1MCEA

Principles and pitfalls in designing site directed peptide ligands
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
216
structure length
216
Chain Sequence
b'PSALTQPPSASGSLGQSVTISCTGTSSDVGGYNYVSWYQQHAGKAPKVIIYEVNKRPSGVPDRFSGSKSGNTASLTVSGLQAEDEADYYCSSYEGSDNFVFGTGTKVTVLGQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IMMUNOGLOBULIN LAMBDA DIMER MCG (LIGHT CHAIN)
publication title Principles and pitfalls in designing site-directed peptide ligands.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immunoglobulin
total genus 40
structure length 216
sequence length 216
chains with identical sequence B
ec nomenclature
pdb deposition date 1993-02-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1mceA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1mceA02
4UT9H 5CZXC 3D0LA 1MJ7L 1DBBH 4ZOBA 1F5WA 5DJDB 4V1DE 5D1XA 4NM4L 2W07A 3PWVA 3X13B 5DFVC 3JV4B 2C3HA 2D7TH 1JJUA 1IAOA 1TVDA 1F11B 3VFWB 3ZKXB 1AP2A 4OGXL 1K4CB 2NW2B 3IDXH 2EYSA 2AJVH 1VFOA 2PYEA 1E4XL 3MRLA 4Y2DB 3U9PL 4EI6A 5D2NC 4BK4A 1NGWB 4BM7A 4EVNA 2YKLL 2Z8WC 2X4RA 5D7IB 4P2QA 4YHPA 4U3CA 1SEQL 4ZD3L 4PV9A 3IDGA 3OR6B 1S7XA 3BP4B 1AGDA 3IJHA 5F9DC 2B7DT 4C56A 4PJAA 4CN1A 2YPVH 3IS1X 2FO1A 2WWMC 3PIQB 3T2NL 3GMLB 2DJUA 4MS8C 3LN4A 1JNHB 3MLPA 3LKRB 5DURB 3W11D 2OM5A 3EYSL 1T4KA 2CD0A 3AM8C 3KNBB 1CDBA 4FQXC 4OD3H 4MB5A 4YK4C 4G6ML 3F65A 4E41B 3ULUF 5IBUG 5FHBL 1VPOL 1FYTB 3VGAC 4JKPL 5KJRL 2G5BB 3BESR 4L3EA 1DLHB 1YECL 3WYRA 4LF3B 1EJ6A 3RWJB 4KRPD 1GPOH 1TZHB 1VFMA 3BMVA 3TJEH 3OG6B 3CSYB 2F8XC 5A2KH 3EOTL 3I6GB 4HUXB 5FYJU 5IB2A 5AUMB 3WUZA 3I9GL 3VI3F 3IF1A 1MRFL 2IG2H 5C0BA 4WWKD 3UO1H 5E6IA 2H3NB 3L3IA 5F88B 2Q1EA 1YNTA 3BZEA 5H37H 1I8IB 5EOTA 2DAVA 1Q1JH 3SE4C 3NIGE 1DN0A 1RK0A 5HGAA 1X5LA 2V7HA 1CXIA 4L29B 1B90A 1P4BL 3T3PE 4Z7QF 2P5WE 1MIEH 1YMMB 2JCCF 4NPYA 4MAYB 3T0VA 1QRND 3ZDYF 1W0WA 3K81A 4MCZB 5T3ZL 4OGYL 2NY7H 4WW2A 5GGUB 3OKYA 2AJSH 1YPZF 4X6FA 2J12B 5KZCB 3MJ7A 4C4KO 1VFUA 3C9NA 3IXAA 5FF6B 2F5BH 4MVBC 4NRXA 1L0XA 2P42B 2IMMA 4OV6F 2YPLD 1HH9B 4YXHH 3MSPA 4K94L 1P2CA 2WLZA 3FB5B 4ZMAT 1BQSA 5HYJE 1N59B 1HINL 1MWAL 3ARUA 5D96C 5EZLB 3AY4C 3O8XA 4M5YH 3MGTB 3X3GL 2CGRH 2EYRA 3HMXA 4U0RC 3C08H 1K5NA 3BGFC 2IH1B 1ZA6A 5DEGA 1FFPB 1WJ3A 3TPUB 1IAKA 4WEBH 4LARH 3QA3B 3O11B 1FV1B 1MVFA 5JW3L 4I8DA 1F2QA 3QNXB 3JWDL 4XI5D 3ZL4H 1KB5A 1LO0H 1WBZA 4OZGB 3GO1L 5T1DL 3UJTH 2X70A 2ADJA 1WIPA 4OZHF 1PY9A 5IJVA 4R96B 5EU6E 3GUTB 5C09B 2RGSA 3UJIL 4XC1L 1J8HB 3GM0A 4M1DH 2ED7A 3BDXA 3BH9B 1QYGL 3TBWA 3IDNA 1U8MA 3MXWH 3U4BL 1CICD 3GNML 2B5IB 5C08E 3HC4L 3U0TB 1ZHKB 1GRWA 3O0RL 4WGVB 3P9LA 1DQJA 2ZUUA 4OFYD 1FIGL 2HFEA 3NPZB 4O02L 5I1EL 2AEQH 2F8OA 1IM3B 2G9HA 4LLYB 5SWZE 2UYLB 4P3DB 4Y5XA 5DK0A 3IS0X 4P2OA 1T6VN 4LP4A 3KYMB 2XA3A 4DZBB 2DN7A 2Y23A 1FO0L 4Q9QL 3EO9H 3V0WH 4G7YH 3GGWA 2WWKT 2R0KL 1OP3K 1FNAA 5C2BH 2KKQA 5I30L 5DJXA 1ZT7B 4PRNB 2CJUH 3QIWD 3EKCA 4KJYA 1HYSD 3PGCA 2RB8A 4FP8H 5MEOA 2R69H 3L3DB 3QUZD 4IRSC 1UM4H 3NIFF 4YZFF 4X99B 1CLYL 4GQPH 4FQJH 2X09A 4L4TA 4O4YL 3MLZL 1K3IA 1I3RA 1DE4B 1R3KA 4DJMA 4L1HA 2VDML 1XGTA 1V7ML 1ZA3A 3WIHL 5C0NC 3LEYL 4JRYA 4KMQA 2VISA 5DRZA 1OCWH 3RNKB 1RJZA 4PJXA 4MD4B 2HTKD 4HH9B 1JGUL 1JF1A 5EUOE 3QI9B 3QFJB 4MA8H 4HIHA 5CZKA 4YE4H 5FYKD 4Q9RL 1B6DA 2AJZA 1NGXA 4ELME 4MXWH 4JG0L 5EO1A 4DTGL 2RR3A 5ALCH 4KMLB 5JXED 2V2TA 3QO0B 4U4BA 2BCKA 4U7KA 2BVEA 1EHLH 4KAQH 4YGAB 1RU9H 1U8NB 3HFML 1U2HA 5IHZB 5E8EA 4NNPH 4PG9A 5BXFB 1A7OH 4EDXB 3PWPE 3LSOB 1AE6L 3FKUS 5FHAH 4JFEA 5BV7H 1H0DB 4M5ZL 3X11B 1KN4H 3ZYIA 1CVRA 4U6VH 3ZKQD 3BX7C 3RAJL 1HIMH 4JQXA 4XH2B 5GS0L 2CLVB 1C1EH 2CDFA 1MJJB 2P7TA 1RK1B 3CH1A 3NFSL 4HT1H 5HI5C 4ELKB 1OTTD 4EUPG 3IJYA 2X4NB 3VD9A 3W0WB 5CD3A 2DQIL 4Z9KB 4GRWF 4I3RL 5FM5M 1XGRB 4XNQB 3WO4B 3IKKA 1IBGL 4PRAB 4OCYL 4OGAC 2LU3A 5HHMD 2GTWA 1LMKA 4M93C 3GEWB 1F4AA 5D1XD 4KH2A 3KWWB 1Q72H 4OUUA 1OL0A 2BY2A 3CU7A 4PJCF 4UT9L 4DKFH 3O81A 2JKXA 5IMKA 1DBBL 2FJGB 3MR9A 3WUWB 3HS0A 2OTUB 5CILH 4RMTA 4PJIE 3REVB 1PG7H 5CJBA 3WBDA 3AS3A 2PYED 3B2UD 2D7TL 2EICA 5IKCB 2XKNB 9CGTA 2DJSA 3IDXL 3QDJE 2NXZC 5L88H 2AJVL 4WUUB 5E1HB 2QHRH 3PP3K 1G84A 4P2QD 2ZSVA 4HQQH 3WS3A 4IOIA 2KPNA 4P23C 5JA9A 1I7UB 5DJAA 1U3HB 3S3SA 1KLGB 5SX5K 4C56D 3PGFH 4PTTB 2FH6A 3TVMA 1KNOB 3U9UA 1KTRL 3L7EB 1K8IA 1UZ8A 2NY5C 5KN5A 2J7LA 4NWTH 1SBBA 5F70A 4N0UE 2YPVL 3BO8B 4FFWC 4OCLC 4Y19E 2H9GB 1QP1A 1CG9B 1QLRA 5GS1B 1G7HB 3QQ3B 3H9ZA 3NZ8B 4RGNE 5C0CA 1XR8A 1Q9WA 1NCCH 5T3ZE 4NOBA 4ZAKC 5DUPH 1A3QA 4L3ED 3PQYA 4OD3L 4L8SB 2CR3A 2EXYC 1WCBB 1CF8H 1BFOB 1LEIA 4OAWB 4U1KA 4LSPH 1T03H 1AJ7H 1OAXH 1N6UA 3BVNB 2FYYA 3TBTB 1K4DB 5HHPB 3VFSA 3GSNB 3ZDXE 1GPOL 4WI2A 3VA6A 3TJEL 5C0BD 4BSWA 3BQUC 2CO7B 4U1LB 3NCBB 1ZHBB 3RUGA 2B0SH 3L9RA 4U49A 1D5BA 2XTJD 1JPFA 1WC7A 2IG2L 4QNPF 3BHBB 3UO1L 5F97E 4XNXH 3OAZH 3MNZB 1VGKB 1Q1JL 5FKAB 3MODH 3AXLB 4J12A 1YY9C 3T3ME 2ZUSA 1F6FB 1UXWB 5I1DA 1S7RA 5JW4N 1MIEL 4IDJH 2OI9C 5KW9H 4OI9A 4NN7C 4WHYH 5FGBC 3L3KA 1GH7A 3GMQA 2NY7L 2XNAA 2AJSL 1X9QA 4O51A 4S2SB 5ISZA 5GGVH 3FRUB 1H5BC 1ED3A 2F5BL 1FZKA 5DO2D 1DUYB 2W0PA 