1MBMA

Nsp4 proteinase from equine arteritis virus
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
198
structure length
198
Chain Sequence
KARGNVGFVAGSSYGTGSVWTRNNEVVVLTASHVVGRANMATLKIGDAMLTLTFKKNGDFAEAVTTQSELPGNWPQLHFAQPTTGPASWCTATGDEEGLLSGEVCLAWTTSGDSGSAVVQGDAVVGVHTGSNTSGVAYVTTPSGKLLGADTVTLSSLSKHFTGPLTSIPKDIPDNIIADVDAVPRSLAMLIDGLSNRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Arterivirus nsp4: the smallest chymotrypsin-like proteinase with an alpha/beta C-terminal extension and alternate conformations of the oxyanion hole
pubmed doi rcsb
source organism Equine arteritis virus
molecule tags Transferase
molecule keywords chymotrypsin-like serine protease
total genus 43
structure length 198
sequence length 198
chains with identical sequence B, C, D
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2002-08-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1mbmA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1mbmA02
3.30.40.20 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Chymotrypsin-like serine protease; domain 3 1mbmA03
4DG4A 3RXVA 4FU7A 2ZKSA 1GL0E 3GY8A 1CA0B 1ANCA 3M5NA 1C1OA 3ZVEA 2Z9JA 1PQAA 1TNJA 1TOMH 5I46H 4K1TA 1B0EA 1BRAA 7GCHF 2Y80A 2FI5E 3M61U 4X1QU 5T6GA 1ZSJA 4ZAEA 2BD9A 1WSSH 5E2PA 3SUDA 2ZDMA 4JK5A 3ENSB 3MO9A 1SLXB 2GZ7A 3VGCB 2FOCA 1A1RA 1Y5BT 2LNCA 3E6PH 1L4DA 5G4BA 3A8AA 4O3UA 3C27B 3OY5U 1D3PB 2VWLA 3PMJA 1ZMLA 2BD2A 1SGFG 2WPJS 1FUJA 4CRCA 1UCYE 3DA9B 1NM6A 3BTHE 2UUFB 4ZHLU 3MTYA 1BB0B 3GCHB 1ACBE 1SGYE 1ID5H 1FJSA 5DP6A 1A3EH 2VGCC 5EODA 1YPLH 2J94A 1NFYA 1CGHA 3HKJB 3U9AH 3BTFE 3PLKA 1QJ1B 1V6DA 3GDSA 4WY3A 4FU8A 5EGMA 5DP9A 2CV3A 2TPIZ 3ZVDA 1CQQA 1AY6H 1GBCA 4NZQA 3VEQB 2ZCHP 4OS1A 4WJG2 4DIHH 4UD9H 2FODA 2VH6A 4DW2U 4TYDA 5C1YA 1KLJH 1Y3YA 6LPRA 5C5OA 1FDPA 1MCTA 1VCWA 2A5KA 4AN7A 1EX3A 3KQEA 1V2KT 3PROA 4TY7A 4X2YA 4AFSA 2QV1A 1SGDE 1RRKA 3BIVH 2GCHG 2Y81A 1T31A 3T62A 3SGBE 3A86A 2F9BH 4X6PA 2P16A 3ODDA 3V0XA 1ELAA 1NPMA 1VGCB 4UFDH 1P06A 2IN2A 1C5ZB 1GBIA 4IW4E 4WWYA 1P11E 3EYDA 2R3YA 4XBBA 1DITH 4FUGA 5T3HA 3RMLH 1FPCH 2GKVE 2K1QA 1TB6H 3GOVB 3RXKA 1ZTLA 3NK8A 2PKSB 2XBVA 1HRTH 1HBTH 3EA7A 4WMFA 1C1RA 3KF2A 1PPZA 3AAUA 2ZPQA 1BTUA 1IQJA 1NRSH 4GLYA 4INKA 4D7GA 1OPHB 4B2BA 4AFUA 6CHAB 2FESH 1A7SA 4X8SH 1CBWC 3KHVA 2Z3DA 2B7DH 2F3CE 1SL3A 3A87A 1P05A 3P8FA 2NWNA 3ATLA 1LQDB 2XCFA 1WTGH 3T27A 1P9UA 4TY6A 2F9VA 5J4QA 1ANDA 2W3IA 4AYVB 1QQ4A 1FI8A 2FS8A 5LGOA 5EPYA 1O5AB 3TK6A 3HGPA 2EI7A 1FONA 2ZECA 4Y76A 2GMTC 1DUAA 1O35A 4ISOA 1YCPH 2ANMH 2G55A 2FEQH 3SNAA 4NFFA 2WYJA 3DD2H 2H5DA 3RXHA 3UNSA 1QBNA 2SFAA 1PQ7A 4A1VA 2ZU5A 2UUJB 2QY0B 1P0SH 3GCNA 5DO4H 1GHBF 2HNTC 3KQCA 3M3TA 5A0CA 3RXEA 1Y5UT 1IQHA 3BSQA 1NT1A 1SLVB 4ABIA 4X8TH 3SV9A 1AMHA 1F2SE 1A0LA 1A5HA 3P95A 1TBRH 3ZVGA 3QTVH 3ZZ7A 1ORFA 4U2WA 4DJZB 3TNSA 4UDWH 4QT8C 1YPEH 4CRDA 1GJDB 2XCNA 2BQWB 2C4FH 3VXFH 4K60A 1V2RT 5AF9H 1H4WA 1RXPA 3A82A 3NXPA 1MTWA 5JB9S 1C9PA 2BLVA 5DGJA 3RXAA 1TGTA 4ABAA 1HAVB 1YCPK 2BD8A 2I6SA 3TH4H 5I25A 1C1VH 2OP9A 4AB8A 1WYKA 2J9NA 4WH8A 1GHAF 2JKHA 1MQ6A 3LGTA 4O97A 1DXWA 1ELEE 2BD5A 1O3HA 5FX6A 1DUEA 1QRZA 1CVWH 2PW8H 3TJUA 1C9TA 4HTCH 2WUBA 2QA9E 7KMEH 3E0NB 1RIWB 3ZZCA 5AVDA 3RMNH 1BHXB 3MH4A 2QIQA 1GPZA 2FI4E 1SOZA 2CHAB 4MNWA 3VPKA 3N7OA 1W0YH 3DFJA 4MG3A 5CMXH 3RLYH 5E0GA 4K69A 5EQQA 4BAKB 2ODQA 2FTLE 4GPGA 2H9HA 2A4OA 1O2HA 2GZ9A 1CGJE 1G3BA 1G3CA 3GDUA 1DS2E 1GCDA 1BZXE 3GY5A 2ZGCA 3MU8A 2C8YB 1HDTH 1WQSA 3NUMA 3F9FA 3MHWU 2OCVB 5HM2A 4GAWA 3MU4A 4ZKSU 4YESB 1Q3XA 3RXQA 1GI2A 4GCHG 5JPMH 1O3IA 1XVMA 2F9OA 4I8HA 1ZHPA 3M3VA 5F8ZA 3ZZDA 3B23B 4KP0A 4I8KA 4KTUA 1C2LA 2TRMA 1QL9A 3CP7A 1QBVH 2BLWA 5E2OA 2XWBI 3VB5A 2ZFFH 4I31A 1HAXB 4X0WU 4ZMAH 4JMYA 1NROH 2VIQA 1QGFA 2GP9B 4H42U 2FYQA 3BTEE 1EAUA 1OP2A 3TITA 3MH7A 4AGKA 1O3EA 2BTCE 5C5NA 4FUEA 1YPGH 2SGFE 3A7YA 5EPNA 2PUXB 1XUKA 4IBLH 2BMGB 5BPEA 1O2XA 1LMWB 1SPJA 3ZZ9A 2BXTH 4UFGH 1C2JA 8GCHG 4UEHH 1MTVA 2G8TA 1LVYA 2WPMS 4NIVA 2VNTA 2OUAA 1O2QA 1BIOA 1W2KH 2BX4A 1E37B 1YCPM 3PLPA 2P3UB 3PTNA 1PQ8A 1C4U2 4NIXA 4BAQB 1C5RA 1ZRKA 1A46H 1O5GH 3NKKA 5DKMA 2ZTZA 2BY9X 4X1PU 4Q2KA 2FPZA 4I7YH 1NS3A 1ESTA 1K1LA 3P70B 1BMAA 2GD4B 1S0QA 1H9HE 1TGBA 3LIWA 5HYOA 2ZZUH 1NFWA 1AFQC 1NU7B 2Q6DA 1W10U 3GY2A 1F0UA 2OC8A 1GI6A 1PPBH 3ODFA 4YOIA 1B5GH 2WPHS 1Z8RA 1HCGA 4I33A 1G36A 1DSUA 1RGQA 2BLOA 3BEIB 1XUJA 5FCKA 4X1SU 1LHGH 3GCTG 5BRRE 2HPPH 1O2WA 4NSVA 5T6FA 4H6SB 1AUTC 1DVAH 3F9EA 3TNTA 4ZXXH 1O3GA 1QJ6B 4TWYA 4IS5A 3RXFA 3V7TA 3RXTA 1TGCA 1UTMA 3LGUA 3EQ0H 1GI0A 2FOAA 3MU0A 4BXSA 4CREA 2BDAA 4CHAC 1GMHF 1JWTA 4FVDA 4WXVA 1GDUA 1C5NH 4D8NA 1TQ7B 2ZDVH 3BEUA 1GHWH 1HYLA 1GBFA 3DFLA 1MKXH 3M5OA 5JBCS 1MU6B 1IQEA 1SGRE 2ZCKP 1B7XB 1FY1A 2ALPA 1O2PA 2I6QA 3M36A 1JMOH 2JH0D 1ZRBA 2SNWA 3RXGA 1A5GH 1CT4E 1LPKB 1KXDA 2Y82A 2GGVB 4IMQA 4ZUHA 1C1WH 4KKDA 1D4PB 1O5CB 1DT2A 2ZU1A 3TJOA 3UR9A 3A80A 4YOGA 4AFZA 1P2OA 5CHAB 1MTNC 3CS7A 2XRCA 1TGSZ 1S6FA 4GUXA 1C2GA 4UE7H 3ZZ6A 1QL7A 4J1YA 2XYAA 4A1TA 1TGNA 1MZAA 2BVXH 1XUIA 1UTOA 1HAOH 1KLIH 1D3TB 2R9PA 1GHZA 2Y5HA 1P12E 1A2CH 2BY5X 2GCTC 2QXGA 4A1XA 1EB1H 1GI1A 9ESTA 