1MBMA

Nsp4 proteinase from equine arteritis virus
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
198
structure length
198
Chain Sequence
b'KARGNVGFVAGSSYGTGSVWTRNNEVVVLTASHVVGRANMATLKIGDAMLTLTFKKNGDFAEAVTTQSELPGNWPQLHFAQPTTGPASWCTATGDEEGLLSGEVCLAWTTSGDSGSAVVQGDAVVGVHTGSNTSGVAYVTTPSGKLLGADTVTLSSLSKHFTGPLTSIPKDIPDNIIADVDAVPRSLAMLIDGLSNRE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords chymotrypsin-like serine protease
molecule tags Transferase
source organism Equine arteritis virus
publication title Structure of Arterivirus nsp4: the smallest chymotrypsin-like proteinase with an alpha/beta C-terminal extension and alternate conformations of the oxyanion hole
pubmed doi rcsb
total genus 43
structure length 198
sequence length 198
chains with identical sequence B, C, D
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2002-08-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1mbmA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1mbmA02
3.30.40.20 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Chymotrypsin-like serine protease; domain 3 1mbmA03
2O9QA 1VCQA 2PKSC 2PSXA 5FPYA 4CRBA 3ODFA 2FOAA 3RXGA 4H6SB 4XBDA 1F0UA 2EI7A 3QLPH 2STAE 1MTWA 2GX4A 1PPGE 1O3OA 2AS9A 2GT8A 1HJ9A 2WPKS 2BVRH 3P70B 3RXSA 1SHHB 1NO9H 1AB9C 1AFQB 1KXEA 4D8NA 1O3KA 3A7WA 2ZFRH 1AFEH 1V2KT 2ZU5A 1AQ7A 3KF2A 5LPRA 1TGBA 1TBQH 4FVDA 4KKDA 1HBTH 3RXLA 1HAGE 5DP4A 3U69H 4AOQA 3M7TA 1C5ZB 4Y0ZE 2OBOA 1AKSA 3O8CA 5AFZH 1FDPA 1DX5M 1T8OA 1S85A 1NRSH 2GDDA 1MTUA 1AN1E 3EGKH 1GBCA 5AFYH 1V2VT 3LU9B 4YO9A 1N6YA 4AORA 1GBMA 1B0FA 1MAYA 2V3OH 3S69A 3MH7A 2RCEA 5LPFA 1O37A 1L1JA 4ZKRU 1GJ4H 5DG6A 2F9NA 4K69A 1O2XA 2CHAC 1BTYA 2CGAA 2V3HH 3RMOH 3TGJE 3K65B 1DXPA 1GJ9B 3SQEE 2O8MA 3VXEH 3LGIA 1W11U 1YYY1 1HXEH 4IS5A 1W3CA 3ZZ7A 4AB9A 1GJ6A 3MMGA 3RXRA 2Z3DA 2HNTE 1ZSKA 1J15A 1VJ9U 2D26C 1XUIA 1UVPA 2FOCA 1AVGH 4Y71A 4RSPA 5E0HA 1EOJA 4IMQA 2H9HA 3U9AH 1ESBA 4CBNA 2WPLS 4TYDA 4Q80A 1ZJDA 1HJAB 4OS5A 1WSSH 2NU2E 1Z1IA 2WINI 1CT2E 1AGJA 1ZGIA 2WYGA 1QNJA 2XNIA 7GCHF 4KP0A 1W2KH 3GYMA 2DE8A 1O3NA 1O2PA 5T6GA 4I8GA 1SPJA 1P09A 2WPHS 2BOHB 4K1SA 2BD3A 4XOJA 3ENSB 2ZO3H 1AD8H 1HYLA 1A0LA 1UVOA 3UQOA 2YNAA 2F9VA 2BMGB 5DP5A 1SL3A 3RC4A 1L0ZA 4B76A 3TK9A 1YM0A 2FTMA 1G3EA 1GMCF 2YNBA 2VIVA 2ZDMA 2IJOB 2QXIA 2Z6BD 1C5SA 1K1JA 1A5GH 4DIIH 3FP8E 5JB8S 3RXAA 2H5DA 2RG3A 1H9LB 4AFSA 4WMFA 4FUIA 3RP2A 2OUAA 1OP0A 1BMMH 1JWTA 1FNIA 4TY7A 3LJOA 1RS0A 4ISLA 1D3QB 1ANBA 1LKBA 1MBMA 3A80A 3KNXA 3Q3XA 1EPTB 3MHWU 2VB0A 1CT0E 1THSH 3ODDA 6LPRA 1SBWA 2FOHA 1J14A 3FVFB 5C5NA 2QY0B 3K2UA 4OS4A 1K2I1 2KAIA 4WMEA 2STBE 2BVSH 1TOMH 4K60A 1UTNA 4ABBA 1AVWA 1ETSH 3PYHA 3HKIB 4PROA 1GCTC 1P9UA 4UFDH 4YESB 2VIWA 3ZZBA 4NZQA 4UEHH 2FZZA 8KME2 4NSVA 1UTQA 1NFWA 1SGIB 4LZ4B 3SU5A 1LHDH 4IGDA 1PQAA 4TWYA 3ZYEA 1NRNH 3A81A 1NU7B 1L4DA 1DSUA 1YCPK 1LVYA 1GJCB 1NS3A 2C3SA 5I46H 1CU1A 1SGFG 2XXLA 2AFQB 1AI8H 1C1SA 2G5NA 3UQVA 1EATA 3A7YA 2P93A 1C2LA 1O30A 1ZRBA 3F1SB 6GCHF 4DG4A 1A46H 4B71A 2UWOA 1P3CA 1NROH 1C2DA 2ZNKH 4OGYA 3SUDA 3PTBA 1SSXA 4YOIA 3GY2A 1TA2A 3SV6A 2HWLB 4O97A 2B8OH 1ZYOA 3M7QA 1ELGA 2CF8H 2P3UB 2VIQA 3RXHA 1QBNA 2V0BA 2PSYA 1O39A 2F3CE 2BM2A 4DGJA 4TWWA 3QX5H 1FZZA 1TABE 5J4QA 2Y81A 1BQYA 3V3MA 2VGCC 3SJOA 2WYJA 3BTDE 2GMTB 4CHAB 2NU4E 3P6ZB 5EQQA 3A8CA 2XBVA 3BEIB 4DIHH 1T8LA 3RU4T 1AUTC 2Q6DA 2YOLA 5L2YH 2D1JA 4FUHA 1HUTH 4CR9A 3F9FA 1YPLH 3PLKA 3GCTG 5F8XA 3SJIA 4I8HA 1TNGA 1ZLRA 1HGTH 4A6LA 2PUQH 3FP7E 3I78A 4E7RG 1O31A 1SI5H 1ZTKA 1O36A 2Y6TA 1TNIA 2C90B 1KDQA 2WUCA 3AW0A 1GBHA 1O2KA 3DUXH 4LXBH 3TU7H 4YT6H 2ZHEH 2NU0E 1K1LA 1QHRB 3RLWH 3SGAE 1GL1A 3BN9A 2P3FH 3TJNA 2O8WA 1W8BH 1W10U 2SNWA 1P05A 3A84A 1TX7A 3MNBA 1Z1JA 1DSTA 5T6FA 4CH8B 2XC5A 2C8ZB 3L6PA 1DT2A 6ESTA 4HTCH 1LDTT 3PO1C 4YT7H 1CSOE 2ZHWH 3KIDU 2ALPA 3D65E 2VVUA 4I8JA 3ZZDA 2FYRA 4ZHAA 4DY7B 1WYKA 2BDHA 1HAZB 3BEFB 3UUZA 4DOQA 1K1OA 3A7TA 2QYIA 1C1WH 5DPAA 3DD2H 4XFQA 1C5WB 3UWIA 5C67A 1TX8A 2FLRH 2ZCHP 2A7HA 1G3CA 1IQIA 5JDUB 1YC0A 1GBKA 2EC9H 3K6YA 3LH1A 2BLOA 2RA3A 5E2PA 5CE1A 4R8TB 1C1TA 5HXFA 4FU8A 1SLUB 4IN1A 2VH6A 1T4UH 5JB9S 2GVFA 2ZEBA 1GHVH 2G81E 3CENA 2FIRH 3UTUH 1QCPA 3LKWA 1UK4A 1CT4E 1A61H 1HAHH 1AE8H 4U30A 1GJBB 3ZVEA 1BOQA 1FUJA 3EAJA 4JZDH 3SHCH 2J94A 3RXCA 3D23A 4H6TA 4MPWA 4GUXA 3NUMA 1EAIA 1VCPA 1BBRH 1O3IA 1PPEE 2G51A 1KTSB 3A7ZA 3PTNA 2AEIH 1QRZA 2J92A 3EA9A 1SGPE 2VIOA 4NIYA 3JZ1B 5CHAC 1XMNB 1ZJKA 1TQ7B 5DGJA 2HPQH 3ZZ3A 1KXDA 1BTUA 1FN6A 1FAXA 3ATLA 1AMHA 3BTTE 3R0FA 4R0IA 3U8TH 4AX9H 1PPBH 4LOYH 4X8TH 3UPEA 1EQ9A 1AIXH 1S0QA 3GY7A 1WOFA 1FY1A 1OP2A 3BTFE 3PLBA 4GAWA 2GT7A 3A7XA 4BXWA 4E05H 5E0GA 1FPHH 4KGAA 3UNSA 1CGJE 1BJUA 3PV4A 3ZVDA 5A0CA 5A8YA 3KEEA 5T6DA 2PUXB 1GHBF 1OKXA 5C1UA 2BD9A 3ZZCA 1QRWA 1C5OH 3M5MA 3E8LA 4E06H 2OD3B 3F68H 2GV6A 1P04A 1V2TT 2UUFB 5A0BA 1KDQB 3TLOA 3AASA 3F9HA 3GCHC 2M5TA 1IQKA 4WF8A 5GPIB 5EXNA 3BTQE 1V2WT 2TGDA 3A8AA 3LGWA 3T5FH 3LONA 3SBKA 1SQAA 5EW1H 1BHXB 1G37A 1DUEA 3RXKA 1ID5H 4U32A 1FIWA 1C1UH 2FI3E 4X8SH 1UTOA 1O3DA 2CJIA 2XW9A 3ZZ6A 3BEUA 4E7NA 3A82A 3SJKA 3URDA 1ELEE 1ZMJA 2BX3A 5DO4H 2Y80A 2PHBA 