1MC9A

Strepromyces lividans xylan binding domain cbm13 in complex with xylopentaose
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
126
structure length
126
Chain Sequence
DGGQIKGVGSGRCLDVPDASTSDGTQLQLWDCHSGTNQQWAATDAGELRVYGDKCLDAAGTSNGSKVQIYSCWGGDNQKWRLNSDGSVVGVQSGLCLDAVGNGTANGTLIQLYTCSNGSNQRWTRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High-resolution crystal structures of the lectin-like xylan binding domain from Streptomyces lividans xylanase 10A with bound substrates reveal a novel mode of xylan binding.
pubmed doi rcsb
molecule keywords ENDO-1,4-BETA-XYLANASE A
molecule tags Hydrolase
source organism Streptomyces lividans
total genus 40
structure length 126
sequence length 126
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2002-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00652 Ricin_B_lectin Ricin-type beta-trefoil lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 1mc9A00
1MC9A 3ZXGA 4I3NA 3WA1A 4IZXA 3HSMA 1FGAA 3T8SA 3O4AA 1HCDA 1Z2VA 1PUUB 3I29B 3O4DA 3UJ4A 3FJEA 3IM5A 4H9WA 3AH1A 2GO2A 4ZA3B 1BA7A 4QKRA 4DCKC 3PHZA 5D62A 1K5VA 2NTDA 3NBNA 4Q9GA 3NBEA 3VSFA 4ZOTA 2Z48A 3CA0A 3O49A 2ERMA 4D0TA 3OJVA 3BRDA 3IIRA 2RG9B 1IILA 3BA4A 1HKNA 3FUOA 3AH2A 1N4KA 5FZZA 5FZYA 1FMMS 4JKQA 4D8HA 3AKGA 1IRPA 2FFUA 4F34A 4I4RA 3WO4A 3R4UA 1V6XA 2F2FA 3FJIA 4I6IA 4EKXB 3AKHA 3VT2A 3BAGA 4ISRA 5B2HA 4X38A 3LLPA 3AH4A 4I1EA 2D24A 1PUMB 1ISZA 2D23A 3PG0A 3RSJA 1EYLA 1AFCA 2KI6B 7I1BA 4ZFWB 1G9DA 1I1BA 4LO2C 4A7KA 21BIA 4P6AA 2AFGA 31BIA 3UJ0A 1TWEA 1ABRB 5BXRA 2GZBA 3AJ5A 4I4UA 1Z0HA 4I4QA 3ZXDA 4LO3C 1YXWA 2VSAA 5BVPI 4JAWA 1I1EA 3A21A 3CA4A 3UDAA 3UD7A 3RMXA 5F8SA 1JT7A 5F8YA 4I4YA 4ENDA 4J2YA 4IY9A 3BA5A 3IAGC 4G1RA 1P63A 4H04A 4KEJA 5F90A 1ISXA 3CAHA 3ZX7A 3H6QA 3WINA 1ILR1 4F83A 2ZQNA 2R9KB 1ISWA 2I1BA 5BP5C 2Y9WC 3FJDA 5G00A 4EFPA 3F62B 1SZ6B 3H6SE 2P39A 4DENA 4EB2B 3FGMA 1JT4A 2IHOA 3C9ZA 3HBWA 3P6JA 4KBBA 1ISYA 1FWVA 3BRFA 1TIEA 3FJAA 1GGPB 4KEIA 3BA7A 4P0JA 2ZQOA 3P6IA 3HALA 2Q3NB 4G6JA 4I4OA 1RG8A 1CE7B 1S0EA 1TTUA 4OWLA 1AVAC 4ZLBB 2K8RA 4KEKA 2D20A 3F1RA 2D1ZA 4JPZA 3N7MA 3A22A 1XZZA 4A7YA 4LO2A 4ZFUB 1Q03A 1V6UA 1DLLA 1MD6A 2D43A 2WRYA 2FDBM 3AZVA 1R8OA 2QYIB 4Q9PA 1RZOB 3CA3A 3JUTA 3OGFA 4IZEA 3V79C 3VSZA 2NYYA 3WO3A 6I1BA 4I4PA 4J23B 4GOYA 4LO0C 1DQGA 4CJMA 3V0BA 1BFCA 4GP3A 5BQUC 1Z4SA 3FJKA 1HCEA 3S8KA 4XFTA 2Y9FA 4QD2C 2VXRA 1BFFA 2BFHA 1BASA 3PMEA 1QQLA 4XKIA 5DSSB 1XYFA 1UPSA 3BAQA 3FFZA 3NBDA 3OGGA 5DVHA 4IY8A 3HOMA 1M2TB 5I1BA 2XOAA 1AVXB 4OW4A 8I1BA 3W9TA 1L2HA 3CA6A 3CRGA 2AXMA 4USOA 1EVTA 3AJ6A 5BP5A 4OWKA 1BLDA 3V0AA 1PZZA 4J2KA 1A8DA 1EPWA 1AF9A 3CA1A 4YOLA 2NP0A 4X39A 5JMCA 1BARA 4QBVA 2RQ9A 1S0BA 4I4XA 4J2SA 9ILBA 4LO1C 3BB2A 4QC4A 2BEAA 4P0LA 4JKXB 1V6VA 4USPA 1T4QA 4I37A 1XG6A 1DJSB 4LO7B 5HPZA 1W3AA 1DQOA 3CRHA 4HR6C 2E4MA 3H6RA 4G9MA 4I7IA 3E8LC 2KKIA 3ZC8A 1HWOB 4OEEA 1FWUA 3FUQA 2KH2A 4I96A 3VUOA 1TFMB 3A23A 1VCLA 4AN7B 1G9BA 3OJMA 4I8MA 4ISQA 1DZCA 5BXPA 4JRAA 1XHBA 4IQPA 4Z8SB 5GAQA 1JLYA 5EC5A 1Q04A 1SR4C 4DEPA 1AXMA 1V6WA 3MALA 2DREA 3BAVA 1ISVA 1WBCA 4OEGA 1QXMA 3FJCA 2LIEA 1YBIA 3NJ5A 4FVVA 2FFVA 4Z9WB 5EG6C 2FO1A 2Y9XE 2Y9GA 4KC3A 2D7RA 2MC2A 3S8JA 4ZFYB 4G9NA 2HW9A 3O4OA 1JLXA 3IM6A 2AAIB 1YTOA 2Z49A 1OQLB 3UD8A 1TOOA 4FGFA 3O44A 5JLVA 1RY7A 3ZC9A 4IYBA 1S0LA 5BOWA 3CU1B 4LO8B 1PWAA 1Q1UA 3HN1A 4I2SA 1IRAX 1F31A 4HJJA 3BTAA 1FN0A 4II0A 4PC4A 4D0ZA 3FJ9A 1QQKA 2AQZA 2VU9A 3WO2A 4I1BA 2DRYA 3VT1A 3V0BB 2LIQA 1RMLA 4I4SA 2DRZA 4XFSA 2WBCA 3O4CA 3AZWA 4LO7C 4LO3A 2J3PA 3FJ8A 3KMVA 1IJTA 3D7WB 4WBCA 2X2TA 1WBAA 1DFCA 4I0YA 5BXSA 1YF8B 3SNVA 3BAHA 4L4HA 2MIBA 3Q7WA 4OWJA 2HWAA 3QYDA 1JY0A 2RSTA 1R8NA 3PUBA 1TP0A 3V0AB 1ONKB 3WINC 1SR4A 1HWMB 3CA5A 1PC8B 5BXTA 3HMYA 4EFQA 1W3GA 3MPPG 2KLLA 2VLCA 3O5WB 4AN6A 5D61A 1IHKA 2NZ9A 2ZR1B 2F8XC 4X3AA 4OUJA 3P53A 4GAIA 1FQ9A 1DFQA 1G9CA 1AVWB 