1MBMA

Nsp4 proteinase from equine arteritis virus
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
198
structure length
198
Chain Sequence
KARGNVGFVAGSSYGTGSVWTRNNEVVVLTASHVVGRANMATLKIGDAMLTLTFKKNGDFAEAVTTQSELPGNWPQLHFAQPTTGPASWCTATGDEEGLLSGEVCLAWTTSGDSGSAVVQGDAVVGVHTGSNTSGVAYVTTPSGKLLGADTVTLSSLSKHFTGPLTSIPKDIPDNIIADVDAVPRSLAMLIDGLSNRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Arterivirus nsp4: the smallest chymotrypsin-like proteinase with an alpha/beta C-terminal extension and alternate conformations of the oxyanion hole
pubmed doi rcsb
source organism Equine arteritis virus
molecule tags Transferase
molecule keywords chymotrypsin-like serine protease
total genus 43
structure length 198
sequence length 198
chains with identical sequence B, C, D
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2002-08-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1mbmA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1mbmA02
3.30.40.20 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Chymotrypsin-like serine protease; domain 3 1mbmA03
1HFDA 2EI8A 1EOLA 4WH8A 1C5TA 1QCPA 3DFJA 3P95A 3U8RH 5A0CA 1BBRH 1KXFA 3A87A 1LHEH 2GD4B 3KIDU 2WPLS 4MG3A 4JK5A 1MAXA 2AGIX 2QXHA 1SGIB 1ZRBA 1C1WH 2G00A 3RMLH 2CMYA 3SU5A 2GX4A 3BTWE 1LCYA 2BQ6B 5L30H 1BJVA 3FVFB 1GBEA 3URDA 1DWBH 3MH4A 2CHAC 4MNYA 1D3QB 2GZ8A 5EGMA 4U32A 1EB2A 3TJVA 1IQGA 1Z1JA 4O3TA 4FU9A 1ELVA 4NA9H 1AB9B 3TNTA 1LDTT 1LQEA 9LPRA 2A31A 4X8SH 1OXGA 3P8FA 1UO6A 3SZNA 3VB7A 3FP8E 1AWFH 1EPTA 1UTJA 1RFNA 5CHAC 3ZZDA 1SGQE 2ZFPH 2J95A 2TRMA 1GBJA 1PQ7A 1SGTA 1A46H 3OX7U 3BTTE 3AASA 2ZQ2A 1SGDE 2A4RA 3OY6U 2Y7ZA 3TGJE 1ZPZA 3SO3A 1B5GH 1O2KA 3T27A 2J9NA 5JBAS 3DT0H 2GMTC 4THNH 2A5IA 2WPHS 1IQHA 2ZDVH 1C5LH 4PROA 3D62A 4BANB 4ISOA 1C1MA 3BV9B 2P95A 1KLIH 1HJAB 5E2PA 2BLQA 4I33A 2ZPRA 3GCHB 4K5ZA 1NC6A 3CS7A 1EATA 2ALPA 5F03A 3A8DA 1P09A 1C5OH 2BM2A 2BQ7B 2BY5X 3P17H 1UVTH 4XBDA 3VB6A 3LIWA 3ZZ8A 1ETSH 1MKWH 3GY7A 1NN6A 5T6DA 4WF8A 3PTBA 2R2MB 4XBBA 2BVXH 2BZ6H 5JYIA 3AW0A 3OTJE 4A1XA 2FM2A 3T2NA 2QV1A 1WV7H 2H9TH 1TABE 1CBWB 1K1OA 1XUKA 1GDUA 2P16A 2F3CE 1BCUH 5HM9A 2EC9H 4XE4A 3T62A 2FOEA 1P03A 1SFIA 3LGTA 1QBNA 1TYNA 3T5FH 4ABJA 4BAKB 1YPMH 5DK1A 5JBTA 2BTCE 3SNCA 1PPFE 2RA0A 1BMLA 2SFAA 1THPB 1A0HB 1G3DA 4JZFH 2FX6A 1TMBH 2ZTYA 5AVDA 1CU1A 2GGVB 2CGAA 3GYLB 3MH6A 3PMAB 1TGNA 1LTOA 3UOPA 4CR5A 1C1PA 1GHWH 1P2IA 5LPRA 5FBIA 1FI8A 2HNTE 3RC5A 3W95A 2BXTH 4H4FA 3S9BA 2XBVA 3GCTF 1AE5A 1BDAA 2LNCA 5C5OA 2O9QA 2IOTA 3RXDA 4NFEA 1GBMA 1YBWA 3A7VA 4ABFA 1BTHH 2BD8A 5SGAE 2VIWA 1N8OC 4FUHA 4IMQA 1CO7E 1TQ7B 1O3HA 2UUYA 2A1DB 1P57B 3HKJB 3M3SA 1XKAC 1QIXB 1V2VT 3U98H 1BB0B 2ZFQH 4K1EA 1O2QA 3K6YA 1C4V2 4Y8YA 1IQEA 1C2MA 2XNIA 4B2BA 1O39A 5F8XA 1AFQB 1TNKA 5DP5A 5JB9S 1OWDA 1ID5H 4AYVB 1L4ZA 5F8ZA 1YP9A 4Y79A 1TFXA 3Q00A 1IAUA 3VXFH 2FIRH 1O2JA 5E0HA 1KSNA 4O03A 2ZGCA 1XVOA 2H6MA 1C1QA 1FJSA 4I31A 1GBCA 1YPLH 3UR6A 3OU0A 1PYTD 1TOCB 1EAWA 1K28D 4FU7A 1V2JT 1Y3XA 2WPKS 3IWMA 3P92A 1ZMJA 4Y7BA 1PPHE 1VCQA 3CP7A 1QB6A 1UTNA 2GCTC 5HYOA 1GHBF 3M7UA 3UFAA 3ZYEA 4MTBA 1HBTH 1QFKH 1MTNB 4RKJB 3TK6A 4K1TA 2G5VA 3BTKE 4FVDA 2HGTH 1LKAA 3EQ0H 3PTNA 1K1NA 1KLJH 4AFQA 2ZU4A 4UDWH 3HK6B 3QK1A 7KMEH 3MH5A 1VITG 1PQ5A 3MNXA 4AORA 2Y81A 1UTOA 2HALA 2BY7X 3SV6A 1CA0C 2TGPZ 1ESAA 5GJ4B 2Z9LA 1FY1A 1RTFB 1F5KU 1O5DH 1TNJA 1O3BA 4B1TA 1O5AB 1K1IA 2BMGB 2VWNA 1S81A 2KAIA 4TY7A 2HWLB 3PROA 2F9PA 1LMWB 3RM0H 5A8ZA 4GAWA 1VITF 3SJKA 1ELCA 1EASA 3BF6H 1YLDA 1MZAA 1SB1H 1JIMA 2QF3A 4WH6A 1ZR0A 4FUEA 1TOMH 3SUEA 5FHTA 4K69A 3KQDA 3QLPH 2WUCA 1V2WT 2P8OC 2NWNA 5C5NA 1SGRE 3SJOA 1IQKA 1OP8A 3U1IB 3JZ2B 2GT8A 3BTME 4YOJA 5K7RA 4X1NU 2WPJS 1C5XB 1FONA 1KXAA 3ZZ6A 2BDYA 3R3GB 4B2AA 1YCPK 5L2ZH 3SGQE 1ELFA 2BLOA 1Z8GA 2FX4A 1HAZB 1T4VH 3RLWH 4NWLA 3UWJH 3RXMA 2O8TA 4ZHLU 4Z0KA 2FYRA 4DOQA 1KDQB 4E7RG 2BHGA 2FESH 1C1NA 3UQVA 6CHAB 3RXEA 1ANCA 1ESTA 2OINA 4Q7YA 2O8UA 1O5EH 1HXEH 1SGFG 2H2ZA 3LPRA 3RXSA 3BSQA 3EDXB 1TNLA 1L1NA 1W8BH 2XWBI 2BOHB 4VGCB 1Y3VA 3MU0A 4WXVA 2VWOA 1UTKA 2A5AA 1W7GH 5FCRA 8GCHF 1CT2E 1WUNH 3P70B 2PR3A 1TQ0B 5E0JA 3F6UH 2UUFB 2PWXA 1GL0E 4WY3A 3U69H 4AZ2B 5EQSA 1AQ7A 3ZVGA 1HLTH 3D23A 2BD4A 4X0WU 1ACBE 1SOZA 2VIPA 1FV9A 1CHOF 3ZVDA 4X1RU 1C5QA 4KGAA 5DJ7A 1J17T 4B75A 3LOXA 2ZHWH 1FQ3A 1E36B 5EOKA 2VIDA 1GI9B 1TGSZ 5EXNA 3STJA 1S5SA 1JRTA 4ZMAH 1DT2A 2H5CA 1E0FD 1BRUP 3CS0A 5HM2A 1ZLRA 4TWYA 4BXSA 2H5DA 3A86A 1G3BA 4E06H 1GHAF 1XUHA 1GHVH 2SGAA 4YT6H 3O8BA 5FX6A 1DICA 4GUXA 3ZV9A 3RU4T 1QNJA 1V2OT 3ESTA 1BRCE 2DE8A 4IGDA 4TPYA 3U9AH 1FZZA 1QBVH 3GOVB 1HAPH 1J14A 5EQQA 1O2PA 4DY7B 2QN5T 4Q2KA 1XX9A 2Y5HA 1TGBA 3LH3A 1EZSC 4NSVA 3RXKA 4A5TS 1O2SA 1P9SA 1XUJA 4YLUA 5FPTA 4Y71A 1LO6A 1A61H 3TITA 2AMDA 3SI3H 1KIGH 2FEQH 1DDJA 3KHVA 4DIHH 1QQ4A 4ISHH 2B5TB 1FY3A 2ZIQH 3RXIA 1O2TA 1QRWA 2Q6GA 2ANKH 4CH8B 1ARBA 1HUTH 4I32A 2HNTF 1Z8JB 1C5WB 1SC8U 2SNWA 2V6NA 1GBKA 1SOTA 4WMFA 1VCPA 1XKBC 3U8TH 1GCTC 1ETTH 3RC6A 5IDKA 3S9CA 1IQJA 2FP7B 2PTNA 2RDLA 4GSOA 4ZXYH 4XDEA 1EXFA 1TE0A 3Q3YA 1O2MA 4MPWA 4YO9A 1SVPA 1V2PT 2VU8E 2XCFA 1P2OA 1X7AC 2SGDE 4K8YA 2B8OH 3LJOA 