1MCEA

Principles and pitfalls in designing site directed peptide ligands
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
216
structure length
216
Chain Sequence
PSALTQPPSASGSLGQSVTISCTGTSSDVGGYNYVSWYQQHAGKAPKVIIYEVNKRPSGVPDRFSGSKