1MC3A

Crystal structure of rffh
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
291
structure length
291
Chain Sequence
HMKGIILAGGSGTRLHPITRGVSKQLLPIYDKPMIYYPLSVLMLAGIREILIITTPEDKGYFQRLLGDGSEFGIQLEYAEQPSPDGLAQAFIIGETFLNGEPSCLVLGDNIFFGQGFSPKLRHVAARTEGATVFGYQVMDPERFGVVEFDDNFRAISLEEKPKQPKSNWAVTGLYFYDSKVVEYAKQVKPSERGELEITSINQMYLEAGNLTVELLGRGFAWLDTGTHDSLIEASTFVQTVEKRQGFKIACLEEIAWRNGWLDDEGVKRAASSLAKTGYGQYLLELLRARP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUCOSE-1-PHOSPHATE THYMIDYLYLTRANSFERASE
publication title Crystal Structure of Escherichia coli Glucose-1-Phosphate Thymidylyltransferase (RffH) Complexed with dTTP and Mg2+
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 76
structure length 291
sequence length 291
chains with identical sequence B
ec nomenclature ec 2.7.7.24: Glucose-1-phosphate thymidylyltransferase.
pdb deposition date 2002-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00483 NTP_transferase Nucleotidyl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 1mc3A00
4Y7TA 1ZCVA 1FGXA 1HM8A 3SXEA 4KC4A 4JD0A 2D7IA 5CQNX 3D5NA 4P00A 2JCLA 4E1KA 1LL0A 4NANA 4Y7VA 4KXOA 3FOQA 2VXMA 5CMJA 2AE7A 1G3LA 1H5SB 1ZCUA 5C1GA 3T7OA 2NXVA 2VS4A 5J49A 2E8BA 4FRDA 2PGVA 4Y9XA 4M4KA 3SXDA 1FG5N 4M28A 3U2XA 4C2SA 3GUEA 1H7EA 4FRPA 5C36A 1FR8A 4B4GA 1S4OA 2FY7A 3R2WA 1ZCYA 2Z87A 5FU0A 2GGOA 1H3MA 5L6VA 1ZJOA 1R80A 2WVLA 4L41C 4J18A 1ZI5A 3F1CA 2V0HA 3OH0A 4EE3A 1VH3A 3IOJA 3PKPA 4ARWA 3KIAA 4B4MA 3OH3A 1YP3A 2RJ7A 1O7QA 1OMZA 1W55A 2RIXA 1FO9A 5CMIA 1PZTA 1ON8A 1ZI4A 2RITA 4BMAA 1WT2A 3USQA 1ZIZA 1H7HA 2X65A 4G3SA 5FV9A 1ZDFA 3I0HA 4ASYA 4CVHA 2WGZA 3V8ZA 1H5TB 3K8DA 2ZU8A 5FU8A 3Q80A 1G1LA 1HJLA 1H5RB 1LL2A 3Q4SA 4ZDQA 1IINA 1MP4A 2I7BA 4BQHA 1HJJA 3OGZA 1JYKA 1VGZA 1W57A 2FYBA 2QH5A 4AC3A 2BO6A 1G23A 2P73A 1H7TA 3DK5A 2VSHA 4EE4A 1INJA 1TW5A 2OI5A 1E5KA 3CKJA 1FZWA 2I5KA 2OEGA 1ZJ1A 2YQCA 4KNRA 3OH4A 4Y63A 1JYLA 3DUVA 1GX4A 3HL3A 4B2WA 1TZFA 2XMEA 4KC1A 1FGGA 3T7MA 1VGUA 5JQQA 4B5BA 1R7YA 1GA8A 1GQ9A 1G9RA 3OH1A 4KPXA 2VSIA 3R3IA 4M2BA 3CKNA 1G2VA 1LZIA 2Y6PA 3ZGFA 1XZ6A 4DECA 5C4FA 2RJ1A 1WT0A 5BXCA 4K6RA 4YS8A 4HO4A 3SXAA 5CQMX 3OAMA 1MC3A 4MYBA 2AH9A 3U2TA 2JCKA 2Y7AA 4D0ZA 3JUKA 1NKHB 3V0MA 2RIYA 1R7VA 1H4EA 4HO0A 2XWLA 1PZYB 2AM4A 2AESA 5C3AA 1FXOA 5AJPA 2OEFA 4IRQA 2JCOA 2VD4A 3K8EA 3U2WA 3U2UA 3I0GA 3V90A 2DPWA 2PGYA 1FXJA 4FRAA 3CKVA 5C4BA 3Q7UA 4NAKA 2W0WA 3RMVA 5FYEA 4UEGA 2Z86A 1VM8A 1VZTA 1I52A 1O7OA 4HO5A 4P02A 3V0NA 4D11A 4EEOA 2ZU7A 4FROA 2Y4MA 5C48A 4EVWA 1GX0A 1MP5A 1H4CA 5AJOA 3CKOA 1FO8A 1JV1A 4HG6A 3BRKX 4HCQA 1LZJA 2WVMA 3DJ4A 1ZDGA 4HOCA 5CQOA 1K4VA 4B42A 4DE7A 1HM9A 3E26A 1H7LA 5IDTA 2VFZA 1G8OA 2YC3A 4EEGA 3V0QA 3NGWA 3D8VA 4KPZA 2BO7A 4Y6UA 3I0KA 1G0RA 5CQLX 5C3DA 1O0RA 2MZBA 3D98A 3U2VA 5C4CA 2QGIA 1MP3A 3OKRA 5C1HA 1WVCA 1FRWA 3TZTA 2PA4A 3JTJA 4KNXA 1INIA 3I0LA 4D0TA 3I0JA 3ZGGA 3N9WA 2AECA 1QGQA 3SX7A 1GWWA 1QG8A 3LW6A 4AYLA 3I0DA 5AJNA 5I1FA 4FCEA 1QWJA 2ICYA 3IOHA 1S4NA 1G93A 4LW6A 3V8YA 2O1HA 3V0OA 5C38A 4LW3A 5C8RA 2RJ6A 1S4PA 1LZ0A 1HM0A 1VZXA 3OH2A 4ASJA 4FRLA 2YQSA 1YROB 1G95A 4Y7GA 1V83A 2V0JA 1NF5B 4KT7A 2X60A 2YCMA 1JV3A 4D11C 5IFYA 1YP4A 2BO8A 1WSZA 1WT1A 1ZCTA 1G97A 3ZF8A 1ON6A 2AGDA 1EZIA 1FR9A 2V0IA 3SX8A 2A8WA 1R81A 4Y64A 2ZU9A 2APCA 4G3PA 3F1YA 4FCUA 5CMHA 4AAWA 4Y7FA 3V0LA 1H4DA 1ZJ2A 3SXBA 2VS3A 2D0JA 3BCVA 1ZJPA 2RIZA 3SXGA 1ZHJA 2YQHA 3ZLLA 3SX3A 2GGQA 1NQIB 2O1FA 1KWSA 2E3DA 4EEMA 1QGSA 1O23B 5CMGX 2YQJA 4HO2A 2YESA 1FWYA 4Y6NA 5C49A 4DDZA 4KQLA 1TVYA 2D7RA 3IOIA 1NHEB 1YP2A 4CJBA 1HV9A 2Y4JA 1LZ7A 2FYAA 