 3KO6A 1W79A 4LLOB 1G6AA 2ZD8A 3BY8A 4Z9QA 4N1XA 1PRQA 4P85A 2UV0E 3IXGA 3LFVA 1MPLA 1TD5A 3OPRA 1BSGA 4EBPA 1GA9A 4F3LA 4Y15A 4U3TA 1ES3A 2ZMFA 2YKFA 4ARZB 1SZVA 2Y2KA 4MBKA 1FCOA 3DWKA 4DN0A 4Y0OA 4H6JA 3NC8A 4Y5FA 2ZC3B 4MDZA 4S2JA 5IHVA 2EX6A 5AJGA 4PM8A 3UB6A 1I2SA 3PBTA 3H7WB 1H8ZA 2DMWA 3RFBA 1K6SA 3T4KA 2W1RA 4R23A 3WS5A 4DF6A 4NETA 1WA9A 4LENA 2ZL1B 4II7A 2HDQA 5AVFA 2ZQAA 4K08A 3NDGA 3VSLA 3BFGA 1OTEA 4ZJ2A 4EUZA 1ZG6A 3D9YA 1SCWA 2J3WA 3ZNYA 4ARZA 1T1CA 2VV7A 4S2NA 4UEYA 1ESIA 4HH3A 2Z2LB 3BLMA 5CXWA 1E25A 3FPVA 3E4PA 1DP9A 4O8GA 5CX7A 5HWTA 1PZPA 4XXRA 3UE0A 3C2WA 1TS6A 3DTIA 2HDUA 1SDEA 2C6WB 3JVUA 2PDRA 2Y2QA 2WGWA 3EWKA 4FH2A 5F1FA 5AQAA 2ZL1A 4I38A 2OAP1 2QZ6A 5HARA 2J9OA 2W0NA 5EM0A 1VM1A 4DRTA 4GZBA 5EVIA 5F68A 3F1NB 5HDDA 5EM1A 1BLCA 3I7JA 2X01A 4E3OA 1K55C 3V67A 2W3HA 3ZVTA 3LUQA 1YSQA 1K54C 4P0MA 3ZNTA 5I94A 3T4OA 4E3MA 3PBQA 2Y2GA 1KGFA 1N9BA 1Y28A 2W1TB 1D7EA 4R3AA 3CITA 2KLIA 3B42A 4LFUA 3F1NA 2EX2A 4MCWA 3M6HA 3MQ0A 2VKSA 4KG6A 2XD5A 4JLFA 1ODVA 4GCZA 4LV0A 5EE8A 1OJ5A 4YOFA 4Y0UA 5A8BA 1KDSA 4S2KA 4EQ1A 5EV0A 1JTGA 2GZAA 2Y2JA 3UE1A 3S1YA 3MMHA 3BWLA 3ZG7B 1MKIA 5EVLA 2OWJA 3IXHA 4BBTA 4P87A 4A5RA 3C4OA 4QY6A 3W4PA 3H9WA 3ZQ5A 5CHJA 3VE3A 3NOPC 4KENB 1FR6A 2HF6A 1YLZA 2JCHA 4RQ9A 5HL1A 3QP1A 3ICYA 3B3XA 4ZJ3A 3G32A 4HEFA 4YWZA 3MQOA 2W3EA 5FQIA 3ULFA 2JKTI 3VOZA 4JGOA 3HBRA 2VA0A 2XR0A 1M40A 1IYPA 4KUKA 5L10A 1D1JA 4PKYA 1FCNA 4DE0A 3HLDA 2AVXA 1FIKA 5J8XA 2IWDA 4OQIA 2KOIA 4HBUA 2PAVP 4LCMA 1PZOA 2Z2MB 2OOLA 2VEAA 2G2WA 1K0KA 1P9RA 1VEUB 1W8YA 3TJZC 1LL5A 2R9XA 2Y2IA 1FR1A 4BD0A 2IWBA 3IF6B 1EROA 5CEDA 1K38A 2IA2A 3LIEA 1TS0A 4UHUA 4OKPA 3AGDA 1LLBA 1MC0A 3MF0A 5FQ9A 1CEGA 4I5SA 2XLNA 4GW9A 4HNBA 1VEUA 2WGIA 1S66L 4GKUA 3NOUC 1I5QA 1LSWA 1CQAA 1LSXA 3GMWA 3LEZA 1IYOA 3B33A 3CUEC 2VJWA 3IF6A 3ISGA 2WKHA 4IHQA 3IHBA 3A0RA 3JVVA 4HHDA 4HOIA 1KVLA 3IF5A 4S2OA 4C75A 2XSSA 2WKQA 5HAQA 2R9WA 2V1BA 3BLSA 5F69A 5FL3A 3Q81A 2EXBA 4DE1A 2I72A 1GSWA 4E3IA 2Q9NA 2W27A 2EFUA 1YT4A 2V0WA 3CI6A 4HBTA 2HV1A 3IX3A 4G3VA 1JVJA 2ZQDA 3U2AA 2QPNA 2A2LA 1XFQA 1CF0A 2ZM8A 1MWRA 2HJEA 3UMEA 4WZ5A 3BY9A 5MC7A 4BLMA 1LHYA 3KSGA 2OWHA 3ITAA 1DJBA 2B18A 1NYYA 3EEAA 1NZOA 2XQZA 1NLYA 4GS9B 3LO7A 2XH9A 1Y4OA 4EESA 2PR6A 5TR7A 5HW3A 2O9CA 2V9AA 4PKYG 3LY4A 3M2JA 2BTFP 3BFCA 5EOEA 4OONA 4NXFA 4XUXA 3FV7A 5CTNA 3MZFA 2IWCA 3FZCA 3CLOA 3A3JA 3N8SA 3G2YA 5EVEA 2QJ7A 3G31A 4GN2A 2WK0A 4M4XA 5J4EA 2V0UA 4GS9A 3N8RA 2A3UA 4BD1A 4OH0A 3UPNA 1TVFA 4FTXA 3LI9A 1H8YA 2FH5A 3O87A 5L07A 4HJ3A 5FQKA 2GX5A 1HVBA 3H82B 4HY8A 4WF0A 4NG2A 2P74A 1ZC2A 3NBLA 1ONGA 3F1OB 3QP8A 1KE3A 4FCFA 2ZBBA 3IF6C 4LPZA 4WBGA 3CAXA 1KDWA 1TDLA 4NKPA 3HLBA 5EPHA 3C30A 4WELA 2P9VB 5EUAA 2D01A 4ME4A 5LBRA 3HUNA 4YNRA 3H82A 4LGWA 2VZWA 2HPBA 3OPPA 1CI8A 1JWPA 1G68A 1OT9A 4LCLA 4IBXA 1K54A 1BYWA 4Q0IA 3D4FA 1VQQA 5FASA 3L7HA 3S22A 2V8CA 2GNXA 4ID4A 1X0OA 1IOUA 1VHMA 4LV3A 2Y2PA 1JNUA 3U4LP 5BOHA 3KSHA 1OTBA 2P9VA 1MXOA 4QD4A 3P01A 4WLAA 2OV5A 2FZ0A 1NRFA 2A24B 3K2NA 3OCLA 4PMAA 3T1SA 3DWZA 1ES2A 1OT6A 4KZ7A 4WZ5C 2XFTA 1W8QA 4WMCD 2JE5A 5FATA 1D06A 1VETB 4XT2B 3UE6A 4FOFA 1K6RA 3QNBA 2EWWA 5FEFA 2PD7A 1SKOB 2DNSA 3LI8A 4BL3A 3UPOA 1XFNA 3Q1FA 2JN7A 4UAAA 3KYQA 3QNCA 5IU1A 5CERA 1XJ2A 4EETB 4Q0JA 2ZQ9A 5EOOA 4OQGA 5HX9A 3PXPA 2O9AA 3FKVA 2A24A 2KX6A 2HZ5A 1WYCA 2NUTC 2B02A 2OLVA 2Y8HA 4IEDA 2PD8A 3C5AA 3TSGA 4XT2A 2Y59A 2XEPA 4JKTA 2PYPA 2JKFA 1SKOA 4IVIA 1OPXA 1ESUA 2Z6DA 3S7NA 4BJPA 5F82A 1CI9A 1IEMA 2QJ5A 2WKPA 1TS7A 1KVMA 5U47A 3RJUA 1LT0A 3PR6A 4EERA 3G4PA 2OLUA 1S1YA 3SH9A 4DJ2A 3CPTB 3V3RA 4JBFA 4X25A 3H7WA 3G34A 2V2FF 4GD8A 2G7UA 3IWQA 1XPBA 3UY6A 4PM7A 2OSUA 3IWOA 3OBFA 3A0SA 1OTAA 3A3FA 5AQ9A 1K56A 1MY8A 5E2HA 5FSRA 3W4OA 5J7EA 4ETXA 4PM5A 4NEED 1E3UD 4K91A 3E2LA 5HFOA 1S6RA 3CPTA 1DY6A 2MJ6A 3T4SA 3P7NA 2EWVA 1ZHHB 3UMDA 5EFWA 1JWVA 3IH9A 3CMZA 3TOIA 3P09A 3HLFA 3OOVA 1BZAA 2WKEA 3G35A 1KE0A 5KMWA 5DFXA 1W5DA 1EWZA 4MNRA 3ZCZA 2V8FA 2ZOIA 2GDNA 2PHYA 1QMEA 1NZUA 4NXBA 4Y0TA 3LIDA 1F2KA 2XGNA 2J3TD 4WZ4A 4S2PA 3CUEA 3D72A 3V39A 4GDBA 5KIZA 1G5UA 2WAEA 4NK3A 4R3BA 1PNEA 5GHZA 2L4RA 3GDIA 4L0LA 4CLCE 5HDSA 3PHYA 2M7UA 4X53A 2VX8A 1T1BA 2DRWA 4EV4A 3G2ZA 4L9GA 3Q7ZA 1YLTA 3IBRA 4P6ZS 5FAOA 5HD3A 3T4QA 2RL3A 3LR5A 4JGQA 1XKZA 3S7OA 2PU4A 2XRNA 2WUQA 2W1TA 1GHIA 5HL6A 5DJTA 3RH8B 5FI2A 4F94A 3PBRA 5DKLA 4E3NA 2QKPA 3NDEA 5HWWA 2Y2NA 1NYMA 1O07A 3SH8A 4UQIS 1DJCA 4X69A 1PI4A 3V50A 3IBJA 1HD8A 1RGYA 3UDIA 3Q07A 3JYIA 4KZ3A 1ERMA 3ZFZA 4GNUA 4DKIA 4FSFA 2XK1A 3SOIA 4OOMA 4G3WA 1LI9A 4X56A 2L1MA 3LGOA 4DE3A 4OVDA 4QPRA
chains in the Genus database with same CATH topology