3HZMB 3QEHB 4YXHL 1SVCP 3O8XD 4Z7WA 5IT2H 1DQDH 2YXMA 1MCCA 4HIEB 5IFAH 4YBLB 3OTTA 2VLRA 1NBYB 2V7NB 3D39B 4M5YL 2N7BA 2CGRL 4AEEA 4GRLA 3C08L 4GXVH 4GS7B 3AREC 1L0YA 3MJ9H 2NR6C 3D69B 2XQYG 1D5XA 2Q7NA 3MJ8A 3MRDA 4KI5C 4WEBL 5E8DH 3WE6B 3WDHA 4LARL 4AIZB 5F7EH 3PGDA 4YHIA 3E6HA 4ZS6C 5ABDE 2AK4E 1M7IB 3QDME 1RZGB 4OBRA 3PL6A 4UNUA 3H9HB 3U1SH 1KBGH 3OJVC 4WENB 5MHSE 3OQ3B 3ZL4L 4D9LH 3S6CA 1LO0L 2VRAA 3ZMRA 4D8PA 1HH6A 1YEDB 2ARJA 3LB6D 3UJTL 4Y5YA 4B50A 4XCNB 1T89A 4C83B 1G6RA 4Z5RA 3HCVA 1IE5A 4UBDC 5FOBA 1AKJA 5DA0B 1WAAF 3VWKA 4IHOA 3IDMA 2PW2A 3OR7A 4M1DL 4NN6B 4XXDB 3IB4A 1MFEH 4Q9BA 4QRRA 1TTUA 3MXWL 4G80B 4FG6C 2NY4B 32C2A 1XF3B 3OX8A 1PVHA 3MV8A 2VIRA 4O2EA 5IVXB 3T0XA 3VD7A 3QFDA 2A0LD 2JJSC 3QIUB 5HDBE 1HQRB 4B41A 2AEQL 1EERB 3DPBA 4LLWB 1AGBA 1F45A 4P99A 5C0IB 2BNRE 1BOYA 4RWHA 2O5ZH 3FQXA 4RMQA 1FE8H 5GXBB 1ZVHA 3EYQC 2R9HC 1S8DB 3EO9L 3NCYS 3V0WL 4G7YL 3N1QC 4LPVA 1FVDA 3L5WB 5C2BL 4I48A 5SWSE 3V9FA 4P3CH 3WXWH 4D0CA 5I2IB 2CJUL 2UWEE 2YHGA 4AM0A 3B8YA 2EXWD 4L4TD 3O45A 5EU5B 4FP8L 1FNHA 1UQSA 4N8VA 1IGCH 2R69L 1JUFA 1OQOA 3MGOA 4KXZH 1UM4L 3P4NB 3CAFA 4JRYD 4MA7H 4FQJL 1LP9A 2JJTA 3GMNA 4TPRH 3DVNB 4U1MB 3EUUA 2OL3B 3M45A 4NQVB 3V6BR 5EZJA 3ILQC 4X6EB 3WFBH 4JCLA 2DS4A 5T3XD 3VE0A 5SV3A 2IALA 5BOPA 3G5ZB 3VFUB 1OCWL 4PLJC 4Z8FH 3S3PA 1M1SA 1Z5LA 4YBLC 2G75B 4MA8L 5F9JB 4YE4L 3WHXB 4NCC1 1GZPA 1ES0A 3MRRA 5FM8A 2WP3T 4MXWL 5DEFA 1YN7A 3FCTA 3RIFK 2AW2A 4G8IB 4HFUH 4ODBD 5ALCL 1K6QL 4MXVE 4K71C 4Y4HB 3T0EA 3PV6B 5EO0A 1IGJB 3DROA 5EUKA 2A74B 1NQBA 4Y16A 1EHLL 4KAQL 2MQ3A 1RU9L 4JFED 3F7YB 3VGDA 4NNPL 5E5MA 1A7OL 3QCVL 4QHUA 5FHAL 5BV7L 4Z7UB 2R2EB 2LABA 1KN4L 1DVFC 1M05B 1TETH 4U6VL 3SE3A 1OGAE 1CD0A 1BLNA 2X4UA 1HIML 4NQDB 5LJYH 3TEUA 3RWHB 1C1EL 5GGVY 4S1QH 4HT1L 1JGEB 3WFEH 1NGQH 2VITA 1EUTA 4HUVA 1GC1H 1B9ZA 5FV2A 4JY5H 3BPLB 3DSFH 4NQXA 2DWEB 1I1AA 1KXQE 1ONQA 2VLKA 1JZ6A 2MFNA 5DRXA 4D3CH 4LCIH 3NCFB 3ECBB 3GMRB 2WAHA 1Q72L 2BVYA 3MACH 4WV1C 4DKFL 4OF3A 3MRBB 3FQUB 4ETQA 2UZYB 3DRQB 4MA3A 2EDYA 4HV8A 5CILL 4X6DF 1PG7L 3STLB 4QYOA 4NNYB 3KPRE 4E0RB 2WSKA 3IETB 3MFFA 2BVOB 2IPKA 3HE6B 3E1F1 4LCWE 3V6OE 2VQ1A 3WJJC 1SYVA 4H8WC 5L6YH 5L88L 4FTVA 4NO5A 5DJ0B 2QHRL 4OM0H 3GFUA 5HD8D 5IM7B 5B3JE 3VXMA 3L1OH 4HQQL 2A1WH 3IGAB 3TVMD 1EAPB 4I5BB 4P5KB 4A6YB 3WLBB 5EN2B 1CGSH 2GSIA 1QFHA 3PGFL 3BJLA 2XWTB 2VZUA 3X12B 3DX9A 3W81A 1A6TB 4KJQC 2Y07H 4G6AC 4OFDA 1EAJA 4NWTL 5HGHA 4RWYH 1XF2A 5EU7E 4Y8AA 5GRZA 3PQYD 4NO0A 3UXFA 1E28B 1A7BA 4NQCE 5IGXH 4LCUA 3OJDA 4DAGH 2AEWA 4R4FH 1HCVA 1NCCL 3VFVB 1F3DJ 4EQ3A 5DUPL 5KS9B 1S7QA 3MRJB 3MV7B 5BS0B 4HXBH 3VFNA 1LHZA 1CF8L 3O3AA 4KKBD 3CLEH 3QIBB 4LSPL 4ZTPH 1AJ7L 1OAXL 3RDTB 1T03L 4DUXA 1T21A 1W72H 1XR9B 1KJ3H 3DTXA 2ZG1A 1MI5A 2EDWA 3D85A 1EEYB 5DTFB 4I3SH 4KKLC 3WNKA 4LL9A 4XAKD 4QF1A 3O41A 3V5KB 3TO2A 4NOFA 4NDMA 2B0SL 3BKCH 5L2KE 3QUXA 2PYFA 3U0PB 4KQ4H 1YC8A 2C7UB 3SO3B 4XNXL 4JRXE 5I75C 3IFNH 5K9QG 3MODL 2BY3A 3KGRA 3HNSH 4XTRD 4Z7VF 4R97C 3ET9F 1DDHB 4JGMA 2BNQE 4C57C 5TDOA 1UH3A 4Y1AE 3P77A 4BFIB 3VJ6A 5KW9L 5ISZD 2ZKHH 4ERSH 5DJCA 2I07B 4TSCH 2A6DB 3E8UH 2EKSB 5D93C 2QEJA 5E2WH 4MHHI 1PG7X 3K8LA 4Y4FA 3DIFB 5HGBB 3T0BA 1OGTA 4F37F 3TN0D 1U0QA 3NZHH 1X3DA 5GGVL 2DQJH 3DO7A 3AMLA 2DBJA 2P5EA 5EOCH 3DETD 2E5EA 3QCUH 1BGXH 3CFCH 3BPOB 2VLRD 4Z7OF 4D2NA 2CUMA 4JJHA 4WIQA 2A83A 2CIKB 3OKOA 1DQDL 1XGPA 5IT2L 4ZXBC 1L9NA 4RGMB 5GRVK 5IFAL 2HP4A 5F7HA 5DHVB 4OD2B 4GXUM 1MQ8A 3RPIB 5HY9B 1P4IH 4GXVL 3OXSA 3MJ9L 3PL6D 1NMCB 3MO1A 4NN5B 4YAQA 5E8DL 5F7EL 3RVWD 4J23A 3LZFH 2YN5A 2E6JA 5F3HB 2P24A 3QQ4B 2K1MA 4N1CA 1KBGL 3U1SL 4CN6A 3HPLA 3G5VA 3SJVB 1LD9A 4D9LL 5JORB 1AKJD 5C2UB 4XNUH 1MCWW 1QA9A 3VWKD 5JOEA 1QSEA 3SCMB 3CFEB 4QRRD 1OD9A 4UOJA 5CS7A 3MV8D 3SGEI 1DANU 2UVEA 5AD0A 1ZHLB 2X89A 1FVEA 3SPVA 1MFEL 4DKDC 2COQA 4NC0B 5C07A 1I3UA 1WICA 4GJTB 5KVMC 2X4OA 1BZ7A 1QSFE 4IRJA 2GAZB 5C6TH 3OKEB 3UTSE 3UZQA 3VD3A 3DVFA 1RZ7H 2O5ZL 1FE8L 5BZDB 4ZUSB 2GK0B 2N56A 4QRUB 2HKFH 4UQ3A 4ODSH 3UTQB 1CLCA 2D7PA 4X7TA 5DJ8A 3U0WH 4NJAH 3JV5A 3VRLF 3STBA 4P3CL 3WXWL 2IBBA 2R56H 4UNVA 4RIRB 3GSXA 1BD2E 1IGCL 1Q9OB 2P48B 4LSVL 4U1SA 3EYFA 1FNFA 5FDYA 3NIGF 3VXRB 3C5ZB 3MBEB 4MA7L 3X3FH 5DMYA 4TPRL 1AGEB 1NCAH 1OY3B 1U93A 2OQJB 3KPSE 4O58H 4OIBA 5JW4M 3WFBL 3UDWC 2FWOA 4D0BB 1HQ4B 1ZXQA 1RVFH 2EDDA 3U48A 1OHQA 4Z8FL 4IJ3C 3I6KA 5EC2A 1BBJB 4M8QA 4RMVA 2P5WB 5AEAA 2CDEB 2DDQH 5FO8B 4P57B 4MSWA 4GG6F 3HUJE 3T0ED 4O00A 4UILH 3VFRA 5I8KH 3C8HA 4Y16D 4K8RD 4F33B 1L7IH 4GLRI 4HFUL 2ZCHH 1NMCC 3F7PC 3MMEB 4PGCA 4UUJB 2XV6B 1ZHNA 4KMTH 5C0EA 4NRYB 3ROOA 4F2MA 5D5MA 3NFNB 3WN5A 1U3ZA 1BZQK 1MHPH 3HAEA 3MLXH 1FRGH 3OXRA 3EFFA 3H0TB 3ARGB 5A2LH 4PJBF 5GPRA 4OZFG 2YC1B 1UJ3B 3GMMB 4U05A 3CDCA 3VXSD 3B9KA 4WFFD 1TETL 2IEPA 2CK2A 3CNKA 2X4QB 1HKFA 1TZIB 3EYUH 1SY6H 4PJ7F 1I1AD 2DRUA 2FIRT 4PY7A 3VRJB 4S1QL 1JZ8A 3WFEL 1NGQL 4Y4KA 2VLKD 1GC1L 5E7FA 4OSUH 4PFEA 4JY5L 3B5TA 4WRLA 1HNGA 3DSFL 1MUJB 1QFWM 1CBVH 3KS0J 2ILLA 3QEQE 1AXSA 4M1CD 5DZNA 2WQRA 4XXCC 4Q6IA 3CVHB 2MKLC 2LU4A 5DQDH 4YBQD 4D3CL 4LCIL 5IHBA 3TGXA 3UPCA 2VKWA 2EDFA 