1ELBA 4SGAE 4X2VA 2H9EH 3MNSA 3R0FA 2FI3E 1MKWK 4H6TA 1WUNH 4X8UH 3SORA 1SGCA 1ZHMA 1P9SA 1GBEA 4B74A 1RJXB 3SQHE 3ZVCA 1UK4A 3GCTF 2A4RA 4FVBA 2M5TA 2AGGX 2GVFA 5EG4A 1GBJA 1QL8A 5HGGA 3RU4D 1HAVA 1QY6A 3OU0A 2IJOB 4BNRA 1SHHB 2ZDKA 1SQAA 2HALA 1OWKA 2CHAC 5ABWA 1DX5M 4BTUB 4CRFA 1AWHB 2BB4A 3AAVA 3RC6A 4ISHH 4OS7A 4B2AA 1O3OA 3SJKA 1MAXA 1TABE 3RC4A 5LPEA 1O2UA 1WQVH 4Y0ZE 3ATMA 4ABGA 4YLQH 4Z6AH 2PSXA 1Y59T 3MI4A 1BUIA 2Z9LA 3GYLB 1UJ1A 7GCHG 1CGIE 3KN2A 4K1EA 1V2QT 1ANEA 3E90B 2QC2A 3QZQA 1EPTC 3QGJA 1TPSA 4A7IB 3MH6A 3ZVAA 3TLOA 1ZPZA 2HNTF 1GG6C 1GJ5H 2G81E 1DWEH 3KEEA 3M3SA 4CBOA 1GGDB 1MQ5A 4YT6H 7LPRA 3D23A 1NC6A 3VB7A 2Q6FA 1A4WH 1O2JA 2ALVA 1ZJDA 4KTCA 2GT8A 1JBUH 2J38A 1QNJA 3IWMA 2ZFQH 3MYWA 1CU1A 1KYNA 1LDTT 3SU0A 3K9XB 3A7WA 3LDXH 3DUXH 2R3UA 1EOLA 3D49H 2H9TH 1FAKH 4E7RG 3GY3A 5HXFA 4LZ1H 1GVLA 1E34B 4KTSA 1LPGB 1HGTH 1EASA 4FUBA 1FNIA 1YLCA 3M7QA 4AYYB 6ESTA 1ZPCA 4D9RA 2RA0A 5FBIA 3SZNA 1VITH 1NRRH 3O8DA 1D6RA 1C2EA 1HAZB 2P93A 1KTTB 1ZYOA 2BOHB 2G4TA 5GDSH 1J9CH 5EU8A 1N6XA 3BTQE 4O9VA 4CRBA 2G4UA 1V2UT 1BTZA 1FPHH 3SJ8A 3PTBA 1XKBC 2ZGXH 1PYTC 3KQDA 1PQ5A 2DE8A 4Y7AA 4X1NU 5PTPA 4AZ2B 2Z6BD 4ZH8A 3BEFB 3RXBA 1P02A 4Q80A 1EJNA 1JRTA 2IPHA 2ZQ2A 2CF8H 2PTNA 2DE9A 2QAAA 3RXRA 1FMGA 2V0BA 2FMJA 3KL6A 1O3PB 3HK3B 1GDNA 2C93B 3U1JB 1GJ6A 1V2TT 1Y3UA 2BDYA 2VB0A 1JOUB 1TX7A 3LC3A 2BYAX 1YM0A 4TPIZ 1ELDE 1HJAB 2C3SA 1TQ0B 4B76A 2WV4A 2Y6TA 1OSSA 3T25A 2ZHQH 1MU8B 3E16B 4CH2B 3RXDA 1K1MA 9LPRA 3QGNB 4DY7B 1JIRA 2FIRH 3BG4B 3VB4A 1THPB 4Y6DA 5L2ZH 1GG6B 2G00A 1K1JA 1N1LA 3PM3A 1QHRB 2GZ8A 1PPCE 4BOHA 4THNH 2A5AA 2ZQ1A 3SNCA 2VIOA 1OP8A 1BMMH 1FN8A 2D2DA 1PYTD 2VIDA 4NSYA 3T5FH 1O2TA 1QJ7B 2XWAA 2BY6X 1D6WA 2R2MB 1LHDH 2STAE 3KCGH 4GVUA 1BHXF 1CE5A 1EOJA 1BBRH 2R0LA 3SNDA 1ZSKA 8ESTE 1MD7A 3GCHC 5TJXA 3UFAA 1BBRK 3TU7H 1KTSB 2OQ5A 3K6YA 1DLKB 2HWLB 5K7RA 1L0ZA 2P3FH 1GCTC 5E0JA 3NZIA 1GJCB 4DGJA 3STIA 3SO3A 4MVNA 3U8RH 4A5TS 3SV8A 1DM4B 1UHBA 2BQ7B 2CN0H 1AZ8A 1C5YB 3ZZ8A 1GMDG 1O0DH 4ZHMU 3RXMA 2BQ6B 1C5UA 1TX8A 2NU4E 3SGAE 2A2XH 1J15A 1IHTH 5C67A 1CBWB 3RM2H 3W94A 3E1XB 4YM9A 2W7SA 2BOKA 3ELAH 4WF8A 3JZ1B 5DK1A 3L6PA 3TPIZ 4ESTE 1XUGA 1ANBA 3TK5A 1MBMA 2GCHF 2A7JA 2OC1A 1AFQB 1DXPA 1E36B 4MPWA 1GBLA 2PV9B 1SGNE 1EATA 2HGTH 2QXJA 1ZJKA 1GI5A 1AKSB 2FO9A 2CXVA 4K5ZA 4LOYH 4LZ4B 3RMOH 2GTBA 1BTHH 1ESBA 2BLQA 2TGAA 4KELA 1NZQH 1X7AC 2PR3A 2TGTA 4MTBA 3P8GA 2V3OH 1EZQA 2H5CA 2G51A 1GI3A 4F4OC 3A83A 5A8ZA 1AZZA 3GYMA 1NESE 1Z1IA 4CRAA 4NA9H 2ZO3H 2IOTA 1HUTH 2B8OH 2UUKB 1YYY1 1O39A 3STJA 1UK2A 4X6NA 2FOHA 3K6ZA 1O3MA 5F8TA 4NWKA 3UWJH 1K21H 2ZWLH 1OS8A 2OBOA 8LPRA 1PJPA 1O38A 3PO1B 1UHBB 1XM1A 4CRGA 4FUFA 1O37A 1QB1A 2PUQH 3RXCA 3FVFB 1GJ4H 4AG1A 1EZXC 3IG6B 4HGCA 3EA8A 1JIMA 2BDCA 3SUEA 2XXLA 1C1TA 1UTJA 1K22H 4WH6A 5HM9A 1QA0A 2QXIA 1KY9A 4ABEA 3SU1A 1AFEH 1NTPA 1BJVA 1Z7KA 4JZDH 3E91A 1YPMH 1YPKH 4X2XA 1KSNA 1FQ3A 1BTYA 2A0QB 4WMEA 2ZCLP 1C1NA 3V12A 3SGQE 1HIAA 4FXGH 1CT0E 1PPFE 1K1IA 1Y5AT 1O3FA 1EAIA 5GXPA 2XC4A 4M7GA 1BRBE 1TNIA 3URDA 3LGYA 3AW1A 3EAJA 3KNXA 3S69A 2J95A 4OS6A 1BOQA 3OX7U 3ESTA 1YGCH 1W3CA 2RCEA 4Y79A 2AGIX 4Y71A 1C5LH 1GMDF 1SSXA 4D76A 1P01A 3MO6A 5FAHA 5A0BA 2XBWA 1EP6A 2CJIA 3FAOA 3MNCA 4R8TB 5L30H 1S82A 2YNAA 2VVUA 3A8CA 2OTVA 2AIQA 3SU4A 1G32B 1UTKA 2ILNA 2BD7A 1BTPA 2O8UA 4Z0KA 2P3TB 3OYPA 4X1RU 1W0ZU 2BDGA 2HRVA 1C2IA 2JETC 5LH8A 1HFDA 4WMDA 1T4UH 2ZU3A 3H7OA 4K8YA 2Y5GA 2YOLA 3QX5H 1L2EA 1O2NA 4DOQA 1O2KA 2BDIA 1CHGA 2VWMA 2PWXA 2ZHWH 4AORA 1UK3A 1T4VH 1NRQH 2V3HH 2WYGA 2Y7XA 1WTHD 3KQBA 1C5XB 1TYNA 1O5FH 4XSKU 2BDHA 2PTCE 4MNYA 3SN8A 3SW2B 3SHCH 1V2JT 1O32A 1C4V2 1AE5A 1GJ9B 3Q3YA 2W3KA 4ABHA 5FXLA 2WPKS 1G37A 1V2OT 4WVPE 1K9OE 3U98H 3PMBB 5C1UA 1GBKA 4IGDA 1Y3VA 2BXUH 3ZZ5A 3UOPA 5T6DA 1BDAA 1W8BH 1O2MA 1UTNA 2C8WB 1DE7H 3A85A 1Z1JA 4FU9A 2R2WU 2PKAA 4RKOB 3ATKA 4FUJA 1KDQA 2QF3A 2SGQE 2PGQB 3BTME 1KXAA 3MH5A 1PPEE 1IQGA 2FP7B 1P3EA 2RG3A 1EPTB 5LPFA 4E06H 1YLDA 4AFQA 4BAOB 3S9BA 5AHGH 1V2NT 4RKJB 1SGIB 5C3NA 3A88A 1DFPA 1HAHH 1VJ9U 1P2IA 1OWJA 3PMAB 3P8OA 4HI3A 1P04A 2QCYA 4DIIH 2AIPA 3E8LA 4Y8YA 5DP3A 1RS0A 2XBYA 4Y8XA 3RM0H 3TGJE 1G9IE 1O2SA 4AX9H 1S85A 2V35A 2BD4A 2ZP0H 1VITG 3RXJA 3TGIE 2OBQA 1DOJA 1SFQB 4ZROA 2W5EA 2AMPA 4OS2A 1VJAU 3DT0H 5DP8A 1MH0A 3MWIU 1XXFA 4CR5A 3TIUA 1P03A 4AB9A 1QFKH 1VZQH 1LQEA 1C5SA 2G52A 1TRMA 1MMJN 1YP9A 2Y7ZA 1YF4A 1P10A 5JB8S 1K28D 4UFEH 1IQMA 4I8GA 1GI9B 1C1UH 1Q2WA 1C2KA 5IYTA 1TPOA 1D9IA 1C5VA 3SI4H 3RXOA 1KXCA 2Y5FA 2ZA5A 2ZU2A 4I8LA 3HATH 1KDQB 4MPVA 1GI8B 2VU8E 3I77A 2W7UA 2ODYB 3O8CA 2J92A 1ELGA 1OWEA 3UWIA 4INHA 1FIZA 1EPTA 1A0JA 4NFEA 1C2DA 2LPRA 2R0KA 3QDZB 1IQFA 4X8VH 5H4IB 2HLCA 2EI6A 1SB1H 1Z6JH 2ZDLA 4NIWA 3QUMP 1FY3A 1SGFA 3A7VA 1AKSA 1GJBB 4K8BA 3PYHA 3H7TA 1GHBG 1C2MA 1XUFA 1XVOA 2Z9KA 3P17H 4I8JA 1UVUH 3GISB 2J4IA 1O3LA 3RC5A 1MUEB 3M7UA 1C2FA 1L1GA 2ANWA 1K1PA 1K1OA 6CHAC 3MU5A 5JBTA 1OOKB 4DCDA 3RU4T 1H9IE 3LU9B 1N6YA 1CHOF 1XUHA 2AGEX 1MTSA 3A84A 1J8AA 1V2WT 3SUFA 2WUCA 3U8OH 1MAYA 2FWWA 1TA6A 2FOFA 3GICB 2EI8A 4U01A 1SQTA 2NU3E 5DJ7A 5TCCA 2ZDAH 4YLUA 2VGCB 1C5MD 4FUIA 1CA0C 3HPTB 2ANKH 2J2UA 3UOUA 1YPHC 