2QPNA 2E8IA 2ZQCA 4QU3A 3IWIA 4DXCA 1JWZA 1K25A 1LL9A 2Y91A 3EQUA 2XFSA 3Q7VB 4YINA 5FQJA 2ZM8A 4GOGA 1MWRA 5CGWA 2J9PA 3WWXA 2ZLYA 3PAGA 3W8KA 2PU2A 4WZ5A 1YLWA 3ZHHA 4BLMA 1TEMA 2Y2LA 1J9MA 1NY0A 1LHYA 2WZXA 2JBFA 5M19A 1L0FA 2ZC4B 1YLJA 2UWXA 3M6BA 1YQSA 4KZ9A 1XA1A 1DJBA 3ITAA 5DF8A 3WS1A 1XP4A 1SHVA 5GLAA 1FSWA 1MWTA 5CECA 1FOFA 1HZOA 4JXWA 1RGZA 5HAIA 2FFFB 1NYYA 3GRJA 5GHYA 4E3KA 4U0XA 3DTMA 4JXGA 1NZOA 2XQZA 2Y2HA 1BLSA 2EX9A 3LO7A 2V1ZA 2XH9A 1ONHA 1H5XA 3DW0A 4YFMA 4EWFA 2WGVA 3A3DA 3SH7A 3BFEA 4HESA 5JYOA 4JPMA 1QMFA 5TR7A 2XD1A 3MZEA 3BYDA 5HW3A 4JF5A 2WKIA 3GQZA 3NY4A 5FAPA 3WS4A 1W79A 4UA6A 2HP6A 3LY4A 3V3SA 1G6AA 3M2JA 4C3QA 3ZG9B 3IHAA 5AQBA 5FQQA 1NXYA 3HLGA 2ZD8A 3Q7VA 3ZGAB 3BFCA 3UO9A 4Z9QA 5EOEA 4N1XA 4OONA 5DF9A 4K0WA 1YLPA 4XUXA 4P85A 5DTTA 5F83A 3IXGA 2EX8A 4M3KA 1MPLA 3FV7A 1GCEA 5CTNA 4R1GA 1PI5A 3MZFA 1BLHA 1BSGA 2EXAA 2IWCA 3OPRA 3NCKA 5E2FA 5EVID 3FZCA 4ZAMA 4EBPA 3VP4A 1GA9A 2Y55A 4H8RA 4E3JA 4X55A 5GL9A 4R4RA 3A3JA 3N8SA 3G2YA 4U3TA 1ES3A 3G31A 5CHMA 4GN2A 4OP5A 5E2GA 2PBYA 2WK0A 1MWSA 2Y2KA 4MBKA 1FCOA 3DWKA 3PTEA 3VP2A 3N8RA 2A3UA 4KZAA 4Y0OA 4BD1A 3NC8A 3EQVA 4OH0A 1ES4A 3UPNA 4IVKA 1ZKJA 1TVFA 2ZC3B 4S2JA 5IHVA 1H8YA 3O87A 4OPQA 4E6XA 2EX6A 3OPLA 4PM8A 1XX2A 1I2SA 1K4EA 3PBTA 5FQKA 1HVBA 2HP5A 1H8ZA 3G30A 3E2KA 1JTDA 2Y2MA 1K6SA 4R23A 3IXDA 3WS5A 4DF6A 4R4SA 1CEFA 2P74A 2A49A 3AGFA 3CG5A 3HL9A 4NETA 4Y7PA 1ZC2A 3NBLA 1C3BA 4LENA 4KZBA 3V5MA 1ONGA 4JXSA 2HDQA 3HLWA 3HLEA 1W7FA 3VMAA 4KZ5A 2ZQAA 4N9LA 1PYYA 3NDGA 4DDYA 3VSLA 2C5WB 3BFGA 3GSGA 5KSHA 4Q8IA 3VP1A 4ZJ2A 4EUZA 5L2FA 1ZG6A 3ZNYA 1SCWA 3M2KA 4OLDA 3RXXA 3PAEA 4S2NA 4WM9A 4QJGA 2JC7A 1AXBA 1ESIA 1KE3A 2CC1A 4FCFA 3IF6C 4WBGA 4OOYA 2Z2LB 2ZJ9A 4ZBEA 3BLMA 3BEBA 1KDWA 1TDLA 1E25A 2H5SA 5CXWA 5E2EA 1XGJA 3HLBA 4E6WA 3CJMA 1ERQA 1PZPA 5EPHA 4JXVA 4OPZA 4WELA 4XXRA 3UE0A 2P9VB 5EUAA 4OPRA 4WYYA 4IBRA 3IQAA 3AGEA 2HDUA 3HUNA 1SDEA 1PWGA 1YMXA 4DXBA 2C6WB 4JF4A 1YLYA 2HPBA 3OPPA 1CI8A 1JWPA 2Y2QA 2WGWA 2HDRA 4FH2A 5GLDA 3VOYA 1G68A 5F1FA 5AQAA 1TDGA 3UPPA 3VSKA 2V20A 4LCLA 3MFDA 3MXSA 1K54A 4FD8A 4IBXA 4N9KA 4S2NC 2QZ6A 4QY5A 4WMCA 5HARA 3D4FA 2Q9MA 1VQQA 4P6BA 4RA7A 4RX3A 2J9OA 3WRZA 3UNWA 5FASA 3S22A 2ZC5B 2ZQ8A 3VFHA 1VM1A 4ID4A 2ZC6B 4DRTA 5CEBA 2ZM2A 4KZ8A 2RCXA 4GZBA 5EVIA 5HAPA 4KZ4A 5D3OA 4RYEA 4ZDXA 5DF7A 4LV3A 3RXWA 2Y2PA 1YMSA 4EBNA 1BLCA 3I7JA 5BOHA 2X01A 4E3OA 2P9VA 5EECA 1K55C 1MXOA 4QD4A 3VP3A 2OV5A 1PW1A 1GHPA 1BTLA 4OP8A 3GTCA 3ZVTA 3P98A 1U60A 1NRFA 3WS2A 3OCLA 4PMAA 4FH4A 3DWZA 3OC2A 5CGXA 1ES2A 1K54C 3TG9A 1SKFA 2WAFA 4KZ7A 3ZG0A 4WZ5C 4DE2A 4P0MA 3BFDA 2XFTA 3HLCA 2FFYA 1W8QA 4WMCD 2JE5A 4OQ0A 5FATA 5FI7A 3ZNTA 5I94A 1S0WA 1K56D 1FSYA 4GD6A 1K6RA 3QNBA 4GB7A 3HVFA 5EVIC 4E3MA 3GR2A 3PBQA 2Y2GA 1KGFA 3LY3A 3ITBA 1N9BA 3N8LA 2DNSA 4BL3A 1DJAA 3UPOA 3UN7A 4KQOA 3Q1FA 4KZ6A 4UAAA 3BECA 3W4QA 2EX2A 1Q2PA 3M6HA 3QNCA 4N1HA 3PBNA 1PW8A 1RP5A 5CERA 4KG6A 1L2SA 2XD5A 2ZQ9A 5EOOA 4JLFA 4OQGA 5CHUA 5TFQA 1EI5A 4LV0A 1KGGA 5FDHA 5EE8A 5HX9A 1Y54A 1K57A 1BLPA 5FQMA 1SDNA 4RX2A 3FKVA 2ZM0A 4Y0UA 4LV2A 3CZDA 5DTKA 1WYCA 5A92A 1KDSA 3MZDA 4S2KA 4RVAA 2OLVA 3N6IA 4IEDA 1RCJA 3C7VA 3C7UA 3C5AA 1GHMA 3TSGA 2B5RA 3VFFA 3ZDJA 1I2WA 1JTGA 2Y2JA 3UE1A 3S1YA 2Y59A 2XEPA 4JKTA 5AQ7A 3OZHA 3FYZA 4UA7A 1OMEA 3ZG7B 1MKIA 5KSCA 1MWUA 5EVLA 1FQGA 4IVIA 1ESUA 1KGEA 1XGIA 3IXHA 5JYPA 4BJPA 4P87A 1CI9A 1IEMA 4N92A 5F82A 4WEJA 4A5RA 1KVMA 5U47A 3RJUA 3C4OA 1XXMA 3Q82A 4QY6A 3W4PA 4OQHA 1K57C 5CHJA 5FAQA 3G4PA 1FR6A 2OLUA 3MKFA 3IH8A 4KENB 4MEZA 3SH9A 4C6YA 3SS4A 3O3VA 3QHYA 5DTSA 3V3RA 5CGSA 3IXBA 4JBFA 4CJNA 1YLZA 3ZVWA 1IKGA 2JCHA 4PM9A 3PBOA 2EFXA 5HL1A 3G34A 3A3IA 2V2FF 1YM1A 3B3XA 4GD8A 1FCMA 5M1AA 3FKWA 3IWQA 3HREA 1XPBA 4ZJ3A 3UY6A 3G32A 4PM7A 2OSUA 4R0QA 4HEFA 3IWOA 4S2IA 4X6TA 5CTMA 5FQIA 2X71A 3WS0A 5GLCA 2ZC7A 2G2UA 3VOZA 3HBRA 2Y4AA 2XR0A 1KE4A 3MXRA 4OOLA 3A3FA 1M40A 1IYPA 2DCFA 5AQ9A 1K56A 1MY8A 2WADA 5CRFA 5E2HA 5FSRA 3W4OA 2J7VA 1M6KA 4D2OA 1FCNA 4PM5A 4PM6A 2ZMAA 3OCNA 1E3UD 3FWLA 4K91A 2J8YA 3E2LA 4DE0A 3HLDA 3N7WA 5HFOA 1S6RA 3N4IA 3SS3A 3UDXA 1DY6A 1L0DA 5J8XA 2WZZA 1IYQA 2HDSA 2IWDA 1HTZA 4OQIA 3GVBA 4BENA 4HBUA 2BG1A 2X02A 1MBLA 5TGFA 4LCMA 1PZOA 4EQIA 4S2LA 1JWVA 1N4OA 2Z2MB 3IH9A 4MBHA 3IT9A 3NI9A 4BQMA 3CMZA 2G2WA 3TOIA 1BT5A 3P09A 5GHXA 4B4ZA 3HLFA 1BUEA 1BZAA 5DVAA 2WKEA 3G35A 1CK3A 1W8YA 1KE0A 4XUZA 5KMWA 1W5DA 4QHCA 1EWZA 4X68A 1LL5A 4MNRA 3ZCZA 1IYSA 5FI6A 2GDNA 1ALQA 3UE3A 2VGKA 1QMEA 2R9XA 2VGJA 1FR1A 1NZUA 2Y2IA 4JF6A 4BD0A 1IELA 2IWBA 1WE4A 4Y0TA 4EBLA 3IF6B 3LCEA 3SS5A 2XGNA 3VP0A 1E4DA 1IKIA 1EROA 5CEDA 4WZ4A 2BLSA 4R3JA 1K38A 4S2PA 4WEKA 1L0EA 2H10A 4OPYA 5E43A 3WRTA 4CPKA 4UHUA 4OKPA 3AGDA 5G18A 1LLBA 4GDBA 3V39A 2WAEA 3NIAA 4NK3A 4R3BA 5FQ9A 5GHZA 1WYBA 4L0LA 3O88A 1CEGA 1L0GA 3BRMA 4KG5A 2XLNA 4MBFA 3A3EA 4X53A 5A90A 3ZG8B 2DRWA 2ZQ7A 4EV4A 5GLBA 3G2ZA 1NJ4A 3Q7ZA 2WGIA 4QB8A 4GKUA 1YLTA 1I5QA 3PBSA 4BL2A 5FAOA 4KQRA 5KZHA 1Q2QA 2RL3A 3GMWA 4ZJ1A 3LEZA 1XKZA 4UA9A 1IYOA 2PU4A 2WUQA 3OPHA 1GHIA 4LV1A 3IF6A 3ISGA 4DDSA 2WKHA 5FI2A 4F94A 3IHBA 3PBRA 4E3NA 2Y2OA 3UDFA 1K4FA 3NDEA 2Y2NA 1NYMA 1O07A 3BFFA 3SH8A 1KVLA 2H0TA 2WGWB 3IF5A 1DJCA 4KG2A 4S2OA 4B88A 4X69A 1PI4A 3BM6A 3ZG5A 4C75A 4U0TA 4S2MA 1E3UA 3V50A 3MBZA 1HD8A 1ZG4A 2R9WA 5HAQA 1RGYA 4E3LA 2XF3A 3UDIA 5A91A 3BLSA 3Q07A 1BULA 3JYIA 4KZ3A 4MLLA 1ERMA 3ZFZA 4GNUA 3Q81A 2EXBA 3MKEA 4DKIA 4DE1A 3GV9A 1O7EA 5M18A 4FSFA 4KQQA 4O7DA 3C4PA 2XK1A 5FA7A 3SOIA 1XA7A 4OOMA 1ES5A 5EVIB 2I72A 4GDNA 2H0YA 4E3IA 1PIOA 1PWCA 2Q9NA 3HUMA 1PWDA 1LI9A 5A93A 2QMIA 2EFUA 1YT4A 2XDMA 4X56A 1GA0A 4ZTKA 3S4XA 4DE3A 4HBTA 1LI0A 2WYXA 4OVDA 1JVJA 3HUOA 5F1GA 4B4XA 2ZQDA 4K0XA 1Z6FA 4PPRA 2HP9A 4OLGA 1K55A 3O86A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QPN A;  2E8I A;  2ZQC A;  4QU3 A;  3IWI A;  4DXC A;  1JWZ A;  1K25 A;  1LL9 A;  2Y91 A;  3EQU A;  2XFS A;  3Q7V B;  4YIN A;  5FQJ A;  2ZM8 A;  4GOG A;  1MWR A;  5CGW A;  2J9P A;  3WWX A;  2ZLY A;  3PAG A;  3W8K A;  2PU2 A;  4WZ5 A;  1YLW A;  3ZHH A;  4BLM A;  