1E6JH 4JFDB 5EU6B 4YO0B 1S7WA 4BSVB 5D7JC 4MD0A 4LBEB 4TUJA 1ZLWH 1S9VA 2XN9A 3ZDZE 5J6GA 2AJYH 4PRPB 3WIFB 4QHMA 3PJSA 8FABA 3KLHC 4NYLA 3TYGH 4FTVD 2H26A 4WU5A 1A6UH 2X9WA 3N9GH 8CGTA 4AJ0A 1AO7A 1HOCB 3BZ4B 3NCJH 2WM0A 2K3TA 2W65A 4NCDA 4DEPC 5C8JB 2YZ8A 5L6YL 4OM0L 1T1ZA 1XGQB 1OP9A 3FQRA 3L1OL 3U4EA 5ITFA 2A1WL 4EIZC 4YHZH 1CGSL 2VZTA 1RSFA 5EC1A 1IEAA 4X6CE 4Q74A 1RURH 5TDNB 2AI0H 2HLFD 3BP5B 3IDJB 2FHBA 3NA4A 3TNMB 4U3HA 2HTLC 2HVKB 2Y07L 4NO0D 1NCTA 5ID1B 3AM8A 4LVOC 1NFIB 3D2UB 4FQXA 3PHOA 1J9CT 3E6FB 4RWYL 1D5ZA 3D3VE 4TN9A 4QHLB 4WI8A 4MWFA 4RNRA 3ZTNH 2HFGH 2ADGA 4PGEB 2IFFH 4K7PH 4RFNB 3FT2A 1I3VA 4QRSB 5GRXG 1ZLUH 4EI5C 1MOEA 5DVOA 5IGXL 4DAGL 2AEPH 3QUKB 4R4FL 5SX4I 1WEJH 4WHTA 4JJ5B 2X41A 4HXBL 1MI5D 1VEOA 4ELMF 3D85D 3T2OA 1TQCC 4APQA 4PJEA 2IADA 3CLEL 3ARGC 4BUGA 4QHKJ 2R2HB 1HSAA 4ZTPL 3VGHA 3VRIB 1UJ3C 1W72L 4JAMB 1KJ3L 1F6LL 3BPNC 4XCEA 3QUXD 2EYTA 2ZUVA 3D18B 3M07A 4JQVC 3T1FA 4MNQA 4I3SL 2VDRH 5C86A 1ZGLA 3SE4A 5HYFA 4GRMB 1KENL 3MYJA 4PJGE 2DIBA 3MLUH 4N0CD 2LVCA 1OSZA 3BKCL 3SDYH 2FJFB 3P9WB 3HN3A 4JFQA 4KQ4L 2ZSWA 4U1JA 4AT6A 2R23B 3K4AA 3IDIB 4HUWA 4OLUH 4UDTA 5FAAA 5D2LE 3IFNL 4FQQB 1CXFA 3MRPB 3QBTB 2VZSA 1UB6A 4R2GC 1EFXA 3FMGH 1J0ZA 3HNSL 3L3HB 1VKXB 5JLZB 3BWUC 1NJ9B 3OAUL 4Y4FD 4HWUA 1MHEB 3RQ3A 1LO4H 3X13A 1QLFA 4YPGA 1SM3H 2LQRA 5F7DB 3JV4A 4G9FA 4OQTA 3IFPB 4QXTB 2WBJB 2ZKHL 2BRQA 3BAEH 4I3GA 4TSCL 4ERSL 5BRZE 3E8UL 5E2WL 3OKKA 5E70A 1K4CA 3B9VA 4Q0XH 5FECA 2P5ED 3ALXA 3FO1B 3NZHL 4CAGA 1V7NH 4AH2B 4JFOB 3DX7B 3HG1D 1W0VB 4XVUC 3MQIA 2NYYC 2DQJL 2H32H 3AY4A 5DA4A 2QL1A 4QTIH 2NCMA 3R1GH 5EOCL 3QCUL 1SJHB 1BGXL 1BOGA 1EA9C 1FVCB 3CFCL 5D7IA 3S5LG 5EBGA 3MX0A 3LN5B 3ARDB 1FL5A 4KJPD 1FNSH 3DARA 3H9SE 5AZEH 1X4YA 3MTRA 3BP4A 1J88A 1RZJH 4PJIF 4ZPVB 5E8NA 5J6HB 1EEQA 4HLZG 3RL1B 5IMLA 3VG9C 5FYLD 1P4IL 3PIQA 3GMLA 1INDH 2C5DC 1A2YB 1D5IH 4KK5D 4WFGD 1F13A 1NC4B 2BP3A 1G7LA 3LZFL 1A6AB 3KNBA 1QSED 2ESVB 4TVPH 1NGYA 2H2SC 2AV1A 5F1NB 2W0FB 4E41A 1EO8H 4XNUL 4JFPB 4R7DB 1HSBB 2PO6B 3D9AH 3GSQB 1DLHA 1KJ2H 3IVKB 1FGVH 3FFDB 5C07D 1NC2B 4ZO8A 3RVXC 2FIKA 1QBAA 3QEGL 4PJHF 3S35X 3CSYA 2YZ1A 2YPKA 3WXVH 2HT4D 4IRJD 1AIFB 3I6GA 4HUXA 3PDDA 3Q3GB 5AUMA 3FOMB 2MNUA 5EIIB 4R0LB 4NNXA 2WWKO 5F88A 4L3CB 3LN9A 3KLAA 1I8IA 1U8PB 4KWUA 4NO3A 2PR4H 5C6TL 3CFKA 2HYMA 4QGYA 5IF0B 1J11A 5EFIA 1YMMA 5F44A 4OZGF 3FFCE 5KVGH 4JKMA 1FFQA 2XXMB 1EEZB 1HNFA 1AQDB 2HKFL 2J8UE 4MCZA 4IRSA 4OCXH 2C1OB 4ODSL 4XP9H 3U0WL 4F7EB 4NJAL 4WFEE 1GAFH 1K8DB 4KK8D 1CYGA 1Q9KB 3D25A 3VH8B 5FF6A 3VDBA 3SDXF 4HS3B 1DQQB 4Z0BH 4Z95H 1MWAB 1CK0H 1J0JA 5KSAB 1CIDA 5KG9A 1YPZA 2YA1A 4JZJC 3UTPD 1UC6A 4NHCH 3X3FL 1G1YA 3O3DB 1NCAL 5EZLA 4OLVH 1ERNA 4O58L 3MA7A 2HJFB 5JNYB 1MJUH 3MGTA 2IH1A 3BKYH 1FFPA 1RVFL 4UT7H 3G6DH 5FYJD 3ARDC 3KYKH 3RIAF 2GEEA 1LK2B 1OAYH 1TZGH 4HDIB 3O4LA 5LVEA 2BDNH 4FXKB 1T04A 2DDQL 4R4NC 4J4PC 3BZDA 1FV1A 4BFGA 3QNXA 1PZUB 1CE6A 4UILL 4R4BA 5I8KL 4PP2A 4HUUB 3RWCA 1K2DB 3JWNC 1XCTB 5JOFA 5JOPD 3TESA 2ZCHL 3W39B 4IOFC 1UA6H 25C8H 4KMTL 3MLWH 1B3JA 4PJFF 4YJZL 3SKOA 4R96A 3GUTA 5KSBE 5C09A 5JW4R 1MHPL 5IFHH 1J8HA 4EIGB 3B9KD 3OPZH 3LKOB 1JWSB 3BH9A 3MLXL 1Y6MR 1FRGL 1P1ZB 1XT5A 1MCJA 2B4CH 4ODWB 2HT2C 5DVLA 4FZEH 1KPVB 1X5IA 1EVUA 3BMWA 4F8QA 1KELH 2A6JB 4PTUB 3QXTA 4Y4KD 1T80A 5GS2H 3M1BB 2I27N 5JQ6H 1N6VA 1AR1C 4S1DD 3ULVH 3EYUL 1SY6L 1FG2B 1IL1B 4LLYA 4JFZH 3DUSB 5FOJA 3KHQA 3MRCA 2DLIA 5CZXD 1ROWA 3V4PH 3U2SB 4OSUL 2CXGA 3KYMA 4DZBA 3QDMB 1DBKH 3HNTL 3EYOA 3JV6B 1CIUA 5TQ0H 1G7MA 3S4SA 4R0LC 1CBVL 4NC2B 1A6ZB 5DFVD 5T5NF 4Z78A 3T8XB 5DQJB 3LKNA 5I71C 1MJ8H 4G6JH 4J3TA 5DQDL 2FDBP 1FL6B 2XN9D 1CR9H 4RGNC 4XCYA 1E6JL 4H1LB 1A22B 2E9IA 2IBGA 5LBSH 3V7AG 2XZAH 2R8SH 4NUGH 2M26A 3S3JA 4FXLA 4N9GB 1AGFB 3BOVA 1AO7D 3L3DA 2AJYL 3ULUH 4KRPB 4EUPH 3TYGL 4P23A 1A6UL 3F6IA 3N9GL 1DE4A 1MHCB 3GSRA 3DO3A 1RJLB 2VH5H 2X6MA 3FOLB 3NCJL 4I18B 5H2BB 3MV11 5ECJE 2J2ZA 2WWMD 4NHUA 5T1MB 3C8KA 5HHQA 4MS8D 5EZOH 5DJ2A 4MX7A 2GTZB 1HE7A 5K9JH 2EE2A 4YHZL 2VE6B 4FQXD 4X5WB 3UBXB 1RURL 2AI0L 5SWSB 4LLVB 4BQCA 4DK6A 1Y0LA 3JWDC 4UQ2B 3U7YH 4ZNEA 4K3HA 2UWEB 2V17H 3VFPB 2OR7A 1EDQA 4ZUWB 1JHTB 2ICEB 1ZLVK 4PJDB 1HXYB 4XWOC 4XT1C 1I7TA 2F53E 3O6FC 4YFDB 1O0VA 5IW6B 4XNZC 3WFHB 4LGPB 3ZTNL 2YPLB 2HFGL 1BZ9B 1HEZB 2ENYA 2IFFL 4K7PL 3O3EB 1KSRA 1GOFA 3CDFA 2AEPL 3X11A 3MLTB 1WEJL 4CL7A 1KIQB 5HVHB 4ODTH 5HI4C 2W91A 4HCRH 3BQUA 1EIBA 3DJ9A 1MJJA 2OJEA 1RK1A 2R1YB 3RWDA 5AYUH 4HC1H 4ELKA 2E8YA 4MXVF 2FHCA 3B2VH 3UTTE 2VDRL 4OCRH 3MRKB 4P46C 3AAZB 5DUBB 3QZWB 4MQTB 1XGRA 5FYJL 2BOCA 3MLUL 2X2YA 1KTDB 4HK0B 4PRAA 1F3RB 2E8ZA 3QDGE 3SDYL 1EFXD 1NAMH 1UB5B 3OKLB 3S37X 4OLUL 2GW5A 3OAYH 3CSGA 2GJZB 1BQHB 4G9FD 4YHOH 4MVBD 1HHHB 5FGBA 4OIAA 3P4MB 2F54E 3FMGL 4M8VA 4UOW0 3WUWA 4ODUB 5IEHA 3A0OA 2OTUA 3REVA 1PZ5B 4D0DB 4XB7A 1IKNC 1LO4L 2SEBA 1H5BA 1SM3L 5C1MB 4OCSH 5IMMB 1BVLB 1RZFH 3BAEL 4JZOB 4PB0H 3TM6A 5IKCA 2XKNA 2NNAA 4Q0XL 2NLJA 3RWEB 5HJ3B 3EOYG 5GIRB 4WUUA 3GBNH 3HZKA 4MMXC 1V7NL 4QTIL 1N4XH 3R1GL 5HBBA 2H6PB 1ZGLP 1N2RB 3OGOE 2Q6WA 1H3PH 3GJEB 1QRKA 3AREA 2VL5B 1KYOJ 5D6DC 