2Z94A 1O31A 5JBBS 3RMMH 2AYWA 2FLRH 2ZDNA 4JZ1A 3LKWA 3OSYA 1NFXA 1TNGA 4BTTB 1ELVA 3BTTE 1O2VA 3AVZA 1V2PT 2FOEA 4IC6A 3S9AA 1DY8A 2O8LA 1QCPA 3B8JA 1OX1A 1QRXA 1TMTH 2AFQB 4XE4A 4ZKRU 3TJVA 5EW1H 3D62A 4YZUA 3P6ZB 3P92A 4OS5A 1LHEH 4NWLA 4LXBH 4ISLA 5EXLA 4XDEA 1TMUH 2GX4A 4ISNA 3BIUH 1O5BB 1F0SA 1ZTKA 1LVMA 1RTLA 1PFXC 4HZHA 4JYVH 4FUHA 3PLBA 1ZSLA 3WY8A 1HLTH 1UTPA 1O34A 1UMAH 3G01A 2Z7FE 3LC5A 2Q1JA 2BX3A 2XC5A 4BTIB 4U30A 1FN6A 1GBTA 2UWPA 2O8TA 3EGKH 3U69H 2VINA 2ZI2H 1AWFH 5EQRA 2Q6GA 4KGAA 3M5LA 3W95A 1SOTA 4Y11E 2AERH 4X6MA 4FUCA 2FXRA 1ZMNA 2BY7X 1MD8A 2ZGJA 1E35B 1VCQA 4YOJA 3UIRA 1GJ8B 1S6HA 1KXEA 1D3QB 4AGJA 4D7FA 1O5DH 3ZYEA 1VR1H 3QK1A 2GV6A 1C5WB 4VGCB 1C5PA 4CR9A 2XC0A 1K2I1 2ZG0H 4GSOA 3V3MA 2P8OB 3MMGA 3Q77A 1YPJH 1P57B 3SU6A 1A0HB 1KXFA 4MNVA 4XFQA 4ABDA 2BDBA 4Q7YA 4ZKNU 4ZKOU 3SV6A 1C5QA 1EZUC 1SGEE 3T29A 5A2MH 1GBAA 3OY6U 3DHKH 1AB9C 1GVZA 4NGAH 4XOJA 1G30B 1GGDC 1AVWA 3PB1E 4RSPA 1LKAA 2P95A 5EOKA 3E0PB 1L1JA 2NU1E 3FANA 2PKAB 1T7CA 1BT7A 1ELFA 6GCHF 2BZAA 1AB9B 3MU1A 1L1NA 1QB6A 3QN7A 1QA7A 1ARBA 2PSYA 3OTJE 3UTUH 2FZZA 4GHTA 1UVPA 1ZZZA 5FX5A 1QQUA 5C1XA 2WPLS 1CO7E 3RXSA 2XBXA 2XW9A 1U6QA 3K2UA 3CS0A 1P2MA 3RXIA 2F83A 3ATIA 1QTFA 3A89A 3FFGA 1ESAA 4ZHAA 5IDKA 4F49A 1OKXA 1O36A 1SG8B 2O8MA 1TLDA 1T32A 2QYIA 1O2YA 5DG6A 5F6MA 4TPYA 1BTWA 2ZFSA 1S0RA 2SGDE 2PGBB 1Z71A 1W7GH 2AS9A 5L2YH 5FBEA 1P2JA 2P59A 3UQVA 1TONA 2AMDA 1SGTA 4B75A 1EJMA 1GBDA 3SU2A 5FHTA 3SQEE 4E05H 3BTWE 1SGPE 2OC7A 1MTNB 1M9UA 3RUOA 1PPGE 1XMNB 1AQ7A 2C90B 5GCHG 1SI5H 1RFNA 2F9PA 3O8RA 1P2QA 1GJAB 5SGAE 1SC8U 1UO6A 2CF9H 1HXEH 1EAWA 1CSOE 3BN9A 2ZFRH 3FP8E 3UREA 1O5EH 3GY6A 1FY5A 3VB3A 1Q31A 1NRNH 5K0HA 5JDUB 5AFZH 1XX9A 1LVOA 4WXIA 5EQSA 1SR5C 2FOGA 3M37A 3BTGE 3UNRA 1H1BA 3RDZA 2WPIS 3UQOA 1EJAA 2O8WA 3A8DA 1HV7A 2XTTB 1RTFB 3U1IB 5AFYH 3NWUA 2BVRH 1O2GH 2QN5T 1IHSH 5C2ZA 2UUYA 2BHGA 1Z8IB 8KME2 1YKTA 1P3CA 2PKSC 3LJJA 5ESTE 4D9QA 3RXPA 1O30A 4JZFH 1HAIH 2HVXA 1OWHA 1BRUP 2A4GA 2VIVA 2VVCA 3A8BA 4Y7BA 1B0FA 1O2ZA 4O03A 2VWNA 3QWCH 1LVBA 3SNBA 1UVTH 1BQYA 2H6MA 2Z9GA 3SNEA 3TK9A 3VFEA 3SUGA 1P2KA 1GDQA 4NA8A 1BRCE 3HK6B 3FP6E 2WV5A 2FLBH 1N8OB 1W14U 1CHOG 1ZTJA 2D1JA 5J4SA 3ZVFA 3UR6A 3F9GA 1OXGA 4B2CA 1THRH 1OWDA 5FCRA 3ZV8A 3HGNA 4A92A 1V2VT 1ZOMA 4NG9H 5GCHF 4UONA 1ABIH 2J34A 5DP5A 2C8XB 2AEIH 3LONA 1GCTB 3SU3A 2ZEBA 2BY8X 1YC0A 2ZF0H 2A5IA 1Z8JB 1WAYB 3URCA 3ZZ3A 2TBSA 3F1SB 1WU1A 1GMHG 1ZGVA 5ESBA 2H2ZA 4ABFA 3ZZBA 3V13A 1Z8GA 3ITIA 2FYRA 2VIPA 2OD3B 4X6OA 1Y8TA 3A7ZA 2TIOA 4B71A 2OQUA 4E7NA 2FOBA 4Y8ZA 1DWCH 1C5OH 3Q3KA 1HIAB 1O2IA 3S0NA 1IQLA 1SLUB 5GWZA 2A7CA 2JH6D 1QURH 1O2LA 2JETB 1MKWH 4XBCA 4ZXYH 3RXUA 3KGPA 1IQNA 4PROA 1QRWA 1ZLRA 2A31A 3KIDU 4HFPB 1CT2E 2H1UA 3Q00A 4O3TA 1J17T 3NCLA 3P8NA 1GBHA 1TALA 1TRYA 3TGKE 1LHFH 5DP4A 2TGPZ 2SGAA 4AG2A 3QZRA 1BMNH 3RU4E 3I29A 1OWIA 1P8VC 1UVOA 2EEKA 2FTMA 4ASHA 1F92A 2Z9IA 3SJIA 1LTOA 1S83A 1SQOA 1VGCC 1T8NA 1W13U 1DANH 2DUCA 3U8TH 3LGVA 1ZR0A 1VCPA 5CHAC 3MO3A 1FLEE 4JZEH 3Q76A 2ZTXA 1BCUH 1O2RA 2ZNKH 2CMYA 5E0HA 3FP7E 1SGQE 5JBAS 3T28A 2PHBA 1ZHRA 5DPAA 1EB2A 2FX6A 4YTAA 1EP5A 2VVVA 1JXPA 2FDAA 1MKXK 1TWXB 3E3TA 3A81A 1IQKA 2WINI 1BTXA 1GHXH 3TH3H 5A0AE 4VGCC 3GDVA 4K2YA 1SHYA 3LJOA 1OYTH 3QTOH 2D26C 3SHAH 1EKBB 1C1PA 1GMCG 1S84A 2PFEA 3MOCA 3BV9B 2ZFTA 2ZU4A 3SJ9A 1J16A 1THSH 2C8ZB 1GJ7B 8GCHF 3EE0B 2A7HA 2ZFPH 5E8EH 1EAXA 2A4QA 3H5CB 3GCOA 3SBKA 3ZVBA 1FIWA 2SGEE 4B73A 2FS9A 2ULLA 2GMTB 3F6UH 4IN1A 1F7ZA 1F5RA 1G3DA 1OP0A 2P8OC 1FZZA 1O3KA 1WOFA 3VXEH 2OINA 3LGWA 2SNVA 1MBQA 1ETRH 1WCZA 1BBRE 1G3EA 2FM2A 3ZZAA 3AW0A 1H9LB 3S9CA 4TWWA 1TOCB 2B5TB 2F91A 1TNLA 2ZC9H 4JYTA 1F5KU 2O9QA 1O33A 1UCYH 1S5SA 1SVPA 1O3AA 2YNBA 3MFJA 3GY7A 1HAYB 4Q7XA 1DWDH 4XBDA 2G5NA 4MNXA 3A7TA 3LH1A 4BANB 2AH4X 3QO6A 1HNEE 1FY4A 1QBOA 4ISIH 2HPQH 2VJ1A 1J14A 5FPYA 2EA3A 1INCA 1GBBA 3QLPH 1MCVA 2OXSA 5L6NH 1UTLM 3RXLA 2F9UA 2G5VA 3SU5A 4SGBE 2BZ6H 2B9LA 1DY9A 1LPZB 2GDEH 5JYIA 1EZSC 1GMCF 2PLXA 2KAIB 5DP7A 4J2YB 1RD3B 4MLFB 5CE1A 2VIWA 1BJUA 1TFXA 1E38B 1FY8E 1NY22 3S7HB 1AVXA 3B9FH 1EUFA 3F68H 1W11U 3RP2A 5FPTA 4R0IA 3AASA 3K65B 2GV7A 3PWBA 1O3BA 1TBQH 3T2NA 4OGYA 1RTKA 2OLGA 1EXFA 3EDXB 1MTUA 5F03A 2GDDA 3I78A 2VH0A 4JCNA 1TPPA 4NZLA 4RN6A 1O3CA 2ZPSA 1C4Y2 1MZDA 3LOXA 1TNKA 2GT7A 1DDJA 1TA2A 4NIYA 3ZZ4A 2ASUB 2ZGBH 1GI4A 3LH3A 2Z3EA 1RIWC 1AI8H 1K1NA 4BAMB 4JK6A 2QGRA 1H8IH 2FOMB 4YT7H 2D8WA 5C20A 1ETSH 1DWBH 1D3DB 1WBGB 4Y10E 2A2QH 2A1DB 3BG8A 1GL1A 1IOEA 3FZZA 1ZPBA 1DLEA 2ANYA 5HMAA 1C5TA 5A09A 3Q3XA 1GHYH 1T8MA 1LHCH 1ZMJA 2BM2A 2ZPRA 2ZHEH 4ABBA 1V2LT 3UNQA 4Y0YE 1AIXH 1LKBA 3SI3H 1HAPH 1V2ST 1SBWA 4NA7A 1BMLA 1AD8H 3MNBA 1H8DH 2BVSH 2A45B 4NCYA 1LO6A 1TNHA 3BTDE 5EXMA 1NRPH 1FAXA 4GHQA 1CA8B 4CH8B 5B6OA 1ELCA 1SMFE 2RDLA 4OGXA 2HNTE 6GCHG 1NFUA 4GCHF 2SGPE 3SOSA 3SV7A 1NO9H 2HOBA 2GCTB 3C1KA 1O3NA 4INLA 1V2MT 3L3TA 1LCYA 3PWCA 5EW2H 4K3JA 1HJAC 1DSTA 4CHAB 1SLWB 1HPGA 4UFFH 1V3XA 5GPIB 5ETXA 3BF6H 1GHVH 1HJ9A 1OYQA 1F0RA 1PPHE 4IMZA 2ODPA 2W26A 1TRNA 5F8XA 1NN6A 3CENA 1DICA 1A5IA 1TMBH 1NU9A 1YBWA 2JH5D 3SV2H 4DURA 1TIOA 4JYUH 4JZIA 1F5LA 1E0FD 1F0TA 4IN2A 