1TEM A;  2Y2L A;  1J9M A;  1NY0 A;  1LHY A;  2WZX A;  2JBF A;  5M19 A;  1L0F A;  2ZC4 B;  1YLJ A;  2UWX A;  3M6B A;  1YQS A;  4KZ9 A;  1XA1 A;  1DJB A;  3ITA A;  5DF8 A;  3WS1 A;  1XP4 A;  1SHV A;  5GLA A;  1FSW A;  1MWT A;  5CEC A;  1FOF A;  1HZO A;  4JXW A;  1RGZ A;  5HAI A;  2FFF B;  1NYY A;  3GRJ A;  5GHY A;  4E3K A;  4U0X A;  3DTM A;  4JXG A;  1NZO A;  2XQZ A;  2Y2H A;  1BLS A;  2EX9 A;  3LO7 A;  2V1Z A;  2XH9 A;  1ONH A;  1H5X A;  3DW0 A;  4YFM A;  4EWF A;  2WGV A;  3A3D A;  3SH7 A;  3BFE A;  4HES A;  5JYO A;  4JPM A;  1QMF A;  5TR7 A;  2XD1 A;  3MZE A;  3BYD A;  5HW3 A;  4JF5 A;  2WKI A;  3GQZ A;  3NY4 A;  5FAP A;  3WS4 A;  1W79 A;  4UA6 A;  2HP6 A;  3LY4 A;  3V3S A;  1G6A A;  3M2J A;  4C3Q A;  3ZG9 B;  3IHA A;  5AQB A;  5FQQ A;  1NXY A;  3HLG A;  2ZD8 A;  3Q7V A;  3ZGA B;  3BFC A;  3UO9 A;  4Z9Q A;  5EOE A;  4N1X A;  4OON A;  5DF9 A;  4K0W A;  1YLP A;  4XUX A;  4P85 A;  5DTT A;  5F83 A;  3IXG A;  2EX8 A;  4M3K A;  1MPL A;  3FV7 A;  1GCE A;  5CTN A;  4R1G A;  1PI5 A;  3MZF A;  1BLH A;  1BSG A;  2EXA A;  2IWC A;  3OPR A;  3NCK A;  5E2F A;  5EVI D;  3FZC A;  4ZAM A;  4EBP A;  3VP4 A;  1GA9 A;  2Y55 A;  4H8R A;  4E3J A;  4X55 A;  5GL9 A;  4R4R A;  3A3J A;  3N8S A;  3G2Y A;  4U3T A;  1ES3 A;  3G31 A;  5CHM A;  4GN2 A;  4OP5 A;  5E2G A;  2PBY A;  2WK0 A;  1MWS A;  2Y2K A;  4MBK A;  1FCO A;  3DWK A;  3PTE A;  3VP2 A;  3N8R A;  2A3U A;  4KZA A;  4Y0O A;  4BD1 A;  3NC8 A;  3EQV A;  4OH0 A;  1ES4 A;  3UPN A;  4IVK A;  1ZKJ A;  1TVF A;  2ZC3 B;  4S2J A;  5IHV A;  1H8Y A;  3O87 A;  4OPQ A;  4E6X A;  2EX6 A;  3OPL A;  4PM8 A;  1XX2 A;  1I2S A;  1K4E A;  3PBT A;  5FQK A;  1HVB A;  2HP5 A;  1H8Z A;  3G30 A;  3E2K A;  1JTD A;  2Y2M A;  1K6S A;  4R23 A;  3IXD A;  3WS5 A;  4DF6 A;  4R4S A;  1CEF A;  2P74 A;  2A49 A;  3AGF A;  3CG5 A;  3HL9 A;  4NET A;  4Y7P A;  1ZC2 A;  3NBL A;  1C3B A;  4LEN A;  4KZB A;  3V5M A;  1ONG A;  4JXS A;  2HDQ A;  3HLW A;  3HLE A;  1W7F A;  3VMA A;  4KZ5 A;  2ZQA A;  4N9L A;  1PYY A;  3NDG A;  4DDY A;  3VSL A;  2C5W B;  3BFG A;  3GSG A;  5KSH A;  4Q8I A;  3VP1 A;  4ZJ2 A;  4EUZ A;  5L2F A;  1ZG6 A;  3ZNY A;  1SCW A;  3M2K A;  4OLD A;  3RXX A;  3PAE A;  4S2N A;  4WM9 A;  4QJG A;  2JC7 A;  1AXB A;  1ESI A;  1KE3 A;  2CC1 A;  4FCF A;  3IF6 C;  4WBG A;  4OOY A;  2Z2L B;  2ZJ9 A;  4ZBE A;  3BLM A;  3BEB A;  1KDW A;  1TDL A;  1E25 A;  2H5S A;  5CXW A;  5E2E A;  1XGJ A;  3HLB A;  4E6W A;  3CJM A;  1ERQ A;  1PZP A;  5EPH A;  4JXV A;  4OPZ A;  4WEL A;  4XXR A;  3UE0 A;  2P9V B;  5EUA A;  4OPR A;  4WYY A;  4IBR A;  3IQA A;  3AGE A;  2HDU A;  3HUN A;  1SDE A;  1PWG A;  1YMX A;  4DXB A;  2C6W B;  4JF4 A;  1YLY A;  2HPB A;  3OPP A;  1CI8 A;  1JWP A;  2Y2Q A;  2WGW A;  2HDR A;  4FH2 A;  5GLD A;  3VOY A;  1G68 A;  5F1F A;  5AQA A;  1TDG A;  3UPP A;  3VSK A;  2V20 A;  4LCL A;  3MFD A;  3MXS A;  1K54 A;  4FD8 A;  4IBX A;  4N9K A;  4S2N C;  2QZ6 A;  4QY5 A;  4WMC A;  5HAR A;  3D4F A;  2Q9M A;  1VQQ A;  4P6B A;  4RA7 A;  4RX3 A;  2J9O A;  3WRZ A;  3UNW A;  5FAS A;  3S22 A;  2ZC5 B;  2ZQ8 A;  3VFH A;  1VM1 A;  4ID4 A;  2ZC6 B;  4DRT A;  5CEB A;  2ZM2 A;  4KZ8 A;  2RCX A;  4GZB A;  5EVI A;  5HAP A;  4KZ4 A;  5D3O A;  4RYE A;  4ZDX A;  5DF7 A;  4LV3 A;  3RXW A;  2Y2P A;  1YMS A;  4EBN A;  1BLC A;  3I7J A;  5BOH A;  2X01 A;  4E3O A;  2P9V A;  5EEC A;  1K55 C;  1MXO A;  4QD4 A;  3VP3 A;  2OV5 A;  1PW1 A;  1GHP A;  1BTL A;  4OP8 A;  3GTC A;  3ZVT A;  3P98 A;  1U60 A;  1NRF A;  3WS2 A;  3OCL A;  4PMA A;  4FH4 A;  3DWZ A;  3OC2 A;  5CGX A;  1ES2 A;  1K54 C;  3TG9 A;  1SKF A;  2WAF A;  4KZ7 A;  3ZG0 A;  4WZ5 C;  4DE2 A;  4P0M A;  3BFD A;  2XFT A;  3HLC A;  2FFY A;  1W8Q A;  4WMC D;  2JE5 A;  4OQ0 A;  5FAT A;  5FI7 A;  3ZNT A;  5I94 A;  1S0W A;  1K56 D;  1FSY A;  4GD6 A;  1K6R A;  3QNB A;  4GB7 A;  3HVF A;  5EVI C;  4E3M A;  3GR2 A;  3PBQ A;  2Y2G A;  1KGF A;  3LY3 A;  3ITB A;  1N9B A;  3N8L A;  2DNS A;  4BL3 A;  1DJA A;  3UPO A;  3UN7 A;  4KQO A;  3Q1F A;  4KZ6 A;  4UAA A;  3BEC A;  3W4Q A;  2EX2 A;  1Q2P A;  3M6H A;  3QNC A;  4N1H A;  3PBN A;  1PW8 A;  1RP5 A;  5CER A;  4KG6 A;  1L2S A;  2XD5 A;  2ZQ9 A;  5EOO A;  4JLF A;  4OQG A;  5CHU A;  5TFQ A;  1EI5 A;  4LV0 A;  1KGG A;  5FDH A;  5EE8 A;  5HX9 A;  1Y54 A;  1K57 A;  1BLP A;  5FQM A;  1SDN A;  4RX2 A;  3FKV A;  2ZM0 A;  4Y0U A;  4LV2 A;  3CZD A;  5DTK A;  1WYC A;  5A92 A;  1KDS A;  3MZD A;  4S2K A;  4RVA A;  2OLV A;  3N6I A;  4IED A;  1RCJ A;  3C7V A;  3C7U A;  3C5A A;  1GHM A;  3TSG A;  2B5R A;  3VFF A;  3ZDJ A;  1I2W A;  1JTG A;  2Y2J A;  3UE1 A;  3S1Y A;  2Y59 A;  2XEP A;  4JKT A;  5AQ7 A;  3OZH A;  3FYZ A;  4UA7 A;  1OME A;  3ZG7 B;  1MKI A;  5KSC A;  1MWU A;  5EVL A;  1FQG A;  4IVI A;  1ESU A;  1KGE A;  1XGI A;  3IXH A;  5JYP A;  4BJP A;  4P87 A;  1CI9 A;  1IEM A;  4N92 A;  5F82 A;  4WEJ A;  4A5R A;  1KVM A;  5U47 A;  3RJU A;  3C4O A;  1XXM A;  3Q82 A;  4QY6 A;  3W4P A;  4OQH A;  1K57 C;  5CHJ A;  5FAQ A;  3G4P A;  1FR6 A;  2OLU A;  3MKF A;  3IH8 A;  4KEN B;  4MEZ A;  3SH9 A;  4C6Y A;  3SS4 A;  3O3V A;  3QHY A;  5DTS A;  3V3R A;  5CGS A;  3IXB A;  4JBF A;  4CJN A;  1YLZ A;  3ZVW A;  1IKG A;  2JCH A;  4PM9 A;  3PBO A;  2EFX A;  5HL1 A;  3G34 A;  3A3I A;  2V2F F;  1YM1 A;  3B3X A;  4GD8 A;  1FCM A;  5M1A A;  3FKW A;  3IWQ A;  3HRE A;  1XPB A;  4ZJ3 