4R6UB 4I4VA 4TLPA 2L5XA 1DIWA 1HWPB 3FJFA 2Q9XA 3IM7A 4GAFA 3N7KA 1JT3A 1TWMA 2VUAA 3QR5A 3UD9A 1FV3A 1G9AA 3RTJB 4J2XA 1NUNA 1HWNB 3FJBA 3JRRA 1DZDA 1BFBA 3H6RB 2D44A 2ET2A 1KNMA 2K43A 5D63A 3O3QA 4XFUA 3NBCA 1D0HA 1S0DA 3RTIB 3OBRA 4X37A 1ITBA 3OBTA 1FV2A 1S0FA 4P0KA 3BRGC 3CRIA 3I2AA 5FNXA 5EHAA 3VWCA 3N7JA 5FNWA 2VXTI 2QN4A 4EFRA 1FMZA 3EF2A 1II4A 3BAOA 2NM1A 2D22A 3WMUA 5E24E 1WD3A 4LO0A 2YUGA 1G82A 1JT5A 4QD2B 1T9FA 1YYNA 2K4AB 1M16A 2HZ9A 1BFGA 1E0OA 1IOBA 2IWTB 3FJHA 3N0KA 5BQUA 4JQ0A 3POKA 4IONA 4G6MA 3Q7YA 4QBCA 4Q91A 2MLLB 4ZKTB 2DS0A 4QKSA 1JTCA 1CVSA 1EV2A 2NVHA 4EEEB 2P23A 3B9UA 3A07A 3OJ2A 4GOVA 41BIA 4GP0A 3FJJA 3ILAA 3CQAA 1S0GA 1NZKA 4IHZA 3WMVA 1WD4A 4QALA 1S0CA 1K5UA 4JP0A 3VEQA 2F2FC 3AKIA 1IT0A 3N7LA 4OEFA 4ZBVB 5FZUA 1HIBA 4ZGRB 4QO3A 5DZUA 4HA2A 1J0SA 3VT0A 3LTQA 2VSEA 2X2SA 3I2XA 3BX1C 1AVUA 3Q7XA 4LO1A 2KI4A 1W3FA 4A7ZA 3AKFA 2HWMA 1JQZA 2FGFA 3RMYA 3R4SA 3K1XA 3BADA 3TC2A 3O4BA 2D7IA 2E4MC 2M49A 2ESUA 5DUYA 4L4IA 2BEBA 5F8WA 2UUSA 1BLAA 3BAUA
chains in the Genus database with same CATH superfamily
1MC9A 3ZXGA 4I3NA 3WA1A 4IZXA 3HSMA 1FGAA 3T8SA 3O4AA 1HCDA 1Z2VA 1PUUB 3I29B 3O4DA 3UJ4A 3FJEA 3IM5A 4H9WA 3AH1A 2GO2A 4ZA3B 1BA7A 4QKRA 4DCKC 3PHZA 5D62A 1K5VA 2NTDA 3NBNA 4MZFB 4Q9GA 3NBEA 3VSFA 4ZOTA 2Z48A 3CA0A 3O49A 2ERMA 4D0TA 3OJVA 3BRDA 3IIRA 2RG9B 1IILA 3BA4A 1HKNA 3FUOA 4MZHA 3AH2A 1N4KA 5FZZA 5FZYA 1FMMS 4JKQA 4D8HA 3AKGA 1IRPA 2FFUA 4F34A 4I4RA 3WO4A 3R4UA 1V6XA 2F2FA 3FJIA 4I6IA 4EKXB 3AKHA 3VT2A 3BAGA 4ISRA 5B2HA 4X38A 3LLPA 3AH4A 4I1EA 2D24A 1PUMB 1ISZA 2D23A 3PG0A 3RSJA 1EYLA 1AFCA 2KI6B 7I1BA 4ZFWB 1G9DA 1I1BA 4LO2C 4A7KA 21BIA 4P6AA 2AFGA 31BIA 3UJ0A 1TWEA 1ABRB 5BXRA 2GZBA 3AJ5A 4I4UA 1Z0HA 4I4QA 3ZXDA 4LO3C 1YXWA 2VSAA 5BVPI 4JAWA 1I1EA 3A21A 3CA4A 3UDAA 3UD7A 3RMXA 5F8SA 1JT7A 5F8YA 4I4YA 4ENDA 4J2YA 4IY9A 3BA5A 3IAGC 4G1RA 1P63A 4H04A 4KEJA 5F90A 1ISXA 3CAHA 3ZX7A 3H6QA 2NS2A 3WINA 1ILR1 4F83A 2ZQNA 2R9KB 1ISWA 2I1BA 5BP5C 2Y9WC 3FJDA 5G00A 4EFPA 3F62B 1SZ6B 3H6SE 2P39A 4DENA 4EB2B 3FGMA 1JT4A 2IHOA 3C9ZA 3HBWA 3P6JA 4KBBA 1ISYA 1FWVA 3BRFA 1TIEA 3FJAA 1GGPB 4KEIA 3BA7A 4P0JA 2ZQOA 3P6IA 3HALA 2Q3NB 4G6JA 4I4OA 1RG8A 1CE7B 1S0EA 1TTUA 4OWLA 1AVAC 4ZLBB 2K8RA 4KEKA 2D20A 3F1RA 2D1ZA 4JPZA 3N7MA 3A22A 1XZZA 4A7YA 4LO2A 4ZFUB 1Q03A 1V6UA 1DLLA 1MD6A 2D43A 2WRYA 2FDBM 3AZVA 1R8OA 2QYIB 4Q9PA 1RZOB 3CA3A 3JUTA 3OGFA 4IZEA 3V79C 3VSZA 2NYYA 3WO3A 6I1BA 4I4PA 4J23B 4GOYA 4LO0C 1DQGA 4CJMA 3V0BA 1BFCA 4GP3A 5BQUC 4H75A 1Z4SA 3FJKA 1HCEA 3S8KA 4XFTA 2Y9FA 4QD2C 2VXRA 1BFFA 2BFHA 1BASA 3PMEA 1QQLA 4XKIA 5DSSB 1XYFA 1UPSA 3BAQA 3FFZA 3NBDA 3OGGA 5DVHA 4IY8A 3HOMA 1M2TB 5I1BA 2XOAA 1AVXB 4OW4A 8I1BA 3W9TA 1L2HA 3CA6A 3CRGA 2AXMA 4USOA 1EVTA 3AJ6A 5BP5A 4OWKA 1BLDA 3V0AA 1PZZA 4J2KA 1A8DA 1EPWA 1AF9A 3CA1A 4YOLA 2NP0A 4X39A 5JMCA 1BARA 4QBVA 2RQ9A 1S0BA 4I4XA 4J2SA 9ILBA 4LO1C 3BB2A 4QC4A 2BEAA 4P0LA 4JKXB 1V6VA 4USPA 1T4QA 4I37A 1XG6A 1DJSB 4LO7B 5HPZA 1W3AA 1DQOA 3CRHA 4HR6C 2E4MA 3H6RA 4G9MA 4I7IA 3E8LC 2KKIA 3ZC8A 1HWOB 4MZGB 4OEEA 1FWUA 3FUQA 2KH2A 4I96A 3VUOA 1TFMB 3A23A 1VCLA 4AN7B 1G9BA 3OJMA 4I8MA 4ISQA 1DZCA 5BXPA 4JRAA 1XHBA 4IQPA 4Z8SB 5GAQA 1JLYA 5EC5A 1Q04A 1SR4C 4DEPA 1AXMA 1V6WA 3MALA 2DREA 3BAVA 1ISVA 1WBCA 4OEGA 1QXMA 3FJCA 2LIEA 1YBIA 3NJ5A 4FVVA 2FFVA 4Z9WB 5EG6C 2FO1A 2Y9XE 2Y9GA 4KC3A 2D7RA 2MC2A 3S8JA 4ZFYB 4G9NA 2HW9A 3O4OA 1JLXA 3IM6A 2AAIB 1YTOA 2Z49A 1OQLB 3UD8A 1TOOA 4FGFA 3O44A 5JLVA 1RY7A 3ZC9A 4IYBA 1S0LA 5BOWA 3CU1B 4LO8B 1PWAA 1Q1UA 3HN1A 4I2SA 1IRAX 1F31A 4HJJA 3BTAA 1FN0A 4II0A 4PC4A 4D0ZA 3FJ9A 1QQKA 2AQZA 2VU9A 3WO2A 4I1BA 2DRYA 3VT1A 3V0BB 2LIQA 1RMLA 4I4SA 2DRZA 4XFSA 2WBCA 3O4CA 3AZWA 4LO7C 4LO3A 2J3PA 3FJ8A 3KMVA 1IJTA 3D7WB 4WBCA 2X2TA 1WBAA 1DFCA 4I0YA 5BXSA 1YF8B 3SNVA 4UY4A 3BAHA 4L4HA 2MIBA 3Q7WA 4OWJA 2HWAA 3QYDA 1JY0A 2RSTA 1R8NA 3PUBA 1TP0A 3V0AB 1ONKB 3WINC 1SR4A 