3TQDA 4IRPA 3V0PA 1H7QA 4HO3A 4CJ8A 1GQCA 3FWWA 2CU2A 1V84A 2Y4KA 4M2AA 1WT3A 3PKQA 1ZJ0A 1TW1A 2Y4LA 2XMHA 5CQPA 2V0KA 1H5SA 1OQMB 4G87A 5IDSA 4FQWA 2WAWA 2UX8A 4AYJA 2VXLA 1R82A 2QKXA 3CU0A 4FRBA 3U0XA 3USRA 5HS2A 3I0EA 1VPAA 1R7XA 2I5EA 1VGWA 4HO9A 1OMXA 1R7UA 1EYRA 3ZLKA 5FTSA 2O1GA 4B4BA 3SX5A 1VICA 3QVBA 4KRVA 1H7GA 2P6WA 2RJ4A 2WEEA 1ZI1A 4GBPA 5C47A 4CJCA 5C1LA 1FOAA 3CGXA 5DDVA 5EJZA 4D48A 2JCJA 5DDTA 4FREA 3SPTA 1NMMB 1ZI3A 1ZJ3A 4EE5A 4B2XA 3I0FA 2WE9A 2RJ9A 2AM5A 5EJ1A 4JISA 4HO8A 1GWVA 1JVDA 3RMWA 2RJ0A 5CMFX 1V82A 1NWGB 4FRQA 5FUHA 3RSBA 3CKQA 2RJ5A 4FRMA 4MNDA 1H5TA 2YC5A 4B3UA 1VH1A 2Q4JA 2X5SA 2FYDB 1H5RA 2V0LA 3JUJA 3POLA 3EE5A 3U0YA 4G3QA 4ECMA 1H5SD 2P72A 3I0IX 3T7NA 4HO6A 3SXCA 2XWNA 2ICXA 5EIYA 1XHBA 3PNNA 2FFUA 1H5SC 2AM3A 4FRHA 1W77A 1SS9A 1VGTA 3E25A 4NAIA 2FFVA 1Z90A 1LVWA 1R7TA 4EEAA 2WVKA 4XWIA 2XWMA 5C4DA 5L6SA 1LL3A 4Y7UA 2X5ZA 2A8UA 3I0CA 4NALA 3ST8A 2BO4A 1IIMA 2OI6A 4R7PA 2W0VA 2PX7A 3V91A 1JVGA 5C3BA 2VS5A 4Y62A 1H7FA 4KC2A 5C4EA 3O3PA 2OI7A 1VZUA 5FTVA 3OC9A 2RJ8A 2FYCB
chains in the Genus database with same CATH superfamily
4Y7TA 1ZCVA 1FGXA 1HM8A 3SXEA 4KC4A 4JD0A 2D7IA 5CQNX 3D5NA 4P00A 2JCLA 4E1KA 1LL0A 4NANA 4Y7VA 4KXOA 4Q7CA 3FOQA 2VXMA 5CMJA 2AE7A 1G3LA 1H5SB 1ZCUA 5C1GA 3T7OA 2NXVA 2VS4A 5J49A 2E8BA 4FRDA 2PGVA 4Y9XA 4M4KA 3SXDA 1FG5N 4M28A 3U2XA 4C2SA 3GUEA 1H7EA 4FRPA 5C36A 1FR8A 4B4GA 1S4OA 2FY7A 3R2WA 1ZCYA 2Z87A 5FU0A 4O6MA 2GGOA 1H3MA 5L6VA 1ZJOA 1R80A 2WVLA 4L41C 4J18A 1ZI5A 3F1CA 2V0HA 3OH0A 4EE3A 1VH3A 3IOJA 3PKPA 4ARWA 3KIAA 4B4MA 3OH3A 1YP3A 2RJ7A 1O7QA 1OMZA 1W55A 2RIXA 1FO9A 5CMIA 1PZTA 1ON8A 1ZI4A 2RITA 4BMAA 1WT2A 3USQA 1ZIZA 1H7HA 2X65A 4G3SA 5FV9A 1ZDFA 3I0HA 4ASYA 4CVHA 2WGZA 3V8ZA 1H5TB 3K8DA 2ZU8A 5FU8A 3Q80A 1G1LA 1HJLA 1H5RB 1LL2A 3Q4SA 4ZDQA 1IINA 1MP4A 2I7BA 4BQHA 1HJJA 3OGZA 1JYKA 1VGZA 1W57A 2FYBA 2QH5A 4AC3A 2BO6A 1G23A 2P73A 1H7TA 3DK5A 2VSHA 4EE4A 1INJA 1TW5A 2OI5A 1E5KA 3CKJA 1FZWA 2I5KA 2OEGA 1ZJ1A 2YQCA 4KNRA 3OH4A 4Y63A 1JYLA 3DUVA 1GX4A 3HL3A 4B2WA 1TZFA 2XMEA 4KC1A 1FGGA 3T7MA 1VGUA 5JQQA 4B5BA 1R7YA 1GA8A 1GQ9A 1G9RA 3OH1A 4KPXA 2VSIA 3R3IA 4M2BA 3CKNA 1G2VA 1LZIA 2Y6PA 3ZGFA 1XZ6A 4DECA 5C4FA 2RJ1A 1WT0A 4O6NA 5BXCA 4K6RA 4YS8A 4HO4A 3SXAA 5CQMX 3OAMA 1MC3A 4MYBA 2AH9A 3U2TA 2JCKA 2Y7AA 4D0ZA 3JUKA 1NKHB 3V0MA 2RIYA 1R7VA 1H4EA 4HO0A 2XWLA 1PZYB 2AM4A 2AESA 5C3AA 1FXOA 5AJPA 2OEFA 2C0NA 4IRQA 2JCOA 2VD4A 3K8EA 3U2WA 3U2UA 3I0GA 3V90A 2VK9A 2DPWA 2PGYA 1FXJA 4FIYA 4FRAA 3CKVA 5C4BA 3Q7UA 4NAKA 2W0WA 3RMVA 5FYEA 4UEGA 2Z86A 1VM8A 1VZTA 1I52A 1O7OA 2J0BA 4HO5A 4P02A 3V0NA 4D11A 4EEOA 2ZU7A 4FROA 2Y4MA 5C48A 4EVWA 1GX0A 1MP5A 1H4CA 5AJOA 5D92A 3CKOA 1FO8A 1JV1A 4HG6A 3BRKX 4HCQA 1LZJA 2WVMA 3DJ4A 1ZDGA 4HOCA 5CQOA 1K4VA 4B42A 4DE7A 1HM9A 3E26A 1H7LA 5IDTA 2VFZA 1G8OA 2YC3A 4EEGA 3V0QA 3NGWA 3D8VA 4KPZA 2BO7A 4Y6UA 3I0KA 1G0RA 5CQLX 5C3DA 1O0RA 2MZBA 3D98A 3U2VA 5C4CA 2QGIA 1MP3A 3OKRA 5C1HA 1WVCA 1FRWA 3TZTA 2PA4A 3JTJA 4KNXA 1INIA 3I0LA 4D0TA 3I0JA 3ZGGA 3N9WA 2AECA 1QGQA 3SX7A 1GWWA 1QG8A 3LW6A 4AYLA 3I0DA 5AJNA 4MIXA 5I1FA 4FCEA 1QWJA 2ICYA 3IOHA 1S4NA 1G93A 4LW6A 3V8YA 2O1HA 3V0OA 5C38A 4LW3A 5C8RA 2RJ6A 1S4PA 1LZ0A 1HM0A 1VZXA 3OH2A 4ASJA 4FRLA 2YQSA 1YROB 1G95A 4Y7GA 1V83A 2V0JA 1NF5B 4KT7A 2X60A 2YCMA 1JV3A 4D11C 5IFYA 1YP4A 2BO8A 1WSZA 1WT1A 1ZCTA 1G97A 3ZF8A 1ON6A 2AGDA 1EZIA 1FR9A 2V0IA 3SX8A 2A8WA 1R81A 4Y64A 2ZU9A 2APCA 4G3PA 3F1YA 4FCUA 5CMHA 4AAWA 4Y7FA 3V0LA 1H4DA 1ZJ2A 3SXBA 2VS3A 2D0JA 3BCVA 1ZJPA 2RIZA 3SXGA 1ZHJA 2YQHA 3ZLLA 3SX3A 2GGQA 1NQIB 2O1FA 1KWSA 2E3DA 4EEMA 1QGSA 1O23B 