2UWOA 2F9NA 1A61H 1AE8H 4CBNA 3JZ2B 2ZGHA 3PV4A 1Z6EA 1ELTA 1QR3E 1AO5A 5LPRA 4MPUA 3F9HA 5GIBA 1AHTH 3M5MA 1HAGE 2AMQA 5GJ4B 3R3GB 4DVAU 3A7XA 1C1SA 1HB0B 3UPEA 3VB6A 1Y3XA 1XKAC 1AN1E 3LPRA 2ZTYA 2OC0A 3MNXA 1BITA 1GVKB 1HJ8A 3PMHB 3EA9A 1A3BH 4MDSA 4AOQA 1TPAE 2UWLA 2QXHA 1TE0A 1UTQA 1P09A 2STBE 2ZIQH 4IC5A 2Z3CA 4BAHB 2CGAA 1Y3WA 4A6LA 1GWAA 1JRSA 1KXBA 1C2HA 3TJNA 5FPSA 3SJOA 1ARCA 5A8XA 1GI7B 1T8OA 1XXDA 4B1TA 1FXYA 1UVSH 4LK4A 2B0FA 1FV9A 4YO9A 1GHAG 3ATWA 1O3JA 3UUZA 3NPSA 4MQAA 5TCAA 3ZYDA 1T8LA 1L4ZA 1ABJH 1G2MA 3TVJB 2ZHDA 1TAWA 1TX6A 3UY9A 1AGJA 3HKIB 4I32A 1G2LA 3TH2H 1WV7H 2NU0E 4OS4A 5EXNA 1KLTA 4BXWA 1BA8B 2EC9H 4DT7B 4K1SA 1IQIA 1C1MA 3FZDA 4MPXA 2FX4A 3ZV9A 3VGCC 1EQ9A 3D65E 1AUJA 2VWOA 1P2NA 1SFIA 2XNIA 3GY4A 3O8BA 1KIGH 1VITF 1AVGH 1ETTH 3BG4C 3LGIA 2KAIA 1DPOA 2THFB 1AU8A 1UCYK 3IITA 2QF0A 4Q7ZA 1C1QA 3BTKE 5A8YA 3RLWH 3T26A 1O2OA 2NU2E 2ESTE 1GBMA 2BD3A 1W7XH 3PO1C 3M7TA 2ZHFH 4FUDA 1O3DA 2P94A 1HXFH 1YPHE 2RA3A 3M35A 1QB9A 2A32A 4U32A 7ESTE 1W12U 1QIXB 4ABJA 2V6NA 3L33A 2TGDA 4H4FA 3S7KB 1IAUA 4X2WA 1ZGIA 1TBZH 1N8OC 3LT3A 1S81A
chains in the Genus database with same CATH superfamily
4DG4A 4V3LC 3RXVA 4FU7A 4H9DA 2ZKSA 1GL0E 4A49A 3GY8A 1CA0B 1ANCA 3M5NA 1C1OA 3ZVEA 2Z9JA 1PQAA 1TNJA 1TOMH 5I46H 4K1TA 1B0EA 1BRAA 7GCHF 2Y80A 2FI5E 3M61U 4X1QU 5T6GA 1ZSJA 4ZAEA 2BD9A 1WSSH 4FOUC 5E2PA 4IC3A 3SUDA 2ZDMA 2L5UA 4JK5A 3ENSB 3MO9A 1SLXB 2GZ7A 3PV5A 3VGCB 1K0HA 2FOCA 1A1RA 1Y5BT 2LNCA 3E6PH 5LKZA 1L4DA 5G4BA 3A8AA 2BAYA 4O3UA 3DSPA 3C27B 3OY5U 1D3PB 2VWLA 3PMJA 1ZMLA 2BD2A 1SGFG 2WPJS 4CA1A 1FUJA 4CRCA 1UCYE 3DA9B 2K0QA 1DCQA 1NM6A 3BTHE 2UUFB 4ZHLU 3MTYA 1BB0B 3GCHB 1ACBE 1SGYE 1ID5H 1FJSA 5DP6A 1A3EH 2VGCC 5EODA 1YPLH 2J94A 5FB1A 1NFYA 1CGHA 2VNFA 3HKJB 3U9AH 1W0KD 3SOXA 3BTFE 3PLKA 2J98B 1QJ1B 1V6DA 3GDSA 4WY3A 4FU8A 5EGMA 5DP9A 2CV3A 2TPIZ 3ZVDA 1CQQA 4UI9B 1AY6H 1GBCA 4NZQA 3VEQB 2OXQC 2ZCHP 2YHNA 4OS1A 3N7EA 4WJG2 4DIHH 4GNGA 4UD9H 2KWNA 2KGGA 2FODA 2VH6A 4DW2U 4TYDA 5C1YA 2LV9A 1KLJH 1Y3YA 6LPRA 4Q4LA 5C5OA 1FDPA 1MCTA 4P02A 2XP0A 1VCWA 2A5KA 4AN7A 1EX3A 4I7DA 3KQEA 1V2KT 4QQ4A 3PROA 4TY7A 4X2YA 4AFSA 4N4FA 2QV1A 1SGDE 1RRKA 3BIVH 2DSMA 2GCHG 2Y81A 1T31A 3T62A 3SGBE 3A86A 2F9BH 4X6PA 2P16A 3ODDA 3V0XA 5G0FA 1ELAA 2YSMA 1NPMA 1VGCB 3KYGA 4UFDH 1WXRA 2EQNA 1P06A 3GL6A 3SOWA 2IN2A 1C5ZB 1GBIA 4IW4E 4WWYA 1P11E 3EYDA 2R3YA 4XBBA 1DITH 3DSOA 4FUGA 5T3HA 3RMLH 1FPCH 2GKVE 2K1QA 1TB6H 3GOVB 3RXKA 1ZTLA 1WE9A 2XOCA 3NK8A 4OGEA 2PKSB 3OEHD 2XBVA 1HRTH 1HBTH 3EA7A 4WMFA 1C1RA 3KF2A 1PPZA 3AAUA 4FO9A 2ZPQA 1BTUA 1IQJA 1NRSH 4GLYA 4INKA 4D7GA 1OPHB 4B2BA 4AFUA 6CHAB 2FESH 1A7SA 4X8SH 4YXWD 1CBWC 3KHVA 2Z3DA 2B7DH 2F3CE 1SL3A 3A87A 1P05A 3P8FA 2NWNA 3ATLA 1LQDB 2XCFA 1WTGH 1WEMA 3T27A 1P9UA 4TY6A 2F9VA 2HVYB 5J4QA 1ANDA 2W3IA 4AYVB 1QQ4A 1FI8A 2FS8A 5LGOA 5EPYA 1O5AB 2MT5A 3TK6A 3HGPA 2EI7A 1FONA 2ZECA 4Y76A 2GMTC 1DUAA 1O35A 5LKUA 4ISOA 1YCPH 2ANMH 2G55A 2FEQH 3SNAA 4NFFA 2WYJA 3DD2H 2H5DA 3RXHA 3UNSA 3U28C 1QBNA 2SFAA 2VJFB 1PQ7A 4A1VA 4MSXA 2ZU5A 2UUJB 2QY0B 1P0SH 1Z60A 3GCNA 5DO4H 1GHBF 2HNTC 3KQCA 3M3TA 5A0CA 3RXEA 1Y5UT 1IQHA 3BSQA 1NT1A 5C11A 2PP6A 3F0PA 4O64A 1SLVB 4Q63A 4ABIA 4X8TH 3SV9A 1AMHA 1F2SE 1A0LA 1A5HA 3P95A 1TBRH 3ZVGA 3QTVH 3ZZ7A 1ORFA 4U2WA 4DJZB 3TNSA 4UDWH 2EXUA 4QT8C 1YPEH 4CRDA 1GJDB 2BQWB 2C4FH 2XCNA 2H0DB 3VXFH 4K60A 4CCGX 1V2RT 5AF9H 1H4WA 1RXPA 1T1HA 2MKEA 3A82A 3NXPA 1MTWA 5JB9S 1C9PA 2BLVA 5DGJA 3RXAA 1TGTA 4ABAA 1HAVB 1YCPK 2BD8A 4WZ0A 2I6SA 3TH4H 5I25A 4YBSA 4LJNA 5HIZA 1C1VH 2OP9A 4AB8A 4XRNA 1WYKA 2J9NA 3FKSD 1MM3A 3DCLA 4WH8A 1GHAF 2JKHA 1MQ6A 3LGTA 4O97A 1DXWA 4NN2A 1ELEE 3KQ5A 2BD5A 1O3HA 5FX6A 1DUEA 1QRZA 1CVWH 2PW8H 1DVPA 3TJUA 1C9TA 4HTCH 2WUBA 2RR4A 2QA9E 7KMEH 3E0NB 1RIWB 3ZZCA 5AVDA 3RMNH 1BHXB 3MH4A 2QIQA 2IDAA 3E2DA 1GPZA 2FI4E 1SOZA 2CHAB 3DWDA 4MNWA 3VPKA 3N7OA 1W0YH 3DFJA 4MG3A 4FETA 5CMXH 3RLYH 5E0GA 4K69A 5EQQA 4BAKB 2ODQA 2FTLE 4GPGA 2H9HA 2VPEA 2A4OA 1O2HA 2GZ9A 1CGJE 1G3BA 2LN0A 1G3CA 3GDUA 1DS2E 5C0UA 1GCDA 1BZXE 2L7PA 2YYRA 3GY5A 2ZGCA 3MU8A 2C8YB 1HDTH 1WQSA 3NUMA 3F9FA 3MHWU 2OCVB 5HM2A 4GAWA 3MU4A 4ZKSU 4YESB 4IC2A 1Q3XA 1JM7A 3RXQA 3EE7A 2GJGA 1GI2A 4GCHG 5JPMH 1O3IA 1XVMA 2F9OA 4I8HA 1ZHPA 3M3VA 5F8ZA 3ZZDA 3B23B 4KP0A 4I8KA 4KTUA 1C2LA 2EODA 2TRMA 1QL9A 3CP7A 1QBVH 2BLWA 5E2OA 2XWBI 3VB5A 2ZFFH 4I31A 1HAXB 4X0WU 2OK5A 4ZMAH 4JMYA 3GV4A 1NROH 2VIQA 1BMFD 1QGFA 2GP9B 4H42U 2FYQA 3BTEE 1EAUA 1OP2A 3TITA 3MH7A 4AGKA 3M63A 1O3EA 2BTCE 5C5NA 4FUEA 1YPGH 1E4UA 2SGFE 3A7YA 2V3MA 5EPNA 4PPEA 2PUXB 1XUKA 2K16A 4IBLH 4LADB 2BMGB 5BPEA 1O2XA 1LMWB 1SPJA 3ZZ9A 2BXTH 4UFGH 1C2JA 8GCHG 4UEHH 5AITA 1MTVA 2G8TA 1LVYA 2WPMS 4NIVA 3Q1DA 2VNTA 2OUAA 3SOUA 1O2QA 1BIOA 1W2KH 2BX4A 1E37B 1YCPM 3PLPA 2P3UB 3PTNA 1PQ8A 1C4U2 4NIXA 5EIYA 4BAQB 2CT2A 1C5RA 1ZRKA 3KNVA 1A46H 1O5GH 3NKKA 5DKMA 2ZTZA 5DKAA 2BY9X 4X1PU 4Q2KA 4YAXA 2FPZA 4I7YH 3H09A 1NS3A 1ESTA 1K1LA 3P70B 1BMAA 2GD4B 3SHBA 1S0QA 1H9HE 1TGBA 2JMJA 3LIWA 4ZQLA 5HYOA 2ZZUH 1NFWA 1AFQC 1NU7B 2Q6DA 1W10U 3GY2A 1F0UA 2OC8A 1GI6A 1PPBH 3ODFA 4YOIA 1B5GH 2WPHS 1Z8RA 1HCGA 4C9ZA 4I33A 1G36A 1DSUA 