1HWMB 3CA5A 1PC8B 5BXTA 3HMYA 4EFQA 1W3GA 3MPPG 2KLLA 2VLCA 3O5WB 4AN6A 5D61A 1IHKA 2NZ9A 2ZR1B 2F8XC 4X3AA 4OUJA 3P53A 4GAIA 1FQ9A 1DFQA 1G9CA 1AVWB 4R6UB 4I4VA 4TLPA 2L5XA 1DIWA 1HWPB 3FJFA 2Q9XA 3IM7A 4GAFA 3N7KA 1JT3A 1TWMA 2VUAA 3QR5A 3UD9A 1FV3A 1G9AA 3RTJB 4J2XA 1NUNA 1HWNB 3FJBA 3JRRA 1DZDA 1BFBA 3H6RB 2D44A 2ET2A 1KNMA 2K43A 5D63A 3O3QA 4XFUA 3NBCA 1D0HA 1S0DA 3RTIB 3OBRA 4X37A 1ITBA 3OBTA 1FV2A 1S0FA 4P0KA 3BRGC 3CRIA 3I2AA 5FNXA 5EHAA 3VWCA 3N7JA 5FNWA 2VXTI 2QN4A 4EFRA 1FMZA 3EF2A 1II4A 3BAOA 2NM1A 2D22A 3WMUA 5E24E 1WD3A 4LO0A 2YUGA 1G82A 1JT5A 4QD2B 1T9FA 1YYNA 2K4AB 1M16A 2HZ9A 1BFGA 1E0OA 1IOBA 2IWTB 3FJHA 3N0KA 5BQUA 4JQ0A 3POKA 4IONA 4G6MA 3Q7YA 4QBCA 4Q91A 2MLLB 4ZKTB 2DS0A 4QKSA 1JTCA 1CVSA 1EV2A 2NVHA 4EEEB 2P23A 3B9UA 3A07A 3OJ2A 4GOVA 41BIA 4GP0A 3FJJA 3ILAA 3CQAA 1S0GA 1NZKA 4IHZA 3WMVA 1WD4A 4QALA 1S0CA 1K5UA 4JP0A 3VEQA 2F2FC 3AKIA 1IT0A 3N7LA 4OEFA 4ZBVB 5FZUA 1HIBA 4ZGRB 4QO3A 5DZUA 4HA2A 1J0SA 3VT0A 3LTQA 2VSEA 2X2SA 3I2XA 3BX1C 1AVUA 3Q7XA 4LO1A 2KI4A 1W3FA 4A7ZA 3AKFA 2HWMA 1JQZA 2FGFA 3RMYA 3R4SA 3K1XA 3BADA 3TC2A 3O4BA 2D7IA 2E4MC 2M49A 2ESUA 5DUYA 4L4IA 2BEBA 5F8WA 2UUSA 1BLAA 3BAUA
chains in the Genus database with same CATH topology
1MC9A 3ZXGA 4I3NA 3WA1A 4IZXA 3HSMA 1FGAA 3T8SA 3O4AA 1HCDA 1Z2VA 1PUUB 3I29B 3O4DA 3UJ4A 3FJEA 3IM5A 4H9WA 3AH1A 2GO2A 4ZA3B 1BA7A 4QKRA 4DCKC 3PHZA 5D62A 1K5VA 2NTDA 3NBNA 4MZFB 4Q9GA 3NBEA 3VSFA 4ZOTA 2Z48A 3CA0A 3O49A 2ERMA 4D0TA 3OJVA 3BRDA 3IIRA 2RG9B 1IILA 3BA4A 1HKNA 3FUOA 4MZHA 3AH2A 1N4KA 5FZZA 5FZYA 1FMMS 4JKQA 4D8HA 3AKGA 1IRPA 2FFUA 4F34A 4I4RA 3WO4A 3R4UA 1V6XA 2F2FA 3FJIA 4I6IA 4EKXB 3AKHA 3VT2A 3BAGA 4ISRA 5B2HA 4X38A 3LLPA 3AH4A 4I1EA 2D24A 1PUMB 1ISZA 2D23A 3PG0A 3RSJA 1EYLA 1AFCA 2KI6B 7I1BA 4ZFWB 1G9DA 1I1BA 4LO2C 4A7KA 21BIA 4P6AA 2AFGA 31BIA 3UJ0A 1TWEA 1ABRB 5BXRA 2GZBA 3AJ5A 4I4UA 1Z0HA 4I4QA 3ZXDA 4LO3C 1YXWA 2VSAA 5BVPI 4JAWA 1I1EA 3A21A 3CA4A 3UDAA 3UD7A 3RMXA 5F8SA 1JT7A 5F8YA 4I4YA 4ENDA 4J2YA 4IY9A 3BA5A 3IAGC 4G1RA 1P63A 4H04A 4KEJA 5F90A 1ISXA 3CAHA 3ZX7A 3H6QA 2NS2A 3WINA 1ILR1 4F83A 2ZQNA 2R9KB 1ISWA 2I1BA 5BP5C 2Y9WC 3FJDA 5G00A 4EFPA 3F62B 1SZ6B 3H6SE 2P39A 4DENA 4EB2B 3FGMA 1JT4A 2IHOA 3C9ZA 3HBWA 3P6JA 4KBBA 1ISYA 1FWVA 3BRFA 1TIEA 3FJAA 1GGPB 4KEIA 3BA7A 4P0JA 2ZQOA 3P6IA 3HALA 2Q3NB 4G6JA 4I4OA 1RG8A 1CE7B 1S0EA 1TTUA 4OWLA 1AVAC 4ZLBB 2K8RA 4KEKA 2D20A 3F1RA 2D1ZA 4JPZA 3N7MA 3A22A 1XZZA 4A7YA 4LO2A 4ZFUB 1Q03A 1V6UA 1DLLA 1MD6A 2D43A 2WRYA 2FDBM 3AZVA 1R8OA 2QYIB 4Q9PA 1RZOB 3CA3A 3JUTA 3OGFA 4IZEA 3V79C 3VSZA 2NYYA 3WO3A 6I1BA 4I4PA 4J23B 4GOYA 4LO0C 1DQGA 4CJMA 3V0BA 1BFCA 4GP3A 5BQUC 4H75A 1Z4SA 3FJKA 1HCEA 3S8KA 4XFTA 2Y9FA 4QD2C 2VXRA 1BFFA 2BFHA 1BASA 3PMEA 1QQLA 4XKIA 5DSSB 1XYFA 1UPSA 3BAQA 3FFZA 3NBDA 3OGGA 5DVHA 4IY8A 3HOMA 1M2TB 5I1BA 2XOAA 1AVXB 4OW4A 8I1BA 3W9TA 1L2HA 3CA6A 3CRGA 2AXMA 4USOA 1EVTA 3AJ6A 5BP5A 4OWKA 1BLDA 3V0AA 1PZZA 4J2KA 1A8DA 1EPWA 1AF9A 3CA1A 4YOLA 2NP0A 4X39A 5JMCA 1BARA 4QBVA 2RQ9A 1S0BA 4I4XA 4J2SA 9ILBA 4LO1C 3BB2A 4QC4A 2BEAA 4P0LA 4JKXB 1V6VA 4USPA 1T4QA 4I37A 1XG6A 1DJSB 4LO7B 5HPZA 1W3AA 1DQOA 3CRHA 4HR6C 2E4MA 3H6RA 4G9MA 4I7IA 3E8LC 2KKIA 3ZC8A 1HWOB 4MZGB 4OEEA 1FWUA 3FUQA 2KH2A 4I96A 3VUOA 1TFMB 3A23A 1VCLA 4AN7B 1G9BA 3OJMA 4I8MA 4ISQA 1DZCA 5BXPA 4JRAA 1XHBA 4IQPA 4Z8SB 5GAQA 1JLYA 5EC5A 1Q04A 1SR4C 4DEPA 1AXMA 1V6WA 3MALA 2DREA 3BAVA 1ISVA 1WBCA 4OEGA 1QXMA 3FJCA 2LIEA 1YBIA 3NJ5A 4FVVA 2FFVA 4Z9WB 5EG6C 2FO1A 2Y9XE 2Y9GA 4KC3A 2D7RA 2MC2A 3S8JA 4ZFYB 4G9NA 2HW9A 3O4OA 1JLXA 3IM6A 2AAIB 1YTOA 2Z49A 1OQLB 3UD8A 1TOOA 4FGFA 3O44A 5JLVA 1RY7A 3ZC9A 4IYBA 1S0LA 5BOWA 3CU1B 4LO8B 1PWAA 1Q1UA 3HN1A 4I2SA 1IRAX 1F31A 4HJJA 3BTAA 1FN0A 4II0A 4PC4A 4D0ZA 3FJ9A 1QQKA 2AQZA 2VU9A 3WO2A 4I1BA 2DRYA 3VT1A 3V0BB 2LIQA 1RMLA 4I4SA 2DRZA 4XFSA 2WBCA 3O4CA 3AZWA 4LO7C 4LO3A 2J3PA 3FJ8A 3KMVA 1IJTA 3D7WB 4WBCA 