5CMGX 2YQJA 4HO2A 2YESA 1FWYA 4Y6NA 5C49A 4FIXA 4DDZA 4KQLA 1TVYA 2D7RA 3IOIA 1NHEB 1YP2A 4CJBA 1HV9A 2Y4JA 1LZ7A 2FYAA 3TQDA 4IRPA 3V0PA 1H7QA 4HO3A 4CJ8A 1GQCA 3FWWA 2CU2A 1V84A 2Y4KA 4M2AA 1WT3A 3PKQA 1ZJ0A 1TW1A 2Y4LA 2XMHA 5CQPA 2V0KA 1H5SA 1OQMB 4G87A 5IDSA 4FQWA 2WAWA 2UX8A 4AYJA 2VXLA 1R82A 2QKXA 3CU0A 4FRBA 3U0XA 3USRA 5HS2A 3I0EA 1VPAA 1R7XA 2I5EA 1VGWA 4HO9A 1OMXA 1R7UA 1EYRA 3ZLKA 5FTSA 2O1GA 4B4BA 3SX5A 1VICA 3QVBA 4KRVA 5D91A 1H7GA 2P6WA 2RJ4A 2WEEA 1ZI1A 4GBPA 5C47A 4CJCA 5C1LA 1FOAA 3CGXA 5DDVA 5EJZA 4D48A 2JCJA 5DDTA 4FREA 3SPTA 1NMMB 1ZI3A 1ZJ3A 4EE5A 4B2XA 3I0FA 2WE9A 2RJ9A 2AM5A 5EJ1A 4JISA 4HO8A 1GWVA 1JVDA 3RMWA 2RJ0A 5CMFX 1V82A 1NWGB 4FRQA 5FUHA 2J0AA 3RSBA 3CKQA 2RJ5A 4FRMA 4MNDA 1H5TA 2YC5A 4B3UA 1VH1A 2Q4JA 2X5SA 2FYDB 1H5RA 2V0LA 3JUJA 3POLA 3EE5A 3U0YA 4G3QA 4ECMA 1H5SD 2P72A 3I0IX 3T7NA 4HO6A 3SXCA 2XWNA 2ICXA 5EIYA 1XHBA 3PNNA 2FFUA 1H5SC 2AM3A 4FRHA 1W77A 1SS9A 1VGTA 3E25A 4NAIA 2FFVA 1Z90A 1LVWA 1R7TA 4EEAA 2WVKA 4XWIA 2XWMA 5C4DA 5L6SA 1LL3A 4Y7UA 2X5ZA 2A8UA 3I0CA 4NALA 3ST8A 2BO4A 1IIMA 2OI6A 4R7PA 2W0VA 2PX7A 3V91A 1JVGA 5C3BA 2VS5A 4Y62A 1H7FA 4KC2A 5C4EA 3O3PA 2OI7A 1VZUA 5FTVA 3OC9A 2RJ8A 2FYCB
chains in the Genus database with same CATH topology
4Y7TA 1ZCVA 1FGXA 1HM8A 3SXEA 4KC4A 4JD0A 2D7IA 5CQNX 3D5NA 4P00A 2JCLA 4E1KA 1LL0A 4NANA 4Y7VA 4KXOA 4Q7CA 3FOQA 2VXMA 5CMJA 2AE7A 1G3LA 1H5SB 1ZCUA 5C1GA 3T7OA 2NXVA 2VS4A 5J49A 2E8BA 4FRDA 2PGVA 4Y9XA 4M4KA 3SXDA 1FG5N 4M28A 3U2XA 4C2SA 3GUEA 1H7EA 4FRPA 5C36A 1FR8A 4B4GA 1S4OA 2FY7A 3R2WA 1ZCYA 2Z87A 5FU0A 4O6MA 2GGOA 1H3MA 5L6VA 1ZJOA 1R80A 2WVLA 4L41C 4J18A 1ZI5A 3F1CA 2V0HA 3OH0A 4EE3A 1VH3A 3IOJA 3PKPA 4ARWA 3KIAA 4B4MA 3OH3A 1YP3A 2RJ7A 1O7QA 1OMZA 1W55A 2RIXA 1FO9A 5CMIA 1PZTA 1ON8A 1ZI4A 2RITA 4BMAA 1WT2A 3USQA 1ZIZA 1H7HA 2X65A 4G3SA 5FV9A 1ZDFA 3I0HA 4ASYA 4CVHA 2WGZA 3V8ZA 1H5TB 3K8DA 2ZU8A 5FU8A 3Q80A 1G1LA 1HJLA 1H5RB 1LL2A 3Q4SA 4ZDQA 1IINA 1MP4A 2I7BA 4BQHA 1HJJA 3OGZA 1JYKA 1VGZA 1W57A 2FYBA 2QH5A 4AC3A 2BO6A 1G23A 2P73A 1H7TA 3DK5A 2VSHA 4EE4A 1INJA 1TW5A 2OI5A 1E5KA 3CKJA 1FZWA 2I5KA 2OEGA 1ZJ1A 2YQCA 4KNRA 3OH4A 4Y63A 1JYLA 3DUVA 1GX4A 3HL3A 4B2WA 1TZFA 2XMEA 4KC1A 1FGGA 3T7MA 1VGUA 5JQQA 4B5BA 1R7YA 1GA8A 1GQ9A 1G9RA 3OH1A 4KPXA 2VSIA 3R3IA 4M2BA 3CKNA 1G2VA 1LZIA 2Y6PA 3ZGFA 1XZ6A 4DECA 5C4FA 2RJ1A 1WT0A 4O6NA 5BXCA 4K6RA 4YS8A 4HO4A 3SXAA 5CQMX 3OAMA 1MC3A 4MYBA 2AH9A 3U2TA 2JCKA 2Y7AA 4D0ZA 3JUKA 1NKHB 3V0MA 2RIYA 1R7VA 1H4EA 4HO0A 2XWLA 1PZYB 2AM4A 2AESA 5C3AA 1FXOA 5AJPA 2OEFA 2C0NA 4IRQA 2JCOA 2VD4A 3K8EA 3U2WA 3U2UA 3I0GA 3V90A 2VK9A 2DPWA 2PGYA 1FXJA 4FIYA 4FRAA 3CKVA 5C4BA 3Q7UA 4NAKA 2W0WA 3RMVA 5FYEA 4UEGA 2Z86A 1VM8A 1VZTA 1I52A 1O7OA 2J0BA 4HO5A 4P02A 3V0NA 4D11A 4EEOA 2ZU7A 4FROA 2Y4MA 5C48A 4EVWA 1GX0A 1MP5A 1H4CA 5AJOA 5D92A 3CKOA 1FO8A 1JV1A 4HG6A 3BRKX 4HCQA 1LZJA 2WVMA 3DJ4A 1ZDGA 4HOCA 5CQOA 1K4VA 4B42A 4DE7A 1HM9A 3E26A 1H7LA 5IDTA 2VFZA 1G8OA 2YC3A 4EEGA 3V0QA 3NGWA 3D8VA 4KPZA 2BO7A 4Y6UA 3I0KA 1G0RA 5CQLX 5C3DA 1O0RA 2MZBA 3D98A 3U2VA 5C4CA 2QGIA 1MP3A 3OKRA 5C1HA 1WVCA 1FRWA 3TZTA 2PA4A 3JTJA 4KNXA 1INIA 3I0LA 4D0TA 3I0JA 3ZGGA 3N9WA 2AECA 1QGQA 3SX7A 1GWWA 1QG8A 3LW6A 4AYLA 3I0DA 5AJNA 4MIXA 5I1FA 4FCEA 1QWJA 2ICYA 3IOHA 1S4NA 1G93A 4LW6A 3V8YA 2O1HA 3V0OA 5C38A 4LW3A 5C8RA 2RJ6A 1S4PA 1LZ0A 1HM0A 1VZXA 3OH2A 4ASJA 4FRLA 2YQSA 1YROB 1G95A 4Y7GA 1V83A 2V0JA 1NF5B 4KT7A 2X60A 2YCMA 1JV3A 4D11C 5IFYA 1YP4A 2BO8A 1WSZA 1WT1A 1ZCTA 1G97A 3ZF8A 1ON6A 2AGDA 1EZIA 1FR9A 2V0IA 3SX8A 2A8WA 1R81A 4Y64A 2ZU9A 2APCA 4G3PA 3F1YA 4FCUA 5CMHA 4AAWA 4Y7FA 3V0LA 