1RGQA 2KWOA 2BLOA 3BEIB 1XUJA 5FCKA 4X1SU 1LHGH 3GCTG 5BRRE 1HYIA 2HPPH 1O2WA 4NSVA 5T6FA 4H6SB 1AUTC 1DVAH 3U5PA 3F9EA 3TNTA 5DSFA 1O3GA 1QJ6B 4TWYA 4ZXXH 4ASUD 4IS5A 2KYUA 3RXFA 3V7TA 3LJUX 3RXTA 2K8IA 3O34A 1TGCA 1WESA 1UTMA 3LGUA 2WPDD 3EQ0H 1GI0A 2FOAA 3MU0A 4BXSA 2ECTA 4CREA 2BDAA 4CHAC 1GMHF 1JWTA 4FVDA 3UAIC 4WXVA 1GDUA 1C5NH 4D8NA 1TQ7B 2ZDVH 3BEUA 1GHWH 1HYLA 1GBFA 3DFLA 2KKXA 1MKXH 3M5OA 5JBCS 1MU6B 1IQEA 1SGRE 2ZCKP 1B7XB 1FY1A 2ALPA 1O2PA 2I6QA 3M36A 1JMOH 2JH0D 5HIYA 1ZRBA 2SNWA 3RXGA 1A5GH 1CT4E 1LPKB 1KXDA 2CSYA 2Y82A 2GGVB 4IMQA 4ZUHA 1C1WH 4KKDA 5H9MA 1D4PB 1O5CB 1DT2A 2XOZA 2ZU1A 2E6SA 2Y1NA 3TJOA 3UR9A 3A80A 4YOGA 4AFZA 1P2OA 5CHAB 1MTNC 3CS7A 2XRCA 1TGSZ 2L6OA 1S6FA 4GUXA 1C2GA 4UE7H 3ZZ6A 1QL7A 4J1YA 2KWJA 2XYAA 4RI0A 4A1TA 1TGNA 1MZAA 2BVXH 2L80A 1XUIA 1UTOA 1HAOH 1KLIH 1D3TB 2R9PA 1GHZA 2Y5HA 4R8PK 1P12E 1A2CH 2BY5X 2GCTC 2QXGA 4A1XA 1EB1H 1GI1A 9ESTA 1ELBA 4SGAE 4X2VA 2H9EH 3MNSA 3R0FA 2FI3E 1MKWK 4H6TA 1WUNH 4X8UH 3SORA 1SGCA 1ZHMA 3GS9A 1P9SA 5TBNA 1GBEA 4B74A 1RJXB 3SQHE 2EGMA 2LGGA 5FL7D 2YUCA 3ZVCA 1UK4A 4YBTA 3GCTF 2A4RA 4FVBA 2VPGA 2M5TA 2AGGX 2GVFA 5EG4A 1GBJA 4AC9A 1QL8A 5B76A 5HGGA 3RU4D 2G45A 1HAVA 1QY6A 2YMSB 3OU0A 2IJOB 4BNRA 1SHHB 2ZDKA 1SQAA 2HALA 1OWKA 3O35A 2CHAC 5ABWA 1DX5M 4BTUB 4CRFA 1AWHB 2BB4A 3AAVA 3RC6A 4ISHH 4OS7A 4B2AA 1O3OA 3DQVR 3SJKA 1MAXA 1TABE 3RC4A 5LPEA 1O2UA 1WQVH 3LVRE 4Y0ZE 4Z0OA 2YU4A 3ATMA 4ABGA 4YLQH 4Z6AH 2PSXA 1Y59T 3L1ZB 3MI4A 1BUIA 5K3QA 2Z9LA 5B78A 3GYLB 1UJ1A 2W6ID 7GCHG 1CGIE 3KN2A 4K1EA 4YBMA 1V2QT 1ANEA 1W0JD 3E90B 2QC2A 3QZQA 1EPTC 3QGJA 3FOAA 1TPSA 4A7IB 3MH6A 3ZVAA 3VG8A 3TLOA 1ZPZA 2HNTF 1GG6C 1GJ5H 3MQKC 2G81E 1DWEH 1NBME 3KEEA 3M3SA 4CBOA 1GGDB 1MQ5A 4YT6H 7LPRA 3D23A 1NC6A 3VB7A 2Q6FA 1A4WH 1O2JA 2ALVA 1ZJDA 4KTCA 2GT8A 1JBUH 2J38A 1RMDA 1QNJA 4FK5A 3O70A 3IWMA 2ZFQH 3MYWA 1Z6UA 1CU1A 1KYNA 3FL2A 1LDTT 3SU0A 3K9XB 3A7WA 3LDXH 2WV9A 4P5OB 3DUXH 2R3UA 1EOLA 3D49H 2OWAA 2H9TH 4AVXA 1FAKH 4E7RG 4W4UA 3GY3A 4ZUXU 5HXFA 4LZ1H 3N7DA 5C17A 1GVLA 5KH7A 1HYJA 1E34B 4KTSA 1LPGB 1HGTH 1EASA 4FUBA 1FNIA 1YLCA 3M7QA 3I2DA 4AYYB 2CONA 2KIZA 2MD7B 6ESTA 1ZPCA 4D9RA 2RA0A 5FBIA 3SZNA 2I50A 1VITH 1NRRH 3O8DA 2YHOA 1D6RA 1C2EA 1HAZB 4FIPA 2P93A 1KTTB 1ZYOA 2BOHB 2G4TA 5GDSH 2YURA 1J9CH 5EU8A 1N6XA 3BTQE 2J97A 3JUEA 4O9VA 4CRBA 2G4UA 1V2UT 1BTZA 1FPHH 3SJ8A 3PTBA 1XKBC 2ZGXH 1PYTC 3KQDA 1PQ5A 2DE8A 4Y7AA 4X1NU 5PTPA 4AZ2B 2Z6BD 4ZH8A 3BEFB 3RXBA 1P02A 4Q80A 1EJNA 1JRTA 2IPHA 2ZQ2A 3ZNIA 2CF8H 2KFWA 2PTNA 2FSAA 2DE9A 2QAAA 3RXRA 1FMGA 2V0BA 1WEUA 2FMJA 3KL6A 2YQLA 1O3PB 3HK3B 1GDNA 3PHDA 2C93B 3U1JB 2J98A 1GJ6A 2CSZA 1V2TT 1Y3UA 2BDYA 2VB0A 3N9QA 4X3GA 1JOUB 1TX7A 3LC3A 2BYAX 1YM0A 4TPIZ 1ELDE 1HJAB 2C3SA 2FFWA 1TQ0B 4B76A 2WV4A 2Y6TA 1OSSA 3T25A 2ZHQH 1MU8B 3E16B 4CH2B 3RXDA 1K1MA 9LPRA 3QGNB 4AUQB 2YW8A 4DY7B 3ZPV1 2EA6A 5T1VA 1JIRA 1CHCA 3LVQE 2FIRH 5KH9A 4BBQA 3BG4B 3VB4A 1THPB 4Y6DA 5L2ZH 1GG6B 2G00A 1K1JA 1N1LA 3PM3A 2DX8A 2W6JD 1QHRB 2GZ8A 1PPCE 4BOHA 4THNH 2A5AA 2ZQ1A 3SNCA 2VIOA 4BHWA 1OP8A 1BMMH 1FN8A 2D2DA 1PYTD 2VIDA 4NSYA 3T5FH 1OHHD 1O2TA 3EB5A 1QJ7B 2XWAA 2BY6X 4F52B 1D6WA 2R2MB 1LHDH 2STAE 3KCGH 4GVUA 3LQIA 1BHXF 2F6NA 1CE5A 1EOJA 1BBRH 2R0LA 2ECJA 3SNDA 1ZSKA 2HYED 8ESTE 1MD7A 3U5MA 3GCHC 5TJXA 3UFAA 3CNRA 1BBRK 3TU7H 1KTSB 2OQ5A 3K6YA 1DLKB 2HWLB 3F0OA 5K7RA 1BORA 1L0ZA 2P3FH 1GCTC 5E0JA 3NZIA 1GJCB 4DGJA 3STIA 3SO3A 4MVNA 3U8RH 4A5TS 3SV8A 1DM4B 1UHBA 2BQ7B 2CN0H 1AZ8A 1C5YB 3ZZ8A 1GMDG 1O0DH 4ZHMU 3RXMA 2BQ6B 1C5UA 2M1RA 4RT1A 1TX8A 2NU4E 3SGAE 2A2XH 1J15A 1IHTH 5C67A 1CBWB 3RM2H 3W94A 3E1XB 4YM9A 2W7SA 2BOKA 3ELAH 4WF8A 3JZ1B 2V7QD 3L6PA 5DK1A 3TPIZ 1XUGA 4ESTE 1ANBA 3F2FA 3TK5A 1MBMA 2GCHF 3PV2A 2A7JA 2OC1A 2LXHC 1AFQB 2C2LA 1DXPA 1E36B 2LGLA 4MPWA 1GBLA 2PV9B 1SGNE 1EATA 2JIZD 4O62A 2HGTH 2QXJA 1ZJKA 5J3XA 1GI5A 2Y1MA 1AKSB 2FO9A 2CXVA 4K5ZA 4LOYH 4LZ4B 4Z0RA 3RMOH 2GTBA 1BTHH 2WHXA 1ESBA 4A4BA 2BLQA 2TGAA 4KELA 2MNYA 1NZQH 1X7AC 2PR3A 2TGTA 4MTBA 2KZ4A 3P8GA 2V3OH 1EZQA 2H5CA 3UB0A 2G51A 1GI3A 4F4OC 3A83A 3KV6A 5A8ZA 1AZZA 5B79A 3GYMA 2H0DA 2KR4A 1NESE 1Z1IA 4CRAA 4NA9H 2ZO3H 2IOTA 1HUTH 2B8OH 3LQJA 4V3KC 2UUKB 1YYY1 1O39A 3STJA 1UK2A 4X6NA 2FOHA 3K6ZA 1O3MA 5F8TA 4NWKA 3UWJH 1K21H 2ZWLH 1OS8A 2OBOA 8LPRA 5H1VA 1PJPA 1O38A 3PO1B 1UHBB 1XM1A 2VJEB 4CRGA 4FUFA 1O37A 1QB1A 2PUQH 3RXCA 3FVFB 1GJ4H 4AG1A 1EZXC 3IG6B 4HGCA 3EA8A 4B7YC 1JIMA 2BDCA 3SUEA 2XXLA 1C1TA 1UTJA 1K22H 4WH6A 5HM9A 1QA0A 2QXIA 1KY9A 4ABEA 3SU1A 3KDEC 1AFEH 1NTPA 1BJVA 1Z7KA 4JZDH 3E91A 1YPMH 1YPKH 4X2XA 1KSNA 5B8DA 1FQ3A 1BTYA 2A0QB 4WMEA 2ZCLP 1C1NA 3V12A 3SGQE 1HIAA 4FXGH 1CT0E 1PPFE 1K1IA 1Y5AT 1O3FA 1EAIA 5GXPA 2XC4A 4M7GA 1VFYA 1BRBE 1TNIA 3URDA 3LGYA 3AW1A 3EAJA 5IK2D 3KNXA 3S69A 2J95A 4S3OB 5CDFE 5AIUA 2CK3D 1BOQA 4OS6A 3OX7U 3ESTA 1YGCH 1W3CA 2RCEA 4Y79A 2AGIX 4Y71A 1WIMA 1C5LH 1GMDF 1SSXA 1YY3A 4D76A 1P01A 3MO6A 5FAHA 5A0BA 5FB0A 2ECNA 5C13A 2XBWA 1EP6A 2CJIA 3FAOA 3MNCA 4R8TB 5L30H 1S82A 2YNAA 3QZVA 2VVUA 3A8CA 2OTVA 1VKYA 2AIQA 3SU4A 1G32B 1UTKA 2ILNA 2BD7A 1BTPA 2O8UA 4Z0KA 2P3TB 3OYPA 4X1RU 1WILA 1W0ZU 2BDGA 3FN8A 2HRVA 2M13A 1C2IA 2JETC 