1LHCH 2O8WA 2ZKSA 3VXEH 1EZUC 1EAXA 1ELBA 3Q3XA 1GJAB 2C93B 2FOMB 5A09A 4O9VA 3MWIU 2GDEH 4UE7H 4GVUA 2PUQH 4X6OA 1YCPH 3UPEA 2JH6D 4Y0ZE 1K1PA 1BBRE 1ELGA 3DHKH 1NO9H 2ZCHP 4OS6A 4H42U 3E16B 1PQ8A 1GDQA 3K9XB 2OCVB 1LKBA 1TB6H 4BNRA 1U6QA 3SW2B 3RXRA 3E0PB 3M3VA 1F92A 4K1SA 5C20A 1ZJKA 4Q7ZA 2PGBB 3GICB 1T8LA 1FIZA 4Q80A 4NIXA 1C1RA 2H9EH 5AFZH 5BPEA 1C9PA 4BTTB 4GHQA 1HAGE 2ZZUH 1IQNA 1GMCF 1TMTH 1HAIH 1G32B 2OUAA 3MO3A 1IQLA 2ZGBH 4ZUHA 1NFXA 5LGOA 2W7UA 1C5PA 3KCGH 5C67A 4ABEA 2VIQA 4WXIA 1O3EA 5FXLA 1NRPH 1TBRH 2G55A 1K21H 4DURA 1ESBA 4E05H 2M5TA 2BY8X 1GHBG 1MZDA 4XOJA 4IW4E 1N6XA 1ZGIA 1PPGE 4NGAH 2FXRA 2UUKB 2F91A 1GJ4H 3NUMA 2BYAX 1MKXH 1AFEH 1UK2A 2ZHEH 3GCTG 1AU8A 3GY8A 1GI8B 4KKDA 3TU7H 4FU8A 4XFQA 2HVXA 1HAXB 2QCYA 4K2YA 3V13A 2AFQB 1O0DH 1RTKA 2XW9A 5ETXA 2BVRH 2ZHDA 1YYY1 3GCHC 2NU3E 1C9TA 1FAXA 4A1TA 1FN6A 3RU4D 1Y5UT 4FUDA 3MI4A 1UCYH 2XC4A 2O8MA 2WYGA 2ODPA 5ESTE 1BRBE 4JK6A 2BD3A 1G2MA 1CE5A 4X6PA 5FPYA 1ZSJA 4F49A 4INLA 4X2XA 2YOLA 4JZIA 4U01A 4MPUA 4WJG2 4Y0YE 3V0XA 2GVFA 2QA9E 5A0BA 3SQEE 1LVYA 3ATLA 4GPGA 3Q3KA 2Y82A 2ZQ1A 1E34B 4NA7A 4O3UA 3A83A 2J4IA 3RLYH 1QJ6B 1NU9A 2Z3EA 3ZZ5A 2EI6A 3LGIA 1IHTH 4YT7H 1W3CA 1D3DB 3ATIA 4NFFA 1S85A 5DP8A 5DP3A 2ZDAH 3I77A 4E7NA 3K6ZA 3OY5U 1TPPA 2BLWA 3FANA 1O2RA 2Z3DA 9ESTA 1ARCA 5GCHG 4D76A 1SG8B 2VNTA 1THRH 1BTUA 5LPEA 1LPKB 2P94A 1GBDA 4AG2A 1YGCH 2VH0A 1ANDA 4MNWA 3TLOA 4CRFA 2OBQA 4UEHH 3B23B 1JOUB 3RMMH 1QHRB 3M7TA 1GBLA 3UUZA 1O2NA 1ZMNA 4ZH8A 3SU6A 1ZOMA 2FTMA 1CHGA 3D65E 1G9IE 3SI4H 1Y5BT 5JDUB 2ZTXA 3NCLA 4KTUA 4HTCH 1O3OA 3C1KA 4YOIA 1SPJA 1MTWA 4DW2U 1XXFA 4NZQA 3TJNA 1MTNC 1QJ7B 2VIOA 4OS4A 1QA0A 5A0AE 1UTQA 3B8JA 2ZDMA 1GGDB 2EA3A 2CN0H 4FUCA 2R2WU 2YNAA 2IJOB 2AMQA 3SJ8A 4ZAEA 5GDSH 7GCHG 3PB1E 4Y8XA 1P0SH 1HCGA 3MO6A 3F9GA 3QWCH 1OYTH 1QL9A 4NCYA 5AHGH 3PLBA 3SU4A 3ZVAA 2A32A 5A8YA 4LXBH 2O8LA 1NPMA 3QTOH 3RXCA 1INCA 5EW1H 3EA9A 3FAOA 4JZDH 3EYDA 1O5GH 3DA9B 4ZKOU 3UNRA 3W94A 2ANWA 1EKBB 1XVMA 3SU0A 4FVBA 4K8BA 1GL1A 2FOHA 4BAMB 1JIRA 1Z7KA 2ZDKA 3SNAA 1EAIA 3LONA 1BMNH 4B76A 1G2LA 2LPRA 1BIOA 4I8LA 4YESB 2FS8A 2ZFFH 2ZPQA 5ESBA 1QRXA 1AIXH 1DWEH 2P59A 1O3CA 2JETC 4WVPE 2P93A 7GCHF 1MTSA 4D7GA 1W13U 1EX3A 1YM0A 1D6WA 1ZHMA 4X1SU 2FI5E 3P6ZB 1GI3A 2W3KA 2WINI 5JBBS 1V2QT 2OXSA 2QXIA 1L4DA 1UCYE 1CGHA 4M7GA 4JZEH 1O5CB 5DPAA 1DWCH 2SGEE 1S6FA 5CMXH 1V2ST 3MTYA 1P12E 3H7OA 1MD8A 3I29A 1ZTJA 1UCYK 3ZVEA 1TPOA 1DANH 1Y3YA 1TMUH 3QN7A 3ENSB 1QY6A 1OWIA 1LQDB 1RD3B 1H9LB 1MBMA 1NFWA 2Y80A 3IG6B 4J2YB 2ZFTA 3SQHE 1LVOA 1O2UA 1GHZA 1BHXF 1GHXH 4NA8A 1RJXB 3BTDE 1DWDH 2FLBH 5TCCA 1MCTA 4GLYA 1GCTB 3VB5A 2A7HA 3LT3A 1CQQA 1FNIA 1GJDB 3GY4A 4JYVH 5CHAB 1P01A 2SGPE 2OC0A 4J1YA 5H4IB 1O2IA 2ZTZA 3HATH 3LC3A 4AGKA 3OSYA 1AFQC 1KDQA 4CREA 3SOSA 4MNVA 5DP9A 1ZJDA 1K2I1 2BD7A 3P8OA 4CRCA 3EA8A 5DP6A 5GIBA 1O2LA 1GI5A 1B7XB 3A7TA 2CF9H 1O3KA 1S0QA 1GJ6A 1C5UA 2ALVA 4ABBA 1SR5C 3EA7A 1VZQH 2AIPA 5EQRA 1DLEA 1NROH 2BDHA 2PLXA 3E0NB 4ABHA 5EPNA 1Y59T 2C90B 1T4UH 2TGTA 1NFYA 5DP7A 1NFUA 3RXJA 2XC0A 1ELTA 3MH7A 3KL6A 5FPSA 3O8CA 1FIWA 3BTEE 4CRDA 5ABWA 3NPSA 4GCHF 3RXHA 4FXGH 2A4GA 1OX1A 3RMOH 6GCHG 1VGCB 2FO9A 1YPHC 4CRAA 3S7KB 3SU2A 3RP2A 1WTGH 4TYDA 1C2LA 2ULLA 2FOAA 1V3XA 2FZZA 1KY9A 1JWTA 4YOGA 1TALA 3HGPA 1LHDH 1GPZA 3H5CB 2IPHA 3F68H 1SGFA 1YLCA 4Y76A 1SQTA 1GBAA 2AS9A 4X6MA 1MQ5A 1WTHD 2HLCA 1K22H 1C5YB 3A7ZA 1E38B 3A7YA 4UFGH 2G5NA 2UWOA 1YPGH 2OC1A 2STAE 1QBOA 2Z6BD 4DG4A 1TPAE 1AI8H 5GCHF 1DLKB 2P3TB 2F9OA 2K1QA 1O3NA 1ZGVA 1C1OA 1C5VA 2W7SA 1A3EH 1GMDG 4DIIH 1CVWH 1OKXA 4ABDA 1FN8A 1WQVH 3SBKA 4I7YH 1C2EA 3HK3B 1HXFH 2VJ1A 1A4WH 3Q76A 1HJ8A 1DXWA 4MPXA 1TPSA 1XMNB 4AB9A 1Z1IA 4AN7A 2F9VA 1OS8A 3RXOA 1FY5A 1O3LA 3SNEA 3A85A 1Y3WA 1P2JA 3BIVH 1EUFA 1YPKH 3GY2A 2FYQA 1NZQH 2Q1JA 2HRVA 2FOCA 1BUIA 2TIOA 1BJUA 2XYAA 2Z3CA 1J16A 1HGTH 2R0KA 5GPIB 1ETRH 1GJBB 1GBBA 3QZQA 1SLWB 2RG3A 2I6SA 1DX5M 2HNTC 2TGDA 1NU7B 3PMJA 2QC2A 1EB1H 1EP6A 2FODA 4AOQA 1TRNA 4IMZA 3BG4B 2TBSA 2WPIS 3PWCA 2J94A 1C1VH 3TPIZ 8LPRA 5DP4A 3PYHA 3T29A 1GG6B 4A1VA 1GBTA 5FCKA 2PSXA 1CA8B 1AE8H 2PFEA 2Q6DA 1LVMA 2AH4X 5T6GA 2ZO3H 3T26A 2A7JA 2H1UA 1D3TB 4IC6A 1AY6H 2A2XH 3CENA 1H9IE 4JYTA 3SV9A 1KXEA 1UTMA 4U30A 1EOJA 3SU3A 1F2SE 3RMNH 1O3IA 1SGCA 1O31A 1NY22 1PPBH 1O37A 3TIUA 1EAUA 1OOKB 1O3JA 1L0ZA 2ZPSA 1O35A 3LC5A 1RS0A 1F0UA 1IQIA 1GBHA 2XBXA 5E8EH 1AB9C 1L2EA 4ZKNU 1W10U 3A82A 1G37A 3ZVBA 2STBE 2F9BH 1HRTH 2XXLA 4I8HA 1EJNA 1RTLA 2OP9A 3EAJA 1C5MD 1V2MT 1KTTB 2HPPH 4CR9A 4MNXA 1GMHF 3MFJA 2Z9GA 3SHCH 4HFPB 1HAOH 2AIQA 3VGCC 1S6HA 2G4UA 2C8XB 3RM2H 4LZ1H 1YPEH 1XUGA 2P3UB 1ZSLA 3SJ9A 2Z9IA 5J4SA 1WU1A 4X2YA 4OS2A 4ISIH 4RN6A 1DS2E 4D7FA 2OQ5A 2A4OA 3P8NA 4SGBE 3A7XA 2ANMH 2BLVA 1MQ6A 3M5MA 3E6PH 1RXPA 1SL3A 1DSUA 2XBYA 3UTUH 5L6NH 1QL7A 3MNSA 1AO5A 3GDUA 7LPRA 5TCAA 1P2QA 1EZXC 1NTPA 1SI5H 3PV4A 1GJCB 1W7XH 4VGCC 4BOHA 5GWZA 4FUBA 1EPTC 1QR3E 1WOFA 3TJUA 2UWPA 3GY6A 3BTQE 1HB0B 3BIUH 1JRSA 1PPZA 1CBWC 2V35A 4A7IB 1BOQA 4MLFB 1AKSA 2FI3E 1NT1A 2GP9B 1P2MA 4DVAU 3HGNA 5JBCS 3QZRA 4WMEA 4IN2A 1JMOH 2ODYB 4BTUB 4H6TA 5FAHA 2OBOA 2ZDLA 1GGDC 2VINA 3EGKH 4DGJA 1NESE 3FZZA 