2X2TA 1WBAA 1DFCA 4I0YA 5BXSA 1YF8B 3SNVA 4UY4A 3BAHA 4L4HA 2MIBA 3Q7WA 4OWJA 2HWAA 3QYDA 1JY0A 2RSTA 1R8NA 3PUBA 1TP0A 3V0AB 1ONKB 3WINC 1SR4A 1HWMB 3CA5A 1PC8B 5BXTA 3HMYA 4EFQA 1W3GA 3MPPG 2KLLA 2VLCA 3O5WB 4AN6A 5D61A 1IHKA 2NZ9A 2ZR1B 2F8XC 4X3AA 4OUJA 3P53A 4GAIA 1FQ9A 1DFQA 1G9CA 1AVWB 4R6UB 4I4VA 4TLPA 2L5XA 1DIWA 1HWPB 3FJFA 2Q9XA 3IM7A 4GAFA 3N7KA 1JT3A 1TWMA 2VUAA 3QR5A 3UD9A 1FV3A 1G9AA 3RTJB 4J2XA 1NUNA 1HWNB 3FJBA 3JRRA 1DZDA 1BFBA 3H6RB 2D44A 2ET2A 1KNMA 2K43A 5D63A 3O3QA 4XFUA 3NBCA 1D0HA 1S0DA 3RTIB 3OBRA 4X37A 1ITBA 3OBTA 1FV2A 1S0FA 4P0KA 3BRGC 3CRIA 3I2AA 5FNXA 5EHAA 3VWCA 3N7JA 5FNWA 2VXTI 2QN4A 4EFRA 1FMZA 3EF2A 1II4A 3BAOA 2NM1A 2D22A 3WMUA 5E24E 1WD3A 4LO0A 2YUGA 1G82A 1JT5A 4QD2B 1T9FA 1YYNA 2K4AB 1M16A 2HZ9A 1BFGA 1E0OA 1IOBA 2IWTB 3FJHA 3N0KA 5BQUA 4JQ0A 3POKA 4IONA 4G6MA 3Q7YA 4QBCA 4Q91A 2MLLB 4ZKTB 2DS0A 4QKSA 1JTCA 1CVSA 1EV2A 2NVHA 4EEEB 2P23A 3B9UA 3A07A 3OJ2A 4GOVA 41BIA 4GP0A 3FJJA 3ILAA 3CQAA 1S0GA 1NZKA 4IHZA 3WMVA 1WD4A 4QALA 1S0CA 1K5UA 4JP0A 3VEQA 2F2FC 3AKIA 1IT0A 3N7LA 4OEFA 4ZBVB 5FZUA 1HIBA 4ZGRB 4QO3A 5DZUA 4HA2A 1J0SA 3VT0A 3LTQA 2VSEA 2X2SA 3I2XA 3BX1C 1AVUA 3Q7XA 4LO1A 2KI4A 1W3FA 4A7ZA 3AKFA 2HWMA 1JQZA 2FGFA 3RMYA 3R4SA 3K1XA 3BADA 3TC2A 3O4BA 2D7IA 2E4MC 2M49A 2ESUA 5DUYA 4L4IA 2BEBA 5F8WA 2UUSA 1BLAA 3BAUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MC9 A;  3ZXG A;  4I3N A;  3WA1 A;  4IZX A;  3HSM A;  1FGA A;  3T8S A;  3O4A A;  1HCD A;  1Z2V A;  1PUU B;  3I29 B;  3O4D A;  3UJ4 A;  3FJE A;  3IM5 A;  4H9W A;  3AH1 A;  2GO2 A;  4ZA3 B;  1BA7 A;  4QKR A;  4DCK C;  3PHZ A;  5D62 A;  1K5V A;  2NTD A;  3NBN A;  4Q9G A;  3NBE A;  3VSF A;  4ZOT A;  2Z48 A;  3CA0 A;  3O49 A;  2ERM A;  4D0T A;  3OJV A;  3BRD A;  3IIR A;  2RG9 B;  1IIL A;  3BA4 A;  1HKN A;  3FUO A;  3AH2 A;  1N4K A;  5FZZ A;  5FZY A;  1FMM S;  4JKQ A;  4D8H A;  3AKG A;  1IRP A;  2FFU A;  4F34 A;  4I4R A;  3WO4 A;  3R4U A;  1V6X A;  2F2F A;  3FJI A;  4I6I A;  4EKX B;  3AKH A;  3VT2 A;  3BAG A;  4ISR A;  5B2H A;  4X38 A;  3LLP A;  3AH4 A;  4I1E A;  2D24 A;  1PUM B;  1ISZ A;  2D23 A;  3PG0 A;  3RSJ A;  1EYL A;  1AFC A;  2KI6 B;  7I1B A;  4ZFW B;  1G9D A;  1I1B A;  4LO2 C;  4A7K A;  21BI A;  4P6A A;  2AFG A;  31BI A;  3UJ0 A;  1TWE A;  1ABR B;  5BXR A;  2GZB A;  3AJ5 A;  4I4U A;  1Z0H A;  4I4Q A;  3ZXD A;  4LO3 C;  1YXW A;  2VSA A;  5BVP I;  4JAW A;  1I1E A;  3A21 A;  3CA4 A;  3UDA A;  3UD7 A;  3RMX A;  5F8S A;  1JT7 A;  5F8Y A;  4I4Y A;  4END A;  4J2Y A;  4IY9 A;  3BA5 A;  3IAG C;  4G1R A;  1P63 A;  4H04 A;  4KEJ A;  5F90 A;  1ISX A;  3CAH A;  3ZX7 A;  3H6Q A;  3WIN A;  1ILR 1;  4F83 A;  2ZQN A;  2R9K B;  1ISW A;  2I1B A;  5BP5 C;  2Y9W C;  3FJD A;  5G00 A;  4EFP A;  3F62 B;  1SZ6 B;  3H6S E;  2P39 A;  4DEN A;  4EB2 B;  3FGM A;  1JT4 A;  2IHO A;  3C9Z A;  3HBW A;  3P6J A;  4KBB A;  1ISY A;  1FWV A;  3BRF A;  1TIE A;  3FJA A;  1GGP B;  4KEI A;  3BA7 A;  4P0J A;  2ZQO A;  3P6I A;  3HAL A;  2Q3N B;  4G6J A;  4I4O A;  1RG8 A;  1CE7 B;  1S0E A;  1TTU A;  4OWL A;  1AVA C;  4ZLB B;  2K8R A;  4KEK A;  2D20 A;  3F1R A;  2D1Z A;  4JPZ A;  3N7M A;  3A22 A;  1XZZ A;  4A7Y A;  4LO2 A;  4ZFU B;  1Q03 A;  1V6U A;  1DLL A;  1MD6 A;  2D43 A;  2WRY A;  2FDB M;  3AZV A;  1R8O A;  2QYI B;  4Q9P A;  1RZO B;  3CA3 A;  3JUT A;  3OGF A;  4IZE A;  3V79 C;  3VSZ A;  2NYY A;  3WO3 A;  6I1B A;  4I4P A;  4J23 B;  4GOY A;  4LO0 C;  1DQG A;  4CJM A;  3V0B A;  1BFC A;  4GP3 A;  5BQU C;  1Z4S A;  3FJK A;  1HCE A;  3S8K A;  4XFT A;  2Y9F A;  4QD2 C;  2VXR A;  1BFF A;  2BFH A;  1BAS A;  3PME A;  1QQL A;  4XKI A;  5DSS B;  1XYF A;  1UPS A;  3BAQ A;  3FFZ A;  3NBD A;  3OGG A;  5DVH A;  4IY8 A;  3HOM A;  1M2T B;  5I1B A;  2XOA A;  1AVX B;  4OW4 A;  8I1B A;  3W9T A;  1L2H A;  3CA6 A;  3CRG A;  2AXM A;  4USO A;  1EVT A;  3AJ6 A;  5BP5 A;  4OWK A;  1BLD A;  3V0A A;  1PZZ A;  4J2K A;  1A8D A;  1EPW A;  1AF9 A;  3CA1 A;  4YOL A;  2NP0 A;  4X39 A;  5JMC A;  1BAR A;  4QBV A;  2RQ9 A;  1S0B A;  4I4X A;  4J2S A;  9ILB A;  4LO1 C;  3BB2 A;  4QC4 A;  2BEA A;  4P0L A;  4JKX B;  1V6V A;  4USP A;  1T4Q A;  4I37 A;  1XG6 A;  1DJS B;  4LO7 B;  5HPZ A;  1W3A A;  1DQO A;  3CRH A;  4HR6 C;  2E4M A;  3H6R A;  4G9M A;  4I7I A;  3E8L C;  2KKI A;  3ZC8 A;  1HWO B;  4OEE A;  1FWU A;  3FUQ A;  2KH2 A;  4I96 A;  3VUO A;  1TFM B;  3A23 A;  1VCL A;  4AN7 B;  1G9B A;  3OJM A;  4I8M A;  4ISQ A;  1DZC A;  5BXP A;  4JRA A;  1XHB A;  4IQP A;  4Z8S B;  5GAQ A;  1JLY A;  5EC5 A;  1Q04 A;  1SR4 C;  4DEP A;  1AXM A;  1V6W A;  3MAL A;  2DRE A;  3BAV A;  1ISV A;  1WBC A;  4OEG A;  1QXM A;  3FJC A;  2LIE A;  1YBI A;  3NJ5 A;  4FVV A;  2FFV A;  4Z9W B;  5EG6 C;  2FO1 A;  2Y9X E;  2Y9G A;  4KC3 A;  2D7R A;  2MC2 A;  3S8J A;  4ZFY B;  4G9N A;  2HW9 A;  3O4O A;  1JLX A;  3IM6 A;  2AAI B;  1YTO A;  2Z49 A;  1OQL B;  3UD8 A;  1TOO A;  4FGF A;  3O44 A;  5JLV A;  1RY7 A;  3ZC9 A;  4IYB A;  1S0L A;  5BOW A;  3CU1 B;  4LO8 B;  1PWA A;  1Q1U A;  3HN1 A;  4I2S A;  1IRA X;  1F31 A;  4HJJ A;  3BTA A;  1FN0 A;  4II0 A;  4PC4 A;  4D0Z A;  3FJ9 A;  1QQK A;  2AQZ A;  2VU9 A;  3WO2 A;  4I1B A;  2DRY A;  3VT1 A;  3V0B B;  2LIQ A;  1RML A;  4I4S A;  2DRZ A;  4XFS A;  2WBC A;  3O4C A;  3AZW A;  4LO7 C;  4LO3 A;  2J3P A;  3FJ8 A;  3KMV A;  1IJT A;  3D7W B;  4WBC A;  2X2T A;  1WBA A;  1DFC A;  4I0Y A;  5BXS A;  1YF8 B;  3SNV A;  3BAH A;  4L4H A;  2MIB A;  3Q7W A;  4OWJ A;  2HWA A;  3QYD A;  1JY0 A;  2RST A;  1R8N A;  3PUB A;  1TP0 A;  3V0A B;  1ONK B;  3WIN C;  1SR4 A;  1HWM B;  3CA5 A;  1PC8 B;  5BXT A;  3HMY A;  4EFQ A;  1W3G A;  3MPP G;  2KLL A;  2VLC A;  3O5W B;  4AN6 A;  5D61 A;  1IHK A;  2NZ9 A;  2ZR1 B;  2F8X C;  4X3A A;  4OUJ A;  3P53 A;  4GAI A;  1FQ9 A;  1DFQ A;  1G9C A;  1AVW B;  4R6U B;  4I4V A;  4TLP A;  2L5X A;  1DIW A;  1HWP B;  3FJF A;  2Q9X A;  3IM7 A;  4GAF A;  3N7K A;  1JT3 A;  1TWM A;  2VUA A;  3QR5 A;  3UD9 A;  1FV3 A;  1G9A A;  3RTJ B;  4J2X A;  1NUN A;  1HWN B;  3FJB A;  3JRR A;  1DZD A;  1BFB A;  3H6R B;  2D44 A;  2ET2 A;  1KNM A;  2K43 A;  5D63 A;  3O3Q A;  4XFU A;  3NBC A;  1D0H A;  1S0D A;  3RTI B;  3OBR A;  4X37 A;  1ITB A;  3OBT A;  1FV2 A;  1S0F A;  4P0K A;  3BRG C;  3CRI A;  3I2A A;  5FNX A;  5EHA A;  3VWC A;  3N7J A;  5FNW A;  2VXT I;  2QN4 A;  4EFR A;  1FMZ A;  3EF2 A;  1II4 A;  3BAO A;  2NM1 A;  2D22 A;  3WMU A;  5E24 E;  1WD3 A;  4LO0 A;  2YUG A;  1G82 A;  1JT5 A;  4QD2 B;  1T9F A;  1YYN A;  2K4A B;  1M16 A;  2HZ9 A;  1BFG A;  1E0O A;  1IOB A;  2IWT B;  3FJH A;  3N0K A;  5BQU A;  4JQ0 A;  3POK A;  4ION A;  4G6M A;  3Q7Y A;  4QBC A;  4Q91 A;  2MLL B;  4ZKT B;  2DS0 A;  4QKS A;  1JTC A;  1CVS A;  1EV2 A;  2NVH A;  4EEE B;  2P23 A;  3B9U A;  3A07 A;  3OJ2 A;  4GOV A;  41BI A;  4GP0 A;  3FJJ A;  3ILA A;  3CQA A;  1S0G A;  1NZK A;  4IHZ A;  3WMV A;  1WD4 A;  4QAL A;  1S0C A;  1K5U A;  4JP0 A;  3VEQ A;  2F2F C;  3AKI A;  1IT0 A;  3N7L A;  4OEF A;  4ZBV B;  5FZU A;  1HIB A;  4ZGR B;  4QO3 A;  5DZU A;  4HA2 A;  1J0S A;  3VT0 A;  3LTQ A;  2VSE A;  2X2S A;  3I2X A;  3BX1 C;  1AVU A;  3Q7X A;  4LO1 A;  2KI4 A;  1W3F A;  4A7Z A;  3AKF A;  2HWM A;  1JQZ A;  2FGF A;  3RMY A;  3R4S A;  3K1X A;  3BAD A;  3TC2 A;  3O4B A;  2D7I A;  2E4M C;  2M49 A;  2ESU A;  5DUY A;  4L4I A;  2BEB A;  5F8W A;  2UUS A;  1BLA A;  3BAU A; 
#chains in the Genus database with same CATH topology