A;  3UY6 A;  3G32 A;  4PM7 A;  2OSU A;  4R0Q A;  4HEF A;  3IWO A;  4S2I A;  4X6T A;  5CTM A;  5FQI A;  2X71 A;  3WS0 A;  5GLC A;  2ZC7 A;  2G2U A;  3VOZ A;  3HBR A;  2Y4A A;  2XR0 A;  1KE4 A;  3MXR A;  4OOL A;  3A3F A;  1M40 A;  1IYP A;  2DCF A;  5AQ9 A;  1K56 A;  1MY8 A;  2WAD A;  5CRF A;  5E2H A;  5FSR A;  3W4O A;  2J7V A;  1M6K A;  4D2O A;  1FCN A;  4PM5 A;  4PM6 A;  2ZMA A;  3OCN A;  1E3U D;  3FWL A;  4K91 A;  2J8Y A;  3E2L A;  4DE0 A;  3HLD A;  3N7W A;  5HFO A;  1S6R A;  3N4I A;  3SS3 A;  3UDX A;  1DY6 A;  1L0D A;  5J8X A;  2WZZ A;  1IYQ A;  2HDS A;  2IWD A;  1HTZ A;  4OQI A;  3GVB A;  4BEN A;  4HBU A;  2BG1 A;  2X02 A;  1MBL A;  5TGF A;  4LCM A;  1PZO A;  4EQI A;  4S2L A;  1JWV A;  1N4O A;  2Z2M B;  3IH9 A;  4MBH A;  3IT9 A;  3NI9 A;  4BQM A;  3CMZ A;  2G2W A;  3TOI A;  1BT5 A;  3P09 A;  5GHX A;  4B4Z A;  3HLF A;  1BUE A;  1BZA A;  5DVA A;  2WKE A;  3G35 A;  1CK3 A;  1W8Y A;  1KE0 A;  4XUZ A;  5KMW A;  1W5D A;  4QHC A;  1EWZ A;  4X68 A;  1LL5 A;  4MNR A;  3ZCZ A;  1IYS A;  5FI6 A;  2GDN A;  1ALQ A;  3UE3 A;  2VGK A;  1QME A;  2R9X A;  2VGJ A;  1FR1 A;  1NZU A;  2Y2I A;  4JF6 A;  4BD0 A;  1IEL A;  2IWB A;  1WE4 A;  4Y0T A;  4EBL A;  3IF6 B;  3LCE A;  3SS5 A;  2XGN A;  3VP0 A;  1E4D A;  1IKI A;  1ERO A;  5CED A;  4WZ4 A;  2BLS A;  4R3J A;  1K38 A;  4S2P A;  4WEK A;  1L0E A;  2H10 A;  4OPY A;  5E43 A;  3WRT A;  4CPK A;  4UHU A;  4OKP A;  3AGD A;  5G18 A;  1LLB A;  4GDB A;  3V39 A;  2WAE A;  3NIA A;  4NK3 A;  4R3B A;  5FQ9 A;  5GHZ A;  1WYB A;  4L0L A;  3O88 A;  1CEG A;  1L0G A;  3BRM A;  4KG5 A;  2XLN A;  4MBF A;  3A3E A;  4X53 A;  5A90 A;  3ZG8 B;  2DRW A;  2ZQ7 A;  4EV4 A;  5GLB A;  3G2Z A;  1NJ4 A;  3Q7Z A;  2WGI A;  4QB8 A;  4GKU A;  1YLT A;  1I5Q A;  3PBS A;  4BL2 A;  5FAO A;  4KQR A;  5KZH A;  1Q2Q A;  2RL3 A;  3GMW A;  4ZJ1 A;  3LEZ A;  1XKZ A;  4UA9 A;  1IYO A;  2PU4 A;  2WUQ A;  3OPH A;  1GHI A;  4LV1 A;  3IF6 A;  3ISG A;  4DDS A;  2WKH A;  5FI2 A;  4F94 A;  3IHB A;  3PBR A;  4E3N A;  2Y2O A;  3UDF A;  1K4F A;  3NDE A;  2Y2N A;  1NYM A;  1O07 A;  3BFF A;  3SH8 A;  1KVL A;  2H0T A;  2WGW B;  3IF5 A;  1DJC A;  4KG2 A;  4S2O A;  4B88 A;  4X69 A;  1PI4 A;  3BM6 A;  3ZG5 A;  4C75 A;  4U0T A;  4S2M A;  1E3U A;  3V50 A;  3MBZ A;  1HD8 A;  1ZG4 A;  2R9W A;  5HAQ A;  1RGY A;  4E3L A;  2XF3 A;  3UDI A;  5A91 A;  3BLS A;  3Q07 A;  1BUL A;  3JYI A;  4KZ3 A;  4MLL A;  1ERM A;  3ZFZ A;  4GNU A;  3Q81 A;  2EXB A;  3MKE A;  4DKI A;  4DE1 A;  3GV9 A;  1O7E A;  5M18 A;  4FSF A;  4KQQ A;  4O7D A;  3C4P A;  2XK1 A;  5FA7 A;  3SOI A;  1XA7 A;  4OOM A;  1ES5 A;  5EVI B;  2I72 A;  4GDN A;  2H0Y A;  4E3I A;  1PIO A;  1PWC A;  2Q9N A;  3HUM A;  1PWD A;  1LI9 A;  5A93 A;  2QMI A;  2EFU A;  1YT4 A;  2XDM A;  4X56 A;  1GA0 A;  4ZTK A;  3S4X A;  4DE3 A;  4HBT A;  1LI0 A;  2WYX A;  4OVD A;  1JVJ A;  3HUO A;  5F1G A;  4B4X A;  2ZQD A;  4K0X A;  1Z6F A;  4PPR A;  2HP9 A;  4OLG A;  1K55 A;  3O86 A; 
#chains in the Genus database with same CATH topology
 4DXC A;  1JWZ A;  3EEH A;  2Y91 A;  5FQJ A;  4GOG A;  3E4Q A;  2K2N A;  1YLW A;  2Y2L A;  1J9M A;  1XJ3 A;  1NY0 A;  3LR0 A;  2JBF A;  5M19 A;  2ZC4 B;  4I39 A;  5GLA A;  5CEC A;  3DTK A;  1FOF A;  4JXW A;  2FFF B;  4EXO A;  3GRJ A;  3LEQ A;  2Y2H A;  2EX9 A;  3K3D A;  2V1Z A;  4P6Z M;  1ONH A;  4YFM A;  2HGV A;  2WGV A;  5F5Y A;  3SH7 A;  3TRC A;  1QMF A;  2XD1 A;  3MZE A;  4JF5 A;  3NY4 A;  1S67 L;  2HP6 A;  4Y17 A;  4C3Q A;  5HD5 A;  3IHA A;  5AQB A;  1NXY A;  4DMZ A;  2D02 A;  3HLG A;  4HH2 A;  3ZGA B;  3UO9 A;  3MSH A;  1J3W A;  5DF9 A;  4IJG A;  2EX8 A;  1PI5 A;  2BAS A;  1BLH A;  2EXA A;  4ZAM A;  5EVI D;  3BQ8 A;  2VV8 A;  3NCK A;  5E2F A;  3VP4 A;  4H8R A;  4E3J A;  2XA7 S;  4X55 A;  3T4T A;  4R4R A;  5CHM A;  4OP5 A;  5E2G A;  2PBY A;  1LSV A;  1MWS A;  3QP5 A;  4FUW A;  3PTE A;  3VP2 A;  4KZA A;  1ES4 A;  3FC7 A;  4OPQ A;  2Z6C A;  3OPL A;  3DBA A;  1XX2 A;  1K4E A;  3G30 A;  3IX8 A;  3E2K A;  1JTD A;  4LRX C;  2Y2M A;  3IXD A;  3HL9 A;  3VV4 A;  1C3B A;  4KZB A;  3HLW A;  4AFI A;  3HLE A;  1G6O A;  3VMA A;  1UWN X;  4N9L A;  4DDY A;  1T1A A;  3GSG A;  3K3C A;  3VP1 A;  5L2F A;  1P97 A;  3M2K A;  1NLZ A;  3PAE A;  4WM9 A;  4EEP A;  4QJG A;  2JC7 A;  2CC1 A;  4OOY A;  2H5S A;  4WL9 A;  1XGJ A;  2VGL S;  4E6W A;  1ERQ A;  4JXV A;  4OPZ A;  4OPR A;  4Y13 A;  1PWG A;  4Q0H A;  3SW1 A;  1EW0 A;  3TE8 A;  4KUO A;  5GLD A;  2VV6 A;  3NHQ A;  3VSK A;  3MXS A;  4N9K A;  4QY5 A;  4NXE A;  4WMC A;  5J3W A;  3IS2 B;  2Q9M A;  4RA7 A;  3WRZ A;  3UNW A;  2ZQ8 A;  3VFH A;  4KZ8 A;  2RCX A;  2XA7 M;  2E8J A;  2QHK A;  4KZ4 A;  1STZ A;  3HJK A;  1YMS A;  4EW7 A;  1OTI A;  3IX4 A;  1DRM A;  3VP3 A;  3UB9 A;  3VE4 A;  1PW1 A;  1BTL A;  1U60 A;  5L09 A;  3WS2 A;  5CGX A;  3OC2 A;  4DE2 A;  3TG9 A;  1SKF A;  3ZYT A;  3BW6 A;  3T1X A;  4OQ0 A;  5FI7 A;  4ETZ A;  1S0W A;  1FSY A;  4GD6 A;  4GB7 A;  5HWV A;  3DAV A;  3LY3 A;  3R4K A;  3N8L A;  1DJA A;  3UN7 A;  4KZ6 A;  1W63 Q;  3DTE A;  5TFQ A;  1EI5 A;  1KGG A;  1Y54 A;  1BLP A;  5FQM A;  1SDN A;  2ZM0 A;  4LV2 A;  4D60 A;  5DTK A;  4Y3I A;  4R6L A;  3MZD A;  2JKG A;  3N6I A;  1GHM A;  1XJ6 A;  3CHW P;  4LRY C;  1OME A;  5KSC A;  1MWU A;  1FQG A;  1KGE A;  1XGI A;  4WEJ A;  3MR0 A;  3UB8 A;  3SZT A;  4OQH A;  1K57 C;  3GEC