1BJVA 1MZAA 2FOGA 3NK8A 3PWCA 4LK4A 2BD2A 4BAOB 1TMUH 5AHGH 2PR3A 1CE5A 1EOLA 1F92A 3TITA 4BAHB 3EA7A 4X2YA 3A89A 3VGCC 1O5EH 2BD8A 2FDAA 2ODPA 3ATMA 4BTUB 1AWHB 1VITF 3BTGE 1D3TB 2ZFPH 1HAVA 4GCHG 1GI4A 3OY6U 2VGCB 3V0XA 4MLFB 4AFZA 1UK2A 2VNTA 1QB6A 5TJXA 2FMJA 4D7FA 5HYOA 2AIPA 2W3KA 4J1YA 1QA0A 1C5PA 3GCHB 1RGQA 2K1QA 3FAOA 3MO9A 1KXFA 2EI8A 3SGBE 2Q1JA 2QXGA 2VVCA 3D49H 2Z9IA 3TNTA 2CXVA 2FPZA 4MG3A 1SR5C 5F03A 1F0TA 2FX4A 1PQ8A 7KMEH 3HGPA 3SI3H 2CHAB 3A83A 1DICA 2AMDA 3ZV8A 3ATWA 4UONA 2H2ZA 4K8YA 2UUYA 3E3TA 2DUCA 1EAXA 4U2WA 3SW2B 1IQJA 3E16B 9ESTA 1S81A 4XBBA 1QQ4A 1ELAA 3RXBA 2FOFA 1EASA 4Y6DA 2Y5HA 2SGQE 4HZHA 1FQ3A 2ZCKP 5DP9A 2PV9B 1A1RA 3GY6A 3Q77A 2PGQB 1S6HA 4D9RA 1P11E 2BDAA 3VGCB 3FP6E 4BTTB 1CA0C 2ZZUH 4BTIB 4Z6AH 4CRDA 1E35B 1LVOA 1ABJH 1ETRH 4ASHA 3B23B 2FI5E 2ZU1A 1Y3XA 1O32A 2A5IA 1BMLA 3M61U 3M3TA 3LC3A 1RTKA 5L2ZH 1TGTA 1ZOMA 1SGFA 4CH2B 4UFFH 4AGJA 1TNLA 5IDKA 1GI9B 1QA7A 1LTOA 1DY9A 2QXHA 4JK6A 3QZRA 1A4WH 2H9EH 1O5FH 1PPZA 8GCHF 1ETTH 1GHXH 1UTJA 3U98H 3HK6B 2QXJA 1AHTH 1XX9A 1K1NA 1SGEE 1O2LA 3SOSA 1D3DB 2FLBH 3NKKA 3FZDA 1O5GH 1K28D 5EXLA 3ZZAA 2P8OB 1HNEE 3OY5U 1FI8A 1UCYK 2BD7A 1LVBA 3AAUA 1FY3A 1X7AC 4FUFA 1D6RA 5E0JA 1HAVB 1C5RA 4X2VA 1OSSA 4IMZA 2VH0A 4OS2A 4B2AA 3RXDA 2BYAX 1GBEA 1FPCH 1P2QA 2GZ8A 3DA9B 2BY5X 1O5CB 5E2OA 4Y10E 4Y79A 4OS7A 1MBQA 1O3PB 1IQNA 4QT8C 1P2JA 3M37A 5T3HA 1C2KA 1RD3B 2ZU3A 2W7SA 1DVAH 3M35A 4BNRA 2I6QA 1ARCA 2R3YA 4VGCB 1N1LA 1ZTJA 1OWEA 3SU0A 2PKSB 3SU3A 3SNEA 5A8ZA 4ZKOU 4WWYA 1HIAA 1C4U2 1IQMA 2AYWA 1XKBC 2XC4A 3GISB 1O2MA 1GJDB 2VJ1A 4NWLA 1MZDA 1QIXB 1VGCB 1QL7A 1A7SA 1ORFA 2ZKSA 1XUFA 1OPHB 2ZC9H 1FY4A 3UNRA 2Z3EA 2PFEA 5ETXA 9LPRA 1O0DH 2NU1E 3UY9A 2XC0A 1E36B 1IQGA 1O5BB 2J38A 3HATH 3LGUA 5E8EH 5FBEA 1CQQA 3UNQA 5GIBA 3ZYDA 4X8VH 1FAKH 2XBXA 2G5VA 1W0YH 3RXVA 4I32A 1Y59T 5DP6A 3RXOA 2WV4A 3PMBB 4O9VA 3MU5A 1J9CH 3T29A 5FAHA 5JYIA 3F6UH 2ZGXH 4Y7BA 1EZSC 2P8OC 4BAMB 1V2OT 2ZU4A 4MNXA 3SU4A 4DURA 1ZZZA 4XDEA 4X8UH 1KYNA 1DWEH 2ZHFH 3KGPA 1WBGB 1GI7B 4YZUA 2ILNA 3GCOA 2J95A 1T31A 1TE0A 4INKA 3ESTA 4KELA 4ABFA 1MD7A 1O2GH 1P0SH 3HGNA 4DT7B 4CBOA 2Y7XA 1GBIA 1UTPA 1P03A 4D7GA 5AVDA 2IPHA 1K1IA 3V13A 1O3AA 3SV7A 1NRPH 1L4ZA 1BBRK 1YBWA 1DWDH 2XBWA 3MOCA 1TWXB 1EXFA 4VGCC 2ZDLA 2QCYA 5J4SA 1EB1H 1QJ7B 1C2FA 1GBTA 1AWFH 3SUGA 1C5LH 1TPSA 4X0WU 5A09A 1HRTH 1O33A 2UWLA 3A88A 2QV1A 1J17T 3Q3YA 2Z9GA 3PWBA 5BPEA 4KTCA 3RUOA 3SJ9A 3E1XB 4AZ2B 3MFJA 5TCAA 5AF9H 5EODA 3RM2H 1F5LA 2F91A 3BG4B 1HJAC 4MVNA 3MU1A 5L6NH 4WH8A 1C1QA 4MNVA 1BUIA 1Z6JH 1RFNA 4NFEA 2XCFA 1PQ7A 2BTCE 1CVWH 2GCTB 2AERH 3RC5A 1KLIH 3GICB 3RXIA 3T25A 4K1TA 3RLYH 1G2LA 3SUEA 4BOHA 4YTAA 1TMBH 2ANKH 1EKBB 2SGAA 2ZA5A 8GCHG 5HGGA 4IC5A 4DJZB 2ZG0H 5JBAS 3SV2H 4O3UA 4ZH8A 1V2QT 1OYTH 2EEKA 4INHA 4B2BA 2ZGHA 2P16A 1YCPH 1AVXA 1Z8JB 2SGDE 3KHVA 2NWNA 4K3JA 1G30B 4XSKU 3SZNA 3BTEE 4GPGA 3ZZ9A 1P9SA 2H1UA 1IQFA 3A8BA 1W12U 2BX4A 2OINA 2BZ6H 1BTPA 4WY3A 1FONA 1YGCH 1OWHA 1QURH 1BHXF 4Y0YE 5FX6A 3RXTA 1KXCA 1BRCE 1CBWB 2PWXA 3ATKA 1LQDB 3VB5A 1O5AB 1BCUH 4NZLA 4ZXXH 1FV9A 1HXFH 2VINA 1QR3E 3L3TA 1GMCG 1BZXE 4F4OC 3Q00A 1G2MA 1O3CA 1YPKH 1MTNC 1OS8A 3P8NA 1Y5BT 4Y8YA 1C2EA 2NU3E 1MQ5A 1KY9A 1QJ1B 1PYTD 1QB9A 1ELFA 1GJ5H 4MPXA 3TJUA 1P12E 8LPRA 2GKVE 3GY5A 1BITA 4JZFH 2C4FH 4CR5A 5JBBS 5JBTA 3M7UA 5ESTE 2H5CA 3TIUA 1YLCA 2G4UA 2QC2A 2W7UA 1HAPH 4Q7YA 4B2CA 4MNWA 1SB1H 1O2JA 3SV9A 1CHOG 1V3XA 1QB1A 4NG9H 1SFIA 2IOTA 1GVZA 5SGAE 3E0NB 2A31A 1K22H 4NA8A 3P17H 2GTBA 3UWJH 3G01A 1IQHA 1GGDC 1UHBB 2THFB 3MH4A 4WH6A 2G4TA 2WV5A 4Q2KA 1LVMA 2BVXH 2B7DH 2PTNA 1CHGA 1F2SE 4X1RU 4NSYA 2A7JA 1ANCA 4ZROA 3LIWA 4AG1A 2FEQH 1GJAB 3V7TA 1HV7A 3TH4H 4K5ZA 1ELBA 2J2UA 4FU7A 2GGVB 3HKJB 5DP3A 1FLEE 2EA3A 4AGKA 5CMXH 4FUJA 3DFJA 5FPSA 3TGKE 3E0PB 2FXRA 1K21H 4YOGA 3S0NA 2V35A 3O8BA 1NM6A 1SQTA 1ZPCA 3MU0A 2A32A 2FX6A 4MPUA 4AB8A 5EQSA 3OU0A 1P2MA 5EG4A 2BB4A 1TNKA 2PW8H 3M36A 2XTTB 3TGIE 1MD8A 3KL6A 3PO1B 3S7KB 1O38A 5EXMA 2LNCA 1NT1A 3Q3KA 2WUBA 3MO3A 1RIWC 3MU4A 1H9IE 2GMTC 2SNVA 2TGPZ 3DT0H 3SUFA 1YPEH 2W3IA 1UCYE 4HI3A 4AN7A 1PYTC 4FUGA 1QBVH 1KXBA 3BV9B 1HCGA 5FX5A 4B73A 1UO6A 1A3BH 3HPTB 3SNDA 4J2YB 1JRTA 2R3UA 4X6NA 3A87A 1GHZA 3RMLH 1GHWH 3LJJA 2WPIS 4WJG2 1QFKH 4UFEH 1XVMA 1EZQA 3SU6A 1PJPA 3M5NA 4KTSA 2PLXA 1NZQH 4CRFA 1WQVH 1SLWB 2A4RA 2QA9E 2AGEX 1V2NT 1GVKB 3SV8A 1WCZA 4I33A 1Y3VA 2IN2A 3RC6A 1WAYB 1UCYH 1SGNE 1PFXC 1JIMA 3RXPA 2VWOA 3ZZ8A 1YPGH 3HK3B 2A0QB 1YF4A 1GI8B 1S83A 3GCTF 5JPMH 1MKXH 1V2RT 2W26A 4MQAA 4B1TA 2BDCA 3A8DA 1EJNA 1TPPA 4RKOB 4FU9A 3ZZ5A 1V6DA 5FCRA 1OWDA 2ZP0H 1O2UA 1LCYA 3B9FH 2XCNA 4A92A 1O34A 4NA7A 3RXFA 2HPPH 5EPYA 1M9UA 2JETC 1EUFA 1JOUB 2BDBA 3QUMP 2XBYA 4GLYA 1AZZA 1TRNA 4ABIA 3RU4E 2F9BH 3TJOA 1O2IA 1AKSB 4ISIH 2P3TB 1BTHH 1GG6C 3QK1A 2KAIB 2XWBI 1E38B 1MMJN 4H42U 5DP8A 1GL0E 1TA6A 3GY8A 4CHAC 3U1JB 1INCA 1YKTA 1D9IA 3A85A 1P2OA 3WY8A 4ZKNU 1O3JA 3MH5A 3PM3A 1Y3UA 1F7ZA 3I29A 4ABDA 2JH6D 1ELCA 1H8IH 1HB0B 1EX3A 1NN6A 3STIA 1RIWB 1RXPA 1YPJH 1UVTH 1XKAC 2BXTH 2P95A 1C5VA 4BXSA 2O8UA 1SGQE 1XUGA 1Z71A 2ZGJA 5FXLA 3W94A 3EE0B 6CHAC 3QWCH 4ABAA 2AGGX 4FUBA 1ZGVA 2HRVA 