1FXYA 1JBUH 2G81E 4KP0A 4ZKRU 1F7ZA 3ITIA 2ASUB 1FLEE 2B7DH 2OTVA 1N6YA 1C5ZB 1TNGA 4TY6A 1ZPBA 1VJAU 1HPGA 3U1JB 1S83A 1O3GA 3STIA 1ZSKA 4NIWA 1YC0A 5JPMH 2PKAB 2RA3A 3ODDA 4YZUA 2Y5GA 1F0RA 2OC8A 2ZU3A 2NU4E 3ATWA 3MOCA 1PPEE 1LHFH 1V6DA 2GCHG 3M61U 4JZ1A 1UHBB 2SNVA 1V2RT 1TA6A 1MH0A 3ZYDA 2KAIB 1E37B 1C2GA 1HIAB 3ATKA 3M5OA 1DUAA 3M5LA 1P9UA 1TLDA 1EQ9A 1BTXA 2V3HH 1NRSH 4LK4A 3KF2A 3SUFA 3L6PA 2QGRA 2OQUA 1C2FA 1O3PB 1ABJH 3SHAH 4O97A 2QIQA 3GYMA 3E3TA 3HPTB 1T31A 2ZG0H 3PMHB 1BRAA 2IN2A 5EPYA 1QURH 1GG6C 7ESTE 1W12U 2WV5A 1SLUB 1ZRKA 1RIWB 2ZU5A 3SV7A 3EE0B 1SBWA 4NIYA 2R9PA 1P2KA 5FBEA 3F9FA 1C5RA 4CBOA 2ZGHA 3ZZAA 2AYWA 2JH5D 3NKKA 2QY0B 3RXAA 3UREA 4YTAA 2Z7FE 3MU4A 1PYTC 2CXVA 3LJJA 3UY9A 1MCVA 2GZ9A 1ELAA 1UK3A 2G8TA 3ELAH 4D9QA 1OSSA 4JCNA 4B73A 1O36A 2D8WA 2FMJA 1CGIE 1O30A 3UOUA 2XTTB 3QX5H 1F0SA 5EW2H 1MUEB 2R3UA 3UWIA 3PLPA 3RXUA 1SHHB 1FY8E 2JETB 2JKHA 2VIVA 1XXDA 5BRRE 4I8GA 3H7TA 2XWAA 1DITH 3A88A 2VB0A 1GVKB 2ZF0H 3BEFB 3RC4A 1L1GA 1BBRK 2A5KA 2VGCC 1UK4A 5F8TA 1P2NA 2BY6X 5DO4H 2V3OH 4X8TH 3LDXH 2OC7A 4Y8ZA 1P10A 5A8XA 1GDNA 3RXFA 2FTLE 2QAAA 2WYJA 1CT4E 3ZZ7A 1VR1H 1DY9A 1BT7A 4ABAA 1AVGH 1Q2WA 1A3BH 1DUEA 4HGCA 1DE7H 1P05A 2EI7A 2THFB 1HJ9A 4X8VH 5DGJA 1SGPE 1O3AA 3KQCA 3V12A 1LPGB 2CJIA 4X8UH 5T3HA 5L2YH 4KELA 1EP5A 3TH4H 4LZ4B 1KXDA 1ELEE 1V2UT 1C4U2 1YF4A 2QXGA 1T7CA 1WBGB 1C2DA 3A7WA 3QGNB 2Z9KA 1OWJA 1A2CH 1Y8TA 2AGEX 4BAOB 1QJ1B 2QF0A 2SGQE 3PMBB 3BG8A 3SN8A 5C1UA 3SUDA 1FPCH 1HJAC 2BY9X 2PHBA 4CBNA 3N7OA 3RXTA 2F9NA 3T25A 2CF8H 2PW8H 3O8RA 1JXPA 2XCNA 5AF9H 2HOBA 1TBQH 1HDTH 1ABIH 5EXLA 3D49H 1MTVA 1QRZA 2FOFA 2ZU1A 3DFLA 2PGQB 1TWXB 1UJ1A 1J9CH 3SV8A 4AFZA 1G3CA 1M9UA 1EJMA 3SJIA 1ZMLA 3M35A 5B6OA 5I25A 1WYKA 1TX6A 3E1XB 1O5FH 3MNBA 1EJAA 2Y6TA 1NRQH 3FZDA 2J2UA 2ZFRH 5E0GA 3SUGA 1OWHA 2V0BA 3MU8A 1YKTA 4MQAA 3MO9A 3TNSA 3OYPA 3FP6E 1HAVB 2FPZA 4FUFA 1W11U 1BQYA 1AZZA 4XSKU 1GI2A 1Q31A 3ATMA 1BTZA 1GHAG 5IYTA 1H9HE 4ASHA 1E35B 6LPRA 1AVXA 2Y5FA 1WAYB 3LU9B 1J15A 1BHXB 4CRBA 3TH2H 4BTIB 1D3PB 4H6SB 1ZZZA 4RKOB 4X1QU 2B9LA 2ANYA 2ODQA 2P3FH 4FUGA 1O3DA 3ZZ4A 3UNQA 2BXUH 4MPVA 1MMJN 2BDIA 3LH1A 3LGYA 1NRNH 2C8ZB 2EEKA 2PTCE 4GCHG 3GISB 1D4PB 1TX7A 4UFEH 4DCDA 2Y7XA 3QDZB 1BMAA 3A80A 3QGJA 1AVWA 1GI1A 2GV7A 4ZKSU 3T28A 1HYLA 3VFEA 3ODFA 4X2WA 1O2OA 1B0EA 5DG6A 4ZHMU 4JMYA 4CH2B 1Z71A 3AVZA 3VB4A 1AZ8A 2CV3A 2A7CA 2FS9A 2PKAA 6GCHF 1SHYA 3KQBA 3K2UA 2ZI2H 1FUJA 2YNBA 1CHOG 2XC5A 3O8DA 4AX9H 1OP2A 4ABGA 3A8AA 4D9RA 1VITH 5C1XA 5J4QA 1GBFA 1GMCG 1A0LA 1TA2A 2TPIZ 1GMHG 1O38A 3WY8A 3M5NA 1TBZH 2Q6FA 3RUOA 5HXFA 4ZROA 1XUFA 3QUMP 1G30B 4ZXXH 3PM3A 5E2OA 1KLTA 1OPHB 2GT7A 1GBIA 2VVVA 3LKWA 1G36A 1PFXC 1SGNE 1CSOE 3MYWA 3PO1C 1O3MA 1TX8A 1RGQA 2J92A 3KNXA 3SNBA 1ANEA 2GKVE 1K1MA 2B0FA 4OGXA 5LH8A 2D26C 1DOJA 8ESTE 2ZWLH 1WSSH 2ZHQH 3V7TA 3TK5A 4A92A 2BX4A 6CHAC 4I8KA 1KYNA 2H9HA 3NK8A 3A81A 5T6FA 1T8NA 3JZ1B 3SGBE 5JB8S 1O5BB 4ABIA 1B0FA 3F9HA 2ZEBA 1V2NT 1SQOA 4HZHA 3E8LA 1ZYOA 2PUXB 3S7HB 1KTSB 8GCHG 1O2VA 1TNHA 1KXCA 3AW1A 2W5EA 4IC5A 3UR9A 1AWHB 1QGFA 1GI6A 3C27B 1HAYB 2GCHF 4I8JA 2JH0D 2PSYA 1SLVB 2ZU2A 3S9AA 1O3FA 3VEQB 1SGEE 1AUJA 1GI4A 4TWWA 1VGCC 3ZZ3A 3BEUA 3MNCA 2VVUA 2BB4A 1IOEA 3U8OH 1DFPA 2PKSC 4ISLA 4ESTE 2C8WB 1GJ8B 2ZC9H 1PPCE 3A84A 3URCA 3ZV8A 3IITA 1GHYH 1MBQA 2HPQH 4ISNA 1MTUA 3RXGA 3ZZBA 2VGCB 1O2YA 3RXBA 2I6QA 2NU0E 1H1BA 2GZ7A 3K65B 3L33A 3V3MA 2C3SA 3ZZCA 4AGJA 3VGCB 4OS1A 2A45B 3S0NA 1LPZB 1Z6EA 2AGGX 4FUIA 4INHA 1ORFA 2ZECA 1UVUH 3E90B 3PLKA 3TH3H 4CHAC 1O2HA 1DY8A 3TJOA 2A0QB 2UWLA 1XM1A 1AGJA 3GY3A 1G3EA 1P02A 1UTPA 3QTVH 4K3JA 3RXPA 2ZFSA 3AAVA 5EXMA 5G4BA 3BEIB 2BD2A 1FAKH 5CE1A 4OS7A 2VVCA 5C2ZA 2ZHFH 1ZHRA 1GJ5H 8KME2 3KQEA 1CGJE 3KGPA 4YLQH 1HNEE 1V2LT 1Y3UA 2GDDA 1LHGH 3GCOA 2XRCA 1YPJH 3TK9A 2D1JA 1W14U 5F6MA 3RXLA 4X6NA 1AN1E 1KXBA 1TAWA 1EZQA 2AEIH 1BA8B 5AFYH 3TVJB 4D8NA 3KEEA 2D2DA 3FFGA 1P8VC 1YPHE 2XBWA 5EODA 4BXWA 4FUJA 2ZGXH 4DJZB 1GVZA 2ZNKH 2UUJB 2VH6A 2NU2E 1UVSH 1GVLA 1P04A 1P3CA 3ZVCA 4WWYA 1O2WA 3GDSA 3SNDA 2G4TA 1IQFA 3DD2H 4Y7AA 5EG4A 1J8AA 3GY5A 1THSH 1MU8B 4MDSA 3MU1A 1V2KT 2BOKA 2ZCKP 2FOBA 4K60A 2C8YB 3GDVA 2AERH 2WPMS 3RXVA 2F9UA 2BD5A 1C1SA 3I78A 2NU1E 3M37A 5GXPA 3E91A 1EPTB 4UD9H 4Z6AH 1SLXB 1O2ZA 1Z6JH 3BTHE 3TGKE 1UMAH 2A2QH 2ZGJA 1BTPA 2W26A 2ILNA 4BAHB 1P11E 1OWEA 4B2CA 3S69A 3HKIB 2VWLA 1PQAA 4KTSA 4Y10E 3F1SB 3L3TA 1MU6B 3RDZA 1TIOA 1T32A 4SGAE 4NSYA 1C4Y2 1F0TA 2C4FH 1O34A 2FLRH 1C2IA 1S82A 1TGTA 1MAYA 2OLGA 2F83A 2BVSH 4KTCA 5C1YA 4B71A 4JYUH 4HI3A 2QYIA 1A5GH 3A8CA 1HAVA 4ZHAA 4INKA 1T8OA 5LPFA 1SMFE 3RXQA 1C2JA 4CRGA 2A4QA 1C2HA 1TNIA 1DSTA 3ZZ9A 1DVAH 2BDBA 1NRRH 1FPHH 3P8GA 1A5IA 1C2KA 4UFDH 3PO1B 5I46H 3TGIE 1TGCA 2P8OB 1OYQA 1D6RA 5DKMA 2WV4A 3SU1A 2BDGA 1P06A 5K0HA 3MMGA 1N1LA 3LGVA 1C1TA 1DM4B 1W0YH 1PJPA 3F9EA 4OGYA 2BZAA 2DE9A 4BAQB 4RSPA 4F4OC 4AYYB 1BITA 1K9OE 1S84A 1ANBA 2FWWA 1C1UH 3SORA 3DUXH 1SFQB 4U2WA 1A7SA 4Y6DA 1GCDA 1Q3XA 1QA7A 1HAHH 1V2TT 4TPIZ 3PWBA 1ELDE 1L1JA 2BX3A 3NWUA 3KN2A 4R8TB 2PKSB 1O2GH 1QL8A 5FX5A 3BN9A 1T8MA 1BZXE 1DPOA 2CHAB 4AB8A 2WUBA 1GI7B 3MHWU 1VCWA 1W0ZU 4UFFH 2GV6A 