1MC3A

Crystal structure of rffh
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
291
structure length
291
Chain Sequence
HMKGIILAGGSGTRLHPITRGVSKQLLPIYDKPMIYYPLSVLMLAGIREILIITTPEDKGYFQRLLGDGSEFGIQLEYAEQPSPDGLAQAFIIGETFLNGEPSCLVLGDNIFFGQGFSPKLRHVAARTEGATVFGYQVMDPERFGVVEFDDNFRAISLEEKPKQPKSNWAVTGLYFYDSKVVEYAKQVKPSERGELEITSINQMYLEAGNLTVELLGRGFAWLDTGTHDSLIEASTFVQTVEKRQGFKIACLEEIAWRNGWLDDEGVKRAASSLAKTGYGQYLLELLRARP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUCOSE-1-PHOSPHATE THYMIDYLYLTRANSFERASE
publication title Crystal Structure of Escherichia coli Glucose-1-Phosphate Thymidylyltransferase (RffH) Complexed with dTTP and Mg2+
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 76
structure length 291
sequence length 291
chains with identical sequence B
ec nomenclature ec 2.7.7.24: Glucose-1-phosphate thymidylyltransferase.
pdb deposition date 2002-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00483 NTP_transferase Nucleotidyl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 1mc3A00
4MYBA 1ZJ3A 3ZLKA 1W77A 1PZTA 4HO3A 3O3PA 4M2BA 3IOIA 1I52A 2RITA 4LW3A 2D7RA 4HO6A 5CMGX 5CQPA 4B3UA 1EZIA 2RJ5A 1H5SA 3V0MA 3ZGFA 1FO9A 2RIYA 4GBPA 3GUEA 2WVMA 3SXBA 4CVHA 2Z87A 4NAKA 5C1GA 2I7BA 2RJ0A 2X60A 1VZUA 5CMIA 2FFUA 1H7TA 1G0RA 1MC3A 1E5KA 1WSZA 1ZHJA 2VXMA 1H3MA 1JV3A 3Q4SA 1HM8A 1R80A 2WVLA 3I0LA 2RJ6A 3V0LA 4D0ZA 1ZJPA 2DPWA 4K6RA 1FR8A 3OH1A 3RMVA 4D0TA 2PGVA 1GA8A 2AESA 4L41C 3FOQA 2BO6A 5C38A 4ZDQA 3OAMA 4DECA 1HJJA 3V90A 1FOAA 2FFVA 2E8BA 3ZGGA 2VSIA 1VGZA 4FRBA 5FV9A 4FRDA 2D0JA 5IDSA 2VD4A 4R7PA 4FQWA 1ZI5A 1VGUA 1JVDA 1GWWA 2Y4LA 2X65A 1W57A 4KC1A 3CKOA 1TW1A 3CKNA 2VFZA 1LL2A 1VGTA 2WE9A 5J49A 1GX0A 1V84A 2AM3A 3Q80A 2ICXA 2O1FA 3USRA 3EE5A 1R7UA 1HV9A 4B5BA 3DJ4A 4Y7TA 1H5TB 4BQHA 2W0WA 2RJ7A 1WT1A 1WT2A 1G2VA 1H7LA 1WVCA 2BO8A 4Y6NA 1H5SC 2PA4A 1QWJA 4EVWA 2Y7AA 2WAWA 2FYAA 5IDTA 2QKXA 1VH1A 3DK5A 5CMFX 5AJPA 4NANA 4NAIA 2YQHA 1FGGA 4KPZA 1H4CA 1NWGB 1FWYA 4D48A 2JCKA 1ZI4A 4HO9A 2AECA 1LVWA 2ZU7A 2OI7A 3V8ZA 5C1LA 3IOHA 1YP3A 3V0OA 1QGQA 1R7VA 2O1HA 2Y6PA 2AM5A 1LZ7A 1ZDFA 3I0GA 3PKQA 1GQ9A 1O7OA 4HO8A 1LL0A 1ZI3A 3OH2A 1EYRA 2NXVA 3DUVA 2WGZA 5FUHA 4ASJA 2OEGA 4B2XA 1JYKA 3CKQA 3V8YA 4BMAA 5FU8A 1K4VA 2VS5A 1VPAA 4B4MA 3T7NA 4Y7FA 2FYDB 5C3BA 1VM8A 5C4DA 1H7QA 1ON8A 4HO5A 3ST8A 4Y6UA 5CQNX 3JUJA 1PZYB 4EEMA 2VSHA 2JCJA 2PGYA 2VS4A 2CU2A 5C4CA 1S4PA 2P72A 1GQCA 4IRQA 4ECMA 1QGSA 2YC5A 4B4BA 1LZ0A 5FTVA 5C49A 1IINA 4UEGA 5BXCA 4M4KA 3K8DA 1SS9A 5DDTA 2WVKA 2RJ8A 2E3DA 4P00A 1INJA 4HO2A 3QVBA 3OGZA 3JUKA 1HJLA 4ASYA 5C36A 4DE7A 3NGWA 1YROB 1ZIZA 2OEFA 3USQA 2BO4A 5CQOA 2YQSA 4KQLA 3POLA 1G8OA 3I0EA 1XHBA 5C1HA 1JYLA 1H5TA 4NALA 3V0NA 1G93A 1ZJ0A 1V82A 4B4GA 5AJOA 5I1FA 4XWIA 1IIMA 4KRVA 4G87A 4FCUA 1NF5B 1H7GA 3V0PA 1Z90A 2XMHA 5FYEA 2JCLA 3FWWA 3V91A 2AE7A 2PX7A 1GX4A 2ZU8A 4Y7UA 3SXEA 3BCVA 5CMHA 5CQLX 3SX5A 5AJNA 4HO0A 1R7XA 1WT0A 4EE3A 2APCA 2JCOA 2XWNA 3D8VA 1FXJA 1VZTA 2AH9A 1NHEB 1H5RA 4FROA 2AGDA 2QGIA 3D98A 4M28A 3SX7A 3U2WA 1VZXA 2A8UA 1R82A 4Y62A 3SX3A 1MP4A 1ZJOA 4JD0A 3V0QA 1ZCVA 4EE4A 5FTSA 4HO4A 3HL3A 2RIZA 3PNNA 1WT3A 3JTJA 3R3IA 1YP2A 4Y7VA 1OQMB 2YQCA 1FO8A 1HM9A 1NKHB 1G9RA 1INIA 5C4EA 3F1CA 3U2UA 3RMWA 2VXLA 3I0CA 1FZWA 3OC9A 4FRPA 1H7FA 1VICA 3OH4A 4KNRA 4J18A 4EEGA 1G1LA 1H5RB 4KPXA 2V0IA 3F1YA 5CMJA 2AM4A 1S4OA 4HG6A 3CKVA 2YC3A 1R81A 5IFYA 5CQMX 2I5EA 1FG5N 3I0JA 2FYBA 1ZI1A 1VH3A 5C3AA 1LL3A 1FR9A 3KIAA 1O0RA 1G3LA 4G3PA 1V83A 2P73A 2X5ZA 3CU0A 3PKPA 3T7MA 5C4BA 5C4FA 1VGWA 1H4DA 2RJ9A 1JVGA 3Q7UA 5C48A 4CJBA 2FY7A 4D11A 