A;  5FAQ A;  4BMW A;  4MEZ A;  3T1R A;  3IH8 A;  3SS4 A;  3ZVW A;  1IKG A;  3FPW A;  2EFX A;  3FKW A;  3HRE A;  3RTY A;  4R0Q A;  2ZMV A;  4S2I A;  5TJJ A;  4X6T A;  5CTM A;  5GLC A;  4IUH A;  3F1O A;  2Y4A A;  1KE4 A;  4CLC D;  5CRF A;  2WAD A;  2K31 A;  2J7V A;  3E0Y A;  4PM6 A;  3NJA A;  2J8Y A;  2QYB A;  4L9E A;  3SS3 A;  1F98 A;  1IYQ A;  2WZZ A;  3VOL A;  1HTZ A;  4BEN A;  5TGF A;  4EQI A;  4S2L A;  1N4O A;  1S4S A;  1BT5 A;  1BUE A;  1DP6 A;  1CK3 A;  4HQA A;  5HSQ A;  4QHC A;  1PFL A;  4JF6 A;  2VGJ A;  3E4O A;  3QP4 A;  4EBL A;  3MFX A;  3LCE A;  1N9O A;  2EA9 A;  1IKI A;  2BLS A;  4R3J A;  1L0E A;  2H10 A;  4OPY A;  2VK3 A;  5E43 A;  2KDK A;  3UB5 P;  1WYB A;  4PHT A;  3F1P B;  1L0G A;  3BRM A;  4KQD A;  4MBF A;  3EGD C;  3KSF A;  2ZQ7 A;  3JPU A;  5GLB A;  1NJ4 A;  2HJ9 C;  1HLU P;  4DJ3 A;  3PBS A;  1VET A;  4BL2 A;  3OLO A;  5KZH A;  1H8M A;  3T50 A;  4UA9 A;  3NUL A;  3OPH A;  4MMN A;  4Y2F A;  5K5B A;  4LV1 A;  4X1M A;  1N9N A;  1K4F A;  2L0W A;  2WGW B;  2H0T A;  4KG2 A;  3BM6 A;  4B9O A;  1KOU A;  4EEU A;  3F1P A;  2P04 A;  1ZG4 A;  5A91 A;  3NOT C;  1IFQ A;  5M18 A;  4KQQ A;  5FA7 A;  1XA7 A;  5EVI B;  4BBU A;  1PIO A;  1PWC A;  1PWD A;  5HPI A;  5DJU A;  1GA0 A;  3QP6 A;  4EU0 A;  3S4X A;  2B95 A;  2WYX A;  3HUO A;  5F1G A;  4JGP A;  3C8C A;  2HP9 A;  4OLG A;  4HJ6 A;  3LR3 A;  2E8I A;  2ZQC A;  3EOI A;  5G4Z A;  3IWI A;  1K25 A;  1LL9 A;  3Q7V B;  3EQU A;  5CGW A;  3LYX A;  2J9P A;  4GJ4 A;  3HCY A;  2WZX A;  2PYR A;  1L0F A;  2INW A;  1YLJ A;  3M6B A;  1YQS A;  5DF8 A;  1XP4 A;  1SHV A;  4G3K A;  1FSW A;  1RGZ A;  1H0M A;  3DTM A;  4JXG A;  1BLS A;  3MS6 A;  5IT5 A;  1XJ4 A;  1H5X A;  3DW0 A;  3A3D A;  3BFE A;  4HES A;  4I3A A;  4JPM A;  3O5Y A;  2J3T C;  2WKI A;  3GQZ A;  3WS4 A;  4UA6 A;  3T4J A;  3V3S A;  3MJQ A;  3ZG9 B;  4MN7 A;  1MKM A;  5FQQ A;  4MN6 A;  3Q7V A;  3W2Z A;  5HDC A;  3KSI A;  4K0W A;  1YLP A;  5DTT A;  5F83 A;  4M3K A;  1GCE A;  4R1G A;  3D3O A;  4MN5 A;  2Y55 A;  5GL9 A;  1TF1 A;  4GLQ A;  2P7J A;  4WN5 A;  5G4Y A;  3EQV A;  1V9Z A;  4IVK A;  1ZKJ A;  4E6X A;  2J80 A;  3E98 A;  2O0Y A;  2HP5 A;  3LIC A;  1MZU A;  3TW8 A;  3B47 A;  4R4S A;  1CEF A;  3AGF A;  2A49 A;  3CG5 A;  4JGR A;  4Y7P A;  1GSX A;  2K7S A;  2JKR M;  3V5M A;  4JXS A;  1W7F A;  3MXQ A;  4KZ5 A;  4BWI A;  1PYY A;  2C5W B;  5KSH A;  4Q8I A;  5DFY A;  4OLD A;  3RXX A;  1AXB A;  1NRJ A;  2ZJ9 A;  4ZBE A;  3BEB A;  5E2E A;  3CJM A;  2GJ3 A;  1T19 A;  4WYY A;  4L9F A;  4IBR A;  4EUV A;  3IQA A;  3AGE A;  1YMX A;  1S4R A;  4DXB A;  4JF4 A;  1YLY A;  4CQH A;  1GSV A;  3T4L A;  2HDR A;  3VOY A;  1TDG A;  3UPP A;  5HZH A;  2V20 A;  3MFD A;  4S2N C;  1A0K A;  4FD8 A;  3MQQ A;  2O9B A;  4I3J A;  1UWP X;  4P6B A;  1P0Z A;  4RX3 A;  2ZC5 B;  2ZC6 B;  5CEB A;  2ACG A;  2ZM2 A;  4Z1W A;  5HAP A;  5D3O A;  4RYE A;  5FDS A;  4ZDX A;  5DF7 A;  3RXW A;  4EBN A;  1F5M A;  5EEC A;  1GHP A;  4OP8 A;  3GTC A;  3P98 A;  2VLG A;  4FH4 A;  2LB9 A;  3ZG0 A;  2WAF A;  2Q0O A;  3LIF A;  3BFD A;  3HLC A;  2FFY A;  2W3G A;  1K56 D;  4UQI M;  3HVF A;  5EVI C;  2PBD P;  3GR2 A;  3ITB A;  4KQO A;  3FG8 A;  3BEC A;  3R7W B;  3W4Q A;  2ZOH A;  4CLC B;  1Q2P A;  4N1H A;  3PBN A;  1PW8 A;  1RP5 A;  1L2S A;  5CHU A;  5FDH A;  2W3D A;  1K57 A;  4RX2 A;  4QWO A;  3CZD A;  5FEG A;  5A92 A;  2PT7 A;  2QWS A;  3S7P A;  4RVA A;  3KYZ A;  1RCJ A;  5L8M A;  3C7V A;  2NUP C;  3C7U A;  3G6O A;  2B5R A;  2H28 A;  3VFF A;  3ZDJ A;  1I2W A;  3UB7 A;  5AQ7 A;  4HJ4 A;  1VB6 A;  3OZH A;  3FYZ A;  4UA7 A;  1F9I A;  5JYP A;  4N92 A;  3R7W A;  1XXM A;  3Q82 A;  4CLC A;  1TS8 A;  5TBM B;  3MKF A;  4C6Y A;  1S1Z A;  1YAX A;  1YKD A;  3O3V A;  2YKH A;  3KYE A;  3QHY A;  5DTS A;  5CGS A;  3IXB A;  4CJN A;  3LIA A;  4PM9 A;  3PBO A;  1L3L A;  3A3I A;  1YM1 A;  3CWF A;  1FCM A;  5M1A A;  4HP4 A;  2Y79 A;  2X71 A;  4E04 A;  3WS0 A;  4R70 A;  2ZC7 A;  2G2U A;  3MXR A;  3PYP A;  4OOL A;  2DCF A;  1M6K A;  4D2O A;  5DKK A;  1P9W A;  2ZMA A;  5TBM A;  3OCN A;  3FWL A;  3KX0 X;  2CMN A;  3A0V A;  2OAQ 1;  3N7W A;  3N4I A;  3UDX A;  1L0D A;  2HDS A;  2V1A A;  2R78 A;  3GVB A;  2BG1 A;  2X02 A;  1MBL A;  4IUK A;  4NXG A;  1DP8 A;  4MBH A;  3IT9 A;  1CJF A;  3NI9 A;  4GHI B;  4BQM A;  5GHX A;  4B4Z A;  2P08 A;  5DVA A;  4XUZ A;  4X68 A;  1IYS A;  3L9K A;  3LR4 A;  5C5K A;  5FI6 A;  1ALQ A;  3IS2 A;  2VGK A;  3UE3 A;  1IEL A;  1WE4 A;  1Z09 A;  1YPR A;  3SS5 A;  3VP0 A;  1E4D A;  2JKT M;  2M1C A;  2O99 A;  4WEK A;  3WRT A;  4CPK A;  4ESP A;  1AWI A;  5G18 A;  1OJG A;  3C38 A;  3NIA A;  3BQA A;  3T12 B;  3T1Q B;  5HPF A;  3O88 A;  2M7V A;  2VGL M;  4KG5 A;  5A90 A;  3A3E A;  3ZG8 B;  4GHI A;  3BJN A;  4HP9 A;  4QB8 A;  1LL8 A;  4KQR A;  1Q2Q A;  1V9Y A;  4BBV A;  4ZJ1 A;  2PR5 A;  4X1L A;  4DDS A;  2Y2O A;  4HIA A;  3UDF A;  3BFF A;  1OTD A;  4O01 A;  4B88 A;  4O0P A;  3ZG5 A;  1W63 M;  4U0T A;  4S2M A;  1E3U A;  3MBZ A;  4E3L A;  2XF3 A;  1BUL A;  4MLL A;  1ZTU A;  1FIL A;  3MKE A;  3GV9 A;  1O7E A;  4O7D A;  3C4P A;  1ES5 A;  4PAU A;  4GDN A;  2H0Y A;  1NWZ A;  5AVE A;  3HUM A;  1ACF A;  2LB5 A;  3HJI A;  5A93 A;  2QMI A;  1N9L A;  2XDM A;  4CLC C;  4WUJ A;  4ZTK A;  2W3F A;  1LI0 A;  1H3Q A;  4HI4 A;  4B4X A;  4K0X A;  1Z6F A;  4LRZ E;  4PPR A;  1YSP A;  