1QQUA 5A2MH 1K1JA 5HMAA 4X1PU 1WCZA 3SV2H 1W2KH 1S0RA 1UTLM 1Z8RA 1D9IA 1ZTKA 6ESTA 2GCTB 3LGWA 4LOYH 1GI0A 3ZVFA 4AFSA 3NXPA 1OP0A 4QT8C 2J38A 4NIVA 1GMDF 1QB9A 3FP7E 2BDAA 1F5LA 1AMHA 1BTWA 4AFUA 1O32A 1O33A 1BTYA 4OS5A 1FMGA 1Z8IB 2ZP0H 2R0LA 1SQAA 1P3EA 1BMMH 1FY4A 2GTBA 4MVNA 1F5RA 2ESTE 1SSXA 2TGAA 1OWKA 2GMTB 1HV7A 2SGFE 1CA0B 1A1RA 1QB1A 3BTGE 3UNSA 1ZHPA 2R3YA 3UIRA 1MD7A 1H8DH 4A6LA 3BTFE 2OD3B 1MKWK 1QTFA 5HGGA 3RU4E 1WQSA 2FDAA 3BG4C 4CHAB 4XBCA 4UONA 4GHTA 1CT0E 2FI4E 4IN1A 1AHTH 3MU5A 1AD8H 1IHSH 2DUCA 3A8BA 5TJXA 1A5HA 1VJ9U 2ZA5A 4IBLH 3QO6A 3GCNA 2Z94A 4NG9H 1Y5AT 2RCEA 1LVBA 3M36A 4R0IA 1GJ9B 4NZLA 1ZTLA 2ZDNA 3AAUA 2AMPA 3M7QA 2G51A 4AG1A 1C5SA 4WMDA 1UVPA 2VWMA 4B74A 1GJ7B 1NS3A 1A0JA 5EU8A 3B9FH 1GWAA 1XUIA 4DT7B 1O2XA 3SGAE 3LGUA 4IS5A 1N8OB 2ZCLP 1H4WA 3VB3A 2J34A 1RRKA 4X2VA 1SGYE 1H8IH 1MKXK 3G01A 2W3IA 1TRYA 1NM6A 3NZIA 1AUTC 1TONA 1RIWC 1YCPM 1HIAA 5C3NA 4Y11E 3M3TA 1K1LA 1TRMA 3VPKA 2PV9B 1UHBA 5PTPA 2FOGA 4NWKA 1AKSB 1C5NH 2BQWB 2G52A 2BDCA 3A89A 2Z9JA 4Q7XA 1UVOA 3UQOA 1FDPA 2BD9A 1IQMA 1DXPA 3R0FA 4YM9A 1ZPCA 3Q77A 2QXJA
chains in the Genus database with same CATH superfamily
4QF3A 1HFDA 3EB5A 2EI8A 1EOLA 4MVTA 4WH8A 1C5TA 1QCPA 3DFJA 3DSOA 3P95A 3U8RH 5A0CA 5KH3A 1BBRH 1KXFA 3A87A 1LHEH 2GD4B 3KIDU 4X3GA 2WPLS 5JG6A 4MG3A 4JK5A 4M9FA 1MAXA 2AGIX 2QXHA 1SGIB 1ZRBA 1C1WH 2G00A 3RMLH 2CMYA 3SU5A 2GX4A 3BTWE 1LCYA 2BQ6B 5L30H 2YVRA 2FUUA 1BJVA 3FVFB 1GBEA 1VD4A 3URDA 1DWBH 3MH4A 2CHAC 4MNYA 1D3QB 2GZ8A 3OAAD 4UP0A 5EGMA 1WEQA 4U32A 1EB2A 3TJVA 2LXPC 1IQGA 1Z1JA 4O3TA 4FU9A 1ELVA 4NA9H 1AB9B 3TNTA 1LDTT 1LQEA 9LPRA 2A31A 4X8SH 2MD7B 1OXGA 3P8FA 1UO6A 3SZNA 3VB7A 2RSDA 3FP8E 1AWFH 1EPTA 3F3BA 1UTJA 1RFNA 5CHAC 3ZZDA 2LN0A 1SGQE 1MABB 2KYUA 2ZFPH 4RT1A 2J95A 3W1EA 4V3LC 2TRMA 1GBJA 1PQ7A 5SVIA 1SGTA 2KWOA 1A46H 3OX7U 3BTTE 3AASA 2ZQ2A 5GNDA 4UI9B 1SGDE 2A4RA 3OY6U 2Y7ZA 3TGJE 2HYED 1ZPZA 3SO3A 1B5GH 1O2KA 3T27A 2J9NA 3SUBA 5JBAS 2YMSD 3DT0H 2GMTC 4THNH 2A5IA 4FO9A 2WPHS 1IQHA 2ZDVH 4GNDA 1C5LH 4PROA 3D62A 4BANB 3N9LA 4ISOA 1C1MA 3BV9B 2P95A 1KLIH 1HJAB 5E2PA 5EJ1A 2BLQA 2QJ0A 4I33A 4YBSA 3O37A 2ZPRA 3GCHB 4K5ZA 1NC6A 3CS7A 1EATA 2ALPA 5F03A 3A8DA 1P09A 2JIZD 2CSVA 1C5OH 2BM2A 2K16A 2YU4A 2BQ7B 2BY5X 3P17H 1UVTH 4XBDA 3OTPA 3VB6A 3LIWA 3ZZ8A 1JM7B 1ETSH 1MKWH 3GY7A 4HG6A 1NN6A 2KCOA 5T6DA 2YREA 4WF8A 4AVXA 3PTBA 2R2MB 3FN8A 4XBBA 2BVXH 3KYGA 2BZ6H 5JYIA 3AW0A 3OTJE 4A1XA 2FM2A 3T2NA 2QV1A 1WV7H 2H9TH 4NN2A 1TABE 1CBWB 2UZGA 1K1OA 1XUKA 1GDUA 2P16A 3FL2A 2F3CE 1BCUH 5HM9A 1WEVA 2EC9H 4XE4A 3T62A 3UB0A 2FOEA 1P03A 2WSSD 1SFIA 3LGTA 1QBNA 1TYNA 2PUYA 3T5FH 4ABJA 4BAKB 1YPMH 5DK1A 5JBTA 2BTCE 3SNCA 1PPFE 2KE1A 2RA0A 1BMLA 2SFAA 1FBVA 2KFTA 1THPB 1A0HB 1G3DA 4JZFH 2FX6A 1TMBH 2ZTYA 5AVDA 1CU1A 2GGVB 4ACAA 4B6EA 5H1TA 2CGAA 3GYLB 5K3QA 3MH6A 3PMAB 1TGNA 1LTOA 3UOPA 4CR5A 1NBME 1MM2A 1C1PA 1GHWH 1P2IA 5LPRA 5FBIA 1FI8A 2HNTE 3RC5A 3W95A 2BXTH 3MQKC 4H4FA 3NG2A 3S9BA 2XBVA 3GCTF 1AE5A 1BDAA 2LNCA 5C5OA 2O9QA 4YC9A 2IOTA 3RXDA 3LQJA 4NFEA 3SZEA 1GBMA 1YBWA 3A7VA 4ABFA 1BTHH 2BD8A 5SGAE 2VIWA 1N8OC 4FUHA 2K0QA 4IMQA 1CO7E 3N9QA 4LADB 1TQ7B 2J5UA 1O3HA 2UUYA 2A1DB 1P57B 3HKJB 3M3SA 1XKAC 1QIXB 1V2VT 3U98H 1BB0B 2ZFQH 4K1EA 1O2QA 4PTBA 3K6YA 1C4V2 4Y8YA 1IQEA 1C2MA 2XNIA 4B2BA 1O39A 5F8XA 1WE9A 1AFQB 1TNKA 5DP5A 3DCLA 1OWDA 5JB9S 1ID5H 4AYVB 4R7EA 1L4ZA 1XWHA 5F8ZA 3KNVA 1YP9A 4Y79A 1TFXA 3Q00A 1IAUA 3VXFH 2NAAA 2FIRH 1O2JA 5E0HA 1KSNA 4O03A 2ZGCA 1XVOA 2H6MA 1C1QA 1FJSA 4I31A 1GBCA 1YPLH 3UR6A 3OU0A 1PYTD 1TOCB 1EAWA 4ZUXU 4WA6A 1K28D 1CHCA 4FU7A 1V2JT 1Y3XA 2WPKS 3IWMA 3P92A 1E1RD 1ZMJA 4Y7BA 5DINA 1PPHE 1VCQA 3CP7A 2RI7A 4FIPA 5DSFA 1QB6A 1UTNA 2GCTC 5HYOA 1GHBF 3M7UA 3UFAA 3DQVR 3ZYEA 4MTBA 1HBTH 1QFKH 1MTNB 5D1LB 4RKJB 1UW7A 3TK6A 2EA6A 4K1TA 2G5VA 3BTKE 4FVDA 2HGTH 1LKAA 3EQ0H 3PTNA 2IDAA 1K1NA 1KLJH 4AFQA 5CHBA 2ZU4A 4UDWH 3HK6B 3QK1A 7KMEH 3MH5A 1VITG 1PQ5A 3MNXA 4AORA 2Y81A 1UTOA 2HALA 2BY7X 3SV6A 3N9PA 1CA0C 2TGPZ 1ESAA 2CT2A 5GJ4B 2Z9LA 1FY1A 1RTFB 1F5KU 2ECGA 1O5DH 1TNJA 1O3BA 4B1TA 1O5AB 1K1IA 2BMGB 2VWNA 4F55A 3N9OA 1S81A 2KAIA 4GB0A 4TY7A 5FEYA 2HWLB 3LQHA 3PROA 2F9PA 5FB0A 1LMWB 2W6JD 3RM0H 5A8ZA 4GAWA 1VITF 3SJKA 1ELCA 1S6LA 3LDYA 1EASA 3BF6H 1YLDA 2VP7A 1MZAA 1SB1H 1JIMA 2QF3A 4WH6A 2DSMA 1ZR0A 4FUEA 1TOMH 3SUEA 5FHTA 4K69A 3KQDA 3QLPH 2WUCA 2OWAA 1V2WT 2P8OC 2MNZA 2NWNA 3LRQA 2XOYA 2JDID 5C5NA 1SGRE 3SJOA 4ASUD 1IQKA 1OP8A 3U1IB 3JZ2B 2GT8A 3BTME 4YOJA 2CRWA 2FFWA 5K7RA 4X1NU 2WPJS 1C5XB 1FONA 1KXAA 3ZZ6A 4AC9A 2BDYA 3R3GB 4B2AA 1YCPK 5L2ZH 3SGQE 1ELFA 2WPDD 2BLOA 1Z8GA 2FX4A 2YHOA 3N9NA 1VFYA 4LKAA 1HAZB 1T4VH 2MIQA 3RLWH 4NWLA 3UWJH 3RXMA 2XP0A 2O8TA 4ZHLU 4Z0KA 2FYRA 4DOQA 3VG8A 1KDQB 3ZTGA 4E7RG 2BHGA 2FESH 1C1NA 3UQVA 6CHAB 3RXEA 1ANCA 1WEWA 2LELA 1ESTA 5TABA 2OINA 4Q7YA 2O8UA 1O5EH 2XEUA 1HXEH 1SGFG 2H2ZA 3LPRA 3RXSA 2D8SA 3BSQA 3EDXB 2QIZA 1TNLA 1L1NA 1W8BH 2XWBI 2BOHB 4VGCB 1Y3VA 3MU0A 4WXVA 2VWOA 2JJ1D 1UTKA 2A5AA 4WZ3B 1W7GH 5FCRA 8GCHF 1CT2E 1WUNH 3P70B 2PR3A 1TQ0B 5E0JA 3F6UH 2UUFB 2PWXA 1GL0E 4WY3A 3U69H 4AZ2B 5EQSA 1AQ7A 3ZVGA 1HLTH 3D23A 2BD4A 5TDWA 