1MP5A 4FRHA 4AYLA 3BRKX 5EJZA 2ICYA 3I0IX 2RJ1A 4YS8A 3SPTA 2RIXA 2UX8A 3OH0A 1H4EA 3TZTA 1ZCYA 4B2WA 1ZJ2A 3I0FA 4FRLA 4EEAA 2Y4KA 2BO7A 3U2VA 4FCEA 1XZ6A 3I0KA 4Y64A 2Y4MA 4IRPA 3K8EA 4EE5A 3SXCA 1YP4A 4AYJA 2V0JA 2QH5A 2RJ4A 2V0LA 4DDZA 2O1GA 2YQJA 1HM0A 3SX8A 1TW5A 3TQDA 5C3DA 4FRAA 3OKRA 2VS3A 4AC3A 3E25A 1W55A 2XWMA 1O7QA 1FXOA 2V0HA 4G3QA 1S4NA 3T7OA 2YESA 2ZU9A 4LW6A 4KXOA 2WEEA 1FGXA 3R2WA 1G97A 4KC2A 1H5SB 2XWLA 2D7IA 3U2TA 2YCMA 4FREA 2A8WA 3SXGA 4AAWA 1MP3A 2W0VA 3CKJA 4CJ8A 2Y4JA 2X5SA 5L6VA 4MNDA 2Z86A 2I5KA 3N9WA 4KC4A 4Y7GA 3U0XA 4D11C 4EEOA 1ON6A 1LZJA 3RSBA 5FU0A 1QG8A 4HCQA 1NQIB 2MZBA 4JISA 3I0HA 1LZIA 3E26A 3D5NA 2Q4JA 4P02A 1ZJ1A 1H7HA 3U0YA 1G23A 3SXAA 4Y63A 4E1KA 3CGXA 4FRMA 1OMXA 2FYCB 4KT7A 4G3SA 4KNXA 3I0DA 3U2XA 1R7TA 2V0KA 1TZFA 2P6WA 1ZDGA 5C8RA 4Y9XA 4HOCA 4CJCA 4B42A 3ZLLA 1R7YA 5C47A 2OI5A 2GGOA 4C2SA 2XMEA 5JQQA 1KWSA 3SXDA 1TVYA 1NMMB 3LW6A 4ARWA 5DDVA 2OI6A 3OH3A 1H7EA 3IOJA 1H5SD 1O23B 1FRWA 2GGQA 5L6SA 1ZCTA 4M2AA 5EIYA 3ZF8A 1ZCUA 5EJ1A 5HS2A 1G95A 1OMZA 4FRQA 1GWVA 1JV1A
chains in the Genus database with same CATH superfamily
4MYBA 1ZJ3A 3ZLKA 1W77A 1PZTA 4HO3A 3O3PA 4M2BA 3IOIA 1I52A 2RITA 4LW3A 2D7RA 4HO6A 5CMGX 5CQPA 4B3UA 1EZIA 2RJ5A 1H5SA 4Q7CA 3V0MA 3ZGFA 1FO9A 2RIYA 4GBPA 3GUEA 2WVMA 3SXBA 4CVHA 2Z87A 4NAKA 5C1GA 2I7BA 2RJ0A 2X60A 1VZUA 5CMIA 2VK9A 2FFUA 1H7TA 1G0RA 1MC3A 1E5KA 1WSZA 1ZHJA 2VXMA 1H3MA 1JV3A 3Q4SA 1HM8A 1R80A 2WVLA 3I0LA 2RJ6A 3V0LA 4D0ZA 1ZJPA 2DPWA 4K6RA 1FR8A 3OH1A 3RMVA 4D0TA 2PGVA 1GA8A 2AESA 4MIXA 4L41C 3FOQA 2BO6A 5C38A 5D92A 4ZDQA 3OAMA 4DECA 1HJJA 3V90A 1FOAA 2FFVA 2E8BA 3ZGGA 2VSIA 1VGZA 4FRBA 5FV9A 4FRDA 2D0JA 5IDSA 2VD4A 4R7PA 4FQWA 1ZI5A 1VGUA 1JVDA 1GWWA 2Y4LA 2X65A 1W57A 4KC1A 3CKOA 1TW1A 3CKNA 2VFZA 1LL2A 1VGTA 2WE9A 5J49A 1GX0A 1V84A 2AM3A 3Q80A 2ICXA 2O1FA 3USRA 3EE5A 1R7UA 1HV9A 4B5BA 3DJ4A 4Y7TA 1H5TB 4BQHA 2W0WA 2RJ7A 1WT1A 1WT2A 1G2VA 1H7LA 1WVCA 2BO8A 4Y6NA 1H5SC 2PA4A 1QWJA 4EVWA 2Y7AA 2WAWA 2FYAA 5IDTA 2QKXA 1VH1A 3DK5A 5CMFX 5AJPA 4NANA 4NAIA 2YQHA 1FGGA 4KPZA 1H4CA 1NWGB 1FWYA 4O6MA 4D48A 2JCKA 1ZI4A 4HO9A 2AECA 1LVWA 2ZU7A 2OI7A 3V8ZA 5C1LA 3IOHA 1YP3A 3V0OA 1QGQA 1R7VA 2O1HA 2Y6PA 2AM5A 1LZ7A 1ZDFA 3I0GA 3PKQA 1GQ9A 1O7OA 4HO8A 1LL0A 1ZI3A 3OH2A 1EYRA 2NXVA 3DUVA 2WGZA 5FUHA 4ASJA 2OEGA 4B2XA 1JYKA 3CKQA 3V8YA 4BMAA 5FU8A 1K4VA 2VS5A 1VPAA 4O6NA 4B4MA 3T7NA 4Y7FA 2FYDB 5C3BA 1VM8A 5C4DA 1H7QA 1ON8A 4HO5A 3ST8A 4Y6UA 5CQNX 3JUJA 1PZYB 4EEMA 2VSHA 2JCJA 2PGYA 2VS4A 2CU2A 5C4CA 1S4PA 2P72A 1GQCA 4IRQA 4ECMA 1QGSA 2YC5A 4B4BA 1LZ0A 5FTVA 5C49A 1IINA 4UEGA 5BXCA 4M4KA 3K8DA 1SS9A 5DDTA 2WVKA 2RJ8A 2E3DA 4P00A 1INJA 4HO2A 3QVBA 3OGZA 3JUKA 1HJLA 4ASYA 5C36A 4DE7A 3NGWA 1YROB 1ZIZA 2OEFA 3USQA 2BO4A 5CQOA 2YQSA 4KQLA 3POLA 1G8OA 3I0EA 1XHBA 5C1HA 1JYLA 1H5TA 4NALA 3V0NA 1G93A 1ZJ0A 1V82A 4B4GA 5AJOA 5I1FA 4XWIA 1IIMA 2J0BA 4G87A 4FCUA 1NF5B 1H7GA 4KRVA 3V0PA 1Z90A 2XMHA 5FYEA 2JCLA 3FWWA 3V91A 2AE7A 2PX7A 1GX4A 2ZU8A 4Y7UA 3SXEA 3BCVA 5CMHA 5CQLX 3SX5A 5AJNA 4HO0A 1R7XA 1WT0A 4EE3A 2APCA 2JCOA 2XWNA 3D8VA 1FXJA 1VZTA 2AH9A 1NHEB 4FIXA 1H5RA 4FROA 2AGDA 2QGIA 3D98A 4M28A 3SX7A 3U2WA 1VZXA 2A8UA 1R82A 4Y62A 3SX3A 1MP4A 1ZJOA 4JD0A 3V0QA 1ZCVA 4EE4A 5FTSA 4HO4A 3HL3A 2RIZA 3PNNA 1WT3A 3JTJA 3R3IA 1YP2A 4Y7VA 1OQMB 2YQCA 1FO8A 1HM9A 1NKHB 1G9RA 1INIA 5C4EA 3F1CA 3U2UA 3RMWA 2VXLA 3I0CA 1FZWA 3OC9A 4FRPA 1H7FA 1VICA 3OH4A 4KNRA 4J18A 4EEGA 1G1LA 1H5RB 4KPXA 2V0IA 3F1YA 5CMJA 2AM4A 1S4OA 4HG6A 3CKVA 2YC3A 1R81A 2J0AA 5IFYA 5CQMX 2I5EA 1FG5N 3I0JA 2FYBA 1ZI1A 1VH3A 5C3AA 1LL3A 1FR9A 3KIAA 1O0RA 1G3LA 