 1MC9 A;  3ZXG A;  4I3N A;  3WA1 A;  4IZX A;  3HSM A;  1FGA A;  3T8S A;  3O4A A;  1HCD A;  1Z2V A;  1PUU B;  3I29 B;  3O4D A;  3UJ4 A;  3FJE A;  3IM5 A;  4H9W A;  3AH1 A;  2GO2 A;  4ZA3 B;  1BA7 A;  4QKR A;  4DCK C;  3PHZ A;  5D62 A;  1K5V A;  2NTD A;  3NBN A;  4MZF B;  4Q9G A;  3NBE A;  3VSF A;  4ZOT A;  2Z48 A;  3CA0 A;  3O49 A;  2ERM A;  4D0T A;  3OJV A;  3BRD A;  3IIR A;  2RG9 B;  1IIL A;  3BA4 A;  1HKN A;  3FUO A;  4MZH A;  3AH2 A;  1N4K A;  5FZZ A;  5FZY A;  1FMM S;  4JKQ A;  4D8H A;  3AKG A;  1IRP A;  2FFU A;  4F34 A;  4I4R A;  3WO4 A;  3R4U A;  1V6X A;  2F2F A;  3FJI A;  4I6I A;  4EKX B;  3AKH A;  3VT2 A;  3BAG A;  4ISR A;  5B2H A;  4X38 A;  3LLP A;  3AH4 A;  4I1E A;  2D24 A;  1PUM B;  1ISZ A;  2D23 A;  3PG0 A;  3RSJ A;  1EYL A;  1AFC A;  2KI6 B;  7I1B A;  4ZFW B;  1G9D A;  1I1B A;  4LO2 C;  4A7K A;  21BI A;  4P6A A;  2AFG A;  31BI A;  3UJ0 A;  1TWE A;  1ABR B;  5BXR A;  2GZB A;  3AJ5 A;  4I4U A;  1Z0H A;  4I4Q A;  3ZXD A;  4LO3 C;  1YXW A;  2VSA A;  5BVP I;  4JAW A;  1I1E A;  3A21 A;  3CA4 A;  3UDA A;  3UD7 A;  3RMX A;  5F8S A;  1JT7 A;  5F8Y A;  4I4Y A;  4END A;  4J2Y A;  4IY9 A;  3BA5 A;  3IAG C;  4G1R A;  1P63 A;  4H04 A;  4KEJ A;  5F90 A;  1ISX A;  3CAH A;  3ZX7 A;  3H6Q A;  2NS2 A;  3WIN A;  1ILR 1;  4F83 A;  2ZQN A;  2R9K B;  1ISW A;  2I1B A;  5BP5 C;  2Y9W C;  3FJD A;  5G00 A;  4EFP A;  3F62 B;  1SZ6 B;  3H6S E;  2P39 A;  4DEN A;  4EB2 B;  3FGM A;  1JT4 A;  2IHO A;  3C9Z A;  3HBW A;  3P6J A;  4KBB A;  1ISY A;  1FWV A;  3BRF A;  1TIE A;  3FJA A;  1GGP B;  4KEI A;  3BA7 A;  4P0J A;  2ZQO A;  3P6I A;  3HAL A;  2Q3N B;  4G6J A;  4I4O A;  1RG8 A;  1CE7 B;  1S0E A;  1TTU A;  4OWL A;  1AVA C;  4ZLB B;  2K8R A;  4KEK A;  2D20 A;  3F1R A;  2D1Z A;  4JPZ A;  3N7M A;  3A22 A;  1XZZ A;  4A7Y A;  4LO2 A;  4ZFU B;  1Q03 A;  1V6U A;  1DLL A;  1MD6 A;  2D43 A;  2WRY A;  2FDB M;  3AZV A;  1R8O A;  2QYI B;  4Q9P A;  1RZO B;  3CA3 A;  3JUT A;  3OGF A;  4IZE A;  3V79 C;  3VSZ A;  2NYY A;  3WO3 A;  6I1B A;  4I4P A;  4J23 B;  4GOY A;  4LO0 C;  1DQG A;  4CJM A;  3V0B A;  1BFC A;  4GP3 A;  5BQU C;  4H75 A;  1Z4S A;  3FJK A;  1HCE A;  3S8K A;  4XFT A;  2Y9F A;  4QD2 C;  2VXR A;  1BFF A;  2BFH A;  1BAS A;  3PME A;  1QQL A;  4XKI A;  5DSS B;  1XYF A;  1UPS A;  3BAQ A;  3FFZ A;  3NBD A;  3OGG A;  5DVH A;  4IY8 A;  3HOM A;  1M2T B;  5I1B A;  2XOA A;  1AVX B;  4OW4 A;  8I1B A;  3W9T A;  1L2H A;  3CA6 A;  3CRG A;  2AXM A;  4USO A;  1EVT A;  3AJ6 A;  5BP5 A;  4OWK A;  1BLD A;  3V0A A;  1PZZ A;  4J2K A;  1A8D A;  1EPW A;  1AF9 A;  3CA1 A;  4YOL A;  2NP0 A;  4X39 A;  5JMC A;  1BAR A;  4QBV A;  2RQ9 A;  1S0B A;  4I4X A;  4J2S A;  9ILB A;  4LO1 C;  3BB2 A;  4QC4 A;  2BEA A;  4P0L A;  4JKX B;  1V6V A;  4USP A;  1T4Q A;  4I37 A;  1XG6 A;  1DJS B;  4LO7 B;  5HPZ A;  1W3A A;  1DQO A;  3CRH A;  4HR6 C;  2E4M A;  3H6R A;  4G9M A;  4I7I A;  3E8L C;  2KKI A;  3ZC8 A;  1HWO B;  4MZG B;  4OEE A;  1FWU A;  3FUQ A;  2KH2 A;  4I96 A;  3VUO A;  1TFM B;  3A23 A;  1VCL A;  4AN7 B;  1G9B A;  3OJM A;  4I8M A;  4ISQ A;  1DZC A;  5BXP A;  4JRA A;  1XHB A;  4IQP A;  4Z8S B;  5GAQ A;  1JLY A;  5EC5 A;  1Q04 A;  1SR4 C;  4DEP A;  1AXM A;  1V6W A;  3MAL A;  2DRE A;  3BAV A;  1ISV A;  1WBC A;  4OEG A;  1QXM A;  3FJC A;  2LIE A;  1YBI A;  3NJ5 A;  4FVV A;  2FFV A;  4Z9W B;  5EG6 C;  2FO1 A;  2Y9X E;  2Y9G A;  4KC3 A;  2D7R A;  2MC2 A;  3S8J A;  4ZFY B;  4G9N A;  2HW9 A;  3O4O A;  1JLX A;  3IM6 A;  2AAI B;  1YTO A;  2Z49 A;  1OQL B;  3UD8 A;  1TOO A;  4FGF A;  3O44 A;  5JLV A;  1RY7 A;  3ZC9 A;  4IYB A;  1S0L A;  5BOW A;  3CU1 B;  4LO8 B;  1PWA A;  1Q1U A;  3HN1 A;  4I2S A;  1IRA X;  1F31 A;  4HJJ A;  3BTA A;  1FN0 A;  4II0 A;  4PC4 A;  4D0Z A;  3FJ9 A;  1QQK A;  2AQZ A;  2VU9 A;  3WO2 A;  4I1B A;  2DRY A;  3VT1 A;  3V0B B;  2LIQ A;  1RML A;  4I4S A;  2DRZ A;  4XFS A;  2WBC A;  3O4C A;  3AZW A;  4LO7 C;  4LO3 A;  2J3P A;  3FJ8 A;  3KMV A;  1IJT A;  3D7W B;  4WBC A;  2X2T A;  1WBA A;  1DFC A;  4I0Y A;  5BXS A;  1YF8 B;  3SNV A;  4UY4 A;  3BAH A;  4L4H A;  2MIB A;  3Q7W A;  4OWJ A;  2HWA A;  3QYD A;  1JY0 A;  2RST A;  1R8N A;  3PUB A;  1TP0 A;  3V0A B;  1ONK B;  3WIN C;  1SR4 A;  1HWM B;  3CA5 A;  1PC8 B;  5BXT A;  3HMY A;  4EFQ A;  1W3G A;  3MPP G;  2KLL A;  2VLC A;  