1H4DA 1ZJ2A 3SXBA 2VS3A 2D0JA 3BCVA 1ZJPA 2RIZA 3SXGA 1ZHJA 2YQHA 3ZLLA 3SX3A 2GGQA 1NQIB 2O1FA 1KWSA 2E3DA 4EEMA 1QGSA 1O23B 5CMGX 2YQJA 4HO2A 2YESA 1FWYA 4Y6NA 5C49A 4FIXA 4DDZA 4KQLA 1TVYA 2D7RA 3IOIA 1NHEB 1YP2A 4CJBA 1HV9A 2Y4JA 1LZ7A 2FYAA 3TQDA 4IRPA 3V0PA 1H7QA 4HO3A 4CJ8A 1GQCA 3FWWA 2CU2A 1V84A 2Y4KA 4M2AA 1WT3A 3PKQA 1ZJ0A 1TW1A 2Y4LA 2XMHA 5CQPA 2V0KA 1H5SA 1OQMB 4G87A 5IDSA 4FQWA 2WAWA 2UX8A 4AYJA 2VXLA 1R82A 2QKXA 3CU0A 4FRBA 3U0XA 3USRA 5HS2A 3I0EA 1VPAA 1R7XA 2I5EA 1VGWA 4HO9A 1OMXA 1R7UA 1EYRA 3ZLKA 5FTSA 2O1GA 4B4BA 3SX5A 1VICA 3QVBA 4KRVA 5D91A 1H7GA 2P6WA 2RJ4A 2WEEA 1ZI1A 4GBPA 5C47A 4CJCA 5C1LA 1FOAA 3CGXA 5DDVA 5EJZA 4D48A 2JCJA 5DDTA 4FREA 3SPTA 1NMMB 1ZI3A 1ZJ3A 4EE5A 4B2XA 3I0FA 2WE9A 2RJ9A 2AM5A 5EJ1A 4JISA 4HO8A 1GWVA 1JVDA 3RMWA 2RJ0A 5CMFX 1V82A 1NWGB 4FRQA 5FUHA 2J0AA 3RSBA 3CKQA 2RJ5A 4FRMA 4MNDA 1H5TA 2YC5A 4B3UA 1VH1A 2Q4JA 2X5SA 2FYDB 1H5RA 2V0LA 3JUJA 3POLA 3EE5A 3U0YA 4G3QA 4ECMA 1H5SD 2P72A 3I0IX 3T7NA 4HO6A 3SXCA 2XWNA 2ICXA 5EIYA 1XHBA 3PNNA 2FFUA 1H5SC 2AM3A 4FRHA 1W77A 1SS9A 1VGTA 3E25A 4NAIA 2FFVA 1Z90A 1LVWA 1R7TA 4EEAA 2WVKA 4XWIA 2XWMA 5C4DA 5L6SA 1LL3A 4Y7UA 2X5ZA 2A8UA 3I0CA 4NALA 3ST8A 2BO4A 1IIMA 2OI6A 4R7PA 2W0VA 2PX7A 3V91A 1JVGA 5C3BA 2VS5A 4Y62A 1H7FA 4KC2A 5C4EA 3O3PA 2OI7A 1VZUA 5FTVA 3OC9A 2RJ8A 2FYCB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Y7T A;  1ZCV A;  1FGX A;  1HM8 A;  3SXE A;  4KC4 A;  4JD0 A;  2D7I A;  5CQN X;  3D5N A;  4P00 A;  2JCL A;  4E1K A;  1LL0 A;  4NAN A;  4Y7V A;  4KXO A;  3FOQ A;  2VXM A;  5CMJ A;  2AE7 A;  1G3L A;  1H5S B;  1ZCU A;  5C1G A;  3T7O A;  2NXV A;  2VS4 A;  5J49 A;  2E8B A;  4FRD A;  2PGV A;  4Y9X A;  4M4K A;  3SXD A;  1FG5 N;  4M28 A;  3U2X A;  4C2S A;  3GUE A;  1H7E A;  4FRP A;  5C36 A;  1FR8 A;  4B4G A;  1S4O A;  2FY7 A;  3R2W A;  1ZCY A;  2Z87 A;  5FU0 A;  2GGO A;  1H3M A;  5L6V A;  1ZJO A;  1R80 A;  2WVL A;  4L41 C;  4J18 A;  1ZI5 A;  3F1C A;  2V0H A;  3OH0 A;  4EE3 A;  1VH3 A;  3IOJ A;  3PKP A;  4ARW A;  3KIA A;  4B4M A;  3OH3 A;  1YP3 A;  2RJ7 A;  1O7Q A;  1OMZ A;  1W55 A;  2RIX A;  1FO9 A;  5CMI A;  1PZT A;  1ON8 A;  1ZI4 A;  2RIT A;  4BMA A;  1WT2 A;  3USQ A;  1ZIZ A;  1H7H A;  2X65 A;  4G3S A;  5FV9 A;  1ZDF A;  3I0H A;  4ASY A;  4CVH A;  2WGZ A;  3V8Z A;  1H5T B;  3K8D A;  2ZU8 A;  5FU8 A;  3Q80 A;  1G1L A;  1HJL A;  1H5R B;  1LL2 A;  3Q4S A;  4ZDQ A;  1IIN A;  1MP4 A;  2I7B A;  4BQH A;  1HJJ A;  3OGZ A;  1JYK A;  1VGZ A;  1W57 A;  2FYB A;  2QH5 A;  4AC3 A;  2BO6 A;  1G23 A;  2P73 A;  1H7T A;  3DK5 A;  2VSH A;  4EE4 A;  1INJ A;  1TW5 A;  2OI5 A;  1E5K A;  3CKJ A;  1FZW A;  2I5K A;  2OEG A;  1ZJ1 A;  2YQC A;  4KNR A;  3OH4 A;  4Y63 A;  1JYL A;  3DUV A;  1GX4 A;  3HL3 A;  4B2W A;  1TZF A;  2XME A;  4KC1 A;  1FGG A;  3T7M A;  1VGU A;  5JQQ A;  4B5B A;  1R7Y A;  1GA8 A;  1GQ9 A;  1G9R A;  3OH1 A;  4KPX A;  2VSI A;  3R3I A;  4M2B A;  3CKN A;  1G2V A;  1LZI A;  2Y6P A;  3ZGF A;  1XZ6 A;  4DEC A;  5C4F A;  2RJ1 A;  1WT0 A;  5BXC A;  4K6R A;  4YS8 A;  4HO4 A;  3SXA A;  5CQM X;  3OAM A;  1MC3 A;  4MYB A;  2AH9 A;  3U2T A;  2JCK A;  2Y7A A;  4D0Z A;  3JUK A;  1NKH B;  3V0M A;  2RIY A;  1R7V A;  1H4E A;  4HO0 A;  2XWL A;  1PZY B;  2AM4 A;  2AES A;  5C3A A;  1FXO A;  5AJP A;  2OEF A;  4IRQ A;  2JCO A;  2VD4 A;  3K8E A;  3U2W A;  3U2U A;  3I0G A;  3V90 A;  2DPW A;  2PGY A;  1FXJ A;  4FRA A;  3CKV A;  5C4B A;  3Q7U A;  4NAK A;  2W0W A;  3RMV A;  5FYE A;  4UEG A;  2Z86 A;  1VM8 A;  1VZT A;  1I52 A;  1O7O A;  4HO5 A;  4P02 A;  3V0N A;  4D11 A;  4EEO A;  2ZU7 A;  4FRO A;  2Y4M A;  5C48 A;  4EVW A;  1GX0 A;  1MP5 A;  1H4C A;  5AJO A;  3CKO A;  1FO8 A;  1JV1 A;  4HG6 A;  3BRK X;  4HCQ A;  1LZJ A;  2WVM A;  3DJ4 A;  1ZDG A;  4HOC A;  5CQO A;  1K4V A;  4B42 A;  4DE7 A;  1HM9 A;  3E26 A;  1H7L A;  5IDT A;  2VFZ A;  1G8O A;  2YC3 A;  4EEG A;  3V0Q A;  3NGW A;  3D8V A;  4KPZ A;  2BO7 A;  4Y6U A;  3I0K A;  1G0R A;  5CQL X;  5C3D A;  1O0R A;  2MZB A;  3D98 A;  3U2V A;  5C4C A;  2QGI A;  1MP3 A;  3OKR A;  5C1H A;  1WVC A;  1FRW A;  3TZT A;  2PA4 A;  3JTJ A;  4KNX A;  1INI A;  3I0L A;  4D0T A;  3I0J A;  3ZGG A;  3N9W A;  2AEC A;  1QGQ A;  3SX7 A;  1GWW A;  1QG8 A;  3LW6 A;  4AYL A;  3I0D A;  5AJN A;  5I1F A;  4FCE A;  1QWJ A;  2ICY A;  3IOH A;  1S4N A;  1G93 A;  4LW6 A;  3V8Y A;  2O1H A;  3V0O A;  5C38 A;  4LW3 A;  5C8R A;  2RJ6 A;  1S4P A;  1LZ0 A;  1HM0 A;  1VZX A;  3OH2 A;  4ASJ A;  4FRL A;  2YQS A;  1YRO B;  1G95 A;  4Y7G A;  1V83 A;  2V0J A;  1NF5 B;  4KT7 A;  2X60 A;  2YCM A;  1JV3 A;  4D11 C;  5IFY A;  1YP4 A;  2BO8 A;  1WSZ A;  1WT1 A;  1ZCT A;  1G97 A;  3ZF8 A;  1ON6 A;  2AGD A;  1EZI A;  1FR9 A;  2V0I A;  3SX8 A;  2A8W A;  1R81 A;  4Y64 A;  2ZU9 A;  2APC A;  4G3P A;  3F1Y A;  4FCU A;  5CMH A;  4AAW A;  4Y7F A;  3V0L A;  1H4D A;  1ZJ2 A;  3SXB A;  2VS3 A;  2D0J A;  3BCV A;  1ZJP A;  2RIZ A;  3SXG A;  1ZHJ A;  2YQH A;  3ZLL A;  3SX3 A;  2GGQ A;  1NQI B;  2O1F A;  1KWS A;  2E3D A;  4EEM A;  1QGS A;  1O23 B;  5CMG X;  2YQJ A;  4HO2 A;  2YES A;  1FWY A;  4Y6N A;  5C49 A;  4DDZ A;  4KQL A;  1TVY A;  2D7R A;  3IOI A;  1NHE B;  1YP2 A;  4CJB A;  1HV9 A;  2Y4J A;  1LZ7 A;  2FYA A;  3TQD A;  4IRP A;  3V0P A;  1H7Q A;  4HO3 A;  4CJ8 A;  1GQC A;  3FWW A;  2CU2 A;  1V84 A;  2Y4K A;  4M2A A;  1WT3 A;  3PKQ A;  1ZJ0 A;  1TW1 A;  2Y4L A;  2XMH A;  5CQP A;  2V0K A;  1H5S A;  1OQM B;  4G87 A;  5IDS A;  4FQW A;  2WAW A;  2UX8 A;  4AYJ A;  2VXL A;  1R82 A;  2QKX A;  3CU0 A;  4FRB A;  3U0X A;  3USR A;  5HS2 A;  3I0E A;  1VPA A;  1R7X A;  2I5E A;  1VGW A;  4HO9 A;  1OMX A;  1R7U A;  1EYR A;  3ZLK A;  5FTS A;  2O1G A;  4B4B A;  3SX5 A;  1VIC A;  3QVB A;  4KRV A;  1H7G A;  2P6W A;  2RJ4 A;  2WEE A;  1ZI1 A;  4GBP A;  5C47 A;  4CJC A;  5C1L A;  1FOA A;  3CGX A;  5DDV A;  5EJZ A;  4D48 A;  2JCJ A;  5DDT A;  4FRE A;  3SPT A;  1NMM B;  1ZI3 A;  1ZJ3 A;  4EE5 A;  4B2X A;  3I0F A;  2WE9 A;  2RJ9 A;  2AM5 A;  5EJ1 A;  4JIS A;  4HO8 A;  1GWV A;  1JVD A;  3RMW A;  2RJ0 A;  5CMF X;  1V82 A;  1NWG B;  4FRQ A;  5FUH A;  3RSB A;  3CKQ A;  2RJ5 A;  4FRM A;  4MND A;  1H5T A;  2YC5 A;  4B3U A;  1VH1 A;  2Q4J A;  2X5S A;  2FYD B;  1H5R A;  2V0L A;  3JUJ A;  3POL A;  3EE5 A;  3U0Y A;  4G3Q A;  4ECM A;  1H5S D;  2P72 A;  3I0I X;  3T7N A;  4HO6 A;  3SXC A;  2XWN A;  2ICX A;  5EIY A;  1XHB A;  3PNN A;  2FFU A;  1H5S C;  2AM3 A;  4FRH A;  1W77 A;  1SS9 A;  1VGT A;  3E25 A;  4NAI A;  2FFV A;  1Z90 A;  1LVW A;  1R7T A;  4EEA A;  2WVK A;  4XWI A;  2XWM A;  5C4D A;  5L6S A;  1LL3 A;  4Y7U A;  2X5Z A;  2A8U A;  3I0C A;  4NAL A;  3ST8 A;  2BO4 A;  1IIM A;  2OI6 A;  4R7P A;  2W0V A;  2PX7 A;  3V91 A;  1JVG A;  5C3B A;  2VS5 A;  4Y62 A;  1H7F A;  4KC2 A;  5C4E A;  3O3P A;  2OI7 A;  1VZU A;  5FTV A;  3OC9 A;  2RJ8 A;  2FYC B; 
#chains in the Genus database with same CATH topology