1ZMNA 3M5LA 5A0AE 1ZSJA 5LGOA 3SNAA 3S9CA 2ZPSA 3VB7A 2GCHG 1GBLA 1EZXC 1NU9A 3E91A 4CRAA 4INLA 2DE9A 1KIGH 3RM0H 1QL9A 1TPAE 2OTVA 3TK5A 1BT7A 4B75A 1BBRE 2R0LA 3B8JA 4WMDA 1TIOA 1NESE 4ZAEA 3MNSA 3TNSA 1G9IE 5C3NA 1IOEA 2J9NA 3ZZ4A 1OWIA 1O2SA 2UWPA 2XWAA 1DANH 1TB6H 1YCPM 1ZHPA 3BTHE 3NPSA 3RMNH 4JZ1A 1O3BA 4YM9A 3BTKE 2F9PA 1V2UT 3GY4A 1TBZH 1SFQB 1EB2A 1O2RA 2BLVA 1IAUA 1HPGA 1MAXA 2ESTE 1K1PA 1GJ7B 2F9UA 3T28A 2ULLA 2W5EA 4X1NU 1SQOA 7ESTE 4UE7H 4FUDA 1D6WA 1K1MA 1TYNA 4Y76A 3LPRA 3T27A 1NFXA 3EA8A 1CGHA 1FJSA 1H8DH 1T8NA 2R2MB 2ANYA 2A4OA 2TGAA 4K8BA 3SORA 2HVXA 3LC5A 3VPKA 1SGTA 1TBRH 2A5KA 4ABEA 2TIOA 5JBCS 4TY6A 1GHBG 1JMOH 5I25A 1NFYA 4AG2A 1DE7H 1VGCC 4RKJB 2ALVA 4JYUH 5GDSH 2BQWB 3GOVB 3LOXA 1IHTH 4SGBE 3GDUA 1EPTA 4ABHA 1J16A 1FN8A 3SI4H 4NGAH 1C5QA 1ELTA 1MTVA 4CREA 4LZ1H 2A5AA 3OTJE 3TK6A 1L1NA 1JIRA 3VB6A 3VFEA 1A2CH 1PPFE 4FXGH 2G8TA 7GCHG 1OWKA 1G3BA 1F0SA 4ESTE 1UTMA 1IHSH 2ZTXA 5C2ZA 1C2HA 2PGBB 3QN7A 1O2TA 1FIZA 1GI6A 3W95A 1HFDA 1AUJA 1FXYA 1PQ5A 2I6SA 4JK5A 4FVBA 1CA0B 1AU8A 1BRAA 4CRCA 1EAUA 2ANWA 1LPKB 2SGEE 2VIPA 3E90B 1C5MD 1W13U 1UVSH 2ZHDA 1UMAH 1SOZA 2ZFQH 4MDSA 2JH0D 1D3PB 1P2NA 4YLUA 1P8VC 1HAXB 1VITG 3SJ8A 1XXFA 1SC8U 1DM4B 1DWBH 2WPJS 3M3SA 3SO3A 1UTLM 3TVJB 1JRSA 1EJAA 1PPHE 4X1QU 1O3GA 2BDYA 2VWMA 3H7TA 5EQRA 1MUEB 2J4IA 1KLJH 2BY7X 1NPMA 2BDGA 4GHQA 3K6ZA 1TX6A 5EGMA 1Y5AT 3O8DA 1AY6H 1VR1H 1AB9B 1V2PT 3CS0A 3TH3H 2HNTF 1W14U 4K1EA 3H7OA 3V12A 1N6XA 2ZIQH 3PMJA 4JCNA 2Z9KA 1TGCA 2R0KA 3AAVA 4Q7ZA 2BLQA 1ARBA 2GZ7A 2HOBA 2OBQA 1H4WA 1SVPA 1W0ZU 4NWKA 5FBIA 1YPHC 2GZ9A 8ESTE 2O8TA 1MH0A 1BTZA 4OGXA 2EI6A 4ZMAH 1SOTA 2FODA 4BAKB 1C2GA 2ODYB 2GD4B 4X2WA 4GCHF 4ZUHA 3UR9A 1DOJA 1TQ0B 4I8KA 1QGFA 3UOUA 2WPMS 2OC7A 3M5OA 2A45B 3SQHE 4IW4E 1TNJA 3AVZA 3LH3A 2ZQ2A 2G52A 3KCGH 4WVPE 3S7HB 2CN0H 2HLCA 1QY6A 3SN8A 4IC6A 5PTPA 1QQUA 4ZKSU 4DCDA 2BY8X 2FYQA 1AO5A 3RXQA 1B7XB 4CRGA 1L2EA 1GBAA 4XBCA 4NCYA 3QZQA 1VJAU 2OCVB 2Z9JA 3MNXA 2ZDAH 4H4FA 2BY9X 4I8LA 1O5DH 3N7OA 3SU2A 1GBFA 1C1RA 1C1MA 3QGNB 2QN5T 1DITH 3ZVFA 3ZVCA 5HM9A 3S9BA 1UK3A 1UVUH 1BMAA 1BIOA 4OS6A 1G3DA 2VWNA 1C4V2 1A0JA 1E37B 2ZTZA 1P2KA 2OQUA 3ELAH 1KSNA 1GGDB 1F5KU 1ABIH 4A5TS 3MH6A 1SGCA 4ISNA 1YP9A 4A7IB 1U6QA 1VITH 2AMQA 1Y5UT 2BLWA 1RTFB 1HLTH 3KQDA 2UUJB 1C9TA 3D62A 1L1GA 3MU8A 1AFQC 4UFGH 2PTCE 6GCHG 1CHOF 1FY5A 1BTXA 1ZHRA 2Y5GA 1T7CA 2ZDNA 3MYWA 2P59A 3UFAA 2FS9A 1OYQA 3UOPA 2JKHA 1C4Y2 1TPOA 2Y5FA 2VVVA 2XYAA 1IQEA 2A7CA 1C1PA 1ZTLA 2OQ5A 1Z7KA 3AW1A 3DFLA 1C5YB 2B0FA 3KN2A 3L33A 4JMYA 1NRRH 5G4BA 4O3TA 3UR6A 5HMAA 1MQ6A 3UIRA 4XE4A 1DLEA 1DPOA 1GCTB 5EW2H 4MPVA 1ANDA 5HM2A 1UTKA 2Q6GA 1FMGA 2CMYA 4M7GA 2FM2A 3F9GA 1SGRE 3P8FA 2BOKA 3P8GA 2TBSA 1QTFA 1HIAB 1GMHF 1OP8A 3R3GB 4DW2U 1MKWK 5ESBA 4X2XA 2PKAA 2C8WB 3IG6B 1CGIE 3BG4C 1E34B 1ZR0A 4MTBA 2XRCA 1LHCH 2BQ7B 1ZPBA 1GBJA 1VCWA 3U8RH 1SLXB 1AZ8A 5H4IB 1P57B 1S0RA 1GWAA 1W7GH 2FO9A 2BQ6B 2ASUB 4ISHH 2A2QH 3C1KA 3S9AA 3RU4D 1SMFE 1NRQH 2Y7ZA 3T2NA 1T8MA 2OC1A 1GI0A 1THRH 1LO6A 1CBWC 1TONA 2BY6X 1ESAA 2JH5D 1N8OB 1NFUA 3EYDA 2RA0A 1XUHA 3RMMH 1THPB 2ZPQA 3P92A 3STJA 1LMWB 1ZHMA 1JBUH 1QRXA 4GSOA 2A4QA 1OOKB 1SG8B 4D9QA 4ABJA 1C5TA 4Y11E 3K9XB 4IBLH 1C2MA 3PMHB 1T4VH 3LT3A 2GCTC 2CV3A 1T32A 4DVAU 3U1IB 1XM1A 1QL8A 3ATIA 3OSYA 1VZQH 4HGCA 2VU8E 2G55A 2GDEH 1RRKA 2B5TB 4ISOA 5DP7A 3RXEA 1Q2WA 1LPGB 1V2LT 4B74A 1QBOA 4Y7AA 1TNHA 2FI4E 2ZDVH 2OC0A 3QO6A 3CP7A 2HGTH 1Q31A 1DFPA 1Y3YA 2H9TH 4AYVB 4ZHLU 4BANB 2ZGBH 2Z9LA 1OWJA 4FUEA 4GVUA 1K9OE 2ZHQH 1GI2A 1NY22 3P8OA 2C93B 1EPTC 4U01A 1A3EH 1Z8GA 1B5GH 2ZPRA 1H1BA 5L30H 3VB4A 2C8YB 2O8LA 3IITA 1B0EA 1KXAA 4X6OA 3TJVA 1DDJA 2FOEA 2GV7A 1ESTA 4RN6A 2ZCLP 2FS8A 2FOMB 4MNYA 2GCHF 3LGYA 2OXSA 2F9OA 2G00A 4IN2A 3M3VA 2JETB 1TRMA 3JZ2B 2UUKB 2VWLA 1EP5A 2BXUH 3SU1A 3OYPA 3ZV9A 3ZVBA 1S82A 2GP9B 1O3EA 1W7XH 4NIXA 4A1XA 1Z8RA 2AH4X 1V2JT 1WQSA 1WV7H 4YOJA 3TPIZ 1GI3A 3A86A 2TPIZ 3VB3A 2AGIX 3U8OH 1GMHG 4WXIA 1EP6A 2HNTC 1C1OA 1SHYA 1BA8B 1O3MA 2Z94A 3F9EA 3URCA 1TFXA 4I7YH 5GJ4B 1TMTH 3Q76A 3UREA 1N8OC 3H5CB 1DXWA 1C1VH 5C1YA 1O2VA 1GMDG 1WU1A 1LKAA 4Y8ZA 1BRUP 3NWUA 1MU6B 1WTGH 3CS7A 1DLKB 2ZGCA 2ZU2A 4NFFA 1ZPZA 1XUKA 1P06A 1ZRKA 3NXPA 4JZIA 1GHYH 1EZUC 5EPNA 3BF6H 3RXJA 5DJ7A 3BG8A 5GCHF 1C5XB 1C5NH 1JXPA 1Q3XA 4HFPB 2QF0A 5K0HA 3NCLA 1ZSLA 1DUAA 1MKWH 2ZECA 2B9LA 3OX7U 1CO7E 3ZVGA 3MWIU 4ABGA 3BSQA 1A5IA 1MU8B 2V6NA 1G32B 5CHAB 3RDZA 1ELDE 3SGQE 1O2YA 5GWZA 2D8WA 3EDXB 1NC6A 2FOBA 5FCKA 1GBDA 2ZI2H 2AMPA 2FTLE 3PMAB 1A0HB 1D4PB 1P2IA 1UHBA 2QIQA 4TPYA 1E0FD 1C5UA 3QTOH 2LPRA 3E6PH 1LHGH 3A7VA 1P10A 4X1SU 3ZVAA 1ANEA 1GPZA 3LGTA 1LHFH 3QDZB 4UD9H 1O35A 4Y8XA 2ODQA 1C2JA 1UJ1A 3KQEA 2ZFFH 2VIDA 3NZIA 1IQLA 2Q6FA 3SNCA 3MO6A 3BTME 3QGJA 3GY3A 4Z0KA 1GMDF 3FFGA 4OS1A 1V2MT 4JZEH 1GDNA 3KQBA 3TH2H 2ZF0H 3VXFH 1O2QA 1QJ6B 1F0RA 1HAYB 2HALA 1GG6B 5DKMA 1O3FA 1WUNH 5DK1A 2ZFSA 5TCCA 1Z6EA 2ANMH 1HJ8A 1MTNB 1SGYE 4UDWH 2SFAA 1S6FA 3MTYA 4ZHMU 2BZAA 4SGAE 1ACBE 4X6MA 5A8XA 2OP9A 1GHAG 1XUJA 5F8TA 3QTVH 2QGRA 5C1XA 4I31A 2PKAB 3IWMA 5BRRE 1TALA 1RJXB 4JYTA 3PLPA 4JYVH 1FY8E 3T26A 1P3EA 1CA8B 2TRMA 7LPRA 3ITIA 3I77A 1YPHE 5EOKA 5F6MA 1MCTA 3GYLB 4GHTA 5LPEA 5IYTA 1Y3WA 3LGVA 1TRYA 1O2WA 1MKXK 2AIQA 1LPZB 6CHAB 1DWCH 1P02A 1O2OA 1BMNH 3BTWE 4A1VA 5B6OA 4FUCA 5C20A 2D2DA 4D76A 2ZQ1A 3KQCA 4Q7XA 1C9PA 2F83A 1GDUA 2H6MA 1GJ8B 4F49A 4TPIZ 5FHTA 3DHKH 1EJMA 2RDLA 1BDAA 4WXVA 1G36A 2A1DB 1O2HA 3LDXH 1PPCE 1Y8TA 1WTHD 1OX1A 2OC8A 1GCDA 1LHEH 5F8ZA 1HAIH 1S5SA 3BIUH 3GDSA 2Z3CA 2R9PA 2R2WU 2ZWLH 4X6PA 1TLDA 3GCNA 4KTUA 1P01A 2J34A 4NIWA 5FPTA 1RTLA 1EAWA 1MTSA 5C5OA 4AYYB 1GBBA 1F5RA 4K2YA 1BRBE 1SLVB 1TOCB 2FWWA 1GVLA 3FANA 1TGNA 1Z8IB 1XVOA 1O3LA 1HDTH 2FP7B 2ZFTA 4ZXYH 2Y82A 3RXUA 2A2XH 1C1NA 1LQEA 5EU8A 1NTPA 3RXMA 3MI4A 3PB1E 3EQ0H 2OLGA 2C8XB 2QF3A 1BB0B 5A2MH 3FZZA 3SHAH 1HAOH 1GI1A 3GDVA 3VEQB 1BTWA 2SGPE 3P95A 1ZMLA 1OXGA 1MCVA 2Z7FE 5ABWA 4THNH 1O2ZA 2ZDKA 3MNCA 1TAWA 5LH8A 4AFUA 1XXDA 2SGFE 3C27B 1SGDE 3SNBA 5GCHG 1AE5A 1DS2E 1KTTB 1TGSZ 2BHGA 1J8AA 1KLTA 2ZTYA 1YLDA 4NIVA 1GI5A 2BD5A 3BIVH 4O03A 4YLQH 1S84A 4A1TA 1DY8A 2BD4A 1H9HE 1GHAF 1ELVA 1A5HA 3PROA 1YPMH 5K7RA 1O2NA 1O3HA 3O8RA 4AFQA 4X1PU 2A4GA 2FESH 3T62A 5GXPA 4NA9H 2QAAA 2TGTA 1GDQA 2CF9H 1C2IA 2P94A 4BAQB 1V2ST 2BDIA
chains in the Genus database with same CATH superfamily
2O9QA 3T9KA 1VCQA 2PKSC 2PSXA 5FPYA 4CRBA 3ODFA 2FOAA 3RXGA 4H6SB 4XBDA 1F0UA 2EI7A 3QLPH 2I50A 2STAE 1MTWA 2GX4A 1PPGE 1O3OA 2MA5A 2AS9A 2GT8A 1HJ9A 2WPKS 2BVRH 3P70B 3RXSA 1SHHB 1NO9H 1AB9C 1AFQB 1KXEA 4D8NA 3L1ZB 5HIZA 2YREA 1O3KA 2LGLA 3A7WA 2ZFRH 2JJ1D 1AFEH 1V2KT 2ZU5A 1AQ7A 3KF2A 5LPRA 1TGBA 1TBQH 2LAUA 4YABA 4FVDA 4KKDA 1HBTH 3RXLA 1HAGE 5DP4A 3U69H 4AOQA 3M7TA 1C5ZB 4Y0ZE 2OBOA 1AKSA 3O8CA 5AFZH 2F6JA 2DJAA 1FDPA 1DX5M 2LELA 1T8OA 5C13A 1S85A 1NRSH 2GDDA 1MTUA 1AN1E 3EGKH 1GBCA 5AFYH 1V2VT 3LU9B 4YO9A 1N6YA 4AORA 1GBMA 1B0FA 2EA6A 1MAYA 2V3OH 3S69A 3MH7A 2RCEA 5LPFA 1O37A 1L1JA 1W0JD 4ZKRU 1GJ4H 5DG6A 2M2AA 3M7KA 2F9NA 4K69A 1O2XA 4X3GA 2CHAC 1BTYA 2CGAA 1QZ8A 2V3HH 3RMOH 3TGJE 3K65B 1DXPA 1GJ9B 3SQEE 2O8MA 4LK9A 3VXEH 3LGIA 1W11U 1YYY1 1HXEH 4IS5A 1W3CA 3ZZ7A 4AB9A 1GJ6A 3MMGA 3RXRA 2Z3DA 2HNTE 5FB1A 1ZSKA 1J15A 1VJ9U 2D26C 1XUIA 1UVPA 2FOCA 1AVGH 4Y71A 4RSPA 5E0HA 1EOJA 4IMQA 4UI9B 3LQHA 2H9HA 3U9AH 1ESBA 4CBNA 2WPLS 4TYDA 4Q80A 1ZJDA 4F1PA 1HJAB 4OS5A 1WSSH 2NU2E 1Z1IA 2WINI 3O7AA 1CT2E 1AGJA 1ZGIA 2WYGA 1QNJA 2XNIA 7GCHF 4KP0A 4A49A 1W2KH 3GYMA 2DE8A 5HKKD 3FL2A 1O3NA 1O2PA 5T6GA 4F55A 4I8GA 2LGKA 1SPJA 1P09A 2L75A 2WPHS 2BOHB 4AYCA 4K1SA 2BD3A 4XOJA 3ENSB 2ZO3H 3O47A 1AD8H 2JDID 1HYLA 1A0LA 1UVOA 5FL7D 2VPDA 3UQOA 2E6RA 2YNAA 2ECNA 2F9VA 2BMGB 5DP5A 1SL3A 3RC4A 1L0ZA 4B76A 3TK9A 4N4FA 1YM0A 2FTMA 1G3EA 1GMCF 2YNBA 3SOWA 2VIVA 2ZDMA 2IJOB 2QXIA 2Z6BD 1C5SA 1K1JA 1A5GH 4DIIH 3FP8E 5JB8S 3RXAA 2WSSD 2H5DA 3LJUX 2RG3A 1H9LB 4AFSA 1JM7A 3DSOA 4WMFA 2KYUA 2LXPC 4FUIA 3RP2A 2OUAA 1OP0A 1BMMH 1JWTA 1FNIA 4TY7A 1MABB 3LJOA 3NG2A 1RS0A 4ISLA 2QIZA 1D3QB 1ANBA 1LKBA 1MBMA 3A80A 3KNXA 3Q3XA 1EPTB 4YADA 3MHWU 2VB0A 1CT0E 1THSH 3ODDA 6LPRA 1SBWA 2FOHA 1J14A 3FVFB 5C5NA 2QY0B 3K2UA 4OS4A 1K2I1 2KAIA 2LXHC 4WMEA 2STBE 2BVSH 1TOMH 4K60A 1UTNA 4ABBA 1AVWA 1ETSH 3PYHA 3HKIB 2C2LA 4PROA 1GCTC 1P9UA 4UFDH 4DT4A 4YESB 2VIWA 3ZZBA 2QF4A 4NZQA 4N3WA 4UEHH 2FZZA 8KME2 4NSVA 1UTQA 1NFWA 2KGGA 1SGIB 4LZ4B 3SU5A 5C11A 1LHDH 4IGDA 4RI0A 1PQAA 4TWYA 3ZYEA 1NRNH 3A81A 2B0OE 1NU7B 1L4DA 1DSUA 1YCPK 1LVYA 1GJCB 1NS3A 2C3SA 2BAYA 5I46H 1WENA 1CU1A 1SGFG 2XXLA 2AFQB 1AI8H 1C1SA 2G5NA 3UQVA 1EATA 3A7YA 2P93A 2VJFB 3F0OA 1C2LA 1U6GB 1O30A 2XEUA 1ZRBA 3F1SB 6GCHF 4DG4A 1A46H 4B71A 2UWOA 1P3CA 1NROH 1C2DA 2ZNKH 4OGYA 3SUDA 3PTBA 1SSXA 4YOIA 3GY2A 1TA2A 3SV6A 4YBMA 2HWLB 4O97A 2B8OH 2M1RA 2MD7B 1ZYOA 3M7QA 1X4UA 1WILA 1ELGA 2CF8H 2P3UB 2VIQA 2YMSB 3RXHA 1QBNA 2V0BA 2PSYA 3OEHD 1O39A 2F3CE 2BM2A 4DGJA 2ECVA 4TWWA 3QX5H 1FZZA 1TABE 5J4QA 2Y81A 1BQYA 3V3MA 2VGCC 3SJOA 2WYJA 3BTDE 2GMTB 4CHAB 2NU4E 3P6ZB 5EQQA 3A8CA 2XBVA 3BEIB 2XOCA 4DIHH 1T8LA 3RU4T 1AUTC 2Q6DA 2YOLA 5L2YH 1Z6UA 2D1JA 4FUHA 2EODA 1HUTH 4CR9A 4BHWA 5TDWA 3F9FA 1WEWA 1YPLH 3PLKA 3GCTG 5F8XA 3SJIA 2YU4A 4I8HA 3GL6A 1TNGA 1ZLRA 3PUQA 1HGTH 4A6LA 2PUQH 3FP7E 2ZETC 3I78A 4E7RG 1O31A 1SI5H 1ZTKA 1O36A 2Y6TA 1TNIA 2C90B 1KDQA 2WUCA 3AW0A 1GBHA 1O2KA 3DUXH 4LXBH 5LCWB 3TU7H 4YT6H 5FERA 2ZHEH 2NU0E 1K1LA 1QHRB 3RLWH 3SGAE 1GL1A 3BN9A 2P3FH 3TJNA 2O8WA 1W8BH 1W10U 3DSPA 2SNWA 4F52B 1P05A 3A84A 1TX7A 3MNBA 1Z1JA 2JUNA 1DSTA 5T6FA 4CH8B 2XC5A 2C8ZB 3L6PA 2ECWA 1DT2A 2L74A 3M62A 4P5OB 6ESTA 4L7XA 4HTCH 4PTBA 1LDTT 3PO1C 1RMDA 4YT7H 1CSOE 2ZHWH 3KIDU 5EJ1A 2ALPA 3D65E 2VVUA 4I8JA 3ZZDA 2FYRA 4ZHAA 4DY7B 1WYKA 2BDHA 1HAZB 3BEFB 3UUZA 4DOQA 1JOCA 1K1OA 3A7TA 5HIYA 2QYIA 1C1WH 5DPAA 3DD2H 4XFQA 1C5WB 1SQRA 3UWIA 5C67A 1TX8A 2H0DA 3F2GA 2FLRH 2ZCHP 2A7HA 1G3CA 1IQIA 2LGVA 5JDUB 1YC0A 1GBKA 2EC9H 3K6YA 3LH1A 2BLOA 2RA3A 5E2PA 5CE1A 4R8TB 1C1TA 4WA6A 5HXFA 4A4BA 4FU8A 4ZCNA 1SLUB 4IN1A 1V87A 1Z60A 2VH6A 1T4UH 5JB9S 3EB6A 2GVFA 2ZEBA 1GHVH 2G81E 3CENA 2FIRH 2YSJA 3UTUH 1QCPA 3LKWA 1UK4A 1CT4E 1A61H 1HAHH 1AE8H 4U30A 2YSMA 1GJBB 3ZVEA 1BOQA 1FUJA 3EAJA 4JZDH 3SHCH 2J94A 3RXCA 3D23A 4H6TA 4MPWA 2G6QA 2RSDA 4GUXA 3NUMA 3T7LA 1EAIA 1VCPA 1BBRH 1O3IA 1PPEE 2G51A 1KTSB 