5LH8A 1HFDA 5FERA 4WMDA 1T4UH 2ZU3A 3H7OA 4YC9A 4K8YA 2Y5GA 2YOLA 3QX5H 1L2EA 1O2NA 1WEQA 4DOQA 1O2KA 1V87A 2BDIA 1CHGA 2VWMA 2PWXA 2ZHWH 4AORA 2WSSD 2B0OE 3ASLA 1UK3A 1T4VH 1NRQH 2V3HH 2WYGA 2Y7XA 1WTHD 3KQBA 2RI7A 1C5XB 1TYNA 2KREA 1O5FH 4XSKU 2BDHA 1WDIA 2PTCE 1X4JA 4MNYA 3SN8A 3SW2B 2KU3A 3SHCH 1V2JT 2WZQA 1O32A 1C4V2 1AE5A 1GJ9B 3Q3YA 2W3KA 4ABHA 5FXLA 2WPKS 2YVRA 2PUYA 1G37A 2F43B 1V2OT 4WVPE 5TABA 1K9OE 3U98H 3PMBB 5C1UA 1GBKA 4IGDA 2F42A 1Y3VA 2BXUH 3ZZ5A 3ZTGA 3UOPA 2M2AA 5T6DA 2L74A 2IPQX 1BDAA 1W8BH 3N9LA 1O2MA 1UTNA 2C8WB 1DE7H 3A85A 1Z1JA 4FU9A 4OM9A 2R2WU 2PKAA 4RKOB 3ATKA 3HCUA 4FUJA 4AYCB 1KDQA 2QF3A 2SGQE 2PGQB 3BTME 1KXAA 3MH5A 5C94A 1PPEE 3M62A 1IQGA 2FP7B 1P3EA 4F48B 2RG3A 1EPTB 5LPFA 4YATA 4E06H 1YLDA 4AFQA 4BAOB 3S9BA 5AHGH 1VYXA 1V2NT 4RKJB 2CSVA 1SGIB 5C3NA 3DDTA 3A88A 2IJD1 1DFPA 1HAHH 1VJ9U 1P2IA 1OWJA 3PMAB 3P8OA 4HI3A 1P04A 2QCYA 4DIIH 2AIPA 3E8LA 4Y8YA 5DP3A 2JMIA 1RS0A 2KWKA 4ACBA 2XBYA 4Y8XA 3RM0H 2LDRA 2LRIC 3TGJE 1G9IE 1O2SA 4AX9H 1S85A 2V35A 2BD4A 2ZP0H 3PURA 1VITG 3RXJA 3TGIE 2OBQA 5DN6D 1DOJA 1SFQB 4ZROA 4AYCA 5C0TA 2W5EA 2AMPA 4OS2A 1VJAU 2UZGA 3DT0H 5DP8A 1MH0A 3EB6A 3FJUB 5G04B 4TT3D 3MHSA 3MWIU 1XXFA 4CR5A 2M6MA 3TIUA 3H7HA 1P03A 4AB9A 1QFKH 3N9NA 1VZQH 1LQEA 1C5SA 2G52A 1TRMA 1MMJN 1YP9A 2Y7ZA 1YF4A 1P10A 5JB8S 1K28D 4UFEH 1IQMA 4I8GA 1GI9B 1C1UH 1Q2WA 2VPDA 2K1JA 1C2KA 5IYTA 1TPOA 1D9IA 1C5VA 3SI4H 3RXOA 3RTRB 1KXCA 2KCPA 2Y5FA 2ZA5A 2ZU2A 3HATH 1KDQB 4I8LA 1WEOA 4MPVA 1GI8B 2VU8E 3I77A 2W7UA 2ODYB 3O8CA 2D8SA 2J92A 4UP0A 1ELGA 1OWEA 3UWIA 4INHA 1FIZA 1EPTA 1A0JA 4NFEA 1C2DA 2LPRA 2R0KA 3QDZB 1IQFA 4X8VH 2MD8C 5H4IB 2HLCA 2EI6A 1F62A 2KR7A 1SB1H 1Z6JH 3FEHA 3ZPVE 2YT5A 2ZDLA 4NIWA 3QUMP 1FY3A 1S6LA 1SGFA 3O33A 3A7VA 4P00A 1AKSA 2E6RA 2KCAA 1GJBB 4K8BA 3PYHA 5LCWB 3H7TA 1GHBG 2NAAA 1C2MA 2G6QA 1XUFA 4F1PA 1XVOA 2Z9KA 3P17H 4I8JA 2CKLB 2LP6A 1UVUH 3GISB 2J4IA 1O3LA 3RC5A 1MUEB 3M7UA 1C2FA 1L1GA 2ANWA 1K1PA 1K1OA 4MVTA 6CHAC 3MU5A 3O47A 5JBTA 1OOKB 4DCDA 3RU4T 1H9IE 3LU9B 1N6YA 1CHOF 1XUHA 2AGEX 1MTSA 3A84A 1J8AA 4B6FA 1V2WT 3SUFA 2WUCA 3O7AA 3U8OH 1MAYA 2FWWA 1TA6A 2FOFA 3GICB 2EI8A 3N9MA 2VJFA 4U01A 1SQTA 2NU3E 5DJ7A 5TCCA 2ZDAH 4YLUA 3SYJA 2VGCB 4WA6A 2RSDA 1C5MD 4FUIA 1CA0C 3HPTB 2ANKH 2J2UA 2QF5A 3UOUA 2YREA 1JOCA 1YPHC 2Z94A 1O31A 5JBBS 3RMMH 2AYWA 2FLRH 2ZDNA 4JZ1A 1WEVA 3LKWA 3OSYA 1NFXA 1TNGA 4BTTB 1ELVA 3BTTE 1O2VA 3AVZA 4GNEA 1V2PT 2FOEA 4IC6A 4AP4A 3S9AA 1DY8A 3L11A 2O8LA 1QCPA 3B8JA 1OX1A 1QRXA 1TMTH 2AFQB 4XE4A 4ZKRU 3TJVA 5EW1H 2ECVA 3D62A 3SUBA 4YZUA 3P6ZB 3P92A 4OS5A 1LHEH 1N87A 4NWLA 3M99A 4LXBH 2KX4A 4ISLA 1H8ED 5EXLA 5KEDA 4XDEA 1TMUH 4A0CD 2GX4A 2HLDD 3BIUH 4ISNA 1O5BB 2YQMA 1F0SA 1ZTKA 1LVMA 3WWFA 1RTLA 1PFXC 4HZHA 4JYVH 4FUHA 3PLBA 1ZSLA 3WY8A 1HLTH 1UTPA 1O34A 1UMAH 3G01A 3PRDA 2Z7FE 3LC5A 2Q1JA 2BX3A 2XC5A 4BTIB 4U30A 1FN6A 1GBTA 2UWPA 2O8TA 3EGKH 3U69H 2VINA 2ZI2H 1AWFH 5EQRA 2Q6GA 4KGAA 3M5LA 3W95A 1SOTA 4Y11E 2AERH 4X6MA 4FUCA 2FXRA 1ZMNA 4B6EA 2BY7X 1WGMA 1MD8A 2ZGJA 1E35B 1VCQA 4YOJA 3UIRA 1GJ8B 2VJEA 1S6HA 3ZIAD 1KXEA 5TRBA 3F3BA 1D3QB 4AGJA 4D7FA 1O5DH 1MM2A 2LXPC 3ZYEA 5GNDA 1VR1H 3QK1A 2FD4A 2GV6A 1C5WB 4VGCB 1C5PA 4CR9A 2XC0A 1K2I1 2ZG0H 2KCYA 4GSOA 5CHBA 3V3MA 3RPGC 2P8OB 1LDJB 3MMGA 2JMDA 3Q77A 1YPJH 2L75A 1P57B 3SU6A 1A0HB 1KXFA 4MNVA 1MABB 4XFQA 4ABDA 2BDBA 3OEED 4Q7YA 4ZKNU 4ZKOU 3SV6A 1C5QA 1EZUC 1SGEE 5H1TA 3T29A 5A2MH 2XEUA 1GBAA 3OY6U 3OTPA 4N3WA 3KYFA 3DHKH 1AB9C 1GVZA 4NGAH 4XOJA 1G30B 1GGDC 1AVWA 4F55A 3PB1E 4RSPA 1LKAA 2P95A 5EOKA 3E0PB 1L1JA 2NU1E 3LQHA 3FANA 2PKAB 1T7CA 1BT7A 1ELFA 6GCHF 5B75A 2MNZA 2BZAA 1AB9B 3MU1A 2YSJA 4LLBA 1L1NA 2MIQA 1QB6A 3QN7A 2JRJA 1QA7A 1ARBA 2PSYA 3OTJE 3UTUH 4YADA 2FZZA 4GHTA 1UVPA 1ZZZA 5FX5A 1QQUA 5C1XA 2WPLS 1CO7E 3RXSA 2XBXA 3LRQA 2XW9A 1U6QA 3K2UA 3CS0A 4S3OC 5SVIB 3T6RA 1P2MA 1QZ8A 3RXIA 2F83A 3ATIA 2Y43A 1QTFA 3VK6A 3A89A 2D8UA 3FFGA 1ESAA 4ZHAA 5IDKA 4F49A 1OKXA 1O36A 1SG8B 2O8MA 1TLDA 1T32A 2QYIA 1O2YA 5DG6A 5F6MA 4TPYA 2XOYA 1BTWA 2ZFSA 4R2YA 2M3HA 3ZVZB 1S0RA 1JM7B 2SGDE 2PGBB 1Z71A 2CKLA 1W7GH 2AS9A 5L2YH 5FBEA 1P2JA 2P59A 3UQVA 1TONA 2AMDA 1SGTA 4B75A 1EJMA 1GBDA 3SU2A 2F4LA 5FHTA 3SQEE 3PRBA 2KGIA 4E05H 3BTWE 2YMSD 1K2FA 1SGPE 2OC7A 1MTNB 1M9UA 4L7XA 3RUOA 1PPGE 1XMNB 1AQ7A 2C90B 5GCHG 1SI5H 1X4UA 5KH3A 1RFNA 2F9PA 3O8RA 1P2QA 1GJAB 2KCOA 5SGAE 1SC8U 1UO6A 2CF9H 1HXEH 5SVXA 1EAWA 1CSOE 2IQJA 4HG6A 3BN9A 2ZFRH 3LDYA 3FP8E 5F53A 3UREA 1O5EH 4UP5A 3GY6A 1FY5A 3VB3A 1Q31A 2JUNA 1NRNH 5K0HA 5JDUB 2ECIA 5AFZH 1XX9A 1LVOA 4WXIA 5EQSA 1SR5C 2FOGA 2XB1A 3M37A 3BTGE 3UNRA 1H1BA 3RDZA 2WPIS 3UQOA 2LELA 1EJAA 2O8WA 3A8DA 1HV7A 2XTTB 1RTFB 4FJCA 3U1IB 5AFYH 3NWUA 2BVRH 3HTKC 3PUQA 1O2GH 2QN5T 1IHSH 5C2ZA 1COWD 2K4DA 2UUYA 3U5NA 2BHGA 1YLNA 1Z8IB 8KME2 1YKTA 1P3CA 3AK5A 2PKSC 3LJJA 5ESTE 5D1KB 4D9QA 3RXPA 1O30A 4JZFH 1HAIH 2HVXA 2LAUA 1OWHA 1BRUP 2A4GA 2VIVA 2VVCA 3A8BA 4Y7BA 1B0FA 1O2ZA 4O03A 2XOKD 3KQIA 2VWNA 3QWCH 1LVBA 3SNBA 1UVTH 1BQYA 2H6MA 2Z9GA 3SNEA 3TK9A 3VFEA 3SUGA 5D1LB 5LKXA 1P2KA 1GDQA 4NA8A 1BRCE 3HK6B 3FP6E 2WV5A 2FLBH 1N8OB 1W14U 1CHOG 1ZTJA 2D1JA 5J4SA 3ZVFA 