4X0WU 1ACBE 2L43A 1SOZA 2VIPA 1FV9A 1CHOF 3ZVDA 4X1RU 1C5QA 5B76A 4KGAA 5DJ7A 5C0TA 1J17T 3KV6A 4B75A 3LOXA 3SHBA 2ZHWH 1FQ3A 1E36B 5EOKA 2VIDA 1GI9B 1TGSZ 3EB6A 5EXNA 3STJA 2MUMA 1S5SA 1JRTA 4ZMAH 1DT2A 2H5CA 2L75A 1E0FD 1BRUP 3CS0A 5HM2A 1ZLRA 4TWYA 4BXSA 4V3KC 2H5DA 3A86A 1G3BA 4E06H 1GHAF 1XUHA 1GHVH 2SGAA 4YT6H 3O8BA 5FX6A 1DICA 4GUXA 3ZV9A 3RU4T 2KREA 1QNJA 4F48B 1V2OT 3ESTA 1BRCE 2DE8A 4IGDA 4TPYA 3U9AH 1FZZA 1QBVH 3F2HA 3GOVB 1HAPH 5C17A 1J14A 5EQQA 1O2PA 4DY7B 2QN5T 4Q2KA 1XX9A 2Y5HA 1TGBA 3LH3A 1EZSC 3L11A 4NSVA 3RXKA 4A5TS 1O2SA 1P9SA 1XUJA 4YLUA 5FPTA 4Y71A 1LO6A 1A61H 3TITA 3EE7A 2AMDA 3SI3H 2FEQH 1KIGH 2QICA 2EY4C 1DDJA 3KHVA 3LJUX 4DIHH 1QQ4A 4ISHH 2B5TB 2CSYA 1FY3A 2J98B 3V43A 2ZIQH 4OM9A 3RXIA 3HTKC 1O2TA 1QRWA 3CNRA 2Q6GA 2ANKH 1WDIA 5F53A 4CH8B 1ARBA 1HUTH 4I32A 2HNTF 1Z8JB 1C5WB 1SC8U 2SNWA 2V6NA 1GBKA 3N7EA 1SOTA 3KQIA 4WMFA 1VCPA 1XKBC 3RTRB 3U8TH 2VPDA 1GCTC 1ETTH 3RC6A 5IDKA 3S9CA 1IQJA 2FP7B 2PTNA 2RDLA 4GSOA 4ZXYH 5EJLA 4H9DA 4XDEA 3T6RA 1EXFA 1TE0A 3Q3YA 1O2MA 4MPWA 4YO9A 1SVPA 1V2PT 2VU8E 2XCFA 1P2OA 1X7AC 2SGDE 4K8YA 2B8OH 3LJOA 1LHCH 2O8WA 2KR7A 2ZKSA 3VXEH 1YLNA 1EZUC 1U6GB 1EAXA 1ELBA 3Q3XA 1GJAB 2C93B 2FOMB 5A09A 4O9VA 4ZQLA 3MWIU 3U28C 2GDEH 4UE7H 4GVUA 2PUQH 2VJEA 4X6OA 1YCPH 3UPEA 2XB1A 2JH6D 4Y0ZE 1K1PA 1BBRE 1ELGA 3DHKH 1NO9H 2H0DA 2ZCHP 2JMJA 4OS6A 4H42U 1VYXA 1H8ED 2KR4A 3E16B 1PQ8A 1GDQA 3K9XB 3T7LA 2OCVB 1LKBA 1TB6H 4XRNA 4BNRA 1U6QA 2MA6A 3SW2B 3RXRA 2W6ID 1HYIA 3E0PB 3M3VA 1F92A 4K1SA 5C20A 1ZJKA 4Q7ZA 2ECJA 2PGBB 3GV4A 3PRDA 3GICB 4B86C 1T8LA 1FIZA 4Q80A 2EODA 4NIXA 1C1RA 2E61A 2H9EH 5AFZH 5BPEA 2CONA 1C9PA 4BTTB 4GHQA 1HAGE 2VBCA 2ZZUH 1IQNA 1GMCF 1TMTH 2ZETC 5LKUA 3FKSD 1HAIH 1G32B 2OUAA 3MO3A 1WEEA 2E6SA 1IQLA 3U5NA 2KKYA 2ZGBH 4ZUHA 1NFXA 5LGOA 2W7UA 1C5PA 3KCGH 5C67A 4ABEA 2VIQA 4WXIA 5G05B 1O3EA 5FXLA 1NRPH 1TBRH 2KWKA 2G55A 1K21H 4DURA 1ESBA 4E05H 2M5TA 2BY8X 1GHBG 1MZDA 4N3WA 3U5MA 2KM0A 4XOJA 4IW4E 1N6XA 2L0BA 1ZGIA 2KCYA 1PPGE 4NGAH 2FXRA 2I50A 2UUKB 1WEPA 2F91A 2EXUA 1GJ4H 3NUMA 2BYAX 1MKXH 5TBNA 1AFEH 1UK2A 2ZHEH 3GCTG 1AU8A 3GY8A 1GI8B 4KKDA 3TU7H 4FU8A 4XFQA 1WEOA 2HVXA 1HAXB 1DCQA 2QCYA 3VK6A 4K2YA 3V13A 2AFQB 1O0DH 1RTKA 2XW9A 5ETXA 4FOUC 2BVRH 2F42A 4AYCB 2ZHDA 1YYY1 2CSZA 3GCHC 2NU3E 1C9TA 1FAXA 4A1TA 3O35A 1FN6A 3RU4D 1Y5UT 4FUDA 3MI4A 1UCYH 2XC4A 2O8MA 3PLWA 2WYGA 3DPLR 2ODPA 5ESTE 1BRBE 4JK6A 2BD3A 1G2MA 1CE5A 3O70A 4X6PA 5FPYA 1ZSJA 4F49A 4INLA 4X2XA 2YOLA 4A4BA 4JZIA 4U01A 4MPUA 4WJG2 4Y0YE 3V0XA 3FEHA 2GVFA 2QA9E 5A0BA 3SQEE 1LVYA 3ATLA 4GPGA 3Q3KA 2Y82A 2V7QD 2ZQ1A 1E34B 4NA7A 4O3UA 3A83A 2J4IA 3RLYH 1QJ6B 1NU9A 2Z3EA 3ZZ5A 2EI6A 3LGIA 1IHTH 1WEMA 4YT7H 1W3CA 1D3DB 3ATIA 4NFFA 1S85A 5DP8A 5DP3A 2ZDAH 3I77A 4E7NA 3K6ZA 3OY5U 1TPPA 2BLWA 3FANA 2M1RA 1O2RA 2Z3DA 9ESTA 1ARCA 5GCHG 4D76A 1SG8B 2VNTA 1THRH 1BTUA 5LPEA 1LPKB 2P94A 1GBDA 4AG2A 1YGCH 2VH0A 1ANDA 4MNWA 3TLOA 4CRFA 2OBQA 4UEHH 3B23B 1H8HD 1JOUB 3RMMH 1QHRB 2DX8A 3PUQA 3M7TA 2RR4A 1GBLA 3UUZA 2PP6A 5DN6D 1O2NA 1ZMNA 4ZH8A 3SU6A 1ZOMA 2FTMA 5D1KB 2PNXA 1CHGA 3D65E 1G9IE 3SI4H 1Y5BT 5JDUB 2ZTXA 3NCLA 3GS9A 4KTUA 4HTCH 1O3OA 3C1KA 4YOIA 1SPJA 1MTWA 4DW2U 2M85A 1XXFA 4NZQA 3TJNA 1MTNC 1QJ7B 2VIOA 4OS4A 1QA0A 5A0AE 1UTQA 3B8JA 2ZDMA 1GGDB 2EA3A 2CN0H 4FUCA 2R2WU 2YNAA 2IJOB 2AMQA 3SJ8A 4ZAEA 5GDSH 7GCHG 2C2LA 3PB1E 4Y8XA 1P0SH 2XOKD 1HCGA 3MO6A 3F9GA 3QWCH 4MSXA 1OYTH 4BHWA 1QL9A 4NCYA 4TKPB 5AHGH 3PLBA 3SU4A 3ZVAA 2A32A 5A8YA 4LXBH 2L5UA 2O8LA 1NPMA 3QTOH 3RXCA 1INCA 5D1MB 5EW1H 3EA9A 1OHHD 4S3OB 3FAOA 4JZDH 3EYDA 1O5GH 2HLDD 3DA9B 4ZKOU 3UNRA 3W94A 2XNDD 2ANWA 5KH9A 1EKBB 1XVMA 4YATA 3SU0A 4FVBA 4K8BA 1GL1A 2FOHA 4BAMB 1JIRA 1Z7KA 3DSGA 2ZDKA 3SNAA 1EAIA 3LONA 1BMNH 4B76A 3PURA 1G2LA 2LPRA 1BIOA 4I8LA 2HDPA 4P5OB 4YESB 2FS8A 2ZFFH 2ZPQA 2FD4A 5ESBA 1QRXA 1AIXH 1DWEH 2P59A 1O3CA 2JETC 4WVPE 2P93A 7GCHF 1MTSA 4D7GA 1WGMA 2MA5A 1W13U 1EX3A 1YM0A 1D6WA 1ZHMA 2YYRA 4X1SU 2FI5E 3F0OA 2CK3D 2KCPA 3P6ZB 1GI3A 2W3KA 2WINI 5FERA 5JBBS 1V2QT 2OXSA 2QXIA 1L4DA 1UCYE 3SOWA 2Y43A 1CGHA 4M7GA 4JZEH 1O5CB 5DPAA 1DWCH 2SGEE 1S6FA 2G45A 5IK2D 5CMXH 1V2ST 3JUEA 3MTYA 3E2DA 4BBQA 1P12E 3H7OA 1MD8A 3I29A 1ZTJA 1UCYK 3ZVEA 1TPOA 1DANH 1Y3YA 2MT5A 3OE7D 2OK5A 2EGMA 1TMUH 3QN7A 3ENSB 1QY6A 3HCUA 4YABA 1OWIA 1LQDB 1RD3B 1H9LB 1MBMA 1NFWA 2Y80A 3IG6B 4J2YB 2LAUA 2ZFTA 3ZIAD 3SQHE 1LVOA 1O2UA 1GHZA 1BHXF 1GHXH 4NA8A 1RJXB 3BTDE 2F6JA 1DWDH 2FLBH 5TCCA 1MCTA 4GLYA 1GCTB 3VB5A 4Q6FA 1E4UA 2CRRA 2A7HA 3LT3A 1CQQA 1FNIA 1GJDB 1WFKA 3GY4A 4JYVH 5CHAB 1X4UA 1P01A 2SGPE 2OC0A 4J1YA 5H4IB 1O2IA 2ZTZA 3HATH 3LC3A 2YUCA 4AGKA 3OSYA 1AFQC 1KDQA 4CREA 3SOSA 4MNVA 5DP9A 1ZJDA 3ZYQA 4B7YC 1HYJA 1K2I1 2BD7A 3P8OA 4CRCA 3EA8A 5DP6A 5GIBA 1O2LA 1GI5A 2KX4A 1B7XB 3O33A 3A7TA 2CF9H 1O3KA 1S0QA 1GJ6A 1C5UA 4XI1A 3UAIC 2ALVA 4ABBA 1SR5C 3EA7A 1VZQH 2AIPA 5EQRA 1BMFD 4R2YA 1DLEA 1NROH 2BDHA 2PLXA 3E0NB 4ABHA 5EPNA 1Y59T 2C90B 1T4UH 2KWNA 2TGTA 2YSJA 1NFYA 4B6FA 5DP7A 3N99A 1NFUA 3MHHA 3RXJA 2ECNA 2XC0A 1ELTA 5T1VA 5LKTA 3MH7A 3KL6A 5FPSA 3O8CA 1FIWA 1YY3A 3BTEE 4CRDA 5ABWA 2JUNA 3NPSA 3HCTA 4GCHF 3RXHA 4FXGH 2A4GA 1OX1A 3RMOH 