3A7ZA 3PTNA 2AEIH 1QRZA 2J92A 3EA9A 1SGPE 2VIOA 4AYCB 4NIYA 3JZ1B 5CHAC 1XMNB 1ZJKA 1TQ7B 5DGJA 2HPQH 3ZZ3A 1KXDA 1BTUA 1FN6A 1FAXA 3ATLA 1AMHA 3BTTE 3R0FA 4R0IA 3U8TH 4AX9H 3DDTA 5LKUA 1PPBH 4LOYH 4X8TH 3UPEA 1EQ9A 1AIXH 1S0QA 3GY7A 1WOFA 1FY1A 1OP2A 3BTFE 3PLBA 4GAWA 2GT7A 3A7XA 4BXWA 4E05H 5E0GA 1H8HD 1FPHH 4KGAA 3UNSA 1CGJE 1BJUA 3PV4A 3ZVDA 5A0CA 2KWKA 5A8YA 3KEEA 5T6DA 2PUXB 1GHBF 1OKXA 2LN0A 5C1UA 2BD9A 3ZZCA 1QRWA 1C5OH 3M5MA 3E8LA 4E06H 2OD3B 3F68H 2GV6A 1P04A 1V2TT 2UUFB 5A0BA 1KDQB 4FJCA 3I2DA 3TLOA 3AASA 3F9HA 3GCHC 2M5TA 1IQKA 4WF8A 5GPIB 5EXNA 3BTQE 1V2WT 2TGDA 5C0UA 3A8AA 3LGWA 3T5FH 3LONA 3SBKA 1SQAA 5EW1H 1BHXB 5B8DA 1G37A 4ACBA 1DUEA 3RXKA 1ID5H 3EE7A 4U32A 2XP0A 1FIWA 2QF5A 1C1UH 2FI3E 3N99A 4X8SH 3ZYQA 1UTOA 1O3DA 2CJIA 2XW9A 3ZZ6A 3BEUA 4E7NA 3A82A 3SJKA 1WGMA 3URDA 4P00A 1ELEE 1ZMJA 2YQLA 3O33A 2BX3A 5DO4H 2Y80A 1H8ED 2PHBA 1BJVA 1MZAA 2FOGA 3NK8A 3PWCA 4LK4A 2FFWA 2BD2A 4BAOB 1TMUH 5AHGH 2PR3A 1CE5A 2XOZA 1EOLA 1F92A 3TITA 4BAHB 3L1XA 3EA7A 4X2YA 3A89A 3VGCC 5KGOA 1O5EH 2BD8A 2FDAA 2ODPA 3ATMA 4B6FA 4LADB 4BTUB 1AWHB 2KR7A 1VITF 3BTGE 1D3TB 2ZFPH 1HAVA 4GCHG 1GI4A 4FETA 3OY6U 2VGCB 3V0XA 4MLFB 4AFZA 1UK2A 2VNTA 1QB6A 5TJXA 2FMJA 4D7FA 5HYOA 5JG6A 2AIPA 2W3KA 4J1YA 1QA0A 4S3OB 1C5PA 3GCHB 1RGQA 2K1QA 4V3KC 2EGMA 3FAOA 3MO9A 4FK5A 1KXFA 2EI8A 3SGBE 2Q1JA 2QXGA 2VVCA 3D49H 2Z9IA 3TNTA 2CXVA 2FPZA 4MG3A 1SR5C 5F03A 1F0TA 3OEED 2FX4A 3U5MA 3H09A 1PQ8A 7KMEH 3HGPA 3SI3H 2CHAB 2Y1MA 3JUEA 3A83A 1DICA 2NAAA 2AMDA 3ZV8A 3ATWA 4UONA 2H2ZA 4K8YA 3DSGA 2UUYA 3E3TA 2DUCA 1EAXA 4U2WA 3SW2B 1IQJA 3E16B 9ESTA 1S81A 4XBBA 1QQ4A 1ELAA 3RXBA 5KEDA 2FOFA 1EASA 4Y6DA 2Y5HA 2SGQE 2YUCA 4HZHA 1FQ3A 2ZCKP 5DP9A 2PV9B 2MKEA 1A1RA 3GY6A 3Q77A 5B79A 2PGQB 1S6HA 4D9RA 1P11E 2BDAA 2FUIA 3VGCB 3FP6E 4BTTB 1CA0C 2ZZUH 4BTIB 4Z6AH 3HTKC 4H9DA 4CRDA 2VNFA 5EYAF 5D1LB 1E35B 1LVOA 1ABJH 1ETRH 4ASHA 3B23B 2FI5E 2ZU1A 3PV2A 1Y3XA 2LRIC 1O32A 2A5IA 1BMLA 3M61U 1ZBDB 3M3TA 3LC3A 1RTKA 5L2ZH 1TGTA 1ZOMA 1SGFA 4CH2B 4UFFH 4AGJA 1TNLA 3C6WA 4LJNA 5IDKA 1GI9B 1QA7A 1LTOA 1DY9A 2QXHA 4JK6A 3SHBA 3QZRA 1A4WH 2H9EH 1Z2QA 1O5FH 4A0CD 1PPZA 8GCHF 1ETTH 1GHXH 1UTJA 3U98H 3HK6B 1LDKC 2QXJA 3HCSA 1AHTH 1XX9A 1K1NA 3SOUA 1SGEE 1O2LA 2RR4A 1X4JA 3SOSA 1D3DB 2FLBH 3NKKA 3FZDA 1O5GH 1K28D 5EXLA 3ZZAA 3AK5A 2P8OB 4L58A 1HNEE 2K4DA 3OY5U 1FI8A 2L6OA 2H0DB 1FX0B 1UCYK 2BD7A 1LVBA 5D1MB 2JMDA 3AAUA 1FY3A 1X7AC 4FUFA 1D6RA 5E0JA 1HAVB 1C5RA 4X2VA 1OSSA 2PNXA 4IMZA 2VH0A 4Z1MD 2AHME 4OS2A 4B2AA 3RXDA 2BYAX 3RPGB 1GBEA 5H1UA 1FPCH 1P2QA 2GZ8A 1WEVA 3DA9B 2BY5X 1O5CB 5E2OA 4YC9A 1XWHA 4Y10E 4Y79A 4OS7A 1MBQA 1O3PB 1IQNA 4QT8C 1P2JA 2KCYA 3M37A 5T3HA 1C2KA 1RD3B 2M85A 2ZU3A 4WZ2A 2IDAA 4RT1A 2W7SA 3MHHA 1DVAH 3M35A 3FO8D 2I6QA 4BNRA 1ARCA 2R3YA 4VGCB 1N1LA 1ZTJA 1OWEA 4B6EA 5FB0A 3SU0A 2PKSB 4HG6A 1CHCA 3SU3A 3SNEA 5A8ZA 4ZKOU 4WWYA 1DCQA 5CDFE 1LDJB 1HIAA 1C4U2 1IQMA 2AYWA 1XKBC 2XC4A 3GISB 1O2MA 1GJDB 1MM3A 2VJ1A 4NWLA 1MZDA 2KIZA 1QIXB 2ECTA 1VGCB 1QL7A 1A7SA 1EFRD 1ORFA 2ZKSA 1XUFA 1OPHB 2CKLA 2CSVA 2ZC9H 4QF2A 1FY4A 3UNRA 3ZPV1 1WEEA 2Z3EA 2PFEA 5ETXA 2VPBA 9LPRA 1O0DH 2NU1E 3UY9A 2XC0A 2VPEA 1E36B 1IQGA 1O5BB 2J38A 3HATH 3LGUA 5E8EH 5FBEA 1CQQA 3UNQA 5GIBA 3ZYDA 4X8VH 1FAKH 2XBXA 2G5VA 1W0YH 3RXVA 4I32A 1Y59T 5DP6A 3RXOA 4CCGX 2WV4A 2LGGA 3PMBB 4O9VA 3MU5A 1J9CH 3T29A 5FAHA 5JYIA 2GJGA 3F6UH 2ZGXH 4Y7BA 3VK6A 1EZSC 2P8OC 4BAMB 2IQJA 1V2OT 2ZU4A 4MNXA 3SU4A 4DURA 3PRBA 1ZZZA 4XDEA 4X8UH 1KYNA 1DWEH 2ZHFH 3KGPA 1WBGB 1GI7B 4YZUA 2ILNA 3GCOA 2J95A 1BORA 1T31A 1TE0A 4INKA 2CKLB 3ZNIA 3ESTA 4KELA 4ABFA 1MD7A 2KWOA 1O2GH 1P0SH 3HGNA 4DT7B 4CBOA 1E4UA 2Y7XA 3LQIA 1GBIA 1UTPA 1P03A 4TT3D 2ECGA 2P57A 4D7GA 3N9NA 4YXWD 2WV9A 5AVDA 2L0BA 2IPHA 1K1IA 3V13A 1O3AA 2JJ2D 4ZUXU 3SV7A 1NRPH 1L4ZA 1BBRK 3O37A 3O70A 1YBWA 2YMSC 4YAXA 1DWDH 2XBWA 3MOCA 1TWXB 1EXFA 2WZQA 4VGCC 2ZDLA 2QCYA 5J4SA 1EB1H 3F0PA 1QJ7B 4AVXA 1C2FA 1GBTA 1AWFH 3SUGA 1C5LH 4MVTA 2IPQX 1TPSA 4X0WU 5A09A 1HRTH 1O33A 2UWLA 3A88A 2QV1A 2KFWA 1J17T 2HLDD 2Z9GA 3PWBA 3Q3YA 4KTCA 5BPEA 3RUOA 3SJ9A 3E1XB 4AZ2B 1WEOA 3MFJA 5TCAA 5AF9H 5EODA 3RM2H 1F5LA 2V3MA 2F91A 3BG4B 1WEMA 1HJAC 4MVNA 3MU1A 5L6NH 3KQ5A 2KU3A 2EXUA 4WH8A 4WZ3B 1C1QA 4MNVA 1BUIA 1Z6JH 1RFNA 4NFEA 2XCFA 1PQ7A 2BTCE 1CVWH 2GCTB 1IYMA 2AERH 2MUMA 3RC5A 1KLIH 3GICB 3RXIA 3V43A 2J98B 3T25A 4K1TA 3RLYH 1G2LA 3SUEA 4BOHA 4YTAA 1TMBH 2ANKH 1EKBB 2SGAA 2ZA5A 8GCHG 5HGGA 3ZPVE 4IC5A 4DJZB 2ZG0H 5JBAS 3SV2H 4O3UA 4ZH8A 1V2QT 4R2YA 1OYTH 2EEKA 4INHA 4B2BA 3FEHA 2ZGHA 2P16A 2SGDE 1AVXA 1YCPH 1Z8JB 2KCOA 2WHXA 3KHVA 2NWNA 4K3JA 1G30B 2M3HA 2F42A 4XSKU 3SZNA 3BTEE 3MQKC 4GPGA 3ZZ9A 1P9SA 2H1UA 1IQFA 3A8BA 1W12U 2BX4A 2OINA 5EJZA 4AP4A 3DCLA 2BZ6H 1BTPA 4WY3A 2C2VS 2LQ6A 1FONA 1YGCH 3KNVA 1OWHA 1QURH 1BHXF 4Y0YE 5FX6A 3RXTA 1KXCA 2E6SA 1BRCE 1CBWB 2PWXA 3ATKA 1LQDB 3VB5A 1O5AB 1BCUH 4NZLA 4ZXXH 5LKTA 1FV9A 1HXFH 2VINA 4I7BA 1QR3E 1WDIA 1GMCG 1BZXE 3L3TA 3Q00A 4F4OC 2KR4A 1G2MA 3U5OA 1O3CA 3UB0A 1YPKH 1MTNC 1OS8A 3P8NA 1Y5BT 4Y8YA 1C2EA 3NRLA 2NU3E 1MQ5A 4I7CA 2M13A 1KY9A 1QJ1B 1PYTD 1QB9A 1ELFA 1GJ5H 4MPXA 3TJUA 1P12E 4QF3A 8LPRA 2GKVE 