3REWB 2GSGB 3BP6B 1CGYA 1EX0A 1FNSL 4HWBA 3L7EA 3V4VH 4HMEA 4WU7B 2AQ1A 5AZEL 4LU5H 1RZJL 2ICWB 3DVIA 3MRQB 2Q8BH 2X1OA 1B0WA 2X9YA 1XIWC 1INDL 3U6RB 1FP5A 3QQ3A 1U8IA 2CLRB 1D5IL 1UM6H 4PV8B 3FO9A 4E41D 3FAWA 4OZIE 5B3JF 1PGRB 5I16B 4L8SA 3MROB 1AD9A 5JIPA 5JZ7C 4K7PX 3BEVB 5GZOC 1EO8L 4X4YB 2C3VB 1BFOA 4OAWA 2CRYA 4LRNH 1G7QA 3D9AL 3K46A 3BVNA 4IBLT 1KJ2L 3VDAA 1FGVL 5GJTH 2PUQT 5GS0C 5HHPA 3GSNA 2JJSA 3SKMA 3ZYZA 3FB7B 4MNGA 4YGVB 2D3VA 5DC4B 3WXVL 2XZZA 4MJ6A 2DQGH 3VCLB 1LEKA 2A38A 2VDLH 3KYNA 3FTGB 1TCRA 1ZT4A 2DLFH 1CXLA 4WCYH 1CDUA 3P3YA 3MNZA 1YMMD 2PR4L 5FKAA 2CR6A 3AXLA 3DYPA 4S0SD 4ZUTB 4JFFA 1CDHA 1GVIA 1SJEB 5E5RB 1O5DT 3UTZA 1N5YH 4IRSD 4PLOB 1DBAH 3QXDA 1UADC 2AXJA 1MCKA 5KVGL 4HWZA 3PNWB 5T5NG 4OCXL 4ORGB 4XP9L 5A2IH 3THMH 5C0ND 5DJYA 4S2SA 1T66D 1GAFL 2A6IB 4G8EA 1JTOA 4G42B 5E2TH 5FK9B 4LVHC 1ZTXH 1FH5H 4Z0BL 3VXUA 4HW6A 4PY8J 3MLYH 4ODXB 3AS0A 1IEBA 4Z95L 1CK0L 1DUYA 2B1AH 4I2XE 5IVXF 5LAXB 3MCKB 3ARSA 2UUDH 4HIEA 4NHCL 2WP3O 2V7NA 3U7WH 4OLVL 1ZKAA 2C4FU 3O4LD 5HHMB 1MJUL 1F02I 1QSZA 2GJJA 2DQHH 2VWEE 3QWOA 1TFHA 3BKYL 2H2PD 4UT7L 3G6DL 5J57B 3KYKL 4B7LA 3D69A 3RWIA 1I8MB 3WE6A 1J1OH 1OAYL 1TZGL 2BDNL 2BNQB 1IAOB 1U42A 4P2RE 1AP2B 1R6VA 1M7IA 5F7KC 1RZGA 2PYEB 4JANA 3G5XB 2PW1B 3MRLB 4JG1H 1JYXA 5FUCE 5C09D 2W60B 3DI3B 1FN4B 1SQ2N 1J8HD 2ZOKA 1UA6L 25C8L 1CFVH 1E27B 4EVNB 5HI5D 3MLWL 1TNMA 2X9XA 2X4RB 2BRRH 2O26U 4P2QB 1VDGA 3WUWG 1HHIA 3TBVB 5IFHL 4TQEH 3V6OC 3OPZL 5D1QC 5F3BA 4XXDA 3ARFB 3O6MH 4U2ZA 1OF2A 2B4CL 1AGDB 4G80A 3FN9A 4C56B 4FZEL 4PJAB 2UV3A 1UZ6E 1JZ2A 2VUOA 1KELL 1UH4A 4OGAD 5CFHA 4JCMA 5D7LA 3HA0A 3LN4B 3ULVL 5EA0H 3QIUA 3K7UA 4JFZL 4LLWA 4HKBA 1U3JA 4CMHC 1T4KB 3V4PL 4GKZA 1BJ8A 1KCVH 3MRFB 5C0IA 4FQHA 4G8GA 1DBKL 5TQ0L 4KK6C 2ZUYA 4ESKA 2VLJE 3C6LC 4FFZH 1S8DA 5EU7C 3I2CH 1MJ8L 4G6JL 1H15A 1CR9L 2EECA 1AC0A 2DQFA 5CSZB 5I2IA 4K7FB 2AVGA 4U31A 5LBSL 2XZAL 4P23D 4HWEH 2R8SL 4NUGL 4XBEH 3RI5F 5DSCA 3TBYA 3WJJA 3G6JE 1YNLH 3ULUL 3IF1B 2W1NA 5EBWA 1Q0XH 3DVNA 1YNTB 2OL3A 5EOTB 4NQVA 1QSFB 1DN0B 2QSCH 2XTJB 3ES6B 3T04D 2V7HB 2VH5L 5ALBH 4FFWD 4XP6H 5GGTH 3ARBC 1R3LA 4NPYB 5EZOL 1HXMA 5EIVA 1DL7H 4M7ZB 2G75A 3EO1B 5K9JL 3WHXA 4FQ2H 4KDTA 4NKIH 5I1IH 4WW2B 2P46B 4G8IA 4UTAH 1YN6B 1I8LC 3MJ7B 3AUVA 3C9NB 3IXAB 3HI6H 3U7YL 3SGKA 3PV6A 1E0OB 1IGJA 2V17L 2JIXA 1WTGT 4LNRB 1OSPH 3MZGB 1BD2B 1P6FA 1FSKB 2CSPA 1U8LB 2C4XA 1T83A 3BQUD 4OKDA 4Z7UA 3O8XB 1OB1B 2R2EA 4PD4K 1K5NB 1ZA6B 4ODTL 1NANH 3RHWK 3EOBA 1D7FA 5CJOH 4HCRL 3RBGA 3B83A 3JBG7 5GSVB 1QFWH 3ARFC 5AYUL 4HC1L 4NWUH 5DGRA 5DC0A 4I4WB 1VENA 1YY9D 1K85A 1XF1A 2D7QA 4WDIB 5F1OB 5J1AB 4RAHA 3P4OA 2DWEA 4PUBH 1KB5B 3B2VL 3P0GB 1A8JH 4OCRL 4YEEA 4M6NH 1DFBH 4MLIA 2X70B 4JFHD 1P84K 3NGBC 1WGOA 1MLBB 1NAML 3ECBA 5I1KH 3GMRA 4ZPTB 3G6AA 3IDNB 4YHOL 3FQUA 1U8MB 4JY4A 5C0RH 5J3HC 2BHYA 3QG7H 4TULH 2Z8RA 5KS9F 2B39A 4JZNA 4TVPE 3STLA 4NNYA 4WUUD 1S7SA 4XNMB 3DOSA 4OCSL 2XG4A 1AHWC 4E42A 2G9HB 3LVEA 4KHTH 3BWAA 4PB0L 4JFXB 3BD4A 1JHLH 5DK0B 5DJ0A 3TYFA 5GHWH 3HKFA 3GBNL 4ZXBA 5IM7A 1X5AA 3RY5A 3ARED 2NR6D 3IGAA 2NY3C 3CD4A 4KI5D 1EAPA 1N4XL 3O2DH 4I5BA 4A6YA 5INDB 5CCKH 3GGWB 4ZS6D 4L4VA 1H3PL 3MRIA 2APWA 1CDIA 2ADIA 3H42H 3MC0A 3ZDZF 3MUZ1 4U1IA 2E7LC 4KHXH 5ACMA 3V4VL 4H25A 3U30B 3V2AR 4M62H 2DICA 4KJYB 4LU5L 2DLHA 5MEOB 4GBXB 1OOAA 2Q8BL 4XVSH 1FNEA 4UBDD 4J3UA 3H8NA 2ERJC 1E28A 2CIIB 3U46B 1UM6L 5HHOA 5I76B 1R3KB 3UPRB 3CFJB 1XGTB 1T7VA 3BZFA 4C4KT 4FG6D 4JRYB 3QO1B 2VISB 5DRZB 4F15B 3MRJA 1RJZB 5BV7C 5BS0A 4JM2F 1HYRC 4BQBA 3ZT5A 4Y5VC 1V3KA 5IFJA 4X6CF 3IYLW 4HIHB 4LRNL 4WFHD 2BSTA 5F9WB 2AJZB 1NGXB 5GJTL 4WTZG 1EEYA 4KTDH 2CO6B 5GJSH 5DD0H 5TDPB 1AH1A 4YNYB 1NFDE 3EYQD 2R9HD 1NEZA 2DQGL 2VDLL 2DLFL 4JFFD 2C7UA 2BJMH 2FX8H 3BEWB 4YC2B 4WCYL 3WFCH 1D3CA 2ZUWA 3BISA 3B3IB 2J8HA 4JFEB 1DDHA 4KUCD 1N5YL 3ZSTA 1WUNT 1JZ7A 2HJLA 2HT3C 1MLCA 3CJJA 1DBAL 1JGLH 2I07A 1IKFH 3NACH 3QNYA 3THML 3VXUD 3ILQD 1JCKA 1S78C 4WW1A 4X9GA 4PJGF 5CD3B 2Z31C 4Y8DC 3WHE0 1LILA 4PLJD 5E2TL 4AYFA 3TPKA 4YPJA 1ZTXL 3EGSA 1FH5L 4QOKE 4UI2A 3MLYL 3UTOA 4S1SH 4ALAH 3UDWA 2JTDA 2RIKA 3L3GA 1I85C 5GZNC 4HGMA 2LAGB 2JJUA 4LPXA 3ULVE 2NY0C 1BMGA 3U7WL 5C0BE 3KXFE 1GHFH 4U7SA 4BH8A 3CC5A 3TC9A 4OD2A 3MR9B 1T7YA 4NCC2 1LE5A 2DQHL 5HY9A 4U33A 3RPIA 1IGYA 4V1DA 4LFHD 2VJXA 1J1OL 2X4PB 2J3SA 1KIRA 3QYCA 4XCCH 4K9EC 4XPGH 4ZSOE 3QQ4A 3MPCA 1V5JA 2Y5TB 4JG1L 2Z93A 1ZLSH 3FL7A 5T1LD 3WS3B 1INQB 4IOIB 2WW8A 3LD8C 1CFVL 2ZG3A 3DXAD 3D87B 1NLBH 2BRRL 3ULUE 4JN2B 4XPTH 4TQEL 2EDNA 3QWRA 4QRPE 1K8IB 1UZ8B 5D7LD 3O6ML 1EFQA 2EH7H 3QIUD 5TJWK 5KN5B 5MEND 5GRUH 3ZYOA 4OI8A 1L0QA 1QLRB 4G8GD 1SJVA 5EA0L 3OKEA 1TPXB 3BXNB 3CPLA 1NEUA 2APXA 1Q9WB 4S11A 1KCVL 2R39A 3MLVH 5D72H 1RIUH 3PQYB 3TV3H 3C60C 1T1WA 5EBMB 5I9QB 5D7JA 2QSQA 4Z7QE 4QRUA 4FFZL 3ISWA 5ICYA 5I17B 3I2CL 3VW3H 3UTQA 4X4ME 4U1KB 2JCCE 5I6XB 3ZDYE 4OZFH 3VFSB 1ZWIB 4AZ8A 5HI3C 5BQ7A 4HWEL 3RUGB 1X6LA 4YWGH 4QXGH 4DQOH 1NLDH 3L9RB 1YNLL 1Y6NR 3MUJA 1WC7B 4XB8A 2V2XB 3VXRA 1Q0XL 4YUEH 5ESVB 5IWLA 1HILA 4J8RB 3D0VB 2OQJA 3LY6A 4KJQD 4G6AD 2PXYB 2ZUTA 2QSCL 5ALBL 2QQKH 