 4Y7T A;  1ZCV A;  1FGX A;  1HM8 A;  3SXE A;  4KC4 A;  4JD0 A;  2D7I A;  5CQN X;  3D5N A;  4P00 A;  2JCL A;  4E1K A;  1LL0 A;  4NAN A;  4Y7V A;  4KXO A;  4Q7C A;  3FOQ A;  2VXM A;  5CMJ A;  2AE7 A;  1G3L A;  1H5S B;  1ZCU A;  5C1G A;  3T7O A;  2NXV A;  2VS4 A;  5J49 A;  2E8B A;  4FRD A;  2PGV A;  4Y9X A;  4M4K A;  3SXD A;  1FG5 N;  4M28 A;  3U2X A;  4C2S A;  3GUE A;  1H7E A;  4FRP A;  5C36 A;  1FR8 A;  4B4G A;  1S4O A;  2FY7 A;  3R2W A;  1ZCY A;  2Z87 A;  5FU0 A;  4O6M A;  2GGO A;  1H3M A;  5L6V A;  1ZJO A;  1R80 A;  2WVL A;  4L41 C;  4J18 A;  1ZI5 A;  3F1C A;  2V0H A;  3OH0 A;  4EE3 A;  1VH3 A;  3IOJ A;  3PKP A;  4ARW A;  3KIA A;  4B4M A;  3OH3 A;  1YP3 A;  2RJ7 A;  1O7Q A;  1OMZ A;  1W55 A;  2RIX A;  1FO9 A;  5CMI A;  1PZT A;  1ON8 A;  1ZI4 A;  2RIT A;  4BMA A;  1WT2 A;  3USQ A;  1ZIZ A;  1H7H A;  2X65 A;  4G3S A;  5FV9 A;  1ZDF A;  3I0H A;  4ASY A;  4CVH A;  2WGZ A;  3V8Z A;  1H5T B;  3K8D A;  2ZU8 A;  5FU8 A;  3Q80 A;  1G1L A;  1HJL A;  1H5R B;  1LL2 A;  3Q4S A;  4ZDQ A;  1IIN A;  1MP4 A;  2I7B A;  4BQH A;  1HJJ A;  3OGZ A;  1JYK A;  1VGZ A;  1W57 A;  2FYB A;  2QH5 A;  4AC3 A;  2BO6 A;  1G23 A;  2P73 A;  1H7T A;  3DK5 A;  2VSH A;  4EE4 A;  1INJ A;  1TW5 A;  2OI5 A;  1E5K A;  3CKJ A;  1FZW A;  2I5K A;  2OEG A;  1ZJ1 A;  2YQC A;  4KNR A;  3OH4 A;  4Y63 A;  1JYL A;  3DUV A;  1GX4 A;  3HL3 A;  4B2W A;  1TZF A;  2XME A;  4KC1 A;  1FGG A;  3T7M A;  1VGU A;  5JQQ A;  4B5B A;  1R7Y A;  1GA8 A;  1GQ9 A;  1G9R A;  3OH1 A;  4KPX A;  2VSI A;  3R3I A;  4M2B A;  3CKN A;  1G2V A;  1LZI A;  2Y6P A;  3ZGF A;  1XZ6 A;  4DEC A;  5C4F A;  2RJ1 A;  1WT0 A;  4O6N A;  5BXC A;  4K6R A;  4YS8 A;  4HO4 A;  3SXA A;  5CQM X;  3OAM A;  1MC3 A;  4MYB A;  2AH9 A;  3U2T A;  2JCK A;  2Y7A A;  4D0Z A;  3JUK A;  1NKH B;  3V0M A;  2RIY A;  1R7V A;  1H4E A;  4HO0 A;  2XWL A;  1PZY B;  2AM4 A;  2AES A;  5C3A A;  1FXO A;  5AJP A;  2OEF A;  2C0N A;  4IRQ A;  2JCO A;  2VD4 A;  3K8E A;  3U2W A;  3U2U A;  3I0G A;  3V90 A;  2VK9 A;  2DPW A;  2PGY A;  1FXJ A;  4FIY A;  4FRA A;  3CKV A;  5C4B A;  3Q7U A;  4NAK A;  2W0W A;  3RMV A;  5FYE A;  4UEG A;  2Z86 A;  1VM8 A;  1VZT A;  1I52 A;  1O7O A;  2J0B A;  4HO5 A;  4P02 A;  3V0N A;  4D11 A;  4EEO A;  2ZU7 A;  4FRO A;  2Y4M A;  5C48 A;  4EVW A;  1GX0 A;  1MP5 A;  1H4C A;  5AJO A;  5D92 A;  3CKO A;  1FO8 A;  1JV1 A;  4HG6 A;  3BRK X;  4HCQ A;  1LZJ A;  2WVM A;  3DJ4 A;  1ZDG A;  4HOC A;  5CQO A;  1K4V A;  4B42 A;  4DE7 A;  1HM9 A;  3E26 A;  1H7L A;  5IDT A;  2VFZ A;  1G8O A;  2YC3 A;  4EEG A;  3V0Q A;  3NGW A;  3D8V A;  4KPZ A;  2BO7 A;  4Y6U A;  3I0K A;  1G0R A;  5CQL X;  5C3D A;  1O0R A;  2MZB A;  3D98 A;  3U2V A;  5C4C A;  2QGI A;  1MP3 A;  3OKR A;  5C1H A;  1WVC A;  1FRW A;  3TZT A;  2PA4 A;  3JTJ A;  4KNX A;  1INI A;  3I0L A;  4D0T A;  3I0J A;  3ZGG A;  3N9W A;  2AEC A;  1QGQ A;  3SX7 A;  1GWW A;  1QG8 A;  3LW6 A;  4AYL A;  3I0D A;  5AJN A;  4MIX A;  5I1F A;  4FCE A;  1QWJ A;  2ICY A;  3IOH A;  1S4N A;  1G93 A;  4LW6 A;  3V8Y A;  2O1H A;  3V0O A;  5C38 A;  4LW3 A;  5C8R A;  2RJ6 A;  1S4P A;  1LZ0 A;  1HM0 A;  1VZX A;  3OH2 A;  4ASJ A;  4FRL A;  2YQS A;  1YRO B;  1G95 A;  4Y7G A;  1V83 A;  2V0J A;  1NF5 B;  4KT7 A;  2X60 A;  2YCM A;  1JV3 A;  4D11 C;  5IFY A;  1YP4 A;  2BO8 A;  1WSZ A;  1WT1 A;  1ZCT A;  1G97 A;  3ZF8 A;  1ON6 A;  2AGD A;  1EZI A;  1FR9 A;  2V0I A;  3SX8 A;  2A8W A;  1R81 A;  4Y64 A;  2ZU9 A;  2APC A;  4G3P A;  3F1Y A;  4FCU A;  5CMH A;  4AAW A;  4Y7F A;  3V0L A;  1H4D A;  1ZJ2 A;  3SXB A;  2VS3 A;  2D0J A;  3BCV A;  1ZJP A;  2RIZ A;  3SXG A;  1ZHJ A;  2YQH A;  3ZLL A;  3SX3 A;  2GGQ A;  1NQI B;  2O1F A;  1KWS A;  2E3D A;  4EEM A;  1QGS A;  1O23 B;  5CMG X;  2YQJ A;  4HO2 A;  2YES A;  1FWY A;  4Y6N A;  5C49 A;  4FIX A;  4DDZ A;  4KQL A;  1TVY A;  2D7R A;  3IOI A;  1NHE B;  1YP2 A;  4CJB A;  1HV9 A;  2Y4J A;  1LZ7 A;  2FYA A;  3TQD A;  4IRP A;  3V0P A;  1H7Q A;  4HO3 A;  4CJ8 