3GY5A 1BITA 3CNRA 4JZFH 2C4FH 4CR5A 5JBBS 5JBTA 3M7UA 5ESTE 3DPLR 2H5CA 3TIUA 1YLCA 2G4UA 2QC2A 2W7UA 1HAPH 2D8UA 4Q7YA 4B2CA 4MNWA 1T1HA 1SB1H 4B86C 1O2JA 3SV9A 1CHOG 1V3XA 1QB1A 5AIUA 3ZVZB 4NG9H 1SFIA 2IOTA 1GVZA 5SGAE 3E0NB 2A31A 1K22H 4NA8A 3P17H 2GTBA 3UWJH 3G01A 1IQHA 1GGDC 1UHBB 2THFB 3MH4A 4WH6A 2G4TA 2WV5A 4Q2KA 1LVMA 2BVXH 2B7DH 2K17A 2PTNA 1SKYE 1CHGA 1F2SE 4X1RU 4NSYA 2A7JA 1ANCA 2L80A 4ZROA 3LIWA 4AG1A 2FEQH 1GJAB 3V7TA 1HV7A 3TH4H 4K5ZA 1ELBA 2J2UA 4FU7A 2GGVB 3HKJB 5DP3A 1FLEE 2EA3A 4AGKA 5CMXH 4FUJA 3LQJA 3DFJA 5FPSA 3TGKE 3E0PB 2FXRA 3MDBC 1WIMA 1K21H 4YOGA 3S0NA 2KKXA 2V35A 3O8BA 1NM6A 1SQTA 1ZPCA 3MU0A 2A32A 2FX6A 5SVIA 1E79D 4MPUA 4AB8A 5EQSA 3OU0A 1P2MA 5EG4A 2BB4A 1TNKA 2PW8H 3M36A 2XTTB 3TGIE 1MD8A 3KL6A 4FIPA 3PO1B 3S7KB 1O38A 5EXMA 4W4UA 2YQMA 2LNCA 5SVXA 1NT1A 3Q3KA 2J97A 3U28C 2WUBA 4UP0A 3MO3A 1RIWC 3MU4A 1H9IE 2GMTC 2SNVA 2TGPZ 3DT0H 3SUFA 1YPEH 2W3IA 1UCYE 5SVYA 4HI3A 4AN7A 1PYTC 4FUGA 1QBVH 1KXBA 3LDYA 4YBSA 3BV9B 1HCGA 5FX5A 4B73A 1UO6A 2UZGA 1A3BH 3HPTB 3SNDA 4J2YB 1JRTA 1VKYA 2R3UA 3FN8A 4X6NA 3A87A 1GHZA 3RMLH 4GNEA 1GHWH 3LJJA 4F48B 2WPIS 1K0HA 4WJG2 1QFKH 4UFEH 2D8SA 1XVMA 1EZQA 3SU6A 1PJPA 3M5NA 4KTSA 2PLXA 5AITA 1NZQH 4CRFA 1WQVH 1SLWB 2A4RA 5B75A 2QA9E 2AGEX 2CT2A 2VBCA 1V2NT 4M9FA 1GVKB 3SV8A 1WCZA 4I33A 1Y3VA 2IN2A 3RC6A 1WAYB 1UCYH 1SGNE 1PFXC 1JIMA 3RXPA 2VWOA 2W6ID 3ZZ8A 1YPGH 3HK3B 2A0QB 1YF4A 1GI8B 1S83A 3GCTF 5JPMH 1MKXH 4ACAA 3EB5A 1V2RT 2W26A 4MQAA 1VYXA 4B1TA 2BDCA 3A8DA 1EJNA 1UW7A 1TPPA 4RKOB 4FU9A 3ZZ5A 3N9OA 1V6DA 5FCRA 1OWDA 2ZP0H 1O2UA 1LCYA 3B9FH 2XCNA 4A92A 1O34A 5B77A 4NA7A 3RXFA 2HPPH 5EPYA 1M9UA 2L5UA 2JETC 1EUFA 1JOUB 2BDBA 3QUMP 2XBYA 4GLYA 1AZZA 1TRNA 3F2HA 4ABIA 3RU4E 2F9BH 3TJOA 4R7EA 2L43A 1O2IA 1AKSB 4ISIH 2P3TB 1HYIA 1BTHH 1GG6C 3QK1A 3IHPA 2KAIB 2XWBI 1E38B 1MMJN 4H42U 2AN6A 5DP8A 1GL0E 1TA6A 3KQIA 4GB0A 3GY8A 4CHAC 3U1JB 1INCA 1YKTA 4XI1A 3SUBA 1D9IA 3A85A 4Q63A 1P2OA 2CK3D 1WEQA 3WY8A 4ZKNU 1O3JA 3MH5A 3PM3A 1Y3UA 1F7ZA 3I29A 2OWAA 4ABDA 2JH6D 1ELCA 1H8IH 1HB0B 1EX3A 1NN6A 3STIA 1RIWB 1RXPA 1YPJH 1UVTH 1XKAC 4O64A 1WEPA 2BXTH 2P95A 1C5VA 4BXSA 2O8UA 1SGQE 1XUGA 1Z71A 2ZGJA 5FXLA 3W94A 3EE0B 6CHAC 3QWCH 5KECA 4ABAA 2AGGX 1N87A 4FUBA 2IJD1 1ZGVA 2HRVA 1ZMNA 3M5LA 2LV9A 5A0AE 1ZSJA 5KH7A 5LGOA 3SNAA 1K2FA 2KCAA 3S9CA 2ZPSA 3VB7A 2GCHG 2RDEA 1GBLA 1EZXC 1NU9A 3E91A 4O62A 4CRAA 4OGCA 4INLA 2DE9A 1KIGH 3RM0H 4FO9A 4Q6FA 4Z0RA 1QL9A 2KM0A 1S6LA 1TPAE 2OTVA 3HCTA 5DN6D 3TK5A 1BT7A 4B75A 1BBRE 2R0LA 5LKZA 3B8JA 2EQNA 4WMDA 1TIOA 1NESE 4ZAEA 3MNSA 4BBQA 2HDPA 3TNSA 1G9IE 5C3NA 1IOEA 2J9NA 3ZZ4A 3DQVR 1OWIA 4FOUC 2LP6A 1O2SA 2UWPA 1E1QD 1DANH 1TB6H 1YCPM 1ZHPA 2XWAA 3BTHE 3NPSA 4JZ1A 3RMNH 1O3BA 4YM9A 3BTKE 2F9PA 1V2UT 3GY4A 1TBZH 1SFQB 1EB2A 1O2RA 2BLVA 1IAUA 1HPGA 1MAXA 2ESTE 4LLBA 1K1PA 1GJ7B 2F9UA 3T28A 5B78A 2ULLA 2W5EA 4X1NU 4XRNA 1SQOA 7ESTE 4UE7H 3SYJA 4FUDA 5F53A 1WEUA 1D6WA 1K1MA 1TYNA 4Y76A 3LPRA 3T27A 1NFXA 4S3OC 3EA8A 1CGHA 4P02A 1FJSA 1H8DH 1T8NA 2R2MB 2ANYA 1VD4A 2A4OA 2TGAA 4K8BA 3SORA 2HVXA 3LC5A 3VPKA 1SGTA 1TBRH 2A5KA 4ABEA 2TIOA 5JBCS 4TY6A 1GHBG 3KV5A 1JMOH 5I25A 1NFYA 3KYFA 3LRQA 4C9ZA 4AG2A 1DE7H 4PPEA 1VGCC 4RKJB 2ALVA 4JYUH 5GDSH 5G0FA 2BQWB 2CRWA 3GOVB 3LOXA 1IHTH 4SGBE 1YY3A 3GDUA 1EPTA 2YHNA 4ABHA 4UP5A 1J16A 3KV6A 1FN8A 3M63A 3SI4H 4NGAH 1C5QA 4GNDA 1ELTA 1MTVA 4CREA 5DSFA 4LZ1H 2CRRA 2A5AA 3OTJE 3TK6A 1L1NA 1JIRA 3VB6A 3VFEA 2LDRA 1A2CH 1PPFE 4FXGH 2G8TA 7GCHG 1OWKA 1G3BA 1F0SA 4ESTE 1UTMA 1IHSH 2ZTXA 5C2ZA 5FEYA 1C2HA 2J98A 2PGBB 3QN7A 1O2TA 1FIZA 1GI6A 3W95A 4QQ4A 1HFDA 1AUJA 1FXYA 1PQ5A 2I6SA 4JK5A 4FVBA 3L11A 1CA0B 1AU8A 1BRAA 4CRCA 3F2FA 1EAUA 2ANWA 3OFND 1LPKB 2SGEE 2VIPA 1WESA 3E90B 1C5MD 1W13U 1UVSH 2ZHDA 1UMAH 1SOZA 2ZFQH 2XNDD 3PV5A 4MDSA 2PUYA 1OHHD 2JH0D 1D3PB 1P2NA 4YLUA 1P8VC 1HAXB 1W0KD 1VITG 3SJ8A 4NN2A 3O36A 1XXFA 3C5KA 1SC8U 1DM4B 1DWBH 2WPJS 3M3SA 4ASUD 3RTRB 3SO3A 1UTLM 4IC3A 3TVJB 3SOXA 1JRSA 5TBNA 1EJAA 1PPHE 3GV4A 4TKPB 4X1QU 1O3GA 2BDYA 2VWMA 3H7TA 5EQRA 1MUEB 2J4IA 1KLJH 2BY7X 1NPMA 2BDGA 4GHQA 3K6ZA 1TX6A 5EGMA 1Y5AT 5SVIB 3O8DA 1AY6H 1VR1H 1AB9B 1V2PT 3CS0A 3TH3H 2EGPA 3O35A 2HNTF 1W14U 4K1EA 3H7OA 3V12A 1N6XA 2ZIQH 4I7DA 3PMJA 4JCNA 3N9QA 2Z9KA 3FOAA 2FSAA 1TGCA 2R0KA 3WW7A 3AAVA 4Q7ZA 2BLQA 1ARBA 2GZ7A 2HOBA 2K1JA 2MA6A 3MHSA 2OBQA 1H4WA 1SVPA 1W0ZU 2EY4C 4NWKA 5FBIA 1YPHC 2GZ9A 8ESTE 2O8TA 1MH0A 1BTZA 4OGXA 2DX8A 2EI6A 4ZMAH 1SOTA 2FODA 4BAKB 1C2GA 2ODYB 2GD4B 4X2WA 4GCHF 4ZUHA 2VJEA 3LVQE 3UR9A 2YVRA 1DOJA 1TQ0B 4I8KA 1QGFA 3UOUA 3RPGC 5I3LA 5C0TA 2WPMS 2OC7A 2W6JD 3M5OA 2A45B 3SQHE 4IW4E 1TNJA 3AVZA 3LH3A 3N7DA 2ZQ2A 2G52A 3KCGH 1HYJA 4ZDTA 3WWFA 4WVPE 3S7HB 2CN0H 2HLCA 1E1RD 1QY6A 3SN8A 5CHBA 4IC6A 5PTPA 1QQUA 4ZKSU 4DCDA 2BY8X 2FYQA 1AO5A 3RXQA 1B7XB 4CRGA 1L2EA 1GBAA 4XBCA 1G25A 4NCYA 3QZQA 1VJAU 2OCVB 2Z9JA 3MNXA 2ZDAH 4H4FA 2BY9X 4I8LA 2ECIA 1O5DH 3N7OA 3SU2A 1GBFA 1C1RA 1C1MA 3QGNB 2QN5T 1DITH 3ZVFA 3ZVCA 5HM9A 3S9BA 1UK3A 4OM9A 2JMJA 1UVUH 3N7EA 1BMAA 1BIOA 4OS6A 2K8IA 1G3DA 2VWNA 1C4V2 1A0JA 1E37B 2ZTZA 1P2KA 2OQUA 3ELAH 1KSNA 1GGDB 1F5KU 1ABIH 2WPDD 4A5TS 3MH6A 