4G3PA 1V83A 2P73A 2X5ZA 3CU0A 3PKPA 3T7MA 5C4BA 5C4FA 1VGWA 1H4DA 2RJ9A 1JVGA 3Q7UA 5C48A 4CJBA 2FY7A 4D11A 1MP5A 4FRHA 4AYLA 3BRKX 5EJZA 2ICYA 3I0IX 2RJ1A 4YS8A 3SPTA 2RIXA 2UX8A 3OH0A 1H4EA 3TZTA 4FIYA 2C0NA 1ZCYA 4B2WA 1ZJ2A 3I0FA 4FRLA 4EEAA 2Y4KA 2BO7A 3U2VA 4FCEA 1XZ6A 3I0KA 4Y64A 2Y4MA 4IRPA 3K8EA 4EE5A 3SXCA 1YP4A 4AYJA 2V0JA 2QH5A 2RJ4A 2V0LA 4DDZA 2O1GA 2YQJA 1HM0A 3SX8A 1TW5A 3TQDA 5C3DA 4FRAA 3OKRA 2VS3A 4AC3A 3E25A 1W55A 2XWMA 1O7QA 1FXOA 2V0HA 4G3QA 5D91A 1S4NA 3T7OA 2YESA 2ZU9A 4LW6A 4KXOA 2WEEA 1FGXA 3R2WA 1G97A 4KC2A 1H5SB 2XWLA 2D7IA 3U2TA 2YCMA 4FREA 2A8WA 3SXGA 4AAWA 1MP3A 2W0VA 3CKJA 4CJ8A 2Y4JA 2X5SA 5L6VA 4MNDA 2Z86A 2I5KA 3N9WA 4KC4A 4Y7GA 3U0XA 4D11C 4EEOA 1ON6A 1LZJA 3RSBA 5FU0A 1QG8A 4HCQA 1NQIB 2MZBA 4JISA 3I0HA 1LZIA 3E26A 3D5NA 2Q4JA 4P02A 1ZJ1A 1H7HA 3U0YA 1G23A 3SXAA 4Y63A 4E1KA 3CGXA 4FRMA 1OMXA 2FYCB 4KT7A 4G3SA 4KNXA 3I0DA 3U2XA 1R7TA 2V0KA 1TZFA 2P6WA 1ZDGA 5C8RA 4Y9XA 4HOCA 4CJCA 4B42A 3ZLLA 1R7YA 5C47A 2OI5A 2GGOA 4C2SA 2XMEA 5JQQA 1KWSA 3SXDA 1TVYA 1NMMB 3LW6A 4ARWA 5DDVA 2OI6A 3OH3A 1H7EA 3IOJA 1H5SD 1O23B 1FRWA 2GGQA 5L6SA 1ZCTA 4M2AA 5EIYA 3ZF8A 1ZCUA 5EJ1A 5HS2A 1G95A 1OMZA 4FRQA 1GWVA 1JV1A
chains in the Genus database with same CATH topology
4MYBA 1ZJ3A 3ZLKA 1W77A 1PZTA 4HO3A 3O3PA 4M2BA 3IOIA 1I52A 2RITA 4LW3A 2D7RA 4HO6A 5CMGX 5CQPA 4B3UA 1EZIA 2RJ5A 1H5SA 4Q7CA 3V0MA 3ZGFA 1FO9A 2RIYA 4GBPA 3GUEA 2WVMA 3SXBA 4CVHA 2Z87A 4NAKA 5C1GA 2I7BA 2RJ0A 2X60A 1VZUA 5CMIA 2VK9A 2FFUA 1H7TA 1G0RA 1MC3A 1E5KA 1WSZA 1ZHJA 2VXMA 1H3MA 1JV3A 3Q4SA 1HM8A 1R80A 2WVLA 3I0LA 2RJ6A 3V0LA 4D0ZA 1ZJPA 2DPWA 4K6RA 1FR8A 3OH1A 3RMVA 4D0TA 2PGVA 1GA8A 2AESA 4MIXA 4L41C 3FOQA 2BO6A 5C38A 5D92A 4ZDQA 3OAMA 4DECA 1HJJA 3V90A 1FOAA 2FFVA 2E8BA 3ZGGA 2VSIA 1VGZA 4FRBA 5FV9A 4FRDA 2D0JA 5IDSA 2VD4A 4R7PA 4FQWA 1ZI5A 1VGUA 1JVDA 1GWWA 2Y4LA 2X65A 1W57A 4KC1A 3CKOA 1TW1A 3CKNA 2VFZA 1LL2A 1VGTA 2WE9A 5J49A 1GX0A 1V84A 2AM3A 3Q80A 2ICXA 2O1FA 3USRA 3EE5A 1R7UA 1HV9A 4B5BA 3DJ4A 4Y7TA 1H5TB 4BQHA 2W0WA 2RJ7A 1WT1A 1WT2A 1G2VA 1H7LA 1WVCA 2BO8A 4Y6NA 1H5SC 2PA4A 1QWJA 4EVWA 2Y7AA 2WAWA 2FYAA 5IDTA 2QKXA 1VH1A 3DK5A 5CMFX 5AJPA 4NANA 4NAIA 2YQHA 1FGGA 4KPZA 1H4CA 1NWGB 1FWYA 4O6MA 4D48A 2JCKA 1ZI4A 4HO9A 2AECA 1LVWA 2ZU7A 2OI7A 3V8ZA 5C1LA 3IOHA 1YP3A 3V0OA 1QGQA 1R7VA 2O1HA 2Y6PA 2AM5A 1LZ7A 1ZDFA 3I0GA 3PKQA 1GQ9A 1O7OA 4HO8A 1LL0A 1ZI3A 3OH2A 1EYRA 2NXVA 3DUVA 2WGZA 5FUHA 4ASJA 2OEGA 4B2XA 1JYKA 3CKQA 3V8YA 4BMAA 5FU8A 1K4VA 2VS5A 1VPAA 4O6NA 4B4MA 3T7NA 4Y7FA 2FYDB 5C3BA 1VM8A 5C4DA 1H7QA 1ON8A 4HO5A 3ST8A 4Y6UA 5CQNX 3JUJA 1PZYB 4EEMA 2VSHA 2JCJA 2PGYA 2VS4A 2CU2A 5C4CA 1S4PA 2P72A 1GQCA 4IRQA 4ECMA 1QGSA 2YC5A 4B4BA 1LZ0A 5FTVA 5C49A 1IINA 4UEGA 5BXCA 4M4KA 3K8DA 1SS9A 5DDTA 2WVKA 2RJ8A 2E3DA 4P00A 1INJA 4HO2A 3QVBA 3OGZA 3JUKA 1HJLA 4ASYA 5C36A 4DE7A 3NGWA 1YROB 1ZIZA 2OEFA 3USQA 2BO4A 5CQOA 2YQSA 4KQLA 3POLA 1G8OA 3I0EA 1XHBA 5C1HA 1JYLA 1H5TA 4NALA 3V0NA 1G93A 1ZJ0A 1V82A 4B4GA 5AJOA 5I1FA 4XWIA 1IIMA 2J0BA 4G87A 4FCUA 1NF5B 1H7GA 4KRVA 3V0PA 1Z90A 2XMHA 5FYEA 2JCLA 3FWWA 3V91A 2AE7A 2PX7A 1GX4A 2ZU8A 4Y7UA 3SXEA 3BCVA 5CMHA 5CQLX 3SX5A 5AJNA 4HO0A 1R7XA 1WT0A 4EE3A 2APCA 2JCOA 2XWNA 3D8VA 1FXJA 1VZTA 2AH9A 1NHEB 4FIXA 1H5RA 4FROA 2AGDA 2QGIA 3D98A 4M28A 3SX7A 3U2WA 1VZXA 2A8UA 1R82A 4Y62A 3SX3A 1MP4A 1ZJOA 4JD0A 3V0QA 1ZCVA 4EE4A 5FTSA 4HO4A 3HL3A 2RIZA 3PNNA 1WT3A 3JTJA 3R3IA 1YP2A 4Y7VA 1OQMB 2YQCA 1FO8A 1HM9A 1NKHB 1G9RA 1INIA 5C4EA 3F1CA 3U2UA 3RMWA 2VXLA 3I0CA 1FZWA 3OC9A 4FRPA 1H7FA 1VICA 3OH4A 4KNRA 4J18A 4EEGA 1G1LA 1H5RB 4KPXA 2V0IA 3F1YA 5CMJA 