4D0BA 3RGVC 5TH2B 4XP6L 2E3VA 5GGTL 3OAZK 2J8UF 4JHAH 1S7RB 5AG8A 5I1DB 2Z0BA 5CIPA 1BBJA 1ZOXA 2P5WA 2CDEA 3MCG1 1DL7L 4P5MA 1ZSDB 3TCLA 1WWBX 3D6GA 2I9LB 4OD1H 4P57A 3FFCB 3DVGA 4JFYB 5TE6H 4NKIL 5I1IL 1HKLH 1FFOB 3GMQB 2XNAB 2JIXD 5EG6C 4O51B 5J9PA 4UTAL 2YA2A 3HR6A 3GHBH 3MMEA 4UUJA 4Z18A 3HI6L 4NRYA 4EI5A 3TN0B 2OLDA 3NFNA 1OSPL 3VGGA 4Z7WB 3RGHA 1ZMYA 1ADQA 4XC3H 5CJXC 1ACZA 3H0TA 4OZHE 4KKLD 3ARGA 2VLRB 5DJ6A 4LHJB 2Z35B 4GAFB 3U7AA 2YC1A 1UJ3A 2GFBB 3RVUC 3GMMA 4L4TE 4PGDA 5CGYC 3ZKNC 2G5RA 2X4QA 4DOHE 1TZIA 5CJOL 1MY7A 1D5XB 3MRDB 2UZIH 1QFWL 3VRJA 1RV6X 3PGDB 4M00A 4YHIB 4FFVC 4CN4A 4NWUL 3V52H 4HMDA 3PL6B 4PUBL 5C0AE 3GSOB 4D8PB 2FEEL 4M6NL 3RWFB 4EN3C 1DFBL 2O93L 4Y5YB 3CVHA 5JO5A 3BP7A 1FNLA 3MRNB 3MLRH 2NXYC 5I1KL 1G6RB 3PWLB 4Z5RB 1NCDH 3VWKB 5EU6A 4IHOB 3TA3B 3IDMB 1E4KC 2PW2B 3OR7B 4GAYB 4BSVA 2DM4A 4LBEA 4QRRB 3ZKSD 2PTTA 5D6CA 1WTLA 5C0RL 3WIFA 4RSVA 3QG7L 3DHJA 4TULL 3MV8B 1CLOH 2VIRB 4O2EB 5DS8B 5C08A 1DJSA 4ZXBD 3NIFE 1D5MB 4YZFE 1EO7A 4TTGA 1WIOA 2NX5E 2VLME 4KHTL 4XWGH 3M8OH 5ESQA 1JHLL 5E1AA 1AGBB 3KVQA 5I18H 1IC5H 5B39A 1FLTX 2OXGA 5SWZA 5GHWL 4L4VD 5DDHB 3KJ6H 1M7DA 2QSVA 3O2DL 2Z92B 3CX5J 2PXYC 1FVDB 4POYA 5CCKL 3T77A 4N5EC 3H42L 1Z9OA 1WBXB 5E4IA 1NSNH 4PJ9C 5EWIH 3TNMA 4D0CB 4KHXL 2HVKA 1RIHH 4M62L 2XOTA 3O9WC 4ZO7A 3O45B 3OKMB 1UQSB 4N8VB 5ID1A 5HHOD 1NFIA 3D2UA 1FZOA 2VNCA 1KB9K 3MGOB 4XVSL 1NPUA 3IFOA 5L0QB 5C3TA 1LP9B 4QHLA 3GMNB 2GJ6E 5SWQB 4PGEA 4YFEA 5IV2A 2W92A 3EDEA 3QUKA 4JJ5A 5T5FH 2IALB 3CVIH 4CU6A 1KEMH 1W72B 1H8SA 1Z5LB 5CEZD 2R2HA 5EUOA 4NQTA 1FQ9C 1MCOH 1GZPB 1ES0B 3MRRB 4MJIE 4JAMA 3DWTA 2BOBA 1J0HA 1F3DH 3HE7C 1YN7B 2Q7YA 4HLZH 4TNVF 3FCTB 5DEFB 3RWGB 1S9XA 4KTDL 1GC1C 5GJSL 5DD0L 1A1MA 2IANE 4CUCA 4DKAA 5EO0B 5J1SC 4WI7A 3CZFB 5GGSY 2FJFA 1MCLA 1NDGB 3M17B 4ONGH 1MIMH 3NIDE 2BJML 2FX8L 5KTEH 3WFCL 1CFBA 4FQQA 3MRPA 2F53B 2OSLB 4LVNC 3L3HA 3PWPA 1VKXA 3IU3A 4PJCE 4YFLF 4KVCH 4HJ0C 1MHEA 3IFPA 5C0CE 4QXTA 3TA3C 3FN3A 2WBJA 1JGLL 3RU8H 1JL8A 1IKFL 3NACL 4JVUA 1BWMA 3QCTH 3VXSB 3NMEA 2VITB 4JZJA 1P4LA 4HUVB 5E2VH 1I75A 2W0LA 3ZZ1A 4IRZH 3S7GA 3BJ91 3Q48A 1OT2A 1I1AB 1W0VA 1ONQB 3LHPH 1A0QH 1MCRA 2VLKB 1FVCA 4S1SL 4ALAL 4HX1A 4AIOA 4KY1H 1RJCA 4MCYA 2W9LA 3LN5A 3ARDA 5JMRA 5IK3B 3EZ8A 4Z77B 4FZ8H 4KI1A 2F8VA 4V1DD 2CRMA 4ZFFA 1JF5A 4J4PA 5I74B 5I19H 1KGCE 3EYVB 4JREC 1GHFL 4ETQB 1JPGB 4MA3B 2X42A 3QSKB 2NW3A 4TOYH 4KTEH 2KQMA 4HV8B 2F54B 4QYOB 1N6QH 1R24B 1IILE 3MFFB 4XCCL 1L9MA 3BKMH 4XPGL 2AJXH 2IPKB 5C6WH 1A6AA 4NO2A 4FTVB 4NO5B 4PRIE 3QDJA 3RZWA 1OTSC 5F1NA 1ZLSL 1CTNA 2W0FA 3MNVB 4R7DA 4DUWA 1MCPH 1YA5A 3QWRD 1JN6A 2PO6A 3GSQA 3JZ7A 1HZHH 3IVKA 1IC1A 3VXNB 2GSIB 3SDAC 1NLBL 3DGCR 2WV3A 4XPTL 1I1YA 5EO9A 3DX9B 5E03A 1QR1B 1ODAA 1AIFA 2EH7L 5E00B 4YXKH 5F9OH 5GRUL 5HGHB 2DM2A 4N0UA 1XF2B 4R0LA 4OZIF 2Q20A 4QLRA 4L3CA 2GY7B 4LEOB 3WJLC 4R8WH 2J6EH 4NO0B 2I5YH 2AXGA 2F9BT 5D7JD 1JHKH 3OJDB 4HULB 1BVKB 1C7SA 3CXHJ 3MLVL 4L8BA 5D72L 1RIUL 3MNWA 3TV3L 5DMKA 4KXZI 3ZT7A 3O3AB 1JNJA 1EEZA 3VW3L 2Y1VA 4Q9CA 4F7EA 1T21B 1YUHA 3DTXB 3N1GC 4D94A 5TGBA 1MI5B 1Q9KA 2BNUA 3UC0H 4MZ3A 3VXRD 4QF1B 3O41B 3TO2B 1MWAA 2Q87A 5A3IC 2HKHH 4YWGL 4QXGL 4DQOL 1NLDL 3QUXB 2PYFB 3OJ2C 4BZ1H 2ICWJ 3PWUA 4YUEL 3ZHKA 2HTLD 3RRQA 5J89A 5A1AA 1G9MH 2P5WD 4XMKH 4U1GB 2QQKL 2APBA 1TJIH 1G6VK 2BHUA 4JHAL 3BIKA 3SBWC 5TDOB 3VJ6B 4FXKA 5DJCB 3CFBB 1SEBB 4OD1L 3Q6GH 5TE6L 4EI5D 1HKLL 1OGTB 4HUUA 3MYZA 1B0GB 1R5VB 1XCTA 5KSVA 5JW5B 3Q5OA 3GHBL 5K9KA 3DO7B 3LV3A 4JN1H 2P5EB 4R3SA 4WNQA 3ZYJA 3ARGD 4XVJH 3HG1B 1Z9SA 2A83B 3OKOB 1XGPB 3F5WB 4HK3J 4WJ5A 1WCQA 4XC3L 1JWSA 2MHAB 2YD9A 4MXQD 2YD1A 4ODWA 4MQXC 1WAAE 5F6IC 3UEZA 1FGNH 4IDLA 3AC0A 5DT1H 3M1BA 3N06B 3OXSB 3MO1B 1L4IA 4P46A 1KOAA 1FG2A 1BJMA 2UZIL 4L9LC 3DUSA 4FQCH 1BBDH 4KZEH 1DN2A 5CP3H 2BX5A 3V52L 4HFWA 4JDTH 4R2GD 1FO0A 3U2SA 3NCMA 4P2RB 2AK4A 2P24B 3QDMA 3L6FA 3JV6A 5J0BA 3G5VB 1LD9B 1GGBH 1A6ZA 3QH3A 2ZJSH 1QA9B 5EU6D 1U91A 2JLLA 2XTLA 1FL6A 2N7AA 4PD4J 3MLRL 3UAJC 2GITA 1NCDL 4ZUUA 3KS0H 5AD0B 1UZ6F 4XVUD 4D9RE 2ADFH 2NYYD 5C08D 5J7CC 4MB3A 1FVEB 3SPVB 4N9GA 1G0XA 3QEUA 2R1WA 1CLOL 1NDMA 5B3NA 3WIHA 2X4OB 1BZ7B 1QEWB 2DI9A 3GHEH 4IRJB 5SWZD 2I60H 4ZS7H 1YEFH 2W59A 1MHCA 1FORH 1MAKA 2H45A 2E7BA 5J13B 4XWGL 3FOLA 4M61B 3M8OL 5H2BA 5EZIH 5D6DA 5I18L 2P4AB 1IC5L 2JB6B 4FQ1H 5T1MA 5KVEH 3KJ6L 5D71H 4TNWF 3E3QE 1BQUA 4UQ3B 2KZWA 2RJMA 4X7TB 3TBSA 2VE6A 4U1GC 1XIWA 4X5WA 5FB8A 3UBXA 5GRJH 2E7CA 1NCBH 5SWSA 1NSNL 2H2SD 5F1IA 5EWIL 1GGIH 3IXTA 4LP5A 1RIHL 2NTFA 3MV9E 2UWEA 3VFPA 1CE1H 4K3GA 3F7VA 1QBMH 4PJDA 2GY5A 3KDMA 3BIBX 4HKZA 5IW6A 2GI7A 5F9AC 1E6OH 2DIAA 2BMKB 2FR4A 1KPRA 1TVBB 5T5FL 1FCGA 3ARRA 3CVIL 4N5UA 5CJ5A 1LDSA 1KEML 4M8QB 4XPAH 3VH8G 3PF2A 3H6JA 4F7PA 1BPVA 1UJTA 2IBZY 3VXME 4MSWB 1X5XA 1MCOL 5JW4Q 3EO0A 3O4OB 4H88H 3F12B 4FMKA 1URLA 4LHUA 4F57H 2VWEC 5DRNB 1IAIM 4PGCB 5DUBA 2EE3A 1PYWA 3ROOB 2WIIB 3RTQC 2CDGA 3V4UH 3SO5A 1GL4B 1G7IA 4ONGL 2PTVA 2VERN 3OKLA 3PWPD 1MIML 3VA2C 3WN5B 4CNIB 5KTEL 3TIDB 3LDBC 3GSUA 2GJZA 1INEH 1MPAH 1RUQH 5JIIA 1IQDA 1HHHA 5FUCC 1I1CA 5E9DE 2PF6A 