4A4CA 1SGCA 4GNGA 4ISNA 1NBME 1YP9A 4A7IB 1U6QA 2YW8A 1VITH 2AMQA 5D1KB 3U5PA 1Y5UT 2BLWA 3LVRE 1RTFB 1HLTH 3KQDA 2UUJB 3H7HA 1C9TA 3D62A 1L1GA 3MU8A 5G04B 1AFQC 4UFGH 2PTCE 6GCHG 1CHOF 1FY5A 1BTXA 5LKXA 1ZHRA 1T7CA 2Y5GA 2ZDNA 3MYWA 3ZVYA 2P59A 3UFAA 2FS9A 1OYQA 1FP0A 3UOPA 2JKHA 1C4Y2 1TPOA 2Y5FA 2VVVA 2XYAA 1IQEA 2A7CA 1C1PA 1ZTLA 2F43B 1Z7KA 2OQ5A 3AW1A 1C5YB 3DFLA 2B0FA 3KN2A 3L33A 4JMYA 1NRRH 3VG8A 2MNZA 5H1TA 5G4BA 4O3TA 3UR6A 5HMAA 2L7PA 1MQ6A 3UIRA 4XE4A 1DLEA 1DPOA 1GCTB 5EW2H 3FM8C 3QZVA 4MPVA 2KREA 1ANDA 5HM2A 1UTKA 2Q6GA 1FMGA 2CMYA 4M7GA 2FM2A 3F9GA 1SGRE 3P8FA 3ASLA 2BOKA 3P8GA 2TBSA 1QTFA 1HIAB 1GMHF 1OP8A 1YWUA 3R3GB 4DW2U 1MKWK 5ESBA 4X2XA 2PKAA 2C8WB 3IG6B 4YATA 1CGIE 3BG4C 3OE7D 1E34B 1ZR0A 4MTBA 2XRCA 2XOKD 1LHCH 3DWDA 2BQ7B 1ZPBA 1GBJA 1VCWA 4Q4LA 3U8RH 1SLXB 1AZ8A 5H4IB 1P57B 1S0RA 1GWAA 2QICA 2RFKC 1W7GH 2FO9A 2BQ6B 1YLNA 2ASUB 4ISHH 2A2QH 3C1KA 4MSXA 3S9AA 3RU4D 1SMFE 1NRQH 2Y7ZA 3T2NA 1T8MA 2OC1A 1GI0A 1THRH 1LO6A 1CBWC 1TONA 2BY6X 1ESAA 2JH5D 1N8OB 1NFUA 2V7QD 3EYDA 2RA0A 1XUHA 5TABA 3RMMH 2KKYA 1THPB 2ZPQA 3P92A 3STJA 2YURA 1LMWB 1ZHMA 1JBUH 1QRXA 4GSOA 2A4QA 1OOKB 1SG8B 4D9QA 2KE1A 1KMHB 4ABJA 4CA1A 4Z0OA 4XD7D 1C5TA 5G05B 4Y11E 3K9XB 2JRJA 4IBLH 1C2MA 3PRDA 1NBMD 1T4VH 3PMHB 3LT3A 2MD8C 2GCTC 2CV3A 1T32A 4DVAU 3U1IB 2XB1A 1XM1A 1QL8A 1MM2A 3ATIA 4WZ0A 3OSYA 1VZQH 4GNFA 4HGCA 1F62A 2VU8E 2JM3A 2G55A 2GDEH 1RRKA 2B5TB 4ISOA 5DP7A 3RXEA 2M6MA 1Q2WA 1LPGB 1V2LT 2VJEB 4R8PK 4B74A 1QBOA 4Y7AA 1TNHA 2DSMA 3W1EA 2FI4E 2ZDVH 2OC0A 3QO6A 3CP7A 2HGTH 1Q31A 1DFPA 1Y3YA 2H9TH 5H9MA 4AYVB 2F4LA 4ZHLU 3O34A 4BANB 2ECJA 2ZGBH 2Z9LA 1OWJA 4FUEA 4GVUA 1K9OE 2ZHQH 4B7YC 1GI2A 1NY22 5EJLA 3P8OA 1VFYA 2C93B 1EPTC 4U01A 1A3EH 5DINA 1Z8GA 1B5GH 2ZPRA 1H1BA 5L30H 3VB4A 2KFTA 2C8YB 2O8LA 3IITA 1B0EA 1KXAA 4X6OA 3TJVA 2G45A 1DDJA 2FOEA 2GV7A 1ESTA 4RN6A 2ZCLP 2FS8A 2FOMB 4AC9A 4MNYA 2MIQA 2GCHF 3LGYA 2CSYA 2YYRA 2OXSA 2F9OA 2G00A 3KYGA 4IN2A 3M3VA 2JETB 1TRMA 3JZ2B 2UUKB 3WWBA 2VWLA 1EP5A 2BXUH 3SU1A 3OYPA 3ZV9A 2MT5A 3ZVBA 1S82A 2GP9B 1O3EA 1W7XH 4NIXA 4A1XA 1Z8RA 2AH4X 1V2JT 1WQSA 1WV7H 4YOJA 4V3LC 3TPIZ 1GI3A 3A86A 2TPIZ 3VB3A 4YBTA 2RI7A 2AGIX 3U8OH 1GMHG 4WXIA 3KDEC 1EP6A 2HNTC 1C1OA 1SHYA 1BA8B 1O3MA 2Z94A 3F9EA 3N9PA 3URCA 1TFXA 2CSZA 4I7YH 5GJ4B 1TMTH 3Q76A 3UREA 1N8OC 3H5CB 1DXWA 1C1VH 5C1YA 1O2VA 1GMDG 1WU1A 1FBVA 4TSFD 1LKAA 4Y8ZA 1BRUP 3NWUA 1MU6B 1WTGH 3CS7A 1DLKB 1BMFD 2ZGCA 2ZU2A 2KZ4A 4NFFA 1ZPZA 1XUKA 2FUUA 1P06A 1ZRKA 3NXPA 4JZIA 2KX4A 5DKAA 1GHYH 1EZUC 2K16A 5EPNA 3BF6H 3RXJA 5DJ7A 2JIZD 1DVPA 3BG8A 5GCHF 1C5XB 4LKAA 1C5NH 1JXPA 1Q3XA 4HFPB 2QF0A 5K0HA 3NCLA 3E2DA 1ZSLA 1DUAA 1MKWH 2ZECA 2HVYB 2Y1NA 2B9LA 3OX7U 1CO7E 3ZVGA 3MWIU 4ABGA 3BSQA 3ZIAD 1A5IA 1JM7B 1MU8B 2OK5A 2V6NA 1G32B 5CHAB 3RDZA 1ELDE 3SGQE 1X4IA 1O2YA 5GWZA 2D8WA 3EDXB 1NC6A 2FOBA 5FCKA 1GBDA 2ZI2H 2AMPA 2FTLE 3PMAB 3T6RA 1A0HB 1D4PB 1P2IA 1UHBA 2QIQA 4TPYA 1E0FD 1C5UA 3QTOH 2LPRA 2K0QA 1LHGH 3A7VA 3E6PH 1P10A 4X1SU 3ZVAA 1ANEA 1GPZA 3N9LA 3LGTA 5TDRA 1LHFH 3QDZB 2MNYA 4UD9H 1O35A 4Y8XA 3HCUA 2ODQA 1C2JA 3OAAD 1UJ1A 3KQEA 2ZFFH 2VIDA 3NZIA 1IQLA 2Q6FA 3SNCA 3MO6A 2JMIA 3BTME 3QGJA 3GY3A 4Z0KA 1GMDF 3FFGA 4OS1A 1V2MT 4JZEH 4RT0A 1GDNA 3KQBA 3TH2H 2ZF0H 3VXFH 2YHOA 1O2QA 1QJ6B 1F0RA 4OGEA 1HAYB 2HALA 1GG6B 3PLWA 5DKMA 2G43A 1O3FA 1WUNH 5DK1A 2ZFSA 5TCCA 1WXRA 1Z6EA 2ANMH 1HJ8A 2YT5A 1MTNB 1SGYE 4UDWH 2SFAA 1S6FA 4ZQLA 3MTYA 4ZHMU 2BZAA 4SGAE 1ACBE 4X6MA 4I86A 5A8XA 2OP9A 1GHAG 1XUJA 5F8TA 3QTVH 2QGRA 2J5UA 5C1XA 2QE7D 4I31A 2PKAB 2KWJA 2QJ0A 3IWMA 5BRRE 2VJFA 1TALA 1RJXB 4JYTA 2KCPA 2F6NA 5KH9A 3PLPA 4JYVH 3UAIC 1FY8E 4AUQB 5GNDA 3T26A 1P3EA 2VP7A 2VPGA 1CA8B 2TRMA 7LPRA 3ITIA 3I77A 1YPHE 5EOKA 2OXQC 5F6MA 5EIYA 1MCTA 3GYLB 2CONA 4GHTA 5LPEA 5IYTA 1Y3WA 3LGVA 5B6LA 2PP6A 2KWNA 1TRYA 1O2WA 1MKXK 2HYED 2AIQA 1LPZB 3GS9A 4IC2A 6CHAB 1DWCH 1P02A 1O2OA 1BMNH 3BTWE 4A1VA 5B6OA 4FUCA 5C20A 2D2DA 4D76A 2ZQ1A 3KQCA 4Q7XA 1C9PA 2F83A 1GDUA 2H6MA 1GJ8B 4F49A 4TPIZ 5FHTA 3DHKH 1EJMA 2RDLA 1BDAA 4WXVA 1G36A 2A1DB 1O2HA 3LDXH 1PPCE 1Y8TA 1WTHD 5C17A 1OX1A 2OC8A 1GCDA 1LHEH 5F8ZA 5TRBA 1HAIH 1S5SA 3BIUH 5T1VA 3GDSA 2Z3CA 2R9PA 2R2WU 3SZEA 2ZWLH 4X6PA 1TLDA 3GCNA 1WFKA 4KTUA 1P01A 2J34A 2YMSD 4NIWA 5FPTA 3FJUB 1RTLA 1EAWA 1MTSA 5C5OA 4AYYB 1GBBA 1F5RA 4K2YA 1BRBE 1SLVB 3N9MA 1TOCB 2FWWA 1GVLA 3FANA 1TGNA 3FKSD 1Z8IB 1XVOA 1O3LA 1HDTH 2FP7B 2ZFTA 4ZXYH 2Y82A 3RXUA 2A2XH 1C1NA 1LQEA 5EU8A 5K3QA 1NTPA 3RXMA 3MI4A 3PB1E 3EQ0H 2OLGA 2E61A 2C8XB 2QF3A 1BB0B 5A2MH 3PURA 3FZZA 3SHAH 1HAOH 1GI1A 3GDVA 3VEQB 2FD4A 2Y43A 3U5NA 1BTWA 3M99A 2SGPE 3P95A 1ZMLA 5IK2D 3Q1DA 1OXGA 3PHDA 1MCVA 2Z7FE 5ABWA 4THNH 2XOYA 1O2ZA 3ZTGA 2ZDKA 1COWD 3MNCA 1TAWA 5LH8A 5B76A 4AFUA 1XXDA 2SGFE 3C27B 1SGDE 3SNBA 5C94A 5GCHG 5J3XA 1AE5A 1DS2E 1KTTB 1TGSZ 2BHGA 1J8AA 1KLTA 2ZTYA 1YLDA 4NIVA 1GI5A 1WE9A 2BD5A 3BIVH 4O03A 4YLQH 1S84A 4A1TA 1DY8A 2BD4A 1H9HE 5KH3A 1GHAF 1ELVA 5H1VA 1A5HA 3PROA 2KGIA 1YPMH 3F3BA 5K7RA 1O2NA 1O3HA 3O8RA 4AFQA 4X1PU 2A4GA 2FESH 3T62A 5GXPA 4NA9H 2QAAA 2TGTA 1GDQA 2CF9H 1C2IA 2P94A 4BAQB 1V2ST 3OTPA 2BDIA
chains in the Genus database with same CATH topology