2AM4A 1S4OA 4HG6A 3CKVA 2YC3A 1R81A 2J0AA 5IFYA 5CQMX 2I5EA 1FG5N 3I0JA 2FYBA 1ZI1A 1VH3A 5C3AA 1LL3A 1FR9A 3KIAA 1O0RA 1G3LA 4G3PA 1V83A 2P73A 2X5ZA 3CU0A 3PKPA 3T7MA 5C4BA 5C4FA 1VGWA 1H4DA 2RJ9A 1JVGA 3Q7UA 5C48A 4CJBA 2FY7A 4D11A 1MP5A 4FRHA 4AYLA 3BRKX 5EJZA 2ICYA 3I0IX 2RJ1A 4YS8A 3SPTA 2RIXA 2UX8A 3OH0A 1H4EA 3TZTA 4FIYA 2C0NA 1ZCYA 4B2WA 1ZJ2A 3I0FA 4FRLA 4EEAA 2Y4KA 2BO7A 3U2VA 4FCEA 1XZ6A 3I0KA 4Y64A 2Y4MA 4IRPA 3K8EA 4EE5A 3SXCA 1YP4A 4AYJA 2V0JA 2QH5A 2RJ4A 2V0LA 4DDZA 2O1GA 2YQJA 1HM0A 3SX8A 1TW5A 3TQDA 5C3DA 4FRAA 3OKRA 2VS3A 4AC3A 3E25A 1W55A 2XWMA 1O7QA 1FXOA 2V0HA 4G3QA 5D91A 1S4NA 3T7OA 2YESA 2ZU9A 4LW6A 4KXOA 2WEEA 1FGXA 3R2WA 1G97A 4KC2A 1H5SB 2XWLA 2D7IA 3U2TA 2YCMA 4FREA 2A8WA 3SXGA 4AAWA 1MP3A 2W0VA 3CKJA 4CJ8A 2Y4JA 2X5SA 5L6VA 4MNDA 2Z86A 2I5KA 3N9WA 4KC4A 4Y7GA 3U0XA 4D11C 4EEOA 1ON6A 1LZJA 3RSBA 5FU0A 1QG8A 4HCQA 1NQIB 2MZBA 4JISA 3I0HA 1LZIA 3E26A 3D5NA 2Q4JA 4P02A 1ZJ1A 1H7HA 3U0YA 1G23A 3SXAA 4Y63A 4E1KA 3CGXA 4FRMA 1OMXA 2FYCB 4KT7A 4G3SA 4KNXA 3I0DA 3U2XA 1R7TA 2V0KA 1TZFA 2P6WA 1ZDGA 5C8RA 4Y9XA 4HOCA 4CJCA 4B42A 3ZLLA 1R7YA 5C47A 2OI5A 2GGOA 4C2SA 2XMEA 5JQQA 1KWSA 3SXDA 1TVYA 1NMMB 3LW6A 4ARWA 5DDVA 2OI6A 3OH3A 1H7EA 3IOJA 1H5SD 1O23B 1FRWA 2GGQA 5L6SA 1ZCTA 4M2AA 5EIYA 3ZF8A 1ZCUA 5EJ1A 5HS2A 1G95A 1OMZA 4FRQA 1GWVA 1JV1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MYB A;  1ZJ3 A;  3ZLK A;  1W77 A;  1PZT A;  4HO3 A;  3O3P A;  4M2B A;  3IOI A;  1I52 A;  2RIT A;  4LW3 A;  2D7R A;  4HO6 A;  5CMG X;  5CQP A;  4B3U A;  1EZI A;  2RJ5 A;  1H5S A;  3V0M A;  3ZGF A;  1FO9 A;  2RIY A;  4GBP A;  3GUE A;  2WVM A;  3SXB A;  4CVH A;  2Z87 A;  4NAK A;  5C1G A;  2I7B A;  2RJ0 A;  2X60 A;  1VZU A;  5CMI A;  2FFU A;  1H7T A;  1G0R A;  1MC3 A;  1E5K A;  1WSZ A;  1ZHJ A;  2VXM A;  1H3M A;  1JV3 A;  3Q4S A;  1HM8 A;  1R80 A;  2WVL A;  3I0L A;  2RJ6 A;  3V0L A;  4D0Z A;  1ZJP A;  2DPW A;  4K6R A;  1FR8 A;  3OH1 A;  3RMV A;  4D0T A;  2PGV A;  1GA8 A;  2AES A;  4L41 C;  3FOQ A;  2BO6 A;  5C38 A;  4ZDQ A;  3OAM A;  4DEC A;  1HJJ A;  3V90 A;  1FOA A;  2FFV A;  2E8B A;  3ZGG A;  2VSI A;  1VGZ A;  4FRB A;  5FV9 A;  4FRD A;  2D0J A;  5IDS A;  2VD4 A;  4R7P A;  4FQW A;  1ZI5 A;  1VGU A;  1JVD A;  1GWW A;  2Y4L A;  2X65 A;  1W57 A;  4KC1 A;  3CKO A;  1TW1 A;  3CKN A;  2VFZ A;  1LL2 A;  1VGT A;  2WE9 A;  5J49 A;  1GX0 A;  1V84 A;  2AM3 A;  3Q80 A;  2ICX A;  2O1F A;  3USR A;  3EE5 A;  1R7U A;  1HV9 A;  4B5B A;  3DJ4 A;  4Y7T A;  1H5T B;  4BQH A;  2W0W A;  2RJ7 A;  1WT1 A;  1WT2 A;  1G2V A;  1H7L A;  1WVC A;  2BO8 A;  4Y6N A;  1H5S C;  2PA4 A;  1QWJ A;  4EVW A;  2Y7A A;  2WAW A;  2FYA A;  5IDT A;  2QKX A;  1VH1 A;  3DK5 A;  5CMF X;  5AJP A;  4NAN A;  4NAI A;  2YQH A;  1FGG A;  4KPZ A;  1H4C A;  1NWG B;  1FWY A;  4D48 A;  2JCK A;  1ZI4 A;  4HO9 A;  2AEC A;  1LVW A;  2ZU7 A;  2OI7 A;  3V8Z A;  5C1L A;  3IOH A;  1YP3 A;  3V0O A;  1QGQ A;  1R7V A;  2O1H A;  2Y6P A;  2AM5 A;  1LZ7 A;  1ZDF A;  3I0G A;  3PKQ A;  1GQ9 A;  1O7O A;  4HO8 A;  1LL0 A;  1ZI3 A;  3OH2 A;  1EYR A;  2NXV A;  3DUV A;  2WGZ A;  5FUH A;  4ASJ A;  2OEG A;  4B2X A;  1JYK A;  3CKQ A;  3V8Y A;  4BMA A;  5FU8 A;  1K4V A;  2VS5 A;  1VPA A;  4B4M A;  3T7N A;  4Y7F A;  2FYD B;  5C3B A;  1VM8 A;  5C4D A;  1H7Q A;  1ON8 A;  4HO5 A;  3ST8 A;  4Y6U A;  5CQN X;  3JUJ A;  1PZY B;  4EEM A;  2VSH A;  2JCJ A;  2PGY A;  2VS4 A;  2CU2 A;  5C4C A;  1S4P A;  2P72 A;  1GQC A;  4IRQ A;  4ECM A;  1QGS A;  2YC5 A;  4B4B A;  1LZ0 A;  5FTV A;  5C49 A;  1IIN A;  4UEG A;  5BXC A;  4M4K A;  3K8D A;  1SS9 A;  5DDT A;  2WVK A;  