6GCHG 5G0FA 1VGCB 2FO9A 2KCAA 1K0HA 1YPHC 4CRAA 3S7KB 3AK5A 3SU2A 5SVIB 3RP2A 1WTGH 4TYDA 4OGCA 1C2LA 2ULLA 2FOAA 1V3XA 4QQ4A 2FZZA 1KY9A 2WHXA 1JWTA 4YOGA 1TALA 3HGPA 2HVYB 1LHDH 1GPZA 3H5CB 2IPHA 1EFRD 3F68H 1SGFA 1YLCA 4Y76A 1SQTA 1GBAA 2AS9A 5SVXA 4X6MA 1MQ5A 1WTHD 2HLCA 1K22H 1C5YB 3A7ZA 1E38B 3A7YA 2H0DB 4UFGH 2G5NA 2UWOA 1YPGH 2OC1A 2STAE 1QBOA 2Z6BD 4DG4A 1TPAE 1AI8H 5GCHF 1DLKB 2P3TB 2F9OA 2K1QA 1O3NA 1ZGVA 1C1OA 1C5VA 2W7SA 1A3EH 1GMDG 4DIIH 1CVWH 1OKXA 4ABDA 1FN8A 1WQVH 3SBKA 4I7YH 1C2EA 3HK3B 1HXFH 2VJ1A 1A4WH 3Q76A 2C2VS 1HJ8A 2DJAA 1DXWA 2YHNA 4MPXA 1TPSA 1XMNB 4AB9A 1Z1IA 4AN7A 4WZ0A 2F9VA 1OS8A 3RXOA 1V87A 4A4CA 1FY5A 1O3LA 3SNEA 3A85A 1Y3WA 1P2JA 3M99A 3BIVH 1EUFA 4ACBA 1YPKH 3H7HA 3GY2A 2FYQA 1NZQH 2Q1JA 2HRVA 2FOCA 1BUIA 2TIOA 1BJUA 2XYAA 2Z3CA 1Z6UA 1J16A 3NRLA 1HGTH 1LDJB 4YADA 2R0KA 5GPIB 2VPBA 1ETRH 1GJBB 1GBBA 3QZQA 1SLWB 1W0KD 2RG3A 4YAXA 2I6SA 1DX5M 2JMDA 1KMHB 1BORA 2HNTC 2TGDA 1NU7B 3PMJA 4A0CD 5EIYA 4I7DA 2QC2A 1EB1H 3I2DA 5C0UA 4GNFA 1EP6A 3KYFA 2FODA 4AOQA 1TRNA 3O7AA 4IMZA 5FB1A 1VKYA 3BG4B 4C9ZA 3OFND 2TBSA 2L6OA 3L1ZB 2WPIS 3PWCA 2J94A 1C1VH 3TPIZ 8LPRA 5DP4A 3PYHA 3T29A 3ZPV1 2KGIA 1GG6B 4A1VA 3C6WA 1GBTA 5FCKA 2PSXA 1CA8B 1AE8H 2PFEA 2Q6DA 1LVMA 2AH4X 2KIZA 3SYJA 5T6GA 2ZO3H 3T26A 1E79D 1COWD 2A7JA 2H1UA 3F2GA 1D3TB 4IC6A 1AY6H 2A2XH 3U5PA 2XOZA 3CENA 1H9IE 4JYTA 3SV9A 1KXEA 1UTMA 4U30A 1EOJA 3SU3A 1F2SE 3RMNH 1O3IA 1SGCA 1O31A 1NY22 1PPBH 1O37A 3OEHD 3TIUA 5KEDA 1EAUA 1OOKB 4L58A 4I7BA 1O3JA 1L0ZA 2ZPSA 2LGLA 2VJFA 1O35A 2WZQA 3LC5A 5LKZA 1RS0A 2Y1MA 5KGOA 1F0UA 1IQIA 1GBHA 2XBXA 4FJCA 5E8EH 3OEED 1AB9C 2YT5A 1L2EA 3O47A 4ZKNU 1W10U 3A82A 2D8UA 1G37A 3ZVBA 2YURA 1JM7A 2STBE 2F9BH 1HRTH 2XXLA 4I8HA 1EJNA 2FUIA 1RTLA 2OP9A 3EAJA 3DSPA 1C5MD 1V2MT 1KTTB 2HPPH 4CR9A 4MNXA 5DKAA 1GMHF 3MFJA 5LCWB 2Z9GA 3SHCH 2F4LA 1X4IA 4HFPB 1HAOH 2AIQA 3VGCC 1S6HA 2G4UA 2C8XB 3RM2H 3WW7A 4LZ1H 1YPEH 3C5KA 1XUGA 2P3UB 1ZSLA 3SJ9A 4UP5A 2Z9IA 5J4SA 2L80A 1WU1A 4X2YA 1X4JA 3SOUA 1LDKC 4OS2A 4ISIH 4RN6A 1DS2E 4D7FA 2OQ5A 3RPGB 2A4OA 3P8NA 4YBMA 4SGBE 3A7XA 2ANMH 2BLVA 1MQ6A 1SKYE 3M5MA 3E6PH 1RXPA 1SL3A 1DSUA 3RPGC 2XBYA 3UTUH 5L6NH 4Q4LA 4ZDTA 1QL7A 3MNSA 1AO5A 3GDUA 7LPRA 5TCAA 1P2QA 1EZXC 1NTPA 1SI5H 3PV4A 1GJCB 1W7XH 4VGCC 4BOHA 5GWZA 2KU3A 4FUBA 1EPTC 1QR3E 1WOFA 3TJUA 2UWPA 3GY6A 5C13A 3BTQE 1HB0B 3BIUH 1JRSA 1PPZA 1CBWC 2FSAA 2V35A 4A7IB 1BOQA 4MLFB 1AKSA 2FI3E 1NT1A 2QE7D 2GP9B 1P2MA 4DVAU 3HGNA 5JBCS 3QZRA 4WMEA 4IN2A 1JMOH 3M63A 2ODYB 5H1VA 3FOAA 4N4FA 4BTUB 4L7XA 4H6TA 5FAHA 2OBOA 2ZDLA 1GGDC 2VINA 3EGKH 4DGJA 1NESE 3FZZA 1FXYA 1JBUH 2G81E 4KP0A 4ZKRU 3MDBC 1F7ZA 3ITIA 2ASUB 1FLEE 2B7DH 2OTVA 1N6YA 1C5ZB 1TNGA 4TY6A 1ZPBA 1VJAU 3T9KA 1HPGA 3U1JB 2CKLB 1S83A 1G25A 1O3GA 3STIA 1ZSKA 4NIWA 1YC0A 5C94A 2PKAB 5JPMH 4Z0OA 2RA3A 4F1PA 3ODDA 4YZUA 2Y5GA 1F0RA 2OC8A 2ZU3A 2NU4E 3ATWA 3MOCA 1PPEE 1LHFH 5AIUA 1V6DA 2GCHG 3M61U 4JZ1A 1UHBB 2SNVA 1V2RT 1TA6A 1MH0A 3ZYDA 4W4UA 2KAIB 1E37B 1C2GA 1HIAB 3ATKA 3M5OA 1DUAA 3M5LA 1P9UA 1TLDA 1EQ9A 3MHSA 1BTXA 2V3HH 1NRSH 2B0OE 4LK4A 3KF2A 3SUFA 4A49A 3L6PA 2QGRA 3WWBA 2OQUA 1C2FA 1O3PB 1ABJH 5HIYA 3SHAH 4O97A 2QIQA 3GYMA 3E3TA 3HPTB 1T31A 2ZG0H 3PMHB 1BRAA 2IN2A 5EPYA 2XOCA 1QURH 1GG6C 7ESTE 5B75A 1W12U 2WV5A 1SLUB 1ZRKA 1RIWB 2ZU5A 3SV7A 3EE0B 5EYAF 1DVPA 2LGVA 1SBWA 4NIYA 3PHDA 2R9PA 5FL7D 1P2KA 5FBEA 3F9FA 1C5RA 4CBOA 2ZGHA 3ZZAA 2AYWA 2JH5D 3NKKA 2QY0B 3RXAA 2GJGA 4YTAA 3UREA 2Z7FE 2F6NA 3MU4A 2OXQC 1PYTC 3LVQE 2CXVA 3LJJA 2JM3A 3UY9A 1MCVA 2GZ9A 2KKXA 1ELAA 5KH7A 1UK3A 2G8TA 3ELAH 4D9QA 1OSSA 4JCNA 4B73A 1O36A 2D8WA 2FMJA 1CGIE 1O30A 3UOUA 2XTTB 3QX5H 1F0SA 5EW2H 5C11A 2K8IA 2YSMA 1MUEB 2R3UA 3UWIA 3PLPA 3RXUA 1SHHB 2ECVA 2P57A 1FY8E 2JETB 4AUQB 2JKHA 2VIVA 1XXDA 5BRRE 4I8GA 3H7TA 2XWAA 1DITH 3A88A 2VB0A 1GVKB 2ZF0H 3BEFB 2LXHC 1ZBDB 5CDFE 3RC4A 1L1GA 2YMSB 1BBRK 2A5KA 2VGCC 1UK4A 4RT0A 1Z2QA 5F8TA 1P2NA 5SVYA 2BY6X 5DO4H 2V3OH 4X8TH 3LDXH 2OC7A 4Y8ZA 1P10A 1WESA 5A8XA 1GDNA 3RXFA 2FTLE 2QAAA 2WYJA 3O34A 3U5OA 1CT4E 3ZZ7A 1VR1H 1DY9A 2ECWA 3KV5A 1BT7A 2E6RA 4ABAA 1AVGH 1Q2WA 1A3BH 1DUEA 4HGCA 1DE7H 1P05A 2EI7A 2IPQX 2THFB 2EGPA 1HJ9A 4X8VH 5DGJA 1SGPE 1O3AA 3KQCA 3V12A 1LPGB 2CJIA 4X8UH 5T3HA 4P02A 3KQ5A 5L2YH 4KELA 1EP5A 3TH4H 2AHME 4LZ4B 1KXDA 1ELEE 1V2UT 1C4U2 1YF4A 2QXGA 1T7CA 1WBGB 1C2DA 3A7WA 3QGNB 2Z9KA 5B6LA 1OWJA 2K1JA 1A2CH 1Y8TA 2AGEX 4BAOB 1QJ1B 2QF0A 2SGQE 3N7DA 3PMBB 3BG8A 3SN8A 5C1UA 3SUDA 3M7KA 1FPCH 1HJAC 2BY9X 4I86A 2PHBA 4CBNA 3N7OA 2ECIA 3ZPVE 2LV9A 3RXTA 2F9NA 3T25A 2CF8H 2PW8H 3O8RA 1JXPA 2XCNA 2RDEA 5AF9H 2HOBA 1YWUA 2G43A 1TBQH 1HDTH 2V3MA 2MKEA 1ABIH 5EXLA 5TRBA 3D49H 3QZVA 1MTVA 1QRZA 2FOFA 2ZU1A 3DFLA 2PGQB 2QF4A 1TWXB 1UJ1A 1W0JD 1J9CH 3SV8A 4AFZA 1G3CA 1M9UA 1EJMA 3SJIA 1ZMLA 3M35A 5B6OA 5I25A 1WYKA 1TX6A 3E1XB 1WIMA 1O5FH 4ZCNA 3MNBA 2YQMA 1EJAA 1NRQH 2Y6TA 3FZDA 2J2UA 2ZFRH 5E0GA 3SUGA 5B78A 1OWHA 2V0BA 3MU8A 1YKTA 2QF5A 4MQAA 3MO9A 3TNSA 3OYPA 3FP6E 1HAVB 2FPZA 4FUFA 4FK5A 1W11U 1BQYA 2LQ6A 1AZZA 1RMDA 2VPGA 4XSKU 1GI2A 2Y1NA 2WV9A 1Q31A 3ATMA 1BTZA 1GHAG 5IYTA 1H9HE 4ASHA 1E35B 6LPRA 1AVXA 2Y5FA 1WAYB 