2O9QA 1VCQA 2PKSC 2PSXA 5FPYA 4CRBA 3ODFA 2FOAA 3RXGA 4H6SB 4XBDA 1F0UA 2EI7A 3QLPH 2STAE 1MTWA 2GX4A 1PPGE 1O3OA 2AS9A 2GT8A 1HJ9A 2WPKS 2BVRH 3P70B 3RXSA 1SHHB 1NO9H 1AB9C 1AFQB 1KXEA 4D8NA 1O3KA 3A7WA 2ZFRH 1AFEH 1V2KT 2ZU5A 1AQ7A 3KF2A 5LPRA 1TGBA 1TBQH 4FVDA 4KKDA 1HBTH 3RXLA 1HAGE 5DP4A 3U69H 4AOQA 3M7TA 1C5ZB 4Y0ZE 2OBOA 1AKSA 3O8CA 5AFZH 1FDPA 1DX5M 1T8OA 1S85A 1NRSH 2GDDA 1MTUA 1AN1E 3EGKH 1GBCA 5AFYH 1V2VT 3LU9B 4YO9A 1N6YA 4AORA 1GBMA 1B0FA 1MAYA 2V3OH 3S69A 3MH7A 2RCEA 5LPFA 1O37A 1L1JA 4ZKRU 1GJ4H 5DG6A 2F9NA 4K69A 1O2XA 2CHAC 1BTYA 2CGAA 2V3HH 3RMOH 3TGJE 3K65B 1DXPA 1GJ9B 3SQEE 2O8MA 3VXEH 3LGIA 1W11U 1YYY1 1HXEH 4IS5A 1W3CA 3ZZ7A 4AB9A 1GJ6A 3MMGA 3RXRA 2Z3DA 2HNTE 1ZSKA 1J15A 1VJ9U 2D26C 1XUIA 1UVPA 2FOCA 1AVGH 4Y71A 4RSPA 5E0HA 1EOJA 4IMQA 2H9HA 3U9AH 1ESBA 4CBNA 2WPLS 4TYDA 4Q80A 1ZJDA 1HJAB 4OS5A 1WSSH 2NU2E 1Z1IA 2WINI 1CT2E 1AGJA 1ZGIA 2WYGA 1QNJA 2XNIA 7GCHF 4KP0A 1W2KH 3GYMA 2DE8A 1O3NA 1O2PA 5T6GA 4I8GA 1SPJA 1P09A 2WPHS 2BOHB 4K1SA 2BD3A 4XOJA 3ENSB 2ZO3H 1AD8H 1HYLA 1A0LA 1UVOA 3UQOA 2YNAA 2F9VA 2BMGB 5DP5A 1SL3A 3RC4A 1L0ZA 4B76A 3TK9A 1YM0A 2FTMA 1G3EA 1GMCF 2YNBA 2VIVA 2ZDMA 2IJOB 2QXIA 2Z6BD 1C5SA 1K1JA 1A5GH 4DIIH 3FP8E 5JB8S 3RXAA 2H5DA 2RG3A 1H9LB 4AFSA 4WMFA 4FUIA 3RP2A 2OUAA 1OP0A 1BMMH 1JWTA 1FNIA 4TY7A 3LJOA 1RS0A 4ISLA 1D3QB 1ANBA 1LKBA 1MBMA 3A80A 3KNXA 3Q3XA 1EPTB 3MHWU 2VB0A 1CT0E 1THSH 3ODDA 6LPRA 1SBWA 2FOHA 1J14A 3FVFB 5C5NA 2QY0B 3K2UA 4OS4A 1K2I1 2KAIA 4WMEA 2STBE 2BVSH 1TOMH 4K60A 1UTNA 4ABBA 1AVWA 1ETSH 3PYHA 3HKIB 4PROA 1GCTC 1P9UA 4UFDH 4YESB 2VIWA 3ZZBA 4NZQA 4UEHH 2FZZA 8KME2 4NSVA 1UTQA 1NFWA 1SGIB 4LZ4B 3SU5A 1LHDH 4IGDA 1PQAA 4TWYA 3ZYEA 1NRNH 3A81A 1NU7B 1L4DA 1DSUA 1YCPK 1LVYA 1GJCB 1NS3A 2C3SA 5I46H 1CU1A 1SGFG 2XXLA 2AFQB 1AI8H 1C1SA 2G5NA 3UQVA 1EATA 3A7YA 2P93A 1C2LA 1O30A 1ZRBA 3F1SB 6GCHF 4DG4A 1A46H 4B71A 2UWOA 1P3CA 1NROH 1C2DA 2ZNKH 4OGYA 3SUDA 3PTBA 1SSXA 4YOIA 3GY2A 1TA2A 3SV6A 2HWLB 4O97A 2B8OH 1ZYOA 3M7QA 1ELGA 2CF8H 2P3UB 2VIQA 3RXHA 1QBNA 2V0BA 2PSYA 1O39A 2F3CE 2BM2A 4DGJA 4TWWA 3QX5H 1FZZA 1TABE 5J4QA 2Y81A 1BQYA 3V3MA 2VGCC 3SJOA 2WYJA 3BTDE 2GMTB 4CHAB 2NU4E 3P6ZB 5EQQA 3A8CA 2XBVA 3BEIB 4DIHH 1T8LA 3RU4T 1AUTC 2Q6DA 2YOLA 5L2YH 2D1JA 4FUHA 1HUTH 4CR9A 3F9FA 1YPLH 3PLKA 3GCTG 5F8XA 3SJIA 4I8HA 1TNGA 1ZLRA 1HGTH 4A6LA 2PUQH 3FP7E 3I78A 4E7RG 1O31A 1SI5H 1ZTKA 1O36A 2Y6TA 1TNIA 2C90B 1KDQA 2WUCA 3AW0A 1GBHA 1O2KA 3DUXH 4LXBH 3TU7H 4YT6H 2ZHEH 2NU0E 1K1LA 1QHRB 3RLWH 3SGAE 1GL1A 3BN9A 2P3FH 3TJNA 2O8WA 1W8BH 1W10U 2SNWA 1P05A 3A84A 1TX7A 3MNBA 1Z1JA 1DSTA 5T6FA 4CH8B 2XC5A 2C8ZB 3L6PA 1DT2A 6ESTA 4HTCH 1LDTT 3PO1C 4YT7H 1CSOE 2ZHWH 3KIDU 2ALPA 3D65E 2VVUA 4I8JA 3ZZDA 2FYRA 4ZHAA 4DY7B 1WYKA 2BDHA 1HAZB 3BEFB 3UUZA 4DOQA 1K1OA 3A7TA 2QYIA 1C1WH 5DPAA 3DD2H 4XFQA 1C5WB 3UWIA 5C67A 1TX8A 2FLRH 2ZCHP 2A7HA 1G3CA 1IQIA 5JDUB 1YC0A 1GBKA 2EC9H 3K6YA 3LH1A 2BLOA 2RA3A 5E2PA 5CE1A 4R8TB 1C1TA 5HXFA 4FU8A 1SLUB 4IN1A 2VH6A 1T4UH 5JB9S 2GVFA 2ZEBA 1GHVH 2G81E 3CENA 2FIRH 3UTUH 1QCPA 3LKWA 1UK4A 1CT4E 1A61H 1HAHH 1AE8H 4U30A 1GJBB 3ZVEA 1BOQA 1FUJA 3EAJA 4JZDH 3SHCH 2J94A 3RXCA 3D23A 4H6TA 4MPWA 4GUXA 3NUMA 1EAIA 1VCPA 1BBRH 1O3IA 1PPEE 2G51A 1KTSB 3A7ZA 3PTNA 2AEIH 1QRZA 2J92A 3EA9A 1SGPE 2VIOA 4NIYA 3JZ1B 5CHAC 1XMNB 1ZJKA 1TQ7B 5DGJA 2HPQH 3ZZ3A 1KXDA 1BTUA 1FN6A 1FAXA 3ATLA 1AMHA 3BTTE 3R0FA 4R0IA 3U8TH 4AX9H 1PPBH 4LOYH 4X8TH 3UPEA 1EQ9A 1AIXH 1S0QA 3GY7A 1WOFA 1FY1A 1OP2A 3BTFE 3PLBA 4GAWA 2GT7A 3A7XA 4BXWA 4E05H 5E0GA 1FPHH 4KGAA 3UNSA 1CGJE 1BJUA 3PV4A 3ZVDA 5A0CA 5A8YA 3KEEA 5T6DA 2PUXB 1GHBF 1OKXA 5C1UA 2BD9A 3ZZCA 1QRWA 1C5OH 3M5MA 3E8LA 4E06H 2OD3B 3F68H 2GV6A 1P04A 1V2TT 2UUFB 5A0BA 1KDQB 3TLOA 3AASA 3F9HA 3GCHC 2M5TA 1IQKA 4WF8A 5GPIB 5EXNA 3BTQE 1V2WT 2TGDA 3A8AA 3LGWA 3T5FH 3LONA 3SBKA 1SQAA 5EW1H 1BHXB 1G37A 1DUEA 3RXKA 1ID5H 4U32A 1FIWA 1C1UH 2FI3E 4X8SH 1UTOA 1O3DA 2CJIA 2XW9A 3ZZ6A 3BEUA 4E7NA 3A82A 3SJKA 3URDA 1ELEE 1ZMJA 2BX3A 5DO4H 2Y80A 2PHBA 1BJVA 1MZAA 2FOGA 3NK8A 3PWCA 4LK4A 2BD2A 4BAOB 1TMUH 5AHGH 2PR3A 1CE5A 1EOLA 1F92A 3TITA 4BAHB 3EA7A 4X2YA 3A89A 3VGCC 1O5EH 2BD8A 2FDAA 2ODPA 3ATMA 4BTUB 1AWHB 1VITF 3BTGE 1D3TB 2ZFPH 1HAVA 4GCHG 1GI4A 3OY6U 2VGCB 3V0XA 4MLFB 4AFZA 1UK2A 2VNTA 1QB6A 5TJXA 2FMJA 4D7FA 5HYOA 2AIPA 2W3KA 4J1YA 1QA0A 1C5PA 3GCHB 1RGQA 2K1QA 3FAOA 3MO9A 1KXFA 2EI8A 3SGBE 2Q1JA 2QXGA 2VVCA 3D49H 2Z9IA 3TNTA 2CXVA 2FPZA 4MG3A 1SR5C 5F03A 1F0TA 2FX4A 1PQ8A 7KMEH 3HGPA 3SI3H 2CHAB 3A83A 1DICA 2AMDA 3ZV8A 3ATWA 4UONA 2H2ZA 4K8YA 2UUYA 3E3TA 2DUCA 1EAXA 4U2WA 3SW2B 1IQJA 3E16B 9ESTA 1S81A 4XBBA 1QQ4A 1ELAA 3RXBA 2FOFA 1EASA 4Y6DA 2Y5HA 2SGQE 4HZHA 1FQ3A 2ZCKP 5DP9A 2PV9B 1A1RA 3GY6A 3Q77A 2PGQB 1S6HA 4D9RA 1P11E 2BDAA 3VGCB 3FP6E 4BTTB 1CA0C 2ZZUH 4BTIB 4Z6AH 4CRDA 1E35B 1LVOA 1ABJH 1ETRH 4ASHA 3B23B 2FI5E 2ZU1A 1Y3XA 1O32A 2A5IA 1BMLA 3M61U 3M3TA 3LC3A 1RTKA 5L2ZH 1TGTA 1ZOMA 1SGFA 4CH2B 4UFFH 4AGJA 1TNLA 5IDKA 1GI9B 1QA7A 1LTOA 1DY9A 2QXHA 4JK6A 3QZRA 1A4WH 2H9EH 1O5FH 1PPZA 8GCHF 1ETTH 1GHXH 1UTJA 3U98H 3HK6B 2QXJA 1AHTH 1XX9A 1K1NA 1SGEE 1O2LA 3SOSA 1D3DB 2FLBH 3NKKA 3FZDA