3O5W B;  4AN6 A;  5D61 A;  1IHK A;  2NZ9 A;  2ZR1 B;  2F8X C;  4X3A A;  4OUJ A;  3P53 A;  4GAI A;  1FQ9 A;  1DFQ A;  1G9C A;  1AVW B;  4R6U B;  4I4V A;  4TLP A;  2L5X A;  1DIW A;  1HWP B;  3FJF A;  2Q9X A;  3IM7 A;  4GAF A;  3N7K A;  1JT3 A;  1TWM A;  2VUA A;  3QR5 A;  3UD9 A;  1FV3 A;  1G9A A;  3RTJ B;  4J2X A;  1NUN A;  1HWN B;  3FJB A;  3JRR A;  1DZD A;  1BFB A;  3H6R B;  2D44 A;  2ET2 A;  1KNM A;  2K43 A;  5D63 A;  3O3Q A;  4XFU A;  3NBC A;  1D0H A;  1S0D A;  3RTI B;  3OBR A;  4X37 A;  1ITB A;  3OBT A;  1FV2 A;  1S0F A;  4P0K A;  3BRG C;  3CRI A;  3I2A A;  5FNX A;  5EHA A;  3VWC A;  3N7J A;  5FNW A;  2VXT I;  2QN4 A;  4EFR A;  1FMZ A;  3EF2 A;  1II4 A;  3BAO A;  2NM1 A;  2D22 A;  3WMU A;  5E24 E;  1WD3 A;  4LO0 A;  2YUG A;  1G82 A;  1JT5 A;  4QD2 B;  1T9F A;  1YYN A;  2K4A B;  1M16 A;  2HZ9 A;  1BFG A;  1E0O A;  1IOB A;  2IWT B;  3FJH A;  3N0K A;  5BQU A;  4JQ0 A;  3POK A;  4ION A;  4G6M A;  3Q7Y A;  4QBC A;  4Q91 A;  2MLL B;  4ZKT B;  2DS0 A;  4QKS A;  1JTC A;  1CVS A;  1EV2 A;  2NVH A;  4EEE B;  2P23 A;  3B9U A;  3A07 A;  3OJ2 A;  4GOV A;  41BI A;  4GP0 A;  3FJJ A;  3ILA A;  3CQA A;  1S0G A;  1NZK A;  4IHZ A;  3WMV A;  1WD4 A;  4QAL A;  1S0C A;  1K5U A;  4JP0 A;  3VEQ A;  2F2F C;  3AKI A;  1IT0 A;  3N7L A;  4OEF A;  4ZBV B;  5FZU A;  1HIB A;  4ZGR B;  4QO3 A;  5DZU A;  4HA2 A;  1J0S A;  3VT0 A;  3LTQ A;  2VSE A;  2X2S A;  3I2X A;  3BX1 C;  1AVU A;  3Q7X A;  4LO1 A;  2KI4 A;  1W3F A;  4A7Z A;  3AKF A;  2HWM A;  1JQZ A;  2FGF A;  3RMY A;  3R4S A;  3K1X A;  3BAD A;  3TC2 A;  3O4B A;  2D7I A;  2E4M C;  2M49 A;  2ESU A;  5DUY A;  4L4I A;  2BEB A;  5F8W A;  2UUS A;  1BLA A;  3BAU A; 
#chains in the Genus database with same CATH homology
 1MC9 A;  3ZXG A;  4I3N A;  3WA1 A;  4IZX A;  3HSM A;  1FGA A;  3T8S A;  3O4A A;  1HCD A;  1Z2V A;  1PUU B;  3I29 B;  3O4D A;  3UJ4 A;  3FJE A;  3IM5 A;  4H9W A;  3AH1 A;  2GO2 A;  4ZA3 B;  1BA7 A;  4QKR A;  4DCK C;  3PHZ A;  5D62 A;  1K5V A;  2NTD A;  3NBN A;  4MZF B;  4Q9G A;  3NBE A;  3VSF A;  4ZOT A;  2Z48 A;  3CA0 A;  3O49 A;  2ERM A;  4D0T A;  3OJV A;  3BRD A;  3IIR A;  2RG9 B;  1IIL A;  3BA4 A;  1HKN A;  3FUO A;  4MZH A;  3AH2 A;  1N4K A;  5FZZ A;  5FZY A;  1FMM S;  4JKQ A;  4D8H A;  3AKG A;  1IRP A;  2FFU A;  4F34 A;  4I4R A;  3WO4 A;  3R4U A;  1V6X A;  2F2F A;  3FJI A;  4I6I A;  4EKX B;  3AKH A;  3VT2 A;  3BAG A;  4ISR A;  5B2H A;  4X38 A;  3LLP A;  3AH4 A;  4I1E A;  2D24 A;  1PUM B;  1ISZ A;  2D23 A;  3PG0 A;  3RSJ A;  1EYL A;  1AFC A;  2KI6 B;  7I1B A;  4ZFW B;  1G9D A;  1I1B A;  4LO2 C;  4A7K A;  21BI A;  4P6A A;  2AFG A;  31BI A;  3UJ0 A;  1TWE A;  1ABR B;  5BXR A;  2GZB A;  3AJ5 A;  4I4U A;  1Z0H A;  4I4Q A;  3ZXD A;  4LO3 C;  1YXW A;  2VSA A;  5BVP I;  4JAW A;  1I1E A;  3A21 A;  3CA4 A;  3UDA A;  3UD7 A;  3RMX A;  5F8S A;  1JT7 A;  5F8Y A;  4I4Y A;  4END A;  4J2Y A;  4IY9 A;  3BA5 A;  3IAG C;  4G1R A;  1P63 A;  4H04 A;  4KEJ A;  5F90 A;  1ISX A;  3CAH A;  3ZX7 A;  3H6Q A;  2NS2 A;  3WIN A;  1ILR 1;  4F83 A;  2ZQN A;  2R9K B;  1ISW A;  2I1B A;  5BP5 C;  2Y9W C;  3FJD A;  5G00 A;  4EFP A;  3F62 B;  1SZ6 B;  3H6S E;  2P39 A;  4DEN A;  4EB2 B;  3FGM A;  1JT4 A;  2IHO A;  3C9Z A;  3HBW A;  3P6J A;  4KBB A;  1ISY A;  1FWV A;  3BRF A;  1TIE A;  3FJA A;  1GGP B;  4KEI A;  3BA7 A;  4P0J A;  2ZQO A;  3P6I A;  3HAL A;  2Q3N B;  4G6J A;  4I4O A;  1RG8 A;  1CE7 B;  1S0E A;  1TTU A;  4OWL A;  1AVA C;  4ZLB B;  2K8R A;  4KEK A;  2D20 A;  3F1R A;  2D1Z A;  4JPZ A;  3N7M A;  3A22 A;  1XZZ A;  4A7Y A;  4LO2 A;  4ZFU B;  1Q03 A;  1V6U A;  1DLL A;  1MD6 A;  2D43 A;  2WRY A;  2FDB M;  3AZV A;  1R8O A;  2QYI B;  4Q9P A;  1RZO B;  3CA3 A;  3JUT A;  3OGF A;  4IZE A;  3V79 C;  3VSZ A;  2NYY A;  3WO3 A;  6I1B A;  4I4P A;  4J23 B;  4GOY A;  4LO0 C;  1DQG A;  4CJM A;  3V0B A;  1BFC A;  4GP3 A;  5BQU C;  4H75 A;  1Z4S A;  3FJK