3LU9B 1J15A 4Z0RA 1BHXB 2F43B 3TH2H 4CRBA 4BTIB 1D3PB 4H6SB 3KDEC 1ZZZA 4RKOB 4X1QU 2B9LA 2ANYA 5LKXA 2ODQA 2P3FH 4FUGA 1MM3A 1O3DA 3ZZ4A 3UNQA 2BXUH 4MPVA 1MMJN 2BDIA 3LH1A 3LGYA 1NRNH 2C8ZB 2EEKA 2PTCE 4GCHG 3GISB 1D4PB 1TX7A 3H09A 4UFEH 4DCDA 2Y7XA 3QDZB 1BMAA 3A80A 3QGJA 2M13A 1AVWA 1GI1A 2GV7A 4ZKSU 3T28A 1HYLA 2BAYA 3VFEA 3ODFA 4X2WA 1O2OA 1B0EA 5DG6A 4ZHMU 4JMYA 4CH2B 1Z71A 3AVZA 3VB4A 1AZ8A 2CV3A 2LGGA 2A7CA 2FS9A 2PKAA 4CA1A 6GCHF 4YXWD 1SHYA 3KQBA 3K2UA 2ZI2H 4R8PK 1FUJA 2YNBA 1CHOG 2XC5A 3ZVYA 3O8DA 4DT4A 4AX9H 1OP2A 4ABGA 3A8AA 4D9RA 1VITH 3F2FA 5C1XA 5J4QA 3L1XA 1GBFA 1GMCG 1A0LA 1TA2A 2TPIZ 1GMHG 1O38A 3WY8A 3M5NA 4LLBA 1TBZH 2Q6FA 3PV5A 3RUOA 2KZ4A 5HXFA 5B77A 4ZROA 1XUFA 3QUMP 1G30B 4ZXXH 3PM3A 5E2OA 1KLTA 1OPHB 2GT7A 1GBIA 2VVVA 3LKWA 1G36A 3FM8C 1PFXC 1SGNE 1CSOE 3MYWA 3PO1C 1O3MA 1TX8A 1RGQA 2J92A 3KNXA 3SNBA 1ANEA 2GKVE 1K1MA 2B0FA 4OGXA 5LH8A 2D26C 1DOJA 8ESTE 2ZWLH 3DWDA 1WSSH 2ZHQH 3V7TA 3TK5A 2RFKC 4A92A 2BX4A 2G6QA 6CHAC 4I8KA 1KYNA 2H9HA 3NK8A 3ZNIA 3A81A 5T6FA 1T8NA 3JZ1B 3SGBE 5J3XA 5JB8S 1O5BB 4XD7D 4ABIA 1B0FA 2EQNA 3F9HA 2ZEBA 1V2NT 1SQOA 4HZHA 3E8LA 1ZYOA 2LGKA 2PUXB 3S7HB 1KTSB 8GCHG 1O2VA 1TNHA 1KXCA 3AW1A 2W5EA 4IC5A 3UR9A 1AWHB 1QGFA 1GI6A 3C27B 1HAYB 2GCHF 4I8JA 2JH0D 4AYCA 2PSYA 1SLVB 3ASLA 2ZU2A 3FJUB 3S9AA 1O3FA 3VEQB 1SGEE 1AUJA 1GI4A 4TWWA 1VGCC 3ZZ3A 3BEUA 4F52B 3MNCA 2VVUA 1F62A 2BB4A 3LVRE 1IOEA 3U8OH 1DFPA 2PKSC 2M2AA 4ISLA 4ESTE 2C8WB 1GJ8B 2ZC9H 1PPCE 3A84A 3URCA 4IC3A 3ZV8A 3IITA 1GHYH 1MBQA 2HPQH 4ISNA 1MTUA 3RXGA 3ZZBA 2VGCB 1O2YA 4Z1MD 3RXBA 2I6QA 2NU0E 2VPEA 2YW8A 1H1BA 2GZ7A 3K65B 3L33A 3V3MA 2C3SA 3ZZCA 5B8DA 4AGJA 3VGCB 4OS1A 2A45B 3S0NA 1LPZB 1Z6EA 2AGGX 4FUIA 4INHA 1ORFA 2ZECA 1UVUH 3E90B 3PLKA 3TH3H 4QF2A 4CHAC 1O2HA 1DY8A 3TJOA 2A0QB 2UWLA 1XM1A 1AGJA 3IHPA 3GY3A 1G3EA 1P02A 1UTPA 3QTVH 1QZ8A 4K3JA 3RXPA 2K4DA 2ZFSA 2ECTA 2K17A 3AAVA 5EXMA 5G4BA 3BEIB 2BD2A 4TSFD 1FAKH 3O36A 5CE1A 4OS7A 2VVCA 5H9MA 5C2ZA 2ZHFH 1ZHRA 5TDRA 1WENA 1GJ5H 8KME2 5KECA 3KQEA 1CGJE 3KGPA 4YLQH 1HNEE 5HIZA 1V2LT 1Y3UA 2GDDA 1K2FA 1LHGH 3GCOA 2XRCA 1YPJH 3SOXA 3TK9A 2D1JA 1W14U 5F6MA 3RXLA 4X6NA 1AN1E 1KXBA 1TAWA 1EZQA 2AEIH 1BA8B 5AFYH 3TVJB 4D8NA 3KEEA 5HKKD 2D2DA 3FFGA 1P8VC 2VJFB 1YPHE 2XBWA 5EODA 4BXWA 4FUJA 2ZGXH 4DJZB 1GVZA 2ZNKH 5B79A 2UUJB 2VH6A 2NU2E 1UVSH 1GVLA 1P04A 1P3CA 3ZVCA 4WWYA 1O2WA 3GDSA 5G04B 3SNDA 2G4TA 4LJNA 1IQFA 3DD2H 4Y7AA 5EG4A 1J8AA 3GY5A 1THSH 1MU8B 4MDSA 5I3LA 3MU1A 1V2KT 2BOKA 2ZCKP 2FOBA 4K60A 2C8YB 3GDVA 2AERH 2WPMS 3RXVA 2F9UA 2BD5A 1C1SA 3I78A 2NU1E 3M37A 5GXPA 4YBTA 3E91A 1EPTB 4UD9H 4Z6AH 2JRJA 1SLXB 1O2ZA 1Z6JH 3BTHE 3TGKE 1UMAH 2A2QH 2ZGJA 1BTPA 2W26A 2ILNA 4BAHB 1P11E 1OWEA 4B2CA 3S69A 3HKIB 2VWLA 1PQAA 4KTSA 4Y10E 3F1SB 4Q63A 3L3TA 1MU6B 2VJEB 3RDZA 1TIOA 1T32A 4GNGA 4SGAE 4NSYA 1C4Y2 1F0TA 2C4FH 1O34A 2FLRH 4WZ2A 1C2IA 1S82A 1TGTA 1MAYA 2OLGA 2F83A 2BVSH 4KTCA 5C1YA 4B71A 4JYUH 4HI3A 2QYIA 2YQLA 5EJZA 1SQRA 1A5GH 3A8CA 1HAVA 1E1QD 4ZHAA 4INKA 4S3OC 1T8OA 5LPFA 1SMFE 3RXQA 1C2JA 4CRGA 2A4QA 1C2HA 2VNFA 1TNIA 1DSTA 3ZZ9A 1DVAH 2BDBA 1NRRH 1FPHH 3P8GA 1WXRA 1A5IA 1C2KA 4O62A 4UFDH 3PO1B 5I46H 3TGIE 1TGCA 2P8OB 1OYQA 1D6RA 5DKMA 2WV4A 2M3HA 4PPEA 2LRIC 3PV2A 3SU1A 1Z60A 4AP4A 2BDGA 1P06A 5K0HA 3MMGA 1N1LA 3LGVA 1C1TA 1DM4B 1W0YH 1PJPA 3F9EA 4OGYA 2BZAA 2DE9A 4BAQB 2JJ2D 4RSPA 4F4OC 4AYYB 1BITA 1FX0B 1K9OE 1S84A 1ANBA 2FWWA 1C1UH 3SORA 2LDRA 3DUXH 1SFQB 4U2WA 2MNYA 1A7SA 4Y6DA 1GCDA 1Q3XA 1QA7A 4TT3D 1HAHH 1V2TT 4TPIZ 3PWBA 1ELDE 1L1JA 2BX3A 3NWUA 1IYMA 1N87A 2AN6A 3KN2A 3F0PA 4GNEA 4R8TB 2PKSB 1O2GH 1QL8A 5FX5A 4FETA 3BN9A 1T8MA 2JMIA 1BZXE 1DPOA 2IQJA 2CHAB 2KFWA 3N9MA 4AB8A 2WUBA 1GI7B 3MHWU 1VCWA 1W0ZU 2J97A 4UFFH 3WWFA 2GV6A 2LP6A 1QQUA 5A2MH 1K1JA 3PRBA 4X1PU 1WCZA 5HMAA 4IC2A 3SV2H 1W2KH 1S0RA 1UTLM 1Z8RA 1D9IA 1ZTKA 6ESTA 2GCTB 3LGWA 4LOYH 1JOCA 1GI0A 3ZVFA 4AFSA 3NXPA 1OP0A 4QT8C 2J38A 1WILA 4NIVA 2CKLA 1GMDF 1QB9A 3FP7E 2BDAA 1F5LA 1AMHA 1BTWA 4AFUA 1O32A 2L74A 1O33A 1BTYA 4OS5A 1FMGA 1Z8IB 2ZP0H 2R0LA 1SQAA 1P3EA 1BMMH 4P00A 1FY4A 2GTBA 4MVNA 4RI0A 1F5RA 2ESTE 5H1UA 1SSXA 1T1HA 2TGAA 1OWKA 2GMTB 2M6MA 1HV7A 2SGFE 1CA0B 4OGEA 1A1RA 1QB1A 3BTGE 3UNSA 1ZHPA 2R3YA 3UIRA 2J98A 1MD7A 1H8DH 4A6LA 4I7CA 3BTFE 2OD3B 1MKWK 1QTFA 5HGGA 3RU4E 1WQSA 2FDAA 1FP0A 3BG4C 4CHAB 4XBCA 4UONA 4GHTA 1CT0E 2FI4E 4IN1A 1AHTH 3MU5A 1AD8H 1IHSH 2DUCA 3A8BA 5TJXA 1A5HA 1VJ9U 2ZA5A 4IBLH 3QO6A 3GCNA 2Z94A 4NG9H 1Y5AT 2RCEA 1LVBA 3M36A 4R0IA 1GJ9B 1NBMD 4NZLA 1ZTLA 2ZDNA 3AAUA 4CCGX 2AMPA 3M7QA 2G51A 4AG1A 1C5SA 1WEUA 4WMDA 1UVPA 2VWMA 4B74A 1GJ7B 1NS3A 1A0JA 2IJD1 5EU8A 3B9FH 1GWAA 1XUIA 4DT7B 1O2XA 3SGAE 3LGUA 4IS5A 1N8OB 2ZCLP 1H4WA 3VB3A 2J34A 1RRKA 4X2VA 1SGYE 2L7PA 1H8IH 1MKXK 3G01A 2W3IA 1TRYA 1NM6A 3NZIA 2KGGA 3M62A 1AUTC 1TONA 4LK9A 1RIWC 1YCPM 1HIAA 5C3NA 3Q1DA 3ZVZB 4Y11E 3FO8D 2KWJA 3M3TA 1K1LA 1TRMA 3VPKA 2PV9B 2MD8C 1UHBA 5PTPA 2FOGA 4NWKA 1AKSB 1C5NH 2BQWB 2YMSC 2G52A 2BDCA 3A89A 2Z9JA 4Q7XA 4O64A 1UVOA 3UQOA 1FDPA 2BD9A 1IQMA 1DXPA 3R0FA 4YM9A 3GL6A 3HCSA 1ZPCA 3LQIA 3Q77A 5AITA 2QXJA 3DDTA
chains in the Genus database with same CATH topology