A;  1GQC A;  3FWW A;  2CU2 A;  1V84 A;  2Y4K A;  4M2A A;  1WT3 A;  3PKQ A;  1ZJ0 A;  1TW1 A;  2Y4L A;  2XMH A;  5CQP A;  2V0K A;  1H5S A;  1OQM B;  4G87 A;  5IDS A;  4FQW A;  2WAW A;  2UX8 A;  4AYJ A;  2VXL A;  1R82 A;  2QKX A;  3CU0 A;  4FRB A;  3U0X A;  3USR A;  5HS2 A;  3I0E A;  1VPA A;  1R7X A;  2I5E A;  1VGW A;  4HO9 A;  1OMX A;  1R7U A;  1EYR A;  3ZLK A;  5FTS A;  2O1G A;  4B4B A;  3SX5 A;  1VIC A;  3QVB A;  4KRV A;  5D91 A;  1H7G A;  2P6W A;  2RJ4 A;  2WEE A;  1ZI1 A;  4GBP A;  5C47 A;  4CJC A;  5C1L A;  1FOA A;  3CGX A;  5DDV A;  5EJZ A;  4D48 A;  2JCJ A;  5DDT A;  4FRE A;  3SPT A;  1NMM B;  1ZI3 A;  1ZJ3 A;  4EE5 A;  4B2X A;  3I0F A;  2WE9 A;  2RJ9 A;  2AM5 A;  5EJ1 A;  4JIS A;  4HO8 A;  1GWV A;  1JVD A;  3RMW A;  2RJ0 A;  5CMF X;  1V82 A;  1NWG B;  4FRQ A;  5FUH A;  2J0A A;  3RSB A;  3CKQ A;  2RJ5 A;  4FRM A;  4MND A;  1H5T A;  2YC5 A;  4B3U A;  1VH1 A;  2Q4J A;  2X5S A;  2FYD B;  1H5R A;  2V0L A;  3JUJ A;  3POL A;  3EE5 A;  3U0Y A;  4G3Q A;  4ECM A;  1H5S D;  2P72 A;  3I0I X;  3T7N A;  4HO6 A;  3SXC A;  2XWN A;  2ICX A;  5EIY A;  1XHB A;  3PNN A;  2FFU A;  1H5S C;  2AM3 A;  4FRH A;  1W77 A;  1SS9 A;  1VGT A;  3E25 A;  4NAI A;  2FFV A;  1Z90 A;  1LVW A;  1R7T A;  4EEA A;  2WVK A;  4XWI A;  2XWM A;  5C4D A;  5L6S A;  1LL3 A;  4Y7U A;  2X5Z A;  2A8U A;  3I0C A;  4NAL A;  3ST8 A;  2BO4 A;  1IIM A;  2OI6 A;  4R7P A;  2W0V A;  2PX7 A;  3V91 A;  1JVG A;  5C3B A;  2VS5 A;  4Y62 A;  1H7F A;  4KC2 A;  5C4E A;  3O3P A;  2OI7 A;  1VZU A;  5FTV A;  3OC9 A;  2RJ8 A;  2FYC B; 
#chains in the Genus database with same CATH homology
 4Y7T A;  1ZCV A;  1FGX A;  1HM8 A;  3SXE A;  4KC4 A;  4JD0 A;  2D7I A;  5CQN X;  3D5N A;  4P00 A;  2JCL A;  4E1K A;  1LL0 A;  4NAN A;  4Y7V A;  4KXO A;  4Q7C A;  3FOQ A;  2VXM A;  5CMJ A;  2AE7 A;  1G3L A;  1H5S B;  1ZCU A;  5C1G A;  3T7O A;  2NXV A;  2VS4 A;  5J49 A;  2E8B A;  4FRD A;  2PGV A;  4Y9X A;  4M4K A;  3SXD A;  1FG5 N;  4M28 A;  3U2X A;  4C2S A;  3GUE A;  1H7E A;  4FRP A;  5C36 A;  1FR8 A;  4B4G A;  1S4O A;  2FY7 A;  3R2W A;  1ZCY A;  2Z87 A;  5FU0 A;  4O6M A;  2GGO A;  1H3M A;  5L6V A;  1ZJO A;  1R80 A;  2WVL A;  4L41 C;  4J18 A;  1ZI5 A;  3F1C A;  2V0H A;  3OH0 A;  4EE3 A;  1VH3 A;  3IOJ A;  3PKP A;  4ARW A;  3KIA A;  4B4M A;  3OH3 A;  1YP3 A;  2RJ7 A;  1O7Q A;  1OMZ A;  1W55 A;  2RIX A;  1FO9 A;  5CMI A;  1PZT A;  1ON8 A;  1ZI4 A;  2RIT A;  4BMA A;  1WT2 A;  3USQ A;  1ZIZ A;  1H7H A;  2X65 A;  4G3S A;  5FV9 A;  1ZDF A;  3I0H A;  4ASY A;  4CVH A;  2WGZ A;  3V8Z A;  1H5T B;  3K8D A;  2ZU8 A;  5FU8 A;  3Q80 A;  1G1L A;  1HJL A;  1H5R B;  1LL2 A;  3Q4S A;  4ZDQ A;  1IIN A;  1MP4 A;  2I7B A;  4BQH A;  1HJJ A;  3OGZ A;  1JYK A;  1VGZ A;  1W57 A;  2FYB A;  2QH5 A;  4AC3 A;  2BO6 A;  1G23 A;  2P73 A;  1H7T A;  3DK5 A;  2VSH A;  4EE4 A;  1INJ A;  1TW5 A;  2OI5 A;  1E5K A;  3CKJ A;  1FZW A;  2I5K A;  2OEG A;  1ZJ1 A;  2YQC A;  4KNR A;  3OH4 A;  4Y63 A;  1JYL A;  3DUV A;  1GX4 A;  3HL3 A;  4B2W A;  1TZF A;  2XME A;  4KC1 A;  1FGG A;  3T7M A;  1VGU A;  5JQQ A;  4B5B A;  1R7Y A;  1GA8 A;  1GQ9 A;  1G9R A;  3OH1 A;  4KPX A;  2VSI A;  3R3I A;  4M2B A;  3CKN A;  1G2V A;  1LZI A;  2Y6P A;  3ZGF A;  1XZ6 A;  4DEC A;  5C4F A;  2RJ1 A;  1WT0 A;  4O6N A;  5BXC A;  4K6R A;  4YS8 A;  4HO4 A;  3SXA A;  5CQM X;  3OAM A;  1MC3 A;  4MYB A;  2AH9 A;  3U2T A;  2JCK A;  2Y7A A;  4D0Z A;  3JUK A;  1NKH B;  3V0M A;  2RIY A;  1R7V A;  1H4E A;  4HO0 A;  2XWL A;  1PZY B;  2AM4 A;  2AES A;  5C3A A;  1FXO A;  5AJP A;  2OEF A;  2C0N A;  4IRQ A;  2JCO A;  2VD4 A;  3K8E A;  