2RJ8 A;  2E3D A;  4P00 A;  1INJ A;  4HO2 A;  3QVB A;  3OGZ A;  3JUK A;  1HJL A;  4ASY A;  5C36 A;  4DE7 A;  3NGW A;  1YRO B;  1ZIZ A;  2OEF A;  3USQ A;  2BO4 A;  5CQO A;  2YQS A;  4KQL A;  3POL A;  1G8O A;  3I0E A;  1XHB A;  5C1H A;  1JYL A;  1H5T A;  4NAL A;  3V0N A;  1G93 A;  1ZJ0 A;  1V82 A;  4B4G A;  5AJO A;  5I1F A;  4XWI A;  1IIM A;  4KRV A;  4G87 A;  4FCU A;  1NF5 B;  1H7G A;  3V0P A;  1Z90 A;  2XMH A;  5FYE A;  2JCL A;  3FWW A;  3V91 A;  2AE7 A;  2PX7 A;  1GX4 A;  2ZU8 A;  4Y7U A;  3SXE A;  3BCV A;  5CMH A;  5CQL X;  3SX5 A;  5AJN A;  4HO0 A;  1R7X A;  1WT0 A;  4EE3 A;  2APC A;  2JCO A;  2XWN A;  3D8V A;  1FXJ A;  1VZT A;  2AH9 A;  1NHE B;  1H5R A;  4FRO A;  2AGD A;  2QGI A;  3D98 A;  4M28 A;  3SX7 A;  3U2W A;  1VZX A;  2A8U A;  1R82 A;  4Y62 A;  3SX3 A;  1MP4 A;  1ZJO A;  4JD0 A;  3V0Q A;  1ZCV A;  4EE4 A;  5FTS A;  4HO4 A;  3HL3 A;  2RIZ A;  3PNN A;  1WT3 A;  3JTJ A;  3R3I A;  1YP2 A;  4Y7V A;  1OQM B;  2YQC A;  1FO8 A;  1HM9 A;  1NKH B;  1G9R A;  1INI A;  5C4E A;  3F1C A;  3U2U A;  3RMW A;  2VXL A;  3I0C A;  1FZW A;  3OC9 A;  4FRP A;  1H7F A;  1VIC A;  3OH4 A;  4KNR A;  4J18 A;  4EEG A;  1G1L A;  1H5R B;  4KPX A;  2V0I A;  3F1Y A;  5CMJ A;  2AM4 A;  1S4O A;  4HG6 A;  3CKV A;  2YC3 A;  1R81 A;  5IFY A;  5CQM X;  2I5E A;  1FG5 N;  3I0J A;  2FYB A;  1ZI1 A;  1VH3 A;  5C3A A;  1LL3 A;  1FR9 A;  3KIA A;  1O0R A;  1G3L A;  4G3P A;  1V83 A;  2P73 A;  2X5Z A;  3CU0 A;  3PKP A;  3T7M A;  5C4B A;  5C4F A;  1VGW A;  1H4D A;  2RJ9 A;  1JVG A;  3Q7U A;  5C48 A;  4CJB A;  2FY7 A;  4D11 A;  1MP5 A;  4FRH A;  4AYL A;  3BRK X;  5EJZ A;  2ICY A;  3I0I X;  2RJ1 A;  4YS8 A;  3SPT A;  2RIX A;  2UX8 A;  3OH0 A;  1H4E A;  3TZT A;  1ZCY A;  4B2W A;  1ZJ2 A;  3I0F A;  4FRL A;  4EEA A;  2Y4K A;  2BO7 A;  3U2V A;  4FCE A;  1XZ6 A;  3I0K A;  4Y64 A;  2Y4M A;  4IRP A;  3K8E A;  4EE5 A;  3SXC A;  1YP4 A;  4AYJ A;  2V0J A;  2QH5 A;  2RJ4 A;  2V0L A;  4DDZ A;  2O1G A;  2YQJ A;  1HM0 A;  3SX8 A;  1TW5 A;  3TQD A;  5C3D A;  4FRA A;  3OKR A;  2VS3 A;  4AC3 A;  3E25 A;  1W55 A;  2XWM A;  1O7Q A;  1FXO A;  2V0H A;  4G3Q A;  1S4N A;  3T7O A;  2YES A;  2ZU9 A;  4LW6 A;  4KXO A;  2WEE A;  1FGX A;  3R2W A;  1G97 A;  4KC2 A;  1H5S B;  2XWL A;  2D7I A;  3U2T A;  2YCM A;  4FRE A;  2A8W A;  3SXG A;  4AAW A;  1MP3 A;  2W0V A;  3CKJ A;  4CJ8 A;  2Y4J A;  2X5S A;  5L6V A;  4MND A;  2Z86 A;  2I5K A;  3N9W A;  4KC4 A;  4Y7G A;  3U0X A;  4D11 C;  4EEO A;  1ON6 A;  1LZJ A;  3RSB A;  5FU0 A;  1QG8 A;  4HCQ A;  1NQI B;  2MZB A;  4JIS A;  3I0H A;  1LZI A;  3E26 A;  3D5N A;  2Q4J A;  4P02 A;  1ZJ1 A;  1H7H A;  3U0Y A;  1G23 A;  3SXA A;  4Y63 A;  4E1K A;  3CGX A;  4FRM A;  1OMX A;  2FYC B;  4KT7 A;  4G3S A;  4KNX A;  3I0D A;  3U2X A;  1R7T A;  2V0K A;  1TZF A;  2P6W A;  1ZDG A;  5C8R A;  4Y9X A;  4HOC A;  4CJC A;  4B42 A;  3ZLL A;  1R7Y A;  5C47 A;  2OI5 A;  2GGO A;  4C2S A;  2XME A;  5JQQ A;  1KWS A;  3SXD A;  1TVY A;  1NMM B;  3LW6 A;  4ARW A;  5DDV A;  2OI6 A;  3OH3 A;  1H7E A;  3IOJ A;  1H5S D;  1O23 B;  1FRW A;  2GGQ A;  5L6S A;  1ZCT A;  4M2A A;  5EIY A;  3ZF8 A;  1ZCU A;  5EJ1 A;  5HS2 A;  1G95 A;  1OMZ A;  4FRQ A;  1GWV A;  1JV1 A; 
#chains in the Genus database with same CATH topology