1HFDA 2EI8A 1EOLA 4WH8A 1C5TA 1QCPA 3DFJA 3P95A 3U8RH 5A0CA 1BBRH 1KXFA 3A87A 1LHEH 2GD4B 3KIDU 2WPLS 4MG3A 4JK5A 1MAXA 2AGIX 2QXHA 1SGIB 1ZRBA 1C1WH 2G00A 3RMLH 2CMYA 3SU5A 2GX4A 3BTWE 1LCYA 2BQ6B 5L30H 1BJVA 3FVFB 1GBEA 3URDA 1DWBH 3MH4A 2CHAC 4MNYA 1D3QB 2GZ8A 5EGMA 4U32A 1EB2A 3TJVA 1IQGA 1Z1JA 4O3TA 4FU9A 1ELVA 4NA9H 1AB9B 3TNTA 1LDTT 1LQEA 9LPRA 2A31A 4X8SH 1OXGA 3P8FA 1UO6A 3SZNA 3VB7A 3FP8E 1AWFH 1EPTA 1UTJA 1RFNA 5CHAC 3ZZDA 1SGQE 2ZFPH 2J95A 2TRMA 1GBJA 1PQ7A 1SGTA 1A46H 3OX7U 3BTTE 3AASA 2ZQ2A 1SGDE 2A4RA 3OY6U 2Y7ZA 3TGJE 1ZPZA 3SO3A 1B5GH 1O2KA 3T27A 2J9NA 5JBAS 3DT0H 2GMTC 4THNH 2A5IA 2WPHS 1IQHA 2ZDVH 1C5LH 4PROA 3D62A 4BANB 4ISOA 1C1MA 3BV9B 2P95A 1KLIH 1HJAB 5E2PA 2BLQA 4I33A 2ZPRA 3GCHB 4K5ZA 1NC6A 3CS7A 1EATA 2ALPA 5F03A 3A8DA 1P09A 1C5OH 2BM2A 2BQ7B 2BY5X 3P17H 1UVTH 4XBDA 3VB6A 3LIWA 3ZZ8A 1ETSH 1MKWH 3GY7A 1NN6A 5T6DA 4WF8A 3PTBA 2R2MB 4XBBA 2BVXH 2BZ6H 5JYIA 3AW0A 3OTJE 4A1XA 2FM2A 3T2NA 2QV1A 1WV7H 2H9TH 1TABE 1CBWB 1K1OA 1XUKA 1GDUA 2P16A 2F3CE 1BCUH 5HM9A 2EC9H 4XE4A 3T62A 2FOEA 1P03A 1SFIA 3LGTA 1QBNA 1TYNA 3T5FH 4ABJA 4BAKB 1YPMH 5DK1A 5JBTA 2BTCE 3SNCA 1PPFE 2RA0A 1BMLA 2SFAA 1THPB 1A0HB 1G3DA 4JZFH 2FX6A 1TMBH 2ZTYA 5AVDA 1CU1A 2GGVB 2CGAA 3GYLB 3MH6A 3PMAB 1TGNA 1LTOA 3UOPA 4CR5A 1C1PA 1GHWH 1P2IA 5LPRA 5FBIA 1FI8A 2HNTE 3RC5A 3W95A 2BXTH 4H4FA 3S9BA 2XBVA 3GCTF 1AE5A 1BDAA 2LNCA 5C5OA 2O9QA 2IOTA 3RXDA 4NFEA 1GBMA 1YBWA 3A7VA 4ABFA 1BTHH 2BD8A 5SGAE 2VIWA 1N8OC 4FUHA 4IMQA 1CO7E 1TQ7B 1O3HA 2UUYA 2A1DB 1P57B 3HKJB 3M3SA 1XKAC 1QIXB 1V2VT 3U98H 1BB0B 2ZFQH 4K1EA 1O2QA 3K6YA 1C4V2 4Y8YA 1IQEA 1C2MA 2XNIA 4B2BA 1O39A 5F8XA 1AFQB 1TNKA 5DP5A 5JB9S 1OWDA 1ID5H 4AYVB 1L4ZA 5F8ZA 1YP9A 4Y79A 1TFXA 3Q00A 1IAUA 3VXFH 2FIRH 1O2JA 5E0HA 1KSNA 4O03A 2ZGCA 1XVOA 2H6MA 1C1QA 1FJSA 4I31A 1GBCA 1YPLH 3UR6A 3OU0A 1PYTD 1TOCB 1EAWA 1K28D 4FU7A 1V2JT 1Y3XA 2WPKS 3IWMA 3P92A 1ZMJA 4Y7BA 1PPHE 1VCQA 3CP7A 1QB6A 1UTNA 2GCTC 5HYOA 1GHBF 3M7UA 3UFAA 3ZYEA 4MTBA 1HBTH 1QFKH 1MTNB 4RKJB 3TK6A 4K1TA 2G5VA 3BTKE 4FVDA 2HGTH 1LKAA 3EQ0H 3PTNA 1K1NA 1KLJH 4AFQA 2ZU4A 4UDWH 3HK6B 3QK1A 7KMEH 3MH5A 1VITG 1PQ5A 3MNXA 4AORA 2Y81A 1UTOA 2HALA 2BY7X 3SV6A 1CA0C 2TGPZ 1ESAA 5GJ4B 2Z9LA 1FY1A 1RTFB 1F5KU 1O5DH 1TNJA 1O3BA 4B1TA 1O5AB 1K1IA 2BMGB 2VWNA 1S81A 2KAIA 4TY7A 2HWLB 3PROA 2F9PA 1LMWB 3RM0H 5A8ZA 4GAWA 1VITF 3SJKA 1ELCA 1EASA 3BF6H 1YLDA 1MZAA 1SB1H 1JIMA 2QF3A 4WH6A 1ZR0A 4FUEA 1TOMH 3SUEA 5FHTA 4K69A 3KQDA 3QLPH 2WUCA 1V2WT 2P8OC 2NWNA 5C5NA 1SGRE 3SJOA 1IQKA 1OP8A 3U1IB 3JZ2B 2GT8A 3BTME 4YOJA 5K7RA 4X1NU 2WPJS 1C5XB 1FONA 1KXAA 3ZZ6A 2BDYA 3R3GB 4B2AA 1YCPK 5L2ZH 3SGQE 1ELFA 2BLOA 1Z8GA 2FX4A 1HAZB 1T4VH 3RLWH 4NWLA 3UWJH 3RXMA 2O8TA 4ZHLU 4Z0KA 2FYRA 4DOQA 1KDQB 4E7RG 2BHGA 2FESH 1C1NA 3UQVA 6CHAB 3RXEA 1ANCA 1ESTA 2OINA 4Q7YA 2O8UA 1O5EH 1HXEH 1SGFG 2H2ZA 3LPRA 3RXSA 3BSQA 3EDXB 1TNLA 1L1NA 1W8BH 2XWBI 2BOHB 4VGCB 1Y3VA 3MU0A 4WXVA 2VWOA 1UTKA 2A5AA 1W7GH 5FCRA 8GCHF 1CT2E 1WUNH 3P70B 2PR3A 1TQ0B 5E0JA 3F6UH 2UUFB 2PWXA 1GL0E 4WY3A 3U69H 4AZ2B 5EQSA 1AQ7A 3ZVGA 1HLTH 3D23A 2BD4A 4X0WU 1ACBE 1SOZA 2VIPA 1FV9A 1CHOF 3ZVDA 4X1RU 1C5QA 4KGAA 5DJ7A 1J17T 4B75A 3LOXA 2ZHWH 1FQ3A 1E36B 5EOKA 2VIDA 1GI9B 1TGSZ 5EXNA 3STJA 1S5SA 1JRTA 4ZMAH 1DT2A 2H5CA 1E0FD 1BRUP 3CS0A 5HM2A 1ZLRA 4TWYA 4BXSA 2H5DA 3A86A 1G3BA 4E06H 1GHAF 1XUHA 1GHVH 2SGAA 4YT6H 3O8BA 5FX6A 1DICA 4GUXA 3ZV9A 3RU4T 1QNJA 1V2OT 3ESTA 1BRCE 2DE8A 4IGDA 4TPYA 3U9AH 1FZZA 1QBVH 3GOVB 1HAPH 1J14A 5EQQA 1O2PA 4DY7B 2QN5T 4Q2KA 1XX9A 2Y5HA 1TGBA 3LH3A 1EZSC 4NSVA 3RXKA 4A5TS 1O2SA 1P9SA 1XUJA 4YLUA 5FPTA 4Y71A 1LO6A 1A61H 3TITA 2AMDA 3SI3H 1KIGH 2FEQH 1DDJA 3KHVA 4DIHH 1QQ4A 4ISHH 2B5TB 1FY3A 2ZIQH 3RXIA 1O2TA 1QRWA 2Q6GA 2ANKH 4CH8B 1ARBA 1HUTH 4I32A 2HNTF 1Z8JB 1C5WB 1SC8U 2SNWA 2V6NA 1GBKA 1SOTA 4WMFA 1VCPA 1XKBC 3U8TH 1GCTC 1ETTH 3RC6A 5IDKA 3S9CA 1IQJA 2FP7B 2PTNA 2RDLA 4GSOA 4ZXYH 4XDEA 1EXFA 1TE0A 3Q3YA 1O2MA 4MPWA 4YO9A 1SVPA 1V2PT 2VU8E 2XCFA 1P2OA 1X7AC 2SGDE 4K8YA 2B8OH 3LJOA 1LHCH 2O8WA 2ZKSA 3VXEH 1EZUC 1EAXA 1ELBA 3Q3XA 1GJAB 2C93B 2FOMB 5A09A 4O9VA 3MWIU 2GDEH 4UE7H 4GVUA 2PUQH 4X6OA 1YCPH 3UPEA 2JH6D 4Y0ZE 1K1PA 1BBRE 1ELGA 3DHKH 1NO9H 2ZCHP 4OS6A 4H42U 3E16B 1PQ8A 1GDQA 3K9XB 2OCVB 1LKBA 1TB6H 4BNRA 1U6QA 3SW2B 3RXRA 3E0PB 3M3VA 1F92A 4K1SA 5C20A 1ZJKA 4Q7ZA 2PGBB 3GICB 1T8LA 1FIZA 4Q80A 4NIXA 1C1RA 2H9EH 5AFZH 5BPEA 1C9PA 4BTTB 4GHQA 1HAGE 2ZZUH 1IQNA 1GMCF 1TMTH 1HAIH 1G32B 2OUAA 3MO3A 1IQLA 2ZGBH 4ZUHA 1NFXA 5LGOA 2W7UA 1C5PA 3KCGH 5C67A 4ABEA 2VIQA 4WXIA 1O3EA 5FXLA 1NRPH 1TBRH 2G55A 1K21H 4DURA 1ESBA 4E05H 2M5TA 2BY8X 1GHBG 1MZDA 4XOJA 4IW4E 1N6XA 1ZGIA 1PPGE 4NGAH 2FXRA 2UUKB 2F91A 1GJ4H 3NUMA 2BYAX 1MKXH 1AFEH 1UK2A 2ZHEH 3GCTG 1AU8A 3GY8A 1GI8B 4KKDA 3TU7H 4FU8A 4XFQA 2HVXA 1HAXB 2QCYA 4K2YA 3V13A 2AFQB 1O0DH 1RTKA 2XW9A 5ETXA 2BVRH 2ZHDA 1YYY1 3GCHC 2NU3E 1C9TA 1FAXA 4A1TA 1FN6A 3RU4D 1Y5UT 4FUDA 3MI4A 1UCYH 2XC4A 2O8MA 2WYGA 2ODPA 5ESTE 1BRBE 4JK6A 2BD3A 1G2MA 1CE5A 4X6PA 5FPYA 1ZSJA 4F49A 4INLA 4X2XA 2YOLA 4JZIA 4U01A 4MPUA 4WJG2 4Y0YE 3V0XA 2GVFA 2QA9E 5A0BA 3SQEE 1LVYA 3ATLA 4GPGA 3Q3KA 2Y82A