4KVCL 5MI0B 5F6HI 1J7VR 5IB1A 1OGAA 1HDMB 4QRTB 3GSWA 1N5AA 3B43A 4JZOA 3RU8L 4EXKA 4PY7B 3AMKA 1GJIA 1HK6A 2Q8AH 2WMPA 3QCTL 4R7NA 1SMOA 2B2XH 1UACH 4JHBA 5E2VL 4IRZL 2ARJQ 2C9AA 1WSST 3QAZC 3ARDD 4QGTA 5FM4A 3LHPL 1A0QL 3G9VA 4J3WA 2H6PA 4OZ4A 2C3XA 2Y9RT 4R4ND 1IEHA 4J4PD 4KY1L 1MCNA 4PREB 2VL5A 3REWA 3U83A 4X9HA 1QO3B 4EKXA 4WU7A 2FEDC 4FZ8L 1S7WB 5DVMA 5F7LB 5I19L 4TUJB 5J6GB 2XN9B 3MRQA 4X9IA 4ZFOL 3BRGC 1F6AA 5KAQF 1WVZA 4TOYL 4QHMB 4KTEL 5IB4A 4HJJH 3RKDC 4HGWB 2UVFA 4NYLB 3KR3H 5D2NB 4X7CC 2CLRA 2CKBH 1N6QL 3QDJD 4WU5B 3VXQA 5HVWA 1ZLWK 3BKML 2YWYA 3KPRA 5C70A 2W9DH 4U6TA 2W0KA 4U0QB 2HT2D 4N90E 2AJXL 3K1KC 3NCCB 4ZUVA 1KJ2B 1T1ZB 5D1QA 2DLTA 1AR1D 3U4EB 4HK3N 4X4YA 4PJ5E 4H1LG 4QHNA 3F8UB 1MCPL 5FA4B 1HZHL 4JPIA 3G9AB 3S98A 4NZUH 4RRPA 5K59F 2HG5A 2QBWA 2VABA 1UCBH 2JE8A 4NP4H 4YGVA 5M95B 3VCLA 4YXKL 5F9OL 3KJ4C 5J06A 1BQLH 3FTGA 2X1QA 2DMBA 4RGND 2Y7QA 3C6LA 2XACC 2HAZA 4R8WL 2J6EL 4MWFB 5T3ZD 2I5YL 4TNWK 1JHKL 3AB0C 3FT2B 5I1LB 4NQCA 3JV0A 1A4KA 3S96A 3UBXG 1S7UA 4NQSA 3PNWA 1ZLUK 4PJEB 2IADB 2L4OA 4BQ9A 2WINB 1AY1H 3QIWC 1HYSC 2DL9A 4CGTA 4G42A 3T1FB 1QSEE 4EEEA 1ZGLB 3UC0L 4I0PC 1QFUH 3V5DA 1MCDA 1VFBA 3MYJB 1CDGA 4ODXA 1I9IH 1NKRA 3BI9X 3AS2A 1OSZB 2HFFA 4BZ1L 3QDAA 3ARBA 4KUZH 2ZSWB 5L2KA 1EXUB 4KU1A 1TJGH 3MCKA 2X4TB 4HUWB 5C07E 4Z7OE 4WI9A 2ATKA 5FV1L 1G9ML 1UB6B 1EFXB 4XMKL 3OL2A 3A6OA 4JY6A 4HG4J 2HTKC 1RZJC 1TJIL 1I8LA 5B38A 4XWOD 4PJ8B 1QLFB 4YPGB 1I8MA 4G9FB 3O6FD 3OHXB 2BNQA 3MV01 3RX5A 4JGUA 4Y1AA 4M4PA 3OKKB 3QZWG 3BN3B 3VMPA 3Q6GL 5FECB 5KANI 1CN4A 2MPAH 3G5XA 2PW1A 3LRSB 4ZOAA 5D96B 1DQLL 2W60A 4KRNA 1FN4A 1WZKA 4Z0XA 1E27A 4JN1L 3NFPA 4RX4A 4LLMB 1BQHG 1BOGB 3F62A 3G5YA 4U0RB 4XVJL 3BGFB 3ULVF 5DC9B 3TBVA 4Y2OA 3L5XH 1FL5B 4JPVH 2ITCA 5JIKA 3ARFA 3QG6B 4L8DA 4P46D 2GK2A 5E8NB 1R3HA 1FGNL 4LQ1A 5IMLB 3KXFB 5DT1L 4I1NB 3TNNA 5HHVH 2AK4D 3QDMD 1BWWA 3ZO0A 2NY2C 4N0YH 2B1HH 4FQCL 1BBDL 4KZEL 5MHSD 2C1PB 3UYRH 1G7LB 4JDTL 5BJTB 1QG3A 2A6KB 4AENB 3MRFA 4WW2F 1C5CH 1NGYB 2AV1B 4PGBB 1GGBL 1P7HL 4Y0GA 2ZJSL 2E9JA 3LS5H 4OFVA 4PRBB 1CS6A 2VR4A 5IP4A 4AL8H 5D1XC 4D9QD 1IZJA 2Y5EA 1X5HA 3WL9A 1BAFH 2FIKB 2OP4H 5CSZA 3PE9A 2ED8A 4K7FA 5CHNA 4O2FA 1AHWA 2F5AH 2YPKB 5JOPE 2ADFL 3FT3A 3VRLE 1QSVA 3A67H 1QPXA 2IBZX 3WLWC 4NNXB 4XP1H 1Z3GL 4NBZB 3GHEL 3KLAB 1PY4A 2I60L 4NO3B 4ZS7L 1YEFL 1QSFA 3CFKB 5HTSA 1FORL 1YEKH 2BNRD 3DV6B 3ES6A 1BFVH 4HZAA 1JZ3A 3O3BB 3DURA 4NRZA 5EZIL 3UTSA 2OXHA 5CLWA 2ZCLH 3O2VH 4FQ1L 1OT1A 5KVEL 5EFIB 2E7LA 2FBOJ 1XIWD 4L5FH 4UT6H 1H8OA 2BXZA 5D71L 4LSSH 2VSCA 3EO1A 5SWSD 1C7TA 1N7MH 4LCYA 4IRSB 5C0JA 2G60H 2XFXB 4UV7H 4FXGB 4RAUB 1YN6A 5HDOA 2ZNWA 5GRJL 1A4JA 1NCBL 1OAQH 4GG6E 3D25B 4PJ8C 5JZ7D 1AQKH 2EEAA 5GZOD 1GGIL 4KPHH 1CE1L 3CGTA 3GBMH 4LNRA 3BGMA 5KG9B 1YPZB 1BD2A 1QBML 5KAQG 5GS0D 3LCYA 2IC2A 3VXOB 4UDUB 3R8BB 4UTBH 1CD8A 1U8LA 1E6OL 3MA7B 1OB1A 4FABH 5ANMB 1Z2KA 2NY1C 4U6YB 3ORJA 2B4CC 2F19H 4LCCC 3DECA 4PJBE 5LWYH 2D7MA 4JKLA 1IGTA 5GSVA 3O4LB 4LSRH 4MZ2A 4LHUD 1T04B 4LGSB 4XPAL 3B9DA 4I4WA 3ULVC 2J1KA 4KJWC 3BDBA 1CE6B 4PJ7E 4WDIA 4R4BB 4PP2B 4H88L 5J1AA 3HUJA 5E6IC 3RWCB 5JOFB 1NAMB 2GHWB 4F57L 5E94A 1JK8B 1KCRH 3SKOB 3V4UL 4HZLB 1MLBA 1G7PA 1WT5A 3L3OB 2FSEA 1M71A 4YHMH 3WV0A 1CD1B 1INEL 1MPAL 4ZPTA 1RUQL 1KIPA 4W4OC 1OGAD 4OZHB 1Q9LA 3D5OF 2Z31A 4JPWH 4HGKC 1JYWA 3ZSSA 4XNMA 4PJXF 3N1PC 3ARZA 3ULUC 4JFXA 2KL6A 3MRCB 4JLRB 2Q8AL 1T3FB 4HKXA 2AV7B 1I85A 5GGQH 2B2XL 1UACL 4M93B 3UCRA 2O5XH 4BJLA 1NBVH 3EYOB 1G7MB 3S4SB 5JDJA 4Z78B 3LKNB 5INDA 5C0AB 1RPQA 1U8JB 1OW0C 4MNQE 2EKJA 1T20B 3JUYA 5HHNB 1CGTA 3CFDA 4NKMA 4GKOA 4XCYB 3W5NA 1TTGA 3FZUC 3WIIH 1JNNH 4GBXA 5ILTH 2NXZB 3KPRD 3GB7B 4RAVB 3ESUF 4W4NA 5HPMA 1F4WH 1CFSB 1TQBC 3KR3L 4P23B 2CIIA 5DZOA 2CKBL 4LCWD 4NGHH 3U46A 5I76A 5D1QD 1WZ1H 3GSRB 1JGVH 3UPRA 3QRFM 3C09C 2W9DL 3CFJA 3FB6B 2DLEA 3GJFB 2HA1A 3QO1A 1S9KC 4NHUB 3C8KB 5HHQB 5DJ2B 4MX7B 3FQWB 4PBWD 3K74B 1A1OB 5I1GH 1GGUA 4NZUL 5FDWA 2P8PB 1CFTA 4UIMA 3EZJB 3N85H 4KK6D 2ID5A 4X6CA 2AK1H 1UCBL 5D7IE 1Y0LB 4NP4L 5TDPA 1PG7W 4YNYA 2WK2A 2YEZA 3C6LD 2EDJA 1I7RA 1BQLL 4ZAKB 4P2OC 3QJHA 4C58B 4W6XB 3C60A 1EGJH 3FB8B 3BEWA 3LIZH 1CQYA 1I7TB 4NQCD 2IPTH 3D3VA 4XP4H 2LE9A 4NZRH 3B3IA 2WUBH 2OX5A 3V7AE 4TRPH 3LKSA 4XHJC 3TO4C 1QNZH 1EPFA 5CWSA 3CDGA 3BQUB 1CDJA 2OJEB 3RWDB 4NFDA 4PRHB 4E41E 1FHGA 1H3XA 1AY1L 4HIIB 1FYTE 4M6MH 5EIQA 3ARBD 5L2KD 3T1WA 1QFUL 3NIDF 2OK0H 2BOCB 1I9IL 4JRXD 2BSRB 3RGVA 4PJGA 5BZWA 4GRWB 4KUZL 3QULA 4P9HC 1Q0YH 1TJGL 2OI9B 5TE7H 3TLRA 3MJ9A 4NN7B 2VDKH 5D2LA 2BNQD 2MSPA 4Y1AD 5IEHB 4HF5H 5FUZH 2LU7A 2SEBB 1H5BB 1QD0A 2X4PA 5F8QC 2HWZH 2NNAB 2EDRA 2NLJB 5F71A 4L4JA 2XIDA 4RX4D 2MPAL 5CJXA 2EIEA 2Y5TA 3HZKB 4NZDA 1INQA 3IDYC 2O61A 4CU7A 3ARFD 1KJVB 3RUGF 3ROLA 2Q6WB 2CKNA 2MOVA 3QRGH 4JN2A 3AREB 5DFTA 5B8CC 3L5XL 4DGYH 4E5XB 4JPVL 4WO4C 1Y18A 2NY6C 3MBXH 5D9SA 4PJHE 2X5PA 2XYCA 4JE4B 3VXTA 2VSDA 3MOBH 2IPUG 1JE6A 4K9EH 4QRQB 2AXFB 5HHVL 1MH5A 2FGWH 4EN3A 1N0XH 1U8IB 1X7QB 4N0YL 2B1HL 3FO9B 3BXNA 3B9EA 3UYRL 1GIGH 4F9PA 5J3HD 1DUZA 2IQAB 5A2JH 1C5CL 1AD9B 2AQ2A 1E4KA 1HCFX 5AWNH 