 4MYB A;  1ZJ3 A;  3ZLK A;  1W77 A;  1PZT A;  4HO3 A;  3O3P A;  4M2B A;  3IOI A;  1I52 A;  2RIT A;  4LW3 A;  2D7R A;  4HO6 A;  5CMG X;  5CQP A;  4B3U A;  1EZI A;  2RJ5 A;  1H5S A;  4Q7C A;  3V0M A;  3ZGF A;  1FO9 A;  2RIY A;  4GBP A;  3GUE A;  2WVM A;  3SXB A;  4CVH A;  2Z87 A;  4NAK A;  5C1G A;  2I7B A;  2RJ0 A;  2X60 A;  1VZU A;  5CMI A;  2VK9 A;  2FFU A;  1H7T A;  1G0R A;  1MC3 A;  1E5K A;  1WSZ A;  1ZHJ A;  2VXM A;  1H3M A;  1JV3 A;  3Q4S A;  1HM8 A;  1R80 A;  2WVL A;  3I0L A;  2RJ6 A;  3V0L A;  4D0Z A;  1ZJP A;  2DPW A;  4K6R A;  1FR8 A;  3OH1 A;  3RMV A;  4D0T A;  2PGV A;  1GA8 A;  2AES A;  4MIX A;  4L41 C;  3FOQ A;  2BO6 A;  5C38 A;  5D92 A;  4ZDQ A;  3OAM A;  4DEC A;  1HJJ A;  3V90 A;  1FOA A;  2FFV A;  2E8B A;  3ZGG A;  2VSI A;  1VGZ A;  4FRB A;  5FV9 A;  4FRD A;  2D0J A;  5IDS A;  2VD4 A;  4R7P A;  4FQW A;  1ZI5 A;  1VGU A;  1JVD A;  1GWW A;  2Y4L A;  2X65 A;  1W57 A;  4KC1 A;  3CKO A;  1TW1 A;  3CKN A;  2VFZ A;  1LL2 A;  1VGT A;  2WE9 A;  5J49 A;  1GX0 A;  1V84 A;  2AM3 A;  3Q80 A;  2ICX A;  2O1F A;  3USR A;  3EE5 A;  1R7U A;  1HV9 A;  4B5B A;  3DJ4 A;  4Y7T A;  1H5T B;  4BQH A;  2W0W A;  2RJ7 A;  1WT1 A;  1WT2 A;  1G2V A;  1H7L A;  1WVC A;  2BO8 A;  4Y6N A;  1H5S C;  2PA4 A;  1QWJ A;  4EVW A;  2Y7A A;  2WAW A;  2FYA A;  5IDT A;  2QKX A;  1VH1 A;  3DK5 A;  5CMF X;  5AJP A;  4NAN A;  4NAI A;  2YQH A;  1FGG A;  4KPZ A;  1H4C A;  1NWG B;  1FWY A;  4O6M A;  4D48 A;  2JCK A;  1ZI4 A;  4HO9 A;  2AEC A;  1LVW A;  2ZU7 A;  2OI7 A;  3V8Z A;  5C1L A;  3IOH A;  1YP3 A;  3V0O A;  1QGQ A;  1R7V A;  2O1H A;  2Y6P A;  2AM5 A;  1LZ7 A;  1ZDF A;  3I0G A;  3PKQ A;  1GQ9 A;  1O7O A;  4HO8 A;  1LL0 A;  1ZI3 A;  3OH2 A;  1EYR A;  2NXV A;  3DUV A;  2WGZ A;  5FUH A;  4ASJ A;  2OEG A;  4B2X A;  1JYK A;  3CKQ A;  3V8Y A;  4BMA A;  5FU8 A;  1K4V A;  2VS5 A;  1VPA A;  4O6N A;  4B4M A;  3T7N A;  4Y7F A;  2FYD B;  5C3B A;  1VM8 A;  5C4D A;  1H7Q A;  1ON8 A;  4HO5 A;  3ST8 A;  4Y6U A;  5CQN X;  3JUJ A;  1PZY B;  4EEM A;  2VSH A;  2JCJ A;  2PGY A;  2VS4 A;  2CU2 A;  5C4C A;  1S4P A;  2P72 A;  1GQC A;  4IRQ A;  4ECM A;  1QGS A;  2YC5 A;  4B4B A;  1LZ0 A;  5FTV A;  5C49 A;  1IIN A;  4UEG A;  5BXC A;  4M4K A;  3K8D A;  1SS9 A;  5DDT A;  2WVK A;  2RJ8 A;  2E3D A;  4P00 A;  1INJ A;  4HO2 A;  3QVB A;  3OGZ A;  3JUK A;  1HJL A;  4ASY A;  5C36 A;  4DE7 A;  3NGW A;  1YRO B;  1ZIZ A;  2OEF A;  3USQ A;  2BO4 A;  5CQO A;  2YQS A;  4KQL A;  3POL A;  1G8O A;  3I0E A;  1XHB A;  5C1H A;  1JYL A;  1H5T A;  4NAL A;  3V0N A;  1G93 A;  1ZJ0 A;  1V82 A;  4B4G A;  5AJO A;  5I1F A;  4XWI A;  1IIM A;  2J0B A;  4G87 A;  4FCU A;  1NF5 B;  1H7G A;  4KRV A;  3V0P A;  1Z90 A;  2XMH A;  5FYE A;  2JCL A;  3FWW A;  3V91 A;  2AE7 A;  2PX7 A;  1GX4 A;  2ZU8 A;  4Y7U A;  3SXE A;  3BCV A;  5CMH A;  5CQL X;  3SX5 A;  5AJN A;  4HO0 A;  1R7X A;  1WT0 A;  4EE3 A;  2APC A;  2JCO A;  2XWN A;  3D8V A;  1FXJ A;  1VZT A;  2AH9 A;  1NHE B;  4FIX A;  1H5R A;  4FRO A;  2AGD A;  2QGI A;  3D98 A;  4M28 A;  3SX7 A;  3U2W A;  1VZX A;  2A8U A;  1R82 A;  4Y62 A;  3SX3 A;  1MP4 A;  1ZJO A;  4JD0 A;  3V0Q A;  1ZCV A;  4EE4 A;  5FTS A;  4HO4 A;  3HL3 A;  2RIZ A;  3PNN A;  1WT3 A;  3JTJ A;  3R3I A;  1YP2 A;  4Y7V A;  1OQM B;  2YQC A;  1FO8 A;  1HM9 A;  1NKH B;  1G9R A;  1INI A;  5C4E A;  3F1C A;  3U2U A;  3RMW A;  2VXL A;  3I0C A;  1FZW A;  3OC9 A;  4FRP A;  1H7F A;  1VIC A;  3OH4 A;  4KNR A;  4J18 A;  4EEG A;  1G1L A;  1H5R B;  4KPX A;  2V0I A;  3F1Y A;  5CMJ A;  2AM4 A;  1S4O A;  4HG6 A;  3CKV A;  2YC3 A;  1R81 A;  2J0A A;  5IFY A;  5CQM X;  2I5E A;  1FG5 N;  3I0J A;  2FYB A;  1ZI1 A;  1VH3 A;  5C3A A;  1LL3 A;  1FR9 A;  3KIA A;  1O0R A;  1G3L A;  4G3P A;  1V83 A;  2P73 A;  2X5Z A;  3CU0 A;  3PKP A;  3T7M A;  5C4B A;  5C4F A;  1VGW A;  1H4D A;  2RJ9 A;  1JVG A;  3Q7U A;  5C48 A;  4CJB A;  2FY7 A;  4D11 A;  1MP5 A;  4FRH A;  4AYL A;  3BRK X;  5EJZ A;  2ICY A;  3I0I X;  