3U2W A;  3U2U A;  3I0G A;  3V90 A;  2VK9 A;  2DPW A;  2PGY A;  1FXJ A;  4FIY A;  4FRA A;  3CKV A;  5C4B A;  3Q7U A;  4NAK A;  2W0W A;  3RMV A;  5FYE A;  4UEG A;  2Z86 A;  1VM8 A;  1VZT A;  1I52 A;  1O7O A;  2J0B A;  4HO5 A;  4P02 A;  3V0N A;  4D11 A;  4EEO A;  2ZU7 A;  4FRO A;  2Y4M A;  5C48 A;  4EVW A;  1GX0 A;  1MP5 A;  1H4C A;  5AJO A;  5D92 A;  3CKO A;  1FO8 A;  1JV1 A;  4HG6 A;  3BRK X;  4HCQ A;  1LZJ A;  2WVM A;  3DJ4 A;  1ZDG A;  4HOC A;  5CQO A;  1K4V A;  4B42 A;  4DE7 A;  1HM9 A;  3E26 A;  1H7L A;  5IDT A;  2VFZ A;  1G8O A;  2YC3 A;  4EEG A;  3V0Q A;  3NGW A;  3D8V A;  4KPZ A;  2BO7 A;  4Y6U A;  3I0K A;  1G0R A;  5CQL X;  5C3D A;  1O0R A;  2MZB A;  3D98 A;  3U2V A;  5C4C A;  2QGI A;  1MP3 A;  3OKR A;  5C1H A;  1WVC A;  1FRW A;  3TZT A;  2PA4 A;  3JTJ A;  4KNX A;  1INI A;  3I0L A;  4D0T A;  3I0J A;  3ZGG A;  3N9W A;  2AEC A;  1QGQ A;  3SX7 A;  1GWW A;  1QG8 A;  3LW6 A;  4AYL A;  3I0D A;  5AJN A;  4MIX A;  5I1F A;  4FCE A;  1QWJ A;  2ICY A;  3IOH A;  1S4N A;  1G93 A;  4LW6 A;  3V8Y A;  2O1H A;  3V0O A;  5C38 A;  4LW3 A;  5C8R A;  2RJ6 A;  1S4P A;  1LZ0 A;  1HM0 A;  1VZX A;  3OH2 A;  4ASJ A;  4FRL A;  2YQS A;  1YRO B;  1G95 A;  4Y7G A;  1V83 A;  2V0J A;  1NF5 B;  4KT7 A;  2X60 A;  2YCM A;  1JV3 A;  4D11 C;  5IFY A;  1YP4 A;  2BO8 A;  1WSZ A;  1WT1 A;  1ZCT A;  1G97 A;  3ZF8 A;  1ON6 A;  2AGD A;  1EZI A;  1FR9 A;  2V0I A;  3SX8 A;  2A8W A;  1R81 A;  4Y64 A;  2ZU9 A;  2APC A;  4G3P A;  3F1Y A;  4FCU A;  5CMH A;  4AAW A;  4Y7F A;  3V0L A;  1H4D A;  1ZJ2 A;  3SXB A;  2VS3 A;  2D0J A;  3BCV A;  1ZJP A;  2RIZ A;  3SXG A;  1ZHJ A;  2YQH A;  3ZLL A;  3SX3 A;  2GGQ A;  1NQI B;  2O1F A;  1KWS A;  2E3D A;  4EEM A;  1QGS A;  1O23 B;  5CMG X;  2YQJ A;  4HO2 A;  2YES A;  1FWY A;  4Y6N A;  5C49 A;  4FIX A;  4DDZ A;  4KQL A;  1TVY A;  2D7R A;  3IOI A;  1NHE B;  1YP2 A;  4CJB A;  1HV9 A;  2Y4J A;  1LZ7 A;  2FYA A;  3TQD A;  4IRP A;  3V0P A;  1H7Q A;  4HO3 A;  4CJ8 A;  1GQC A;  3FWW A;  2CU2 A;  1V84 A;  2Y4K A;  4M2A A;  1WT3 A;  3PKQ A;  1ZJ0 A;  1TW1 A;  2Y4L A;  2XMH A;  5CQP A;  2V0K A;  1H5S A;  1OQM B;  4G87 A;  5IDS A;  4FQW A;  2WAW A;  2UX8 A;  4AYJ A;  2VXL A;  1R82 A;  2QKX A;  3CU0 A;  4FRB A;  3U0X A;  3USR A;  5HS2 A;  3I0E A;  1VPA A;  1R7X A;  2I5E A;  1VGW A;  4HO9 A;  1OMX A;  1R7U A;  1EYR A;  3ZLK A;  5FTS A;  2O1G A;  4B4B A;  3SX5 A;  1VIC A;  3QVB A;  4KRV A;  5D91 A;  1H7G A;  2P6W A;  2RJ4 A;  2WEE A;  1ZI1 A;  4GBP A;  5C47 A;  4CJC A;  5C1L A;  1FOA A;  3CGX A;  5DDV A;  5EJZ A;  4D48 A;  2JCJ A;  5DDT A;  4FRE A;  3SPT A;  1NMM B;  1ZI3 A;  1ZJ3 A;  4EE5 A;  4B2X A;  3I0F A;  2WE9 A;  2RJ9 A;  2AM5 A;  5EJ1 A;  4JIS A;  4HO8 A;  1GWV A;  1JVD A;  3RMW A;  2RJ0 A;  5CMF X;  1V82 A;  1NWG B;  4FRQ A;  5FUH A;  2J0A A;  3RSB A;  3CKQ A;  2RJ5 A;  4FRM A;  4MND A;  1H5T A;  2YC5 A;  4B3U A;  1VH1 A;  2Q4J A;  2X5S A;  2FYD B;  1H5R A;  2V0L A;  3JUJ A;  3POL A;  3EE5 A;  3U0Y A;  4G3Q A;  4ECM A;  1H5S D;  2P72 A;  3I0I X;  3T7N A;  4HO6 A;  3SXC A;  2XWN A;  2ICX A;  5EIY A;  1XHB A;  3PNN A;  2FFU A;  1H5S C;  2AM3 A;  4FRH A;  1W77 A;  1SS9 A;  1VGT A;  3E25 A;  4NAI A;  2FFV A;  1Z90 A;  1LVW A;  1R7T A;  4EEA A;  2WVK A;  4XWI A;  2XWM A;  5C4D A;  5L6S A;  1LL3 A;  4Y7U A;  2X5Z A;  2A8U A;  3I0C A;  4NAL A;  3ST8 A;  2BO4 A;  1IIM A;  2OI6 A;  4R7P A;  2W0V A;  2PX7 A;  3V91 A;  1JVG A;  5C3B A;  2VS5 A;  4Y62 A;  1H7F A;  4KC2 A;  5C4E A;  3O3P A;  2OI7 A;  1VZU A;  5FTV A;  3OC9 A;  2RJ8 A;  2FYC B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...