A;  1HCE A;  3S8K A;  4XFT A;  2Y9F A;  4QD2 C;  2VXR A;  1BFF A;  2BFH A;  1BAS A;  3PME A;  1QQL A;  4XKI A;  5DSS B;  1XYF A;  1UPS A;  3BAQ A;  3FFZ A;  3NBD A;  3OGG A;  5DVH A;  4IY8 A;  3HOM A;  1M2T B;  5I1B A;  2XOA A;  1AVX B;  4OW4 A;  8I1B A;  3W9T A;  1L2H A;  3CA6 A;  3CRG A;  2AXM A;  4USO A;  1EVT A;  3AJ6 A;  5BP5 A;  4OWK A;  1BLD A;  3V0A A;  1PZZ A;  4J2K A;  1A8D A;  1EPW A;  1AF9 A;  3CA1 A;  4YOL A;  2NP0 A;  4X39 A;  5JMC A;  1BAR A;  4QBV A;  2RQ9 A;  1S0B A;  4I4X A;  4J2S A;  9ILB A;  4LO1 C;  3BB2 A;  4QC4 A;  2BEA A;  4P0L A;  4JKX B;  1V6V A;  4USP A;  1T4Q A;  4I37 A;  1XG6 A;  1DJS B;  4LO7 B;  5HPZ A;  1W3A A;  1DQO A;  3CRH A;  4HR6 C;  2E4M A;  3H6R A;  4G9M A;  4I7I A;  3E8L C;  2KKI A;  3ZC8 A;  1HWO B;  4MZG B;  4OEE A;  1FWU A;  3FUQ A;  2KH2 A;  4I96 A;  3VUO A;  1TFM B;  3A23 A;  1VCL A;  4AN7 B;  1G9B A;  3OJM A;  4I8M A;  4ISQ A;  1DZC A;  5BXP A;  4JRA A;  1XHB A;  4IQP A;  4Z8S B;  5GAQ A;  1JLY A;  5EC5 A;  1Q04 A;  1SR4 C;  4DEP A;  1AXM A;  1V6W A;  3MAL A;  2DRE A;  3BAV A;  1ISV A;  1WBC A;  4OEG A;  1QXM A;  3FJC A;  2LIE A;  1YBI A;  3NJ5 A;  4FVV A;  2FFV A;  4Z9W B;  5EG6 C;  2FO1 A;  2Y9X E;  2Y9G A;  4KC3 A;  2D7R A;  2MC2 A;  3S8J A;  4ZFY B;  4G9N A;  2HW9 A;  3O4O A;  1JLX A;  3IM6 A;  2AAI B;  1YTO A;  2Z49 A;  1OQL B;  3UD8 A;  1TOO A;  4FGF A;  3O44 A;  5JLV A;  1RY7 A;  3ZC9 A;  4IYB A;  1S0L A;  5BOW A;  3CU1 B;  4LO8 B;  1PWA A;  1Q1U A;  3HN1 A;  4I2S A;  1IRA X;  1F31 A;  4HJJ A;  3BTA A;  1FN0 A;  4II0 A;  4PC4 A;  4D0Z A;  3FJ9 A;  1QQK A;  2AQZ A;  2VU9 A;  3WO2 A;  4I1B A;  2DRY A;  3VT1 A;  3V0B B;  2LIQ A;  1RML A;  4I4S A;  2DRZ A;  4XFS A;  2WBC A;  3O4C A;  3AZW A;  4LO7 C;  4LO3 A;  2J3P A;  3FJ8 A;  3KMV A;  1IJT A;  3D7W B;  4WBC A;  2X2T A;  1WBA A;  1DFC A;  4I0Y A;  5BXS A;  1YF8 B;  3SNV A;  4UY4 A;  3BAH A;  4L4H A;  2MIB A;  3Q7W A;  4OWJ A;  2HWA A;  3QYD A;  1JY0 A;  2RST A;  1R8N A;  3PUB A;  1TP0 A;  3V0A B;  1ONK B;  3WIN C;  1SR4 A;  1HWM B;  3CA5 A;  1PC8 B;  5BXT A;  3HMY A;  4EFQ A;  1W3G A;  3MPP G;  2KLL A;  2VLC A;  3O5W B;  4AN6 A;  5D61 A;  1IHK A;  2NZ9 A;  2ZR1 B;  2F8X C;  4X3A A;  4OUJ A;  3P53 A;  4GAI A;  1FQ9 A;  1DFQ A;  1G9C A;  1AVW B;  4R6U B;  4I4V A;  4TLP A;  2L5X A;  1DIW A;  1HWP B;  3FJF A;  2Q9X A;  3IM7 A;  4GAF A;  3N7K A;  1JT3 A;  1TWM A;  2VUA A;  3QR5 A;  3UD9 A;  1FV3 A;  1G9A A;  3RTJ B;  4J2X A;  1NUN A;  1HWN B;  3FJB A;  3JRR A;  1DZD A;  1BFB A;  3H6R B;  2D44 A;  2ET2 A;  1KNM A;  2K43 A;  5D63 A;  3O3Q A;  4XFU A;  3NBC A;  1D0H A;  1S0D A;  3RTI B;  3OBR A;  4X37 A;  1ITB A;  3OBT A;  1FV2 A;  1S0F A;  4P0K A;  3BRG C;  3CRI A;  3I2A A;  5FNX A;  5EHA A;  3VWC A;  3N7J A;  5FNW A;  2VXT I;  2QN4 A;  4EFR A;  1FMZ A;  3EF2 A;  1II4 A;  3BAO A;  2NM1 A;  2D22 A;  3WMU A;  5E24 E;  1WD3 A;  4LO0 A;  2YUG A;  1G82 A;  1JT5 A;  4QD2 B;  1T9F A;  1YYN A;  2K4A B;  1M16 A;  2HZ9 A;  1BFG A;  1E0O A;  1IOB A;  2IWT B;  3FJH A;  3N0K A;  5BQU A;  4JQ0 A;  3POK A;  4ION A;  4G6M A;  3Q7Y A;  4QBC A;  4Q91 A;  2MLL B;  4ZKT B;  2DS0 A;  4QKS A;  1JTC A;  1CVS A;  1EV2 A;  2NVH A;  4EEE B;  2P23 A;  3B9U A;  3A07 A;  3OJ2 A;  4GOV A;  41BI A;  4GP0 A;  3FJJ A;  3ILA A;  3CQA A;  1S0G A;  1NZK A;  4IHZ A;  3WMV A;  1WD4 A;  4QAL A;  1S0C A;  1K5U A;  4JP0 A;  3VEQ A;  2F2F C;  3AKI A;  1IT0 A;  3N7L A;  4OEF A;  4ZBV B;  5FZU A;  1HIB A;  4ZGR B;  4QO3 A;  5DZU A;  4HA2 A;  1J0S A;  3VT0 A;  3LTQ A;  2VSE A;  2X2S A;  3I2X A;  3BX1 C;  1AVU A;  3Q7X A;  4LO1 A;  2KI4 A;  1W3F A;  4A7Z A;  3AKF A;  2HWM A;  1JQZ A;  2FGF A;  3RMY A;  3R4S A;  3K1X A;  3BAD A;  3TC2 A;  3O4B A;  2D7I A;  2E4M C;  2M49 A;  2ESU A;  5DUY A;  4L4I A;  2BEB A;  5F8W A;  2UUS A;  1BLA A;  3BAU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...