3UR6A 3F9GA 1OXGA 4B2CA 1THRH 1OWDA 5FCRA 3ZV8A 2QICA 2K17A 3HGNA 4A92A 1V2VT 2C2VS 1ZOMA 4NG9H 5GCHF 4UONA 1ABIH 2J34A 5DP5A 2C8XB 2AEIH 1IYMA 3LONA 1GCTB 4RT0A 3SU3A 2ZEBA 2BY8X 1YC0A 2ZF0H 2A5IA 3FM8C 4GNFA 1Z8JB 5JG6A 1WAYB 3URCA 3ZZ3A 2TBSA 3F1SB 1WU1A 1GMHG 1ZGVA 5ESBA 2H2ZA 4ABFA 3ZZBA 3V13A 1Z8GA 2J5UA 2FYRA 3ITIA 1NBMD 1FP0A 2VIPA 2OD3B 4X6OA 1Y8TA 5KGOA 3A7ZA 2TIOA 4B71A 2OQUA 4E7NA 2FOBA 3F2HA 4Y8ZA 1DWCH 1C5OH 3Q3KA 1HIAB 1O2IA 3S0NA 1IQLA 1SLUB 1Z2QA 5GWZA 2A7CA 2JH6D 1QURH 1O2LA 2JETB 1MKWH 4XBCA 4ZXYH 3RXUA 3KGPA 3HCSA 3W1EA 1IQNA 4PROA 1QRWA 1ZLRA 2A31A 3KIDU 4HFPB 1CT2E 2H1UA 3Q00A 4O3TA 1J17T 3NCLA 3P8NA 5H1UA 1GBHA 1TALA 1TRYA 3TGKE 1LHFH 3C5KA 2AHME 5DP4A 2TGPZ 2SGAA 4AG2A 3U5OA 3QZRA 1BMNH 3RU4E 3I29A 1OWIA 1ZBDB 1P8VC 3SZEA 1UVOA 2EEKA 2FTMA 3OE7D 1F92A 2Z9IA 4ASHA 3SJIA 1LTOA 1S83A 1SQOA 1VGCC 1T8NA 1W13U 1DANH 2ECGA 2DUCA 3U8TH 3LGVA 1ZR0A 1VCPA 5CHAC 3MO3A 1FLEE 4JZEH 1FBVA 3Q76A 2ZTXA 1BCUH 1O2RA 2ZNKH 2CMYA 5E0HA 5SVIA 3FP7E 1SGQE 5JBAS 3T28A 3WW7A 2PHBA 1ZHRA 5DPAA 1EB2A 2FX6A 4YTAA 1EP5A 5HKKD 3HCTA 3ZVYA 2VVVA 1JXPA 2FDAA 1MKXK 1TWXB 5FEYA 3DSGA 4Z1MD 3E3TA 3NRLA 3A81A 1IQKA 2WINI 1BTXA 1GHXH 3TH3H 5A0AE 4VGCC 3GDVA 4K2YA 1SHYA 3LJOA 1OYTH 3QTOH 4XI1A 2D26C 3SHAH 1FX0B 1EKBB 4I7CA 1C1PA 1GMCG 1S84A 2PFEA 3MOCA 3BV9B 1WEPA 2ZFTA 2ZU4A 3SJ9A 1WEWA 1J16A 4B86C 1THSH 2C8ZB 1GJ7B 8GCHF 3EE0B 1E79D 2A7HA 2ZFPH 5E8EH 1EAXA 2A4QA 3H5CB 3O37A 3GCOA 2JM3A 4TKPB 3SBKA 1XWHA 1WFKA 3ZVBA 1FIWA 2SGEE 4B73A 5EJ1A 2FS9A 2ULLA 3N9PA 2GMTB 3F6UH 4IN1A 1F7ZA 3O36A 1F5RA 1G3DA 1OP0A 2P8OC 1FZZA 1O3KA 1WOFA 3VXEH 2OINA 3LGWA 2SNVA 5KECA 1MBQA 1ETRH 3FO8D 2RFKC 1WCZA 1BBRE 1G3EA 2FM2A 3ZZAA 3AW0A 1H9LB 3S9CA 4TWWA 1TOCB 2B5TB 2F91A 1TNLA 2ZC9H 4JYTA 1F5KU 2O9QA 3ZYQA 1O33A 1UCYH 1S5SA 1SVPA 1O3AA 2YNBA 3MFJA 3C6WA 3GY7A 1HAYB 4Q7XA 1DWDH 4XBDA 5D1MB 2G5NA 4MNXA 3A7TA 5TDRA 3LH1A 4BANB 2AH4X 3QO6A 1HNEE 1FY4A 1QBOA 4ISIH 2HPQH 2VJ1A 1J14A 5FPYA 2CRRA 2EA3A 1INCA 1GBBA 3QLPH 3N99A 1MCVA 2OXSA 5L6NH 1UTLM 3RXLA 2F9UA 2G5VA 3SU5A 4SGBE 2BZ6H 5LKTA 2B9LA 1DY9A 1LPZB 2P57A 2GDEH 5JYIA 2LQ6A 1EZSC 5EYAF 1GMCF 2FUUA 2PLXA 2KAIB 2F6JA 5DP7A 5DINA 2LGKA 4J2YB 1RD3B 4MLFB 5CE1A 2VIWA 1BJUA 2JDID 1TFXA 1E38B 1FY8E 1NY22 4TSFD 1AVXA 3B9FH 3S7HB 1EUFA 3F68H 1W11U 3RP2A 5FPTA 4R0IA 3AASA 2M85A 3K65B 2GV7A 3PWBA 2MUMA 1O3BA 3V43A 1TBQH 5B6LA 3T2NA 4OGYA 1RTKA 2OLGA 1EXFA 3EDXB 1MTUA 5F03A 3T7LA 2GDDA 3I78A 2VH0A 2ECWA 4JCNA 1TPPA 4NZLA 4RN6A 1O3CA 2ZPSA 1C4Y2 1MZDA 3LOXA 1TNKA 2GT7A 1DDJA 1TA2A 2KM0A 4NIYA 3OAAD 2ASUB 3ZZ4A 2ZGBH 1GI4A 3LH3A 2Z3EA 1E1QD 1RIWC 1AI8H 1K1NA 4BAMB 4JK6A 2QGRA 1H8IH 2FOMB 4YT7H 3OFND 4PTBA 2D8WA 2HDPA 5C20A 1ETSH 2LGVA 1DWBH 1D3DB 1WBGB 2G43A 4Y10E 3F2GA 2A2QH 2A1DB 3BG8A 2E61A 1GL1A 1IOEA 3FZZA 1ZPBA 1DLEA 2ANYA 5HMAA 1C5TA 5A09A 3Q3XA 1GHYH 1T8MA 4WZ3B 1LHCH 1ZMJA 2BM2A 2ZPRA 2ZHEH 4ABBA 2CRWA 1V2LT 3UNQA 4Y0YE 1AIXH 1LKBA 3SI3H 1HAPH 1V2ST 1SBWA 4NA7A 1BMLA 1AD8H 5G05B 3KV5A 3MNBA 1H8DH 2BVSH 2A45B 4NCYA 1LO6A 1TNHA 3BTDE 5EXMA 1NRPH 1FAXA 4GHQA 1CA8B 4CH8B 4OGCA 5B6OA 4DT4A 1ELCA 2AN6A 1SMFE 2RDLA 4OGXA 2KKYA 3PLWA 2HNTE 6GCHG 1NFUA 4GCHF 2SGPE 3SOSA 2QE7D 3SV7A 1NO9H 5TDWA 2VP7A 2HOBA 2GCTB 3C1KA 1O3NA 4INLA 1V2MT 3L3TA 1LCYA 3PWCA 5EW2H 4K3JA 1HJAC 1DSTA 5EJLA 2MA6A 4CHAB 1SLWB 1HPGA 4UFFH 1V3XA 5GPIB 2QJ0A 5ETXA 3BF6H 1GHVH 1HJ9A 1X4IA 1OYQA 1F0RA 1PPHE 2VBCA 4IMZA 2ODPA 4LK9A 2W26A 1TRNA 5F8XA 3MHHA 4ZDTA 1NN6A 3CENA 4XD7D 1DICA 1A5IA 2PNXA 1TMBH 1NU9A 1YBWA 2QIZA 2JH5D 3SV2H 4ACAA 3M7KA 4DURA 1TIOA 4JYUH 4JZIA 4Q6FA 1F5LA 1E0FD 1U6GB 1F0TA 4IN2A 2UWOA 2F9NA 3T9KA 1A61H 4L58A 1AE8H 2MA5A 4CBNA 3JZ2B 2ZGHA 4QF3A 3N9OA 3PV4A 1Z6EA 2RDEA 1ELTA 1QR3E 1G25A 1AO5A 2KFTA 5LPRA 2XNDD 4GNDA 3DPLR 4R7EA 4MPUA 3F9HA 2JJ1D 5GIBA 1AHTH 3M5MA 4LKAA 2QF4A 1VD4A 1HAGE 2AMQA 2DJAA 5GJ4B 3R3GB 4DVAU 3A7XA 1C1SA 1HB0B 3UPEA 2EGPA 3VB6A 1Y3XA 1XKAC 1AN1E 3LPRA 2ZTYA 2OC0A 3MNXA 1WENA 1BITA 1GVKB 1HJ8A 4ZCNA 3PMHB 3EA9A 1E1RD 3IHPA 3RPGB 1A3BH 4MDSA 4AOQA 1TPAE 2EY4C 2UWLA 2QXHA 1TE0A 1UTQA 1P09A 2STBE 2ZIQH 2JJ2D 2FUIA 4IC5A 2Z3CA 4BAHB 2CGAA 1Y3WA 4A6LA 1GWAA 1JRSA 5I3LA 1SKYE 1KXBA 1C2HA 3TJNA 5FPSA 3SJOA 1ARCA 5A8XA 1GI7B 1T8OA 1XXDA 4B1TA 1H8HD 1FXYA 1UVSH 1EFRD 4LK4A 5B77A 2VPBA 2L43A 2B0FA 4A4CA 1FV9A 4YO9A 1GHAG 3ATWA 4M9FA 1O3JA 3UUZA 3NPSA 4GB0A 4MQAA 5TCAA 3ZYDA 1T8LA 1L4ZA 1ABJH 1G2MA 3TVJB 5EJZA 2ZHDA 1TAWA 5SVYA 1TX6A 3UY9A 1AGJA 3HKIB 4I32A 3MDBC 4YABA 1G2LA 3TH2H 1WV7H 2NU0E 4OS4A 5EXNA 1KLTA 4BXWA 1BA8B 2EC9H 4DT7B 4K1SA 1YWUA 1IQIA 2ZETC 1C1MA 3FZDA 4MPXA 2FX4A 3WWBA 3ZV9A 3VGCC 4WZ2A 1EQ9A 3D65E 1AUJA 2VWOA 1P2NA 1SFIA 2XNIA 3GY4A 3O8BA 1KIGH 1SQRA 1VITF 1AVGH 1ETTH 3BG4C 3LGIA 2KAIA 1DPOA 2THFB 1AU8A 1UCYK 3IITA 2QF0A 4Q7ZA 1C1QA 3BTKE 3L1XA 4I86A 5A8YA 3RLWH 3T26A 2L0BA 1O2OA 2NU2E 2ESTE 1GBMA 2BD3A 1W7XH 2YMSC 3PO1C 3M7TA 2ZHFH 4FUDA 1O3DA 2P94A 1KMHB 1HXFH 4QF2A 4I7BA 1YPHE 2RA3A 1UW7A 3M35A 1QB9A 2A32A 4U32A 7ESTE 1W12U 1QIXB 4ABJA 2V6NA 3L33A 2TGDA 3NG2A 2KE1A 4H4FA 3S7KB 1LDKC 1WEEA 1IAUA 4X2WA 1ZGIA 1TBZH 1N8OC 3LT3A 1S81A
chains in the Genus database with same CATH topology