2RJ1 A;  4YS8 A;  3SPT A;  2RIX A;  2UX8 A;  3OH0 A;  1H4E A;  3TZT A;  4FIY A;  2C0N A;  1ZCY A;  4B2W A;  1ZJ2 A;  3I0F A;  4FRL A;  4EEA A;  2Y4K A;  2BO7 A;  3U2V A;  4FCE A;  1XZ6 A;  3I0K A;  4Y64 A;  2Y4M A;  4IRP A;  3K8E A;  4EE5 A;  3SXC A;  1YP4 A;  4AYJ A;  2V0J A;  2QH5 A;  2RJ4 A;  2V0L A;  4DDZ A;  2O1G A;  2YQJ A;  1HM0 A;  3SX8 A;  1TW5 A;  3TQD A;  5C3D A;  4FRA A;  3OKR A;  2VS3 A;  4AC3 A;  3E25 A;  1W55 A;  2XWM A;  1O7Q A;  1FXO A;  2V0H A;  4G3Q A;  5D91 A;  1S4N A;  3T7O A;  2YES A;  2ZU9 A;  4LW6 A;  4KXO A;  2WEE A;  1FGX A;  3R2W A;  1G97 A;  4KC2 A;  1H5S B;  2XWL A;  2D7I A;  3U2T A;  2YCM A;  4FRE A;  2A8W A;  3SXG A;  4AAW A;  1MP3 A;  2W0V A;  3CKJ A;  4CJ8 A;  2Y4J A;  2X5S A;  5L6V A;  4MND A;  2Z86 A;  2I5K A;  3N9W A;  4KC4 A;  4Y7G A;  3U0X A;  4D11 C;  4EEO A;  1ON6 A;  1LZJ A;  3RSB A;  5FU0 A;  1QG8 A;  4HCQ A;  1NQI B;  2MZB A;  4JIS A;  3I0H A;  1LZI A;  3E26 A;  3D5N A;  2Q4J A;  4P02 A;  1ZJ1 A;  1H7H A;  3U0Y A;  1G23 A;  3SXA A;  4Y63 A;  4E1K A;  3CGX A;  4FRM A;  1OMX A;  2FYC B;  4KT7 A;  4G3S A;  4KNX A;  3I0D A;  3U2X A;  1R7T A;  2V0K A;  1TZF A;  2P6W A;  1ZDG A;  5C8R A;  4Y9X A;  4HOC A;  4CJC A;  4B42 A;  3ZLL A;  1R7Y A;  5C47 A;  2OI5 A;  2GGO A;  4C2S A;  2XME A;  5JQQ A;  1KWS A;  3SXD A;  1TVY A;  1NMM B;  3LW6 A;  4ARW A;  5DDV A;  2OI6 A;  3OH3 A;  1H7E A;  3IOJ A;  1H5S D;  1O23 B;  1FRW A;  2GGQ A;  5L6S A;  1ZCT A;  4M2A A;  5EIY A;  3ZF8 A;  1ZCU A;  5EJ1 A;  5HS2 A;  1G95 A;  1OMZ A;  4FRQ A;  1GWV A;  1JV1 A; 
#chains in the Genus database with same CATH homology
 4MYB A;  1ZJ3 A;  3ZLK A;  1W77 A;  1PZT A;  4HO3 A;  3O3P A;  4M2B A;  3IOI A;  1I52 A;  2RIT A;  4LW3 A;  2D7R A;  4HO6 A;  5CMG X;  5CQP A;  4B3U A;  1EZI A;  2RJ5 A;  1H5S A;  4Q7C A;  3V0M A;  3ZGF A;  1FO9 A;  2RIY A;  4GBP A;  3GUE A;  2WVM A;  3SXB A;  4CVH A;  2Z87 A;  4NAK A;  5C1G A;  2I7B A;  2RJ0 A;  2X60 A;  1VZU A;  5CMI A;  2VK9 A;  2FFU A;  1H7T A;  1G0R A;  1MC3 A;  1E5K A;  1WSZ A;  1ZHJ A;  2VXM A;  1H3M A;  1JV3 A;  3Q4S A;  1HM8 A;  1R80 A;  2WVL A;  3I0L A;  2RJ6 A;  3V0L A;  4D0Z A;  1ZJP A;  2DPW A;  4K6R A;  1FR8 A;  3OH1 A;  3RMV A;  4D0T A;  2PGV A;  1GA8 A;  2AES A;  4MIX A;  4L41 C;  3FOQ A;  2BO6 A;  5C38 A;  5D92 A;  4ZDQ A;  3OAM A;  4DEC A;  1HJJ A;  3V90 A;  1FOA A;  2FFV A;  2E8B A;  3ZGG A;  2VSI A;  1VGZ A;  4FRB A;  5FV9 A;  4FRD A;  2D0J A;  5IDS A;  2VD4 A;  4R7P A;  4FQW A;  1ZI5 A;  1VGU A;  1JVD A;  1GWW A;  2Y4L A;  2X65 A;  1W57 A;  4KC1 A;  3CKO A;  1TW1 A;  3CKN A;  2VFZ A;  1LL2 A;  1VGT A;  2WE9 A;  5J49 A;  1GX0 A;  1V84 A;  2AM3 A;  3Q80 A;  2ICX A;  2O1F A;  3USR A;  3EE5 A;  1R7U A;  1HV9 A;  4B5B A;  3DJ4 A;  4Y7T A;  1H5T B;  4BQH A;  2W0W A;  2RJ7 A;  1WT1 A;  1WT2 A;  1G2V A;  1H7L A;  1WVC A;  2BO8 A;  4Y6N A;  1H5S C;  2PA4 A;  1QWJ A;  4EVW A;  2Y7A A;  2WAW A;  2FYA A;  5IDT A;  2QKX A;  1VH1 A;  3DK5 A;  5CMF X;  5AJP A;  4NAN A;  4NAI A;  2YQH A;  1FGG A;  4KPZ A;  1H4C A;  1NWG B;  1FWY A;  4O6M A;  4D48 A;  2JCK A;  1ZI4 A;  4HO9 A;  2AEC A;  1LVW A;  2ZU7 A;  2OI7 A;  3V8Z A;  5C1L A;  3IOH A;  1YP3 A;  3V0O A;  1QGQ A;  1R7V A;  2O1H A;  2Y6P A;  2AM5 A;  1LZ7 A;  1ZDF A;  3I0G A;  3PKQ A;  1GQ9 A;  1O7O A;  4HO8 A;  1LL0 A;  1ZI3 A;  3OH2 A;  1EYR A;  2NXV A;  3DUV A;  2WGZ A;  5FUH A;  4ASJ A;  2OEG A;  4B2X A;  1JYK A;  3CKQ A;  3V8Y A;  4BMA A;  5FU8 A;  1K4V A;  2VS5 A;  1VPA A;  4O6N A;  4B4M A;  3T7N A;  4Y7F A;  2FYD B;  5C3B A;  1VM8 A;  5C4D A;  1H7Q A;  1ON8 A;  4HO5 A;  