1K55 A;  3O86 A;  5IS1 A;  5I5L A;  4QU3 A;  2PRF A;  2XFS A;  4YIN A;  1G28 A;  4R38 A;  3WWX A;  2ZLY A;  3PAG A;  3W8K A;  2WKR A;  2PU2 A;  4ZRR A;  3ZHH A;  4B93 A;  1TEM A;  1T18 A;  2UWX A;  4F3L B;  4KZ9 A;  1XA1 A;  3WS1 A;  2XRO A;  1MWT A;  3S7Q A;  1HZO A;  3LIB A;  5HAI A;  5GHY A;  4E3K A;  4U0X A;  1UGU A;  4H6J B;  4EWF A;  5JYO A;  3EGX C;  2JHE A;  3NEC A;  3BYD A;  3QP2 A;  2I9V A;  4I3I A;  5F6A A;  5FAP A;  2JKR I;  3KO6 A;  1W79 A;  4LLO B;  1G6A A;  2ZD8 A;  3BY8 A;  4Z9Q A;  4N1X A;  1PRQ A;  4P85 A;  2UV0 E;  3IXG A;  3LFV A;  1MPL A;  1TD5 A;  3OPR A;  1BSG A;  4EBP A;  1GA9 A;  4F3L A;  4Y15 A;  4U3T A;  1ES3 A;  2ZMF A;  2YKF A;  4ARZ B;  1SZV A;  2Y2K A;  4MBK A;  1FCO A;  3DWK A;  4DN0 A;  4Y0O A;  4H6J A;  3NC8 A;  4Y5F A;  2ZC3 B;  4MDZ A;  4S2J A;  5IHV A;  2EX6 A;  5AJG A;  4PM8 A;  3UB6 A;  1I2S A;  3PBT A;  3H7W B;  1H8Z A;  2DMW A;  3RFB A;  1K6S A;  3T4K A;  2W1R A;  4R23 A;  3WS5 A;  4DF6 A;  4NET A;  1WA9 A;  4LEN A;  2ZL1 B;  4II7 A;  2HDQ A;  5AVF A;  2ZQA A;  4K08 A;  3NDG A;  3VSL A;  3BFG A;  1OTE A;  4ZJ2 A;  4EUZ A;  1ZG6 A;  3D9Y A;  1SCW A;  2J3W A;  3ZNY A;  4ARZ A;  1T1C A;  2VV7 A;  4S2N A;  4UEY A;  1ESI A;  4HH3 A;  2Z2L B;  3BLM A;  5CXW A;  1E25 A;  3FPV A;  3E4P A;  1DP9 A;  4O8G A;  5CX7 A;  5HWT A;  1PZP A;  4XXR A;  3UE0 A;  3C2W A;  1TS6 A;  3DTI A;  2HDU A;  1SDE A;  2C6W B;  3JVU A;  2PDR A;  2Y2Q A;  2WGW A;  3EWK A;  4FH2 A;  5F1F A;  5AQA A;  2ZL1 A;  4I38 A;  2OAP 1;  2QZ6 A;  5HAR A;  2J9O A;  2W0N A;  5EM0 A;  1VM1 A;  4DRT A;  4GZB A;  5EVI A;  5F68 A;  3F1N B;  5HDD A;  5EM1 A;  1BLC A;  3I7J A;  2X01 A;  4E3O A;  1K55 C;  3V67 A;  2W3H A;  3ZVT A;  3LUQ A;  1YSQ A;  1K54 C;  4P0M A;  3ZNT A;  5I94 A;  3T4O A;  4E3M A;  3PBQ A;  2Y2G A;  1KGF A;  1N9B A;  1Y28 A;  2W1T B;  1D7E A;  4R3A A;  3CIT A;  2KLI A;  3B42 A;  4LFU A;  3F1N A;  2EX2 A;  4MCW A;  3M6H A;  3MQ0 A;  2VKS A;  4KG6 A;  2XD5 A;  4JLF A;  1ODV A;  4GCZ A;  4LV0 A;  5EE8 A;  1OJ5 A;  4YOF A;  4Y0U A;  5A8B A;  1KDS A;  4S2K A;  4EQ1 A;  5EV0 A;  1JTG A;  2GZA A;  2Y2J A;  3UE1 A;  3S1Y A;  3MMH A;  3BWL A;  3ZG7 B;  1MKI A;  5EVL A;  2OWJ A;  3IXH A;  4BBT A;  4P87 A;  4A5R A;  3C4O A;  4QY6 A;  3W4P A;  3H9W A;  3ZQ5 A;  5CHJ A;  3VE3 A;  3NOP C;  4KEN B;  1FR6 A;  2HF6 A;  1YLZ A;  2JCH A;  4RQ9 A;  5HL1 A;  3QP1 A;  3ICY A;  3B3X A;  4ZJ3 A;  3G32 A;  4HEF A;  4YWZ A;  3MQO A;  2W3E A;  5FQI A;  3ULF A;  2JKT I;  3VOZ A;  4JGO A;  3HBR A;  2VA0 A;  2XR0 A;  1M40 A;  1IYP A;  4KUK A;  5L10 A;  1D1J A;  4PKY A;  1FCN A;  4DE0 A;  3HLD A;  2AVX A;  1FIK A;  5J8X A;  2IWD A;  4OQI A;  2KOI A;  4HBU A;  2PAV P;  4LCM A;  1PZO A;  2Z2M B;  2OOL A;  2VEA A;  2G2W A;  1K0K A;  1P9R A;  1VEU B;  1W8Y A;  3TJZ C;  1LL5 A;  2R9X A;  2Y2I A;  1FR1 A;  4BD0 A;  2IWB A;  3IF6 B;  1ERO A;  5CED A;  1K38 A;  2IA2 A;  3LIE A;  1TS0 A;  4UHU A;  4OKP A;  3AGD A;  1LLB A;  1MC0 A;  3MF0 A;  5FQ9 A;  1CEG A;  4I5S A;  2XLN A;  4GW9 A;  4HNB A;  1VEU A;  2WGI A;  1S66 L;  4GKU A;  3NOU C;  1I5Q A;  1LSW A;  1CQA A;  1LSX A;  3GMW A;  3LEZ A;  1IYO A;  3B33 A;  3CUE C;  2VJW A;  3IF6 A;  3ISG A;  2WKH A;  4IHQ A;  3IHB A;  3A0R A;  3JVV A;  4HHD A;  4HOI A;  1KVL A;  3IF5 A;  4S2O A;  4C75 A;  2XSS A;  2WKQ A;  5HAQ A;  2R9W A;  2V1B A;  3BLS A;  5F69 A;  5FL3 A;  3Q81 A;  2EXB A;  4DE1 A;  2I72 A;  1GSW A;  4E3I A;  2Q9N A;  2W27 A;  2EFU A;  1YT4 A;  2V0W A;  3CI6 A;  4HBT A;  2HV1 A;  3IX3 A;  4G3V A;  1JVJ A;  2ZQD A;  3U2A A;  2QPN A;  2A2L A;  1XFQ A;  1CF0 A;  2ZM8 A;  1MWR A;  2HJE A;  3UME A;  4WZ5 A;  3BY9 A;  5MC7 A;  4BLM A;  1LHY A;  3KSG A;  2OWH A;  3ITA A;  1DJB A;  2B18 A;  1NYY A;  3EEA A;  1NZO A;  2XQZ A;  1NLY A;  4GS9 B;  3LO7 A;  2XH9 A;  1Y4O A;  4EES A;  2PR6 A;  5TR7 A;  5HW3 A;  2O9C A;  2V9A A;  4PKY G;  3LY4 A;  3M2J A;  2BTF P;  3BFC A;  5EOE A;  4OON A;  4NXF A;  4XUX A;  3FV7 A;  5CTN A;  3MZF A;  2IWC A;  3FZC A;  3CLO A;  3A3J A;  3N8S A;  3G2Y A;  5EVE A;  2QJ7 A;  3G31 A;  4GN2 A;  2WK0 A;  4M4X A;  5J4E A;  2V0U A;  4GS9 A;  3N8R A;  2A3U A;  4BD1 A;  4OH0 A;  3UPN A;  1TVF A;  4FTX A;  3LI9 A;  1H8Y A;  2FH5 A;  3O87 A;  5L07 A;  4HJ3 A;  5FQK A;  2GX5 A;  1HVB A;  3H82 B;  4HY8 A;  4WF0 A;  4NG2 A;  2P74 A;  1ZC2 A;  3NBL A;  1ONG A;  3F1O B;  3QP8 A;  1KE3 A;  4FCF A;  2ZBB A;  3IF6 C;  4LPZ A;  4WBG A;  3CAX A;  1KDW A;  1TDL A;  4NKP A;  3HLB A;  5EPH A;  3C30 A;  4WEL A;  2P9V B;  5EUA A;  2D01 A;  4ME4 A;  5LBR A;  3HUN A;  4YNR A;  3H82 A;  4LGW A;  2VZW A;  2HPB A;  3OPP A;  1CI8 A;  1JWP A;  1G68 A;  1OT9 A;  4LCL A;  4IBX A;  1K54 A;  1BYW A;  4Q0I A;  3D4F A;  1VQQ A;  5FAS A;  3L7H A;  3S22 A;  2V8C A;  2GNX A;  4ID4 A;  1X0O A;  1IOU A;  1VHM A;  4LV3 A;  2Y2P A;  1JNU A;  3U4L P;  5BOH A;  3KSH A;  1OTB A;  2P9V A;  1MXO A;  4QD4 A;  3P01 A;  4WLA A;  2OV5 A;  2FZ0 A;  1NRF A;  2A24 B;  3K2N A;  3OCL A;  4PMA A;  3T1S A;  3DWZ A;  1ES2 A;  1OT6 A;  4KZ7 A;  4WZ5 C;  2XFT A;  1W8Q A;  4WMC D;  2JE5 A;  5FAT A;  1D06 A;  1VET B;  4XT2 B;  3UE6 A;  4FOF A;  1K6R A;  3QNB A;  2EWW A;  5FEF A;  2PD7 A;  1SKO B;  2DNS A;  3LI8 A;  4BL3 A;  3UPO A;  1XFN A;  3Q1F A;  2JN7 A;  4UAA A;  3KYQ A;  3QNC A;  5IU1 A;  5CER A;  1XJ2 A;  