4DG4A 3RXVA 4FU7A 2ZKSA 1GL0E 3GY8A 1CA0B 1ANCA 3M5NA 1C1OA 3ZVEA 2Z9JA 1PQAA 1TNJA 1TOMH 5I46H 4K1TA 1B0EA 1BRAA 7GCHF 2Y80A 2FI5E 3M61U 4X1QU 5T6GA 1ZSJA 4ZAEA 2BD9A 1WSSH 5E2PA 3SUDA 2ZDMA 4JK5A 3ENSB 3MO9A 1SLXB 2GZ7A 3VGCB 2FOCA 1A1RA 1Y5BT 2LNCA 3E6PH 1L4DA 5G4BA 3A8AA 4O3UA 3C27B 3OY5U 1D3PB 2VWLA 3PMJA 1ZMLA 2BD2A 1SGFG 2WPJS 1FUJA 4CRCA 1UCYE 3DA9B 1NM6A 3BTHE 2UUFB 4ZHLU 3MTYA 1BB0B 3GCHB 1ACBE 1SGYE 1ID5H 1FJSA 5DP6A 1A3EH 2VGCC 5EODA 1YPLH 2J94A 1NFYA 1CGHA 3HKJB 3U9AH 3BTFE 3PLKA 1QJ1B 1V6DA 3GDSA 4WY3A 4FU8A 5EGMA 5DP9A 2CV3A 2TPIZ 3ZVDA 1CQQA 1AY6H 1GBCA 4NZQA 3VEQB 2ZCHP 4OS1A 4WJG2 4DIHH 4UD9H 2FODA 2VH6A 4DW2U 4TYDA 5C1YA 1KLJH 1Y3YA 6LPRA 5C5OA 1FDPA 1MCTA 1VCWA 2A5KA 4AN7A 1EX3A 3KQEA 1V2KT 3PROA 4TY7A 4X2YA 4AFSA 2QV1A 1SGDE 1RRKA 3BIVH 2GCHG 2Y81A 1T31A 3T62A 3SGBE 3A86A 2F9BH 4X6PA 2P16A 3ODDA 3V0XA 1ELAA 1NPMA 1VGCB 4UFDH 1P06A 2IN2A 1C5ZB 1GBIA 4IW4E 4WWYA 1P11E 3EYDA 2R3YA 4XBBA 1DITH 4FUGA 5T3HA 3RMLH 1FPCH 2GKVE 2K1QA 1TB6H 3GOVB 3RXKA 1ZTLA 3NK8A 2PKSB 2XBVA 1HRTH 1HBTH 3EA7A 4WMFA 1C1RA 3KF2A 1PPZA 3AAUA 2ZPQA 1BTUA 1IQJA 1NRSH 4GLYA 4INKA 4D7GA 1OPHB 4B2BA 4AFUA 6CHAB 2FESH 1A7SA 4X8SH 1CBWC 3KHVA 2Z3DA 2B7DH 2F3CE 1SL3A 3A87A 1P05A 3P8FA 2NWNA 3ATLA 1LQDB 2XCFA 1WTGH 3T27A 1P9UA 4TY6A 2F9VA 5J4QA 1ANDA 2W3IA 4AYVB 1QQ4A 1FI8A 2FS8A 5LGOA 5EPYA 1O5AB 3TK6A 3HGPA 2EI7A 1FONA 2ZECA 4Y76A 2GMTC 1DUAA 1O35A 4ISOA 1YCPH 2ANMH 2G55A 2FEQH 3SNAA 4NFFA 2WYJA 3DD2H 2H5DA 3RXHA 3UNSA 1QBNA 2SFAA 1PQ7A 4A1VA 2ZU5A 2UUJB 2QY0B 1P0SH 3GCNA 5DO4H 1GHBF 2HNTC 3KQCA 3M3TA 5A0CA 3RXEA 1Y5UT 1IQHA 3BSQA 1NT1A 1SLVB 4ABIA 4X8TH 3SV9A 1AMHA 1F2SE 1A0LA 1A5HA 3P95A 1TBRH 3ZVGA 3QTVH 3ZZ7A 1ORFA 4U2WA 4DJZB 3TNSA 4UDWH 4QT8C 1YPEH 4CRDA 1GJDB 2XCNA 2BQWB 2C4FH 3VXFH 4K60A 1V2RT 5AF9H 1H4WA 1RXPA 3A82A 3NXPA 1MTWA 5JB9S 1C9PA 2BLVA 5DGJA 3RXAA 1TGTA 4ABAA 1HAVB 1YCPK 2BD8A 2I6SA 3TH4H 5I25A 1C1VH 2OP9A 4AB8A 1WYKA 2J9NA 4WH8A 1GHAF 2JKHA 1MQ6A 3LGTA 4O97A 1DXWA 1ELEE 2BD5A 1O3HA 5FX6A 1DUEA 1QRZA 1CVWH 2PW8H 3TJUA 1C9TA 4HTCH 2WUBA 2QA9E 7KMEH 3E0NB 1RIWB 3ZZCA 5AVDA 3RMNH 1BHXB 3MH4A 2QIQA 1GPZA 2FI4E 1SOZA 2CHAB 4MNWA 3VPKA 3N7OA 1W0YH 3DFJA 4MG3A 5CMXH 3RLYH 5E0GA 4K69A 5EQQA 4BAKB 2ODQA 2FTLE 4GPGA 2H9HA 2A4OA 1O2HA 2GZ9A 1CGJE 1G3BA 1G3CA 3GDUA 1DS2E 1GCDA 1BZXE 3GY5A 2ZGCA 3MU8A 2C8YB 1HDTH 1WQSA 3NUMA 3F9FA 3MHWU 2OCVB 5HM2A 4GAWA 3MU4A 4ZKSU 4YESB 1Q3XA 3RXQA 1GI2A 4GCHG 5JPMH 1O3IA 1XVMA 2F9OA 4I8HA 1ZHPA 3M3VA 5F8ZA 3ZZDA 3B23B 4KP0A 4I8KA 4KTUA 1C2LA 2TRMA 1QL9A 3CP7A 1QBVH 2BLWA 5E2OA 2XWBI 3VB5A 2ZFFH 4I31A 1HAXB 4X0WU 4ZMAH 4JMYA 1NROH 2VIQA 1QGFA 2GP9B 4H42U 2FYQA 3BTEE 1EAUA 1OP2A 3TITA 3MH7A 4AGKA 1O3EA 2BTCE 5C5NA 4FUEA 1YPGH 2SGFE 3A7YA 5EPNA 2PUXB 1XUKA 4IBLH 2BMGB 5BPEA 1O2XA 1LMWB 1SPJA 3ZZ9A 2BXTH 4UFGH 1C2JA 8GCHG 4UEHH 1MTVA 2G8TA 1LVYA 2WPMS 4NIVA 2VNTA 2OUAA 1O2QA 1BIOA 1W2KH 2BX4A 1E37B 1YCPM 3PLPA 2P3UB 3PTNA 1PQ8A 1C4U2 4NIXA 4BAQB 1C5RA 1ZRKA 1A46H 1O5GH 3NKKA 5DKMA 2ZTZA 2BY9X 4X1PU 4Q2KA 2FPZA 4I7YH 1NS3A 1ESTA 1K1LA 3P70B 1BMAA 2GD4B 1S0QA 1H9HE 1TGBA 3LIWA 5HYOA 2ZZUH 1NFWA 1AFQC 1NU7B 2Q6DA 1W10U 3GY2A 1F0UA 2OC8A 1GI6A 1PPBH 3ODFA 4YOIA 1B5GH 2WPHS 1Z8RA 1HCGA 4I33A 1G36A 1DSUA 1RGQA 2BLOA 3BEIB 1XUJA 5FCKA 4X1SU 1LHGH 3GCTG 5BRRE 2HPPH 1O2WA 4NSVA 5T6FA 4H6SB 1AUTC 1DVAH 3F9EA 3TNTA 4ZXXH 1O3GA 1QJ6B 4TWYA 4IS5A 3RXFA 3V7TA 3RXTA 1TGCA 1UTMA 3LGUA 3EQ0H 1GI0A 2FOAA 3MU0A 4BXSA 4CREA 2BDAA 4CHAC 1GMHF 1JWTA 4FVDA 4WXVA 1GDUA 1C5NH 4D8NA 1TQ7B 2ZDVH 3BEUA 1GHWH 1HYLA 1GBFA 3DFLA 1MKXH 3M5OA 5JBCS 1MU6B 1IQEA 1SGRE 2ZCKP 1B7XB 1FY1A 2ALPA 1O2PA 2I6QA 3M36A 1JMOH 2JH0D 1ZRBA 2SNWA 3RXGA 1A5GH 1CT4E 1LPKB 1KXDA 2Y82A 2GGVB 4IMQA 4ZUHA 1C1WH 4KKDA 1D4PB 1O5CB 1DT2A 2ZU1A 3TJOA 3UR9A 3A80A 4YOGA 4AFZA 1P2OA 5CHAB 1MTNC 3CS7A 2XRCA 1TGSZ 1S6FA 4GUXA 1C2GA 4UE7H 3ZZ6A 1QL7A 4J1YA 2XYAA 4A1TA 1TGNA 1MZAA 2BVXH 1XUIA 1UTOA 1HAOH 1KLIH 1D3TB 2R9PA 1GHZA 2Y5HA 1P12E 1A2CH 2BY5X 2GCTC 2QXGA 4A1XA 1EB1H 1GI1A 9ESTA 1ELBA 4SGAE 4X2VA 2H9EH 3MNSA 3R0FA 2FI3E 1MKWK 4H6TA 1WUNH 4X8UH 3SORA 1SGCA 1ZHMA 1P9SA 1GBEA 4B74A 1RJXB 3SQHE 3ZVCA 1UK4A 3GCTF 2A4RA 4FVBA 2M5TA 2AGGX 2GVFA 5EG4A 1GBJA 1QL8A 5HGGA 3RU4D 1HAVA 1QY6A 3OU0A 2IJOB 4BNRA 1SHHB 2ZDKA 1SQAA 2HALA 1OWKA 2CHAC 5ABWA 1DX5M 4BTUB 4CRFA 1AWHB 2BB4A 3AAVA 3RC6A 4ISHH 4OS7A 4B2AA 1O3OA 3SJKA 1MAXA 1TABE 3RC4A 5LPEA 1O2UA 1WQVH 4Y0ZE 3ATMA 4ABGA 4YLQH 4Z6AH 2PSXA 1Y59T 3MI4A 1BUIA 2Z9LA 3GYLB 1UJ1A 7GCHG 1CGIE 3KN2A 4K1EA 1V2QT 1ANEA 3E90B 2QC2A 3QZQA 1EPTC 3QGJA 1TPSA 4A7IB 3MH6A 3ZVAA 3TLOA 1ZPZA 2HNTF 1GG6C 1GJ5H 2G81E 1DWEH 3KEEA 3M3SA 4CBOA 1GGDB 1MQ5A 4YT6H 7LPRA 3D23A 1NC6A 3VB7A 2Q6FA 1A4WH 1O2JA 2ALVA 1ZJDA 4KTCA 2GT8A 1JBUH 2J38A 1QNJA 3IWMA 2ZFQH 3MYWA 1CU1A 1KYNA 1LDTT 3SU0A 3K9XB 3A7WA 3LDXH 3DUXH 2R3UA 1EOLA 3D49H 2H9TH 1FAKH 4E7RG 3GY3A 5HXFA 4LZ1H 1GVLA 1E34B 4KTSA 1LPGB 1HGTH 1EASA 4FUBA 1FNIA 1YLCA 3M7QA 4AYYB 6ESTA 1ZPCA 4D9RA 2RA0A 5FBIA 3SZNA 1VITH 1NRRH 3O8DA 1D6RA 1C2EA 1HAZB 2P93A 1KTTB 1ZYOA 2BOHB 2G4TA 5GDSH 1J9CH 5EU8A 1N6XA 3BTQE 4O9VA 4CRBA 2G4UA 1V2UT 1BTZA 1FPHH 3SJ8A