5EBMA 1JFQH 3VU2A 5IUSA 3LS5L 3CMGA 5F6HJ 2RAMA 5I17A 1NUDA 1G7QB 2DM3A 4AL8L 4U6XA 4OZGE 1CI5A 3L95A 4HKJB 4PP1C 2YK1H 1BAFL 1ZWIA 2OP4L 1F97A 3GJFK 3SKMB 5I73C 4MNGB 2F5AL 5E2UH 2NY3D 5C09E 2C26A 4MJ6B 1J8HE 1QSFD 3A67L 1LEKB 4G6FB 3KYNB 1TCRB 3SDXE 1ZT4B 2DQUH 2V2XA 3OZ9H 2DD8H 3UTSD 2EZ0C 4XP1L 5ESVA 1FL3A 1A3LH 3HZYB 2XQYK 3MJ6A 4J8RA 3D0VA 3MGAA 1UYWH 1YEKL 2PXYA 1HWHB 5IB5B 1BFVL 4JFFB 1T1YB 5TH2A 3FT4B 3SN6N 3UTZB 1U2CA 1EEUA 5I8CA 1BF2A 2ZCLL 3O2VL 1T7ZA 4PJ9A 5DHVH 3TVMC 5CEYB 5DRWA 3QXDB 4L5FL 4UT6L 4LSSL 4WTXA 5MEQA 1ZSDA 2XPGB 4YR6B 2VQTA 4HWZB 2IH3A 2I9LA 4CKVX 3V79C 5ICZA 1N7ML 3FFCA 4JFYA 1FFOA 5B21A 2J8UA 2G60L 5DJYB 4UV7L 1UH2A 2ZWLT 3QUYB 3GSVB 1BD2D 4G8EB 4TUKH 1NCWH 1BEYH 1OAQL 2DJ4A 1AQKL 2PN5A 3C87A 1AXTH 4KPHL 3VXUB 5IQ9A 1IEBB 3TN0A 4F7MA 1LNUB 3GBML 5TQ2H 2LTQC 3MRMB 4PJFE 5F96H 4UTBL 4PLNC 1MCQA 2Z35A 3IU4H 2GFBA 2KH2B 4FABL 3HE7A 3O6LH 1RQ5A 2VDOH 5DHYA 3QWOB 4I9WE 2F19L 2UUDK 5LWYL 4RA3A 4KKBC 2EEDA 4GUPA 3RWIB 4K71B 1I3GH 2NQCA 4LSRL 5I1AA 1A9EB 5MERB 1DQTA 4BUHA 3SQBA 1OAUH 3QFJE 4JANB 3J8F7 1PKQB 4HBCH 2HT3D 3GSOA 1P5VA 3RWFA 2ZOKB 3VFMB 3I6LE 1MF2H 4ONHA 1KCRL 1I1FB 4KVNH 3MRNA 4E9LA 1DVFB 1A7QH 5I1CH 3PWLA 5T1LB 1S78D 4ZNEE 1HHIB 2Z31D 3TA3A 5KSBA 1LP9F 2P8LA 4GAYA 5F3BB 2FHFA 4YHML 1OF2B 3DXAB 3L5JA 1C16A 5DMIH 2FBJH 3KLDA 2HJKB 4JPWL 5GZND 2X1PA 3KPTA 5DS8A 5D7LB 2A9MH 1D5MA 1C08A 5MENB 5GGRA 2NY0D 1E4WH 2HVJB 4HKBB 1LK3H 3QWQB 3ABZA 3D1MC 5GGQL 3BD5A 1CXEA 4GKZB 4JO3H 5DDHA 2JJVA 2O5XL 1P9MC 4FQHB 1WF5A 4G8GB 1NBVL 2OTWB 1V05A 4WV1B 3H3BC 4B0MM 3LRHA 3W0WE 2Z92A 2HH0H 4KRMB 3CSBA 4KKAD 3Q6FB 5IHUH 1H15B 4GBXD 4GRLC 4F7TB 1A7RH 1WBXA 2DQFB 1T7WA 2XA8H 5ESAA 4MB4A 3OKMA 3WIIL 3TBYB 1JNNL 5DSCB 5ILTL 3QJFA 2V5MA 4AG4H 4KKCC 1QBBA 3QUYC 1MFCH 5EBWB 1IZKA 1F4WL 5FXCH 4NGHL 5LGKA 1UEMA 5SWQA 1LEGB 4JHZA 1WZ1L 4LK4A 1JGVL 3RVTC 3SDAA 3PHQB 1UGNA 3D48R 1LO5A 1W72A 1R3LB 2NZ9C 3C6SA 1OWWA 1HXMB 5CBAA 4PYHA 4POUB 1IAIH 4K3JH 4KROB 5I1GL 1IFHH 3BRFA 3RWGA 4Z7NF 1NKOA 2V9RA 2V5RA 3WJLA 3TP4A 3C60D 3N85L 2AK1L 1SJXA 3U79A 3ELAT 4N1HB 3KPNB 5CMAB 3D3VD 3CZFA 2JIXB 1JBJA 1NDGA 3M17A 1IVLA 2YN3A 2D0GA 1EGJL 3LIZL 4N68A 4LKXA 2WUCH 5HI3D 2IPTL 2F53A 2OSLA 4XP4L 4GMSH 4NZRL 2EDKA 2BXYA 2WUBL 4WTWA 1RJYA 2ZUQC 1F90H 2VDQH 2WNGA 3R4DA 1F2XK 2OMBA 2OTPA 4TRPL 4OT1H 1U41A 1QNZL 3EOBB 4OM1H 5IG7B 35C8H 2BVUA 4NQEB 3VXSA 3I75B 1XFPA 2EC8A 3GRWH 3FRPA 3RGVD 4BZ2H 3P4OB 5I75B 2JJTC 4M6ML 3QB7C 1I9RH 1OP5K 3UTTA 2EIDA 4HUMB 3FONA 4TTDC 2OK0L 4ODHH 4R97B 3R06B 3AS1A 3X14A 3T09A 1DSFH 4U1NB 5DI8B 5IK3A 3ZLQC 4CBPA 3QDGA 1Q0YL 3SBWA 4Z77A 5TE7L 4LDOB 5D93B 3H3PH 3HC0A 3G6AB 2VDKL 3EYVA 2FL5B 3H7BB 2QHLA 1JPGA 4JY4B 4UINH 4P5TC 2Y6SC 1JWUA 5JTWA 2F54A 4HF5L 5BRZD 3BT2H 2AJUH 3RNQB 4JZNB 2QV2A 4XPBH 5FUZL 1S7SB 1R24A 5CBEA 3CUPB 4ZFZB 4X4XA 2HWZL 4E42B 3BWAB 5M7QA 1B6UA 4K8RC 4X6DB 3RVUD 3DRTA 1NCUA 3TYFB 4ZXBB 3ZKND 3MNVA 2XWJA 4HHAB 3ZE0E 2ED9A 2JJWA 3GBLA 4FFVD 5FO7A 1JPTH 3VXNA 4L4VB 2A77H 3MRIB 3H9SD 2FJHB 4S0TD 2YD2A 2ADIB 3CXDH 3QRGL 1X6NA 1F3JA 4U1IB 2GKIA 5EB9A 2CUHA 4DGYL 1QR1A 4H25B 3MBXL 2YUZA 3T0AA 2HMIC 4EN3D 5E00A 1J10A 4R9HA 1RUKH 3DV4A 2VXUH 1MNUH 3E3QC 3RPKA 1FNEB 1OTUC 3MOBL 4GKSA 4KROC 2F58H 2NXYD 4K9EL 4OKVA 3D39E 4MQSB 2FGWL 4LEOA 1N0XL 5HHOB 2FX9H 5FIEA 3LKQB 3BZFB 1BVKA 1DZBA 1GIGL 5EOQH 4X4ZA 2CLZB 1RZIB 1KACB 3AROA 5AWNL 1JFQL 1UXSA 5IFJB 1FPTH 2BSTB 4N8VG 2YK1L 1U8QA 2BZDA 5DQ9B 3PDOA 4HEPG 4CW1B 5IBLC 5E2UL 3FHAA 1XF5A 1NEZB 1JPST 2BC4B 2PXYD 4ENEC 2R29H 4N5ED 2DQUL 3OZ9L 2DD8L 3VDCA 4HD9A 4G43B 1S5HA 3UX9B 4F58H 1A3LL 1JTTA 5E56A 4PJ9D 1UYWL 1YDPB 5EU4B 5IVXE 2X10A 5HYSA 5DLMH 3C5SB 3E0GA 3FFCD 2DF3A 1PAMA 2HJLB 1MLCB 3ZE1F 4IDJL 1N8ZB 3DX6A 5C9JA 4LQFH 3CFBA 1SEBA 5L2JA 4WFED 4Z7VB 1FAKT 3QNYB 4MA1C 3ARQA 4WW1B 3QPQC 4YDIH 2VB5A 1B0GA 1R5VA 1J05A 5JW5A 4TUKL 1NCWL 1BEYL 3FQNB 2RCSH 4JKPH 3EGSB 3CIQA 1AXTL 1NANI 1UG9A 4NZTH 3L3GB 5A16B 1QFWI 5TQ2L 3HG1A 4I2XA 4IJ3B 3T2QA 43C9A 3F5WA 1A1NA 3HE7D 3TWCH 2MHAA 5F96L 2CH8A 3IRPX 2YD3A 1A9BA 4NT6A 5IMOA 1SY6A 4BH8B 3CC5B 1WWWX 1NBQA 2FEEI 1EO5A 1RZKH 3O6LL 4W81A 1LE5B 2DTMH 2VDOL 1IGYB 3HRZB 1KLUA 4OFPA 1KEGH 4V1DB 5EORH 1KIRB 3RTQA 3IJSA 4P2RA 1OAUL 3ZE2F 5DR5H 4TYUA 3C2AH 4HJ0D 1VA9A 2MQCA 2Z93B 4HBCL 4XBPB 4GOSA 1S9YA 3TA3D 4KGLA 4LLDB 1MF2L 2QQNH 2GCYA 2WQ8A 3LEVH 4KVNL 1A7QL 5I1CL 3WMSA 5J1TC 3CCHB 5ID0A 3OJMB 4HPOH 3WKMH 1I9EA 4KK9C 4Y4FC 2DQTH 5DMIL 2FBJL 3HB3C 3RY6C 3WDJA 3SDDC 1QEWA 5K9QI 3MZTA 4Z7UE 1T0MB 2A9ML 1FFNA 1RFDH 5EDXA 5JPMA 2ZOLA 5GGRY 5FGRA 1E4WL 4NBYB 3X3GH 3X17A 4M61A 3CPLB 1LK3L 4NQDE 3H3KA 4AY0A 4JO3L 2DQCH 2JB6A 2XKUA 1T1WB 3SY0A 1BFTA 5D7JB 5IW1B 2WZPD 5ICYB 2HH0L 5HVFB 5D5MF 5IHUL 1IC4H 1A7RL 4QWWC 4IIQB 3SKNB 3DBXB 1OTSD 1RUMH 1J0IA 2XA8L 5I1HH 5BQ7B 3QUMH 2DL2A 4NC1E 1G1CA 4DEPB 2PKDA 4AG4L 3SDAD 3G6JA 1IGMH 4ZG1A 1MFCL 1HILB 3S5LB 2BMKA 4WI4A 4YHYB 1TVBA 2BVTA 1DQMH 1OAKH 3BIAX 4S1RH 2AS5M 4ZO6A 2CK0H 1X5GA 4LAJH 4RBPH 3QISA 4WHCA 3OF6D 5CIPB 4ZQKA 4BH7A 1FZMA 4P5MB 3TCLB 1X4XA 1IAIL 4LVOB 3ARXA 3DVGB 4K3JL 5CUSH 1IFHL 3F12A 2EDHA 3SHSA 5J9PB 4DW2H 