4EET B;  4Q0J A;  2ZQ9 A;  5EOO A;  4OQG A;  5HX9 A;  3PXP A;  2O9A A;  3FKV A;  2A24 A;  2KX6 A;  2HZ5 A;  1WYC A;  2NUT C;  2B02 A;  2OLV A;  2Y8H A;  4IED A;  2PD8 A;  3C5A A;  3TSG A;  4XT2 A;  2Y59 A;  2XEP A;  4JKT A;  2PYP A;  2JKF A;  1SKO A;  4IVI A;  1OPX A;  1ESU A;  2Z6D A;  3S7N A;  4BJP A;  5F82 A;  1CI9 A;  1IEM A;  2QJ5 A;  2WKP A;  1TS7 A;  1KVM A;  5U47 A;  3RJU A;  1LT0 A;  3PR6 A;  4EER A;  3G4P A;  2OLU A;  1S1Y A;  3SH9 A;  4DJ2 A;  3CPT B;  3V3R A;  4JBF A;  4X25 A;  3H7W A;  3G34 A;  2V2F F;  4GD8 A;  2G7U A;  3IWQ A;  1XPB A;  3UY6 A;  4PM7 A;  2OSU A;  3IWO A;  3OBF A;  3A0S A;  1OTA A;  3A3F A;  5AQ9 A;  1K56 A;  1MY8 A;  5E2H A;  5FSR A;  3W4O A;  5J7E A;  4ETX A;  4PM5 A;  4NEE D;  1E3U D;  4K91 A;  3E2L A;  5HFO A;  1S6R A;  3CPT A;  1DY6 A;  2MJ6 A;  3T4S A;  3P7N A;  2EWV A;  1ZHH B;  3UMD A;  5EFW A;  1JWV A;  3IH9 A;  3CMZ A;  3TOI A;  3P09 A;  3HLF A;  3OOV A;  1BZA A;  2WKE A;  3G35 A;  1KE0 A;  5KMW A;  5DFX A;  1W5D A;  1EWZ A;  4MNR A;  3ZCZ A;  2V8F A;  2ZOI A;  2GDN A;  2PHY A;  1QME A;  1NZU A;  4NXB A;  4Y0T A;  3LID A;  1F2K A;  2XGN A;  2J3T D;  4WZ4 A;  4S2P A;  3CUE A;  3D72 A;  3V39 A;  4GDB A;  5KIZ A;  1G5U A;  2WAE A;  4NK3 A;  4R3B A;  1PNE A;  5GHZ A;  2L4R A;  3GDI A;  4L0L A;  4CLC E;  5HDS A;  3PHY A;  2M7U A;  4X53 A;  2VX8 A;  1T1B A;  2DRW A;  4EV4 A;  3G2Z A;  4L9G A;  3Q7Z A;  1YLT A;  3IBR A;  4P6Z S;  5FAO A;  5HD3 A;  3T4Q A;  2RL3 A;  3LR5 A;  4JGQ A;  1XKZ A;  3S7O A;  2PU4 A;  2XRN A;  2WUQ A;  2W1T A;  1GHI A;  5HL6 A;  5DJT A;  3RH8 B;  5FI2 A;  4F94 A;  3PBR A;  5DKL A;  4E3N A;  2QKP A;  3NDE A;  5HWW A;  2Y2N A;  1NYM A;  1O07 A;  3SH8 A;  4UQI S;  1DJC A;  4X69 A;  1PI4 A;  3V50 A;  3IBJ A;  1HD8 A;  1RGY A;  3UDI A;  3Q07 A;  3JYI A;  4KZ3 A;  1ERM A;  3ZFZ A;  4GNU A;  4DKI A;  4FSF A;  2XK1 A;  3SOI A;  4OOM A;  4G3W A;  1LI9 A;  4X56 A;  2L1M A;  3LGO A;  4DE3 A;  4OVD A;  4QPR A; 
#chains in the Genus database with same CATH homology
 2QPN A;  2E8I A;  2ZQC A;  4QU3 A;  3IWI A;  4DXC A;  1JWZ A;  1K25 A;  1LL9 A;  2Y91 A;  3EQU A;  2XFS A;  3Q7V B;  4YIN A;  5FQJ A;  2ZM8 A;  4GOG A;  1MWR A;  5CGW A;  2J9P A;  3WWX A;  2ZLY A;  3PAG A;  3W8K A;  2PU2 A;  4WZ5 A;  1YLW A;  3ZHH A;  4BLM A;  1TEM A;  2Y2L A;  1J9M A;  1NY0 A;  1LHY A;  2WZX A;  2JBF A;  5M19 A;  1L0F A;  2ZC4 B;  1YLJ A;  2UWX A;  3M6B A;  1YQS A;  4KZ9 A;  1XA1 A;  1DJB A;  3ITA A;  5DF8 A;  3WS1 A;  1XP4 A;  1SHV A;  5GLA A;  1FSW A;  1MWT A;  5CEC A;  1FOF A;  1HZO A;  4JXW A;  1RGZ A;  5HAI A;  2FFF B;  1NYY A;  3GRJ A;  5GHY A;  4E3K A;  4U0X A;  3DTM A;  4JXG A;  1NZO A;  2XQZ A;  2Y2H A;  1BLS A;  2EX9 A;  3LO7 A;  2V1Z A;  2XH9 A;  1ONH A;  1H5X A;  3DW0 A;  4YFM A;  4EWF A;  2WGV A;  3A3D A;  3SH7 A;  3BFE A;  4HES A;  5JYO A;  4JPM A;  1QMF A;  5TR7 A;  2XD1 A;  3MZE A;  3BYD A;  5HW3 A;  4JF5 A;  2WKI A;  3GQZ A;  3NY4 A;  5FAP A;  3WS4 A;  1W79 A;  4UA6 A;  2HP6 A;  3LY4 A;  3V3S A;  1G6A A;  3M2J A;  4C3Q A;  3ZG9 B;  3IHA A;  5AQB A;  5FQQ A;  1NXY A;  3HLG A;  2ZD8 A;  3Q7V A;  3ZGA B;  3BFC A;  3UO9 A;  4Z9Q A;  5EOE A;  4N1X A;  4OON A;  5DF9 A;  4K0W A;  1YLP A;  4XUX A;  4P85 A;  5DTT A;  5F83 A;  3IXG A;  2EX8 A;  4M3K A;  1MPL A;  3FV7 A;  1GCE A;  5CTN A;  4R1G A;  1PI5 A;  3MZF A;  1BLH A;  1BSG A;  2EXA A;  2IWC A;  3OPR A;  3NCK A;  5E2F A;  5EVI D;  3FZC A;  4ZAM A;  4EBP A;  3VP4 A;  1GA9 A;  2Y55 A;  4H8R A;  4E3J A;  4X55 A;  5GL9 A;  4R4R A;  3A3J A;  3N8S A;  3G2Y A;  4U3T A;  1ES3 A;  3G31 A;  5CHM A;  4GN2 A;  4OP5 A;  5E2G A;  2PBY A;  2WK0 A;  1MWS A;  2Y2K A;  4MBK A;  1FCO A;  3DWK A;  3PTE A;  3VP2 A;  3N8R A;  2A3U A;  4KZA A;  4Y0O A;  4BD1 A;  3NC8 A;  3EQV A;  4OH0 A;  1ES4 A;  3UPN A;  4IVK A;  1ZKJ A;  1TVF A;  2ZC3 B;  4S2J A;  5IHV A;  1H8Y A;  3O87 A;  4OPQ A;  4E6X A;  2EX6 A;  3OPL A;  4PM8 A;  1XX2 A;  1I2S A;  1K4E A;  3PBT A;  5FQK A;  1HVB A;  2HP5 A;  1H8Z A;  3G30 A;  3E2K A;  1JTD A;  2Y2M A;  1K6S A;  4R23 A;  3IXD A;  3WS5 A;  4DF6 A;  4R4S A;  1CEF A;  2P74 A;  2A49 A;  3AGF A;  3CG5 A;  3HL9 A;  4NET A;  4Y7P A;  1ZC2 A;  3NBL A;  1C3B A;  4LEN A;  4KZB A;  3V5M A;  1ONG A;  4JXS A;  2HDQ A;  3HLW A;  3HLE A;  1W7F A;  3VMA A;  4KZ5 A;  2ZQA A;  4N9L A;  1PYY A;  3NDG A;  4DDY A;  3VSL A;  2C5W B;  3BFG A;  3GSG A;  5KSH A;  4Q8I A;  3VP1 A;  4ZJ2 A;  4EUZ A;  5L2F A;  1ZG6 A;  3ZNY A;  1SCW A;  3M2K A;  4OLD A;  3RXX A;  3PAE A;  4S2N A;  4WM9 A;  4QJG A;  2JC7 A;  1AXB A;  1ESI A;  1KE3 A;  2CC1 A;  4FCF A;  3IF6 C;  4WBG A;  4OOY A;  2Z2L B;  2ZJ9 A;  4ZBE A;  3BLM A;  3BEB A;  1KDW A;  1TDL A;  1E25 A;  2H5S A;  5CXW A;  5E2E A;  1XGJ A;  3HLB A;  4E6W A;  3CJM A;  1ERQ A;  1PZP A;  5EPH A;  4JXV A;  4OPZ A;  4WEL A;  4XXR A;  3UE0 A;  2P9V B;  5EUA A;  4OPR A;  4WYY A;  4IBR A;  3IQA A;  3AGE A;  2HDU A;  3HUN A;  1SDE A;  1PWG A;  1YMX A;  4DXB A;  2C6W B;  4JF4 A;  1YLY A;  2HPB A;  3OPP A;  1CI8 A;  1JWP A;  2Y2Q A;  2WGW A;  2HDR A;  4FH2 A;  5GLD A;  3VOY A;  1G68 A;  5F1F A;  5AQA A;  1TDG A;  3UPP A;  3VSK A;  2V20 A;  4LCL A;  3MFD A;  3MXS A;  1K54 A;  4FD8 A;  4IBX A;  4N9K A;  4S2N C;  2QZ6 A;  4QY5 A;  4WMC A;  5HAR A;  3D4F A;  2Q9M A;  1VQQ A;  4P6B A;  4RA7 A;  4RX3 A;  2J9O