3ST8 A;  4Y6U A;  5CQN X;  3JUJ A;  1PZY B;  4EEM A;  2VSH A;  2JCJ A;  2PGY A;  2VS4 A;  2CU2 A;  5C4C A;  1S4P A;  2P72 A;  1GQC A;  4IRQ A;  4ECM A;  1QGS A;  2YC5 A;  4B4B A;  1LZ0 A;  5FTV A;  5C49 A;  1IIN A;  4UEG A;  5BXC A;  4M4K A;  3K8D A;  1SS9 A;  5DDT A;  2WVK A;  2RJ8 A;  2E3D A;  4P00 A;  1INJ A;  4HO2 A;  3QVB A;  3OGZ A;  3JUK A;  1HJL A;  4ASY A;  5C36 A;  4DE7 A;  3NGW A;  1YRO B;  1ZIZ A;  2OEF A;  3USQ A;  2BO4 A;  5CQO A;  2YQS A;  4KQL A;  3POL A;  1G8O A;  3I0E A;  1XHB A;  5C1H A;  1JYL A;  1H5T A;  4NAL A;  3V0N A;  1G93 A;  1ZJ0 A;  1V82 A;  4B4G A;  5AJO A;  5I1F A;  4XWI A;  1IIM A;  2J0B A;  4G87 A;  4FCU A;  1NF5 B;  1H7G A;  4KRV A;  3V0P A;  1Z90 A;  2XMH A;  5FYE A;  2JCL A;  3FWW A;  3V91 A;  2AE7 A;  2PX7 A;  1GX4 A;  2ZU8 A;  4Y7U A;  3SXE A;  3BCV A;  5CMH A;  5CQL X;  3SX5 A;  5AJN A;  4HO0 A;  1R7X A;  1WT0 A;  4EE3 A;  2APC A;  2JCO A;  2XWN A;  3D8V A;  1FXJ A;  1VZT A;  2AH9 A;  1NHE B;  4FIX A;  1H5R A;  4FRO A;  2AGD A;  2QGI A;  3D98 A;  4M28 A;  3SX7 A;  3U2W A;  1VZX A;  2A8U A;  1R82 A;  4Y62 A;  3SX3 A;  1MP4 A;  1ZJO A;  4JD0 A;  3V0Q A;  1ZCV A;  4EE4 A;  5FTS A;  4HO4 A;  3HL3 A;  2RIZ A;  3PNN A;  1WT3 A;  3JTJ A;  3R3I A;  1YP2 A;  4Y7V A;  1OQM B;  2YQC A;  1FO8 A;  1HM9 A;  1NKH B;  1G9R A;  1INI A;  5C4E A;  3F1C A;  3U2U A;  3RMW A;  2VXL A;  3I0C A;  1FZW A;  3OC9 A;  4FRP A;  1H7F A;  1VIC A;  3OH4 A;  4KNR A;  4J18 A;  4EEG A;  1G1L A;  1H5R B;  4KPX A;  2V0I A;  3F1Y A;  5CMJ A;  2AM4 A;  1S4O A;  4HG6 A;  3CKV A;  2YC3 A;  1R81 A;  2J0A A;  5IFY A;  5CQM X;  2I5E A;  1FG5 N;  3I0J A;  2FYB A;  1ZI1 A;  1VH3 A;  5C3A A;  1LL3 A;  1FR9 A;  3KIA A;  1O0R A;  1G3L A;  4G3P A;  1V83 A;  2P73 A;  2X5Z A;  3CU0 A;  3PKP A;  3T7M A;  5C4B A;  5C4F A;  1VGW A;  1H4D A;  2RJ9 A;  1JVG A;  3Q7U A;  5C48 A;  4CJB A;  2FY7 A;  4D11 A;  1MP5 A;  4FRH A;  4AYL A;  3BRK X;  5EJZ A;  2ICY A;  3I0I X;  2RJ1 A;  4YS8 A;  3SPT A;  2RIX A;  2UX8 A;  3OH0 A;  1H4E A;  3TZT A;  4FIY A;  2C0N A;  1ZCY A;  4B2W A;  1ZJ2 A;  3I0F A;  4FRL A;  4EEA A;  2Y4K A;  2BO7 A;  3U2V A;  4FCE A;  1XZ6 A;  3I0K A;  4Y64 A;  2Y4M A;  4IRP A;  3K8E A;  4EE5 A;  3SXC A;  1YP4 A;  4AYJ A;  2V0J A;  2QH5 A;  2RJ4 A;  2V0L A;  4DDZ A;  2O1G A;  2YQJ A;  1HM0 A;  3SX8 A;  1TW5 A;  3TQD A;  5C3D A;  4FRA A;  3OKR A;  2VS3 A;  4AC3 A;  3E25 A;  1W55 A;  2XWM A;  1O7Q A;  1FXO A;  2V0H A;  4G3Q A;  5D91 A;  1S4N A;  3T7O A;  2YES A;  2ZU9 A;  4LW6 A;  4KXO A;  2WEE A;  1FGX A;  3R2W A;  1G97 A;  4KC2 A;  1H5S B;  2XWL A;  2D7I A;  3U2T A;  2YCM A;  4FRE A;  2A8W A;  3SXG A;  4AAW A;  1MP3 A;  2W0V A;  3CKJ A;  4CJ8 A;  2Y4J A;  2X5S A;  5L6V A;  4MND A;  2Z86 A;  2I5K A;  3N9W A;  4KC4 A;  4Y7G A;  3U0X A;  4D11 C;  4EEO A;  1ON6 A;  1LZJ A;  3RSB A;  5FU0 A;  1QG8 A;  4HCQ A;  1NQI B;  2MZB A;  4JIS A;  3I0H A;  1LZI A;  3E26 A;  3D5N A;  2Q4J A;  4P02 A;  1ZJ1 A;  1H7H A;  3U0Y A;  1G23 A;  3SXA A;  4Y63 A;  4E1K A;  3CGX A;  4FRM A;  1OMX A;  2FYC B;  4KT7 A;  4G3S A;  4KNX A;  3I0D A;  3U2X A;  1R7T A;  2V0K A;  1TZF A;  2P6W A;  1ZDG A;  5C8R A;  4Y9X A;  4HOC A;  4CJC A;  4B42 A;  3ZLL A;  1R7Y A;  5C47 A;  2OI5 A;  2GGO A;  4C2S A;  2XME A;  5JQQ A;  1KWS A;  3SXD A;  1TVY A;  1NMM B;  3LW6 A;  4ARW A;  5DDV A;  2OI6 A;  3OH3 A;  1H7E A;  3IOJ A;  1H5S D;  1O23 B;  1FRW A;  2GGQ A;  5L6S A;  1ZCT A;  4M2A A;  5EIY A;  3ZF8 A;  1ZCU A;  5EJ1 A;  5HS2 A;  1G95 A;  1OMZ A;  4FRQ A;  1GWV A;  1JV1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...