1MFDH 5DRNA 4YQXH 1ULVA 1M7XA 4EI5B 2WIIA 2F53D 1DEDA 5B4MC 3WNLA 4CNIA 3RVVC 2YBRA 3TIDA 2VXQH 5I15H 4GAGH 2WUCL 1TQCB 4X7SH 5HYJB 2VLLA 4Q7DA 5DJ6B 3U36B 5HXMA 3IRZA 3N0PB 4GMSL 1UFUA 4AIXA 4CVXA 4H1LH 1C12B 1F90L 3EJYC 5A3ID 4F80A 2VDQL 1A14H 4PGDB 3BPNB 4OT1L 3VFOA 4F37K 4I0PA 1KT2A 4PR5A 2DKUA 1HDMA 1X4ZA 1EVTC 4QRTA 4OM1L 35C8L 5KS9E 3ULSA 3MV7E 1JGDA 5E99H 3UTTD 2H32A 5BS0E 3EOAA 2GQHA 3BUYA 4OFKA 3GRWL 4BZ2L 3QDGD 1I9RL 1PX4A 1VERA 1MCBA 4R2GB 1XGUA 5JO5B 4ODHL 3BP7B 3GIVA 1QQDB 4PREA 3V0VA 3EDKA 1DSFL 3KYOB 1QO3A 1MCFA 1ORSA 3C5JB 4AMKH 2F54D 4O9HH 3MACL 3SGJC 4FA8A 4BYHA 1KCUH 5J11C 4JDVA 3H3PL 2DI8A 5H94B 4JR9H 2PTTB 4UINL 5D6CB 1UCTA 1G9NC 4DGVH 4HGWA 3BT2L 2AJUL 5D2NA 1CCZA 4IIQC 5F7FA 1ZVSB 5KBNC 4XPBL 5F7NC 5C08B 4PG2C 4PJEF 4MQXD 3W9EA 5ESQB 2Z9TA 5L8JB 5L9DH 4G6KH 1IC7H 5E1AB 4Z76A 5B39B 4OI7A 5SWZB 3UPAA 1KJ2A 2ZZUT 4A2LA 4PBVC 1M7DB 4KQ3H 4NFBA 5FA4A 2CMRH 3T77B 3VG9B 4YHYC 2A77L 3BUTA 3CXDL 1OM3H 2AERT 3OGCA 3PWNB 3UJJH 3V5HA 1RUKL 3TT1H 5C6PB 1FZOB 1GZQB 1MNUL 2VXUL 2NPLX 4WHDA 2F58L 4QY8A 2D7OA 4FRWA 3IFOB 3UAJD 4POZC 2VZ3A 4ZYKA 1BM3H 3DYMA 5DMGC 3IDUA 4N0FA 1C8PA 4Q6IC 5IV2B 1RHHB 2FX9L 5I1LA 1CXHA 5EOQL 4C54A 1HHGA 3TFKC 1U95A 4LOUC 3OKNA 4KFZC 1FPTL 2YD4A 5EUOB 3SJVE 5D7IF 5L8KB 2QADB 2WINA 1MQKH 2BOBB 1GXEA 2Q7YB 4ELMB 1S9XB 1A1MB 5ADPH 4QTHB 1AXIB 2CXKA 3BW9A 1NFDA 1WFTA 2R29L 4EXPX 3LQZB 1EXUA 2X4TA 4XMLH 3VG0H 4F58L 5LCVH 5DLML 3PWPB 3IU3B 5AAMA 2AJ3A 4PJ8A 2EDBA 3OHXA 4LQFL 2Z8SA 2QQQA 4FMFA 4JZJB 1P4LB 2FECL 4RMRA 4YDIL 3LRSA 2OZ4H 1V3MA 2D0HA 2RCSL 4LGRB 3HAEG 1R5IB 2EIZA 3SGDH 1EJOH 1E4JA 4LLMA 4QOKA 4G5ZH 4DCQA 1Z0NA 4HX1B 4NZTL 3WKNA 4MCYB 2J5LB 4LCCA 2FCBA 3GI9H 4MD5B 3A6CH 3TWCL 2VXVH 1BECA 1D9KC 1FG9C 3QG6A 4APQC 4ZFFB 4ETYA 2IQ9H 3VXRE 1TTFA 3MUHL 2MKWA 1RZKL 2NW3B 1PBYA 3KXFA 5FYKH 4PYGA 2VAJA 3RTQD 3WDIA 2DTML 4FFYH 4OBSA 1KEGL 4P2RD 5MEPA 1R3JA 2VQUA 4PJIB 5EORL 5INCA 4O2CA 1XF4A 4FHBD 2C1PA 5BJTA 2A6KA 4AENA 4NO2B 5E4EB 1T5WA 5DR5L 4ZSOA 3C2AL 4MAUH 1V8HA 3QDJB 4PGBA 1DP0A 3PWJB 4W4OA 2I26N 2H1PH 4I0KA 5LGJB 1MFAH 1REIA 4PRBA 2QTEA 1JN6B 2QQNL 3LEVL 4QEGA 4JKWA 2HLAB 1I1YB 5EO9B 4EUPA 2H8PA 1J12A 2KZ1B 4HPOL 1BIHA 3ZKXC 4DK3A 1ETZA 4LEXH 4QRPA 3WKML 3RZCB 4CADB 3GDBA 1L6ZA 2DQTL 2DKSA 1OLZA 4PJHB 1ORQA 4Y2DC 2QADC 4N0UB 2E6PA 4NKDA 4Y19B 1RUPH 1RFDL 5I71B 3BN9C 1JIBA 2FEDD 3BH8B 2P44B 2AXGB 1OW0A 3DV6A 3LQMA 1MCWM 3O3BA 2PCPA 3CLFH 2VLJD 1N0LA 4NUJA 4RGNB 5DHXB 4L8BB 2DQCL 1G9MC 1P7KA 1RZ7L 3MNWB 3RKDD 5IW3A 5DK2A 5DMKB 2MWCA 3WNNA 3CK0H 2QQLH 3K4DA 1UENA 4FQPA 3VGBA 3SKUD 2XFXA 1YUHB 4X4MA 2JCCA 1IC4L 4FXGA 4RAUA 4PLKC 5TGBB 2BNUB 4HIJA 1A21A 3VWJB 1DTUA 1RUML 2R56L 1EV2E 5I1HL 2ITDA 3F7RA 3QUML 2PETA 3PXHA 4JFDE 4BKLA 4OJFH 1S9WB 4K7PY 1X5YA 3SOBH 1JZ5A 1IGML 3VXOA 3QXUA 3SDXB 4UDUA 3PWUB 4PRPE 1TVHA 2XICA 3OKDB 2YSSB 5IVZA 4HCRA 2E27H 1U8KA 4TUOB 4ISVB 5ANMA 2BVPA 1DQML 1OAKL 4S1RL 2A73A 4U6YA 4HC1A 1OQXA 2CK0L 2X05A 2J5LC 3LAFA 2M2DA 3CU1A 3MRGB 1EHAA 3BIKB 2LVEA 2R0WH 3VFTA 1ZAGA 1Z9LA 3P0VH 1O7VA 2VZ1A 3WS6C 5CUSL 5JHDE 3O6FB 2NMSA 4DW2L 1L7IL 1NAMA 4XNZB 5KSVB 5K9KB 1MFDL 4LKCA 4YQXL 3BFOA 3LV3B 1JK8A 4R3SB 4WNQB 2ICCA 4HZLA 5JQHC 5K9OB 4X6BA 3TO4A 3L3OA 5E4EC 2UZXB 4NSKB 4MAYC 2VXQL 5I15L 4WJ5B 4GAGL 1CD1A 4X7SL 4I0PD 4PJFB 4OZHA 5C0GA 4YHKH 1A14L 5I1JH 5JXAH 1UWXH 1G0YR 1MRDH 5FA3A 3I02A 4P46B 3P9MA 4HS8H 4I0CC 4JLRA 1ITBB 1T3FA 5E99L 2AV7A 3RZCC 4HFWB 3T0WA 1FO0B 1T66C 3ESVF 4XZUA 5CINH 2L7JA 2AK4B 3L6FB 3QH3B 5KSUB 1AC6A 1U91B 5C0AA 1U8JA 5F8RC 5LQBH 1T20A 3P0YH 5HHNA 1K6QH 5E5UB 2GITB 4AMKL 1PQZB 4GG8A 4P3WA 5E6YA 3J7HA 2EC9U 4ZUUB 4O9HL 5AZ2H 1KCUL 1RD6A 4TVPD 4JR9L 2CKBB 2H2PC 1OWRM 2QR0B 3QEUB 3GB7A 2R1WB 3HRPA 2WBWB 3EJZC 1NDMB 4HXAH 4RAVA 3STZA 4DGVL 1CFSA 3QCVH 5I0ZA 1PW3A 3VWJC 1YEGH 4K07A 5F1KC 2EC9T 3FB6A 3GJFA 4X7EC 1MHHA 5L9DL 1W8NA 2NX5A 4G6KL 1IC7L 5B8CA 2FGZA 3K8MA 4OF0A 4FNLH 2QKIB 2YMXH 4WO4A 3HMXH 4KQ3L 2BNRB 3DI2B 2NY2D 3FQWA 4M1GH 4XRCB 4U1HB 2B5IC 2CMRL 1A1OA 4X8JA 5T33H 2VAAA 3TBSB 1MVUA 1MCEA 1XIWB 2P8PA 5FB8B 1BIIA 1OM3L 4BSJA 4YDJA 5DD3H 2DB8A 5F1IB 2MMXA 2KQNA 1CGWA 3A6BH 3IXTB 3UJJL 4K23H 2NTFB 1I8KA 1KB5H 3TT1L 4ZAKA 3F7VB 3FB8A 2OBGA 3V7MA 4OV5B 3KDMB 2GUOA 1HHKA 4HKZB 1BM3L 1QFPA 2AKRB 4XPHH 5ERWA 2FR4B 1KPRB 2RBLA 2GJ6A 4WY7H 2D03H 2VUYA 4JKKA 1IRAY 5FGCE 1Z9MA 4ZOCA 1F4YH 1D6EA 4GXUN 5FO9B 1T2XA 3WLWD 1NBZB 4I77H 3MUGB 3WEXA 2ESVE 3HR5A 1ZT1B 1QBLH 4F7PB 4ZDHB 4PRHA 1CFNA 3EO0B 4OQ1A 1MQKL 1P6AB 4Z6AT 3PABA 4HIIA 5F89A 4MJIA 4KI5F 2QJDA 4LHUB 1J1XH 5JPNA 4OF6A 4UNTA 5ADPL 1KCSH 2ENSA 2IANA 2DQEH 1PYWB 2EDEA 4LIQH 5BMFH 2BSRA 2CDGB 3BKJH 1G7IB 3EAKA 2EO1A 5E8OB 1H3GA 4XMLL 5K93A 3VG0L 3GSUB 3QI9C 4PJ8D 3RIAK 2R1XA 1IQDB 3Q2CA 5LCVL 1T5XB 2EDXA 3Q5YA 1LGVA 5JMOC 3KPMB 5L8LB 4PJCA 1KPUA 4LVHB 1FLRH 6FABH 5IB1B 3NN8B 1OGAB 4P0DA 3GSWB 1N5AB 3HNVH 5ENWB 5A40E 4OTXH 4NKQB 4R7NB 2ORBH 5BVJB 2YRZA 4QOKD 2DKMA 1A6PA 2NY1D 2OZ4L 2I9TB 4Q2ZB 2VYRE 3QDHA 4P9HH 1HWGB 1KJVA 1EJOL 2GT9A 4OZ4B 5GS2D 4G5ZL 3ULVD 4KJWD 2X1XR 3GI9L 5T3XH 5KVFH 3KXFD 3A6CL 5E6ID 4E5XA 1ND0A 2VXVL 3KYAA