A;  3WRZ A;  3UNW A;  5FAS A;  3S22 A;  2ZC5 B;  2ZQ8 A;  3VFH A;  1VM1 A;  4ID4 A;  2ZC6 B;  4DRT A;  5CEB A;  2ZM2 A;  4KZ8 A;  2RCX A;  4GZB A;  5EVI A;  5HAP A;  4KZ4 A;  5D3O A;  4RYE A;  4ZDX A;  5DF7 A;  4LV3 A;  3RXW A;  2Y2P A;  1YMS A;  4EBN A;  1BLC A;  3I7J A;  5BOH A;  2X01 A;  4E3O A;  2P9V A;  5EEC A;  1K55 C;  1MXO A;  4QD4 A;  3VP3 A;  2OV5 A;  1PW1 A;  1GHP A;  1BTL A;  4OP8 A;  3GTC A;  3ZVT A;  3P98 A;  1U60 A;  1NRF A;  3WS2 A;  3OCL A;  4PMA A;  4FH4 A;  3DWZ A;  3OC2 A;  5CGX A;  1ES2 A;  1K54 C;  3TG9 A;  1SKF A;  2WAF A;  4KZ7 A;  3ZG0 A;  4WZ5 C;  4DE2 A;  4P0M A;  3BFD A;  2XFT A;  3HLC A;  2FFY A;  1W8Q A;  4WMC D;  2JE5 A;  4OQ0 A;  5FAT A;  5FI7 A;  3ZNT A;  5I94 A;  1S0W A;  1K56 D;  1FSY A;  4GD6 A;  1K6R A;  3QNB A;  4GB7 A;  3HVF A;  5EVI C;  4E3M A;  3GR2 A;  3PBQ A;  2Y2G A;  1KGF A;  3LY3 A;  3ITB A;  1N9B A;  3N8L A;  2DNS A;  4BL3 A;  1DJA A;  3UPO A;  3UN7 A;  4KQO A;  3Q1F A;  4KZ6 A;  4UAA A;  3BEC A;  3W4Q A;  2EX2 A;  1Q2P A;  3M6H A;  3QNC A;  4N1H A;  3PBN A;  1PW8 A;  1RP5 A;  5CER A;  4KG6 A;  1L2S A;  2XD5 A;  2ZQ9 A;  5EOO A;  4JLF A;  4OQG A;  5CHU A;  5TFQ A;  1EI5 A;  4LV0 A;  1KGG A;  5FDH A;  5EE8 A;  5HX9 A;  1Y54 A;  1K57 A;  1BLP A;  5FQM A;  1SDN A;  4RX2 A;  3FKV A;  2ZM0 A;  4Y0U A;  4LV2 A;  3CZD A;  5DTK A;  1WYC A;  5A92 A;  1KDS A;  3MZD A;  4S2K A;  4RVA A;  2OLV A;  3N6I A;  4IED A;  1RCJ A;  3C7V A;  3C7U A;  3C5A A;  1GHM A;  3TSG A;  2B5R A;  3VFF A;  3ZDJ A;  1I2W A;  1JTG A;  2Y2J A;  3UE1 A;  3S1Y A;  2Y59 A;  2XEP A;  4JKT A;  5AQ7 A;  3OZH A;  3FYZ A;  4UA7 A;  1OME A;  3ZG7 B;  1MKI A;  5KSC A;  1MWU A;  5EVL A;  1FQG A;  4IVI A;  1ESU A;  1KGE A;  1XGI A;  3IXH A;  5JYP A;  4BJP A;  4P87 A;  1CI9 A;  1IEM A;  4N92 A;  5F82 A;  4WEJ A;  4A5R A;  1KVM A;  5U47 A;  3RJU A;  3C4O A;  1XXM A;  3Q82 A;  4QY6 A;  3W4P A;  4OQH A;  1K57 C;  5CHJ A;  5FAQ A;  3G4P A;  1FR6 A;  2OLU A;  3MKF A;  3IH8 A;  4KEN B;  4MEZ A;  3SH9 A;  4C6Y A;  3SS4 A;  3O3V A;  3QHY A;  5DTS A;  3V3R A;  5CGS A;  3IXB A;  4JBF A;  4CJN A;  1YLZ A;  3ZVW A;  1IKG A;  2JCH A;  4PM9 A;  3PBO A;  2EFX A;  5HL1 A;  3G34 A;  3A3I A;  2V2F F;  1YM1 A;  3B3X A;  4GD8 A;  1FCM A;  5M1A A;  3FKW A;  3IWQ A;  3HRE A;  1XPB A;  4ZJ3 A;  3UY6 A;  3G32 A;  4PM7 A;  2OSU A;  4R0Q A;  4HEF A;  3IWO A;  4S2I A;  4X6T A;  5CTM A;  5FQI A;  2X71 A;  3WS0 A;  5GLC A;  2ZC7 A;  2G2U A;  3VOZ A;  3HBR A;  2Y4A A;  2XR0 A;  1KE4 A;  3MXR A;  4OOL A;  3A3F A;  1M40 A;  1IYP A;  2DCF A;  5AQ9 A;  1K56 A;  1MY8 A;  2WAD A;  5CRF A;  5E2H A;  5FSR A;  3W4O A;  2J7V A;  1M6K A;  4D2O A;  1FCN A;  4PM5 A;  4PM6 A;  2ZMA A;  3OCN A;  1E3U D;  3FWL A;  4K91 A;  2J8Y A;  3E2L A;  4DE0 A;  3HLD A;  3N7W A;  5HFO A;  1S6R A;  3N4I A;  3SS3 A;  3UDX A;  1DY6 A;  1L0D A;  5J8X A;  2WZZ A;  1IYQ A;  2HDS A;  2IWD A;  1HTZ A;  4OQI A;  3GVB A;  4BEN A;  4HBU A;  2BG1 A;  2X02 A;  1MBL A;  5TGF A;  4LCM A;  1PZO A;  4EQI A;  4S2L A;  1JWV A;  1N4O A;  2Z2M B;  3IH9 A;  4MBH A;  3IT9 A;  3NI9 A;  4BQM A;  3CMZ A;  2G2W A;  3TOI A;  1BT5 A;  3P09 A;  5GHX A;  4B4Z A;  3HLF A;  1BUE A;  1BZA A;  5DVA A;  2WKE A;  3G35 A;  1CK3 A;  1W8Y A;  1KE0 A;  4XUZ A;  5KMW A;  1W5D A;  4QHC A;  1EWZ A;  4X68 A;  1LL5 A;  4MNR A;  3ZCZ A;  1IYS A;  5FI6 A;  2GDN A;  1ALQ A;  3UE3 A;  2VGK A;  1QME A;  2R9X A;  2VGJ A;  1FR1 A;  1NZU A;  2Y2I A;  4JF6 A;  4BD0 A;  1IEL A;  2IWB A;  1WE4 A;  4Y0T A;  4EBL A;  3IF6 B;  3LCE A;  3SS5 A;  2XGN A;  3VP0 A;  1E4D A;  1IKI A;  1ERO A;  5CED A;  4WZ4 A;  2BLS A;  4R3J A;  1K38 A;  4S2P A;  4WEK A;  1L0E A;  2H10 A;  4OPY A;  5E43 A;  3WRT A;  4CPK A;  4UHU A;  4OKP A;  3AGD A;  5G18 A;  1LLB A;  4GDB A;  3V39 A;  2WAE A;  3NIA A;  4NK3 A;  4R3B A;  5FQ9 A;  5GHZ A;  1WYB A;  4L0L A;  3O88 A;  1CEG A;  1L0G A;  3BRM A;  4KG5 A;  2XLN A;  4MBF A;  3A3E A;  4X53 A;  5A90 A;  3ZG8 B;  2DRW A;  2ZQ7 A;  4EV4 A;  5GLB A;  3G2Z A;  1NJ4 A;  3Q7Z A;  2WGI A;  4QB8 A;  4GKU A;  1YLT A;  1I5Q A;  3PBS A;  4BL2 A;  5FAO A;  4KQR A;  5KZH A;  1Q2Q A;  2RL3 A;  3GMW A;  4ZJ1 A;  3LEZ A;  1XKZ A;  4UA9 A;  1IYO A;  2PU4 A;  2WUQ A;  3OPH A;  1GHI A;  4LV1 A;  3IF6 A;  3ISG A;  4DDS A;  2WKH A;  5FI2 A;  4F94 A;  3IHB A;  3PBR A;  4E3N A;  2Y2O A;  3UDF A;  1K4F A;  3NDE A;  2Y2N A;  1NYM A;  1O07 A;  3BFF A;  3SH8 A;  1KVL A;  2H0T A;  2WGW B;  3IF5 A;  1DJC A;  4KG2 A;  4S2O A;  4B88 A;  4X69 A;  1PI4 A;  3BM6 A;  3ZG5 A;  4C75 A;  4U0T A;  4S2M A;  1E3U A;  3V50 A;  3MBZ A;  1HD8 A;  1ZG4 A;  2R9W A;  5HAQ A;  1RGY A;  4E3L A;  2XF3 A;  3UDI A;  5A91 A;  3BLS A;  3Q07 A;  1BUL A;  3JYI A;  4KZ3 A;  4MLL A;  1ERM A;  3ZFZ A;  4GNU A;  3Q81 A;  2EXB A;  3MKE A;  4DKI A;  4DE1 A;  3GV9 A;  1O7E A;  5M18 A;  4FSF A;  4KQQ A;  4O7D A;  3C4P A;  2XK1 A;  5FA7 A;  3SOI A;  1XA7 A;  4OOM A;  1ES5 A;  5EVI B;  2I72 A;  4GDN A;  2H0Y A;  4E3I A;  1PIO A;  1PWC A;  2Q9N A;  3HUM A;  1PWD A;  1LI9 A;  5A93 A;  2QMI A;  2EFU A;  1YT4 A;  2XDM A;  4X56 A;  1GA0 A;  4ZTK A;  3S4X A;  4DE3 A;  4HBT A;  1LI0 A;  2WYX A;  4OVD A;  1JVJ A;  3HUO A;  5F1G A;  4B4X A;  2ZQD A;  4K0X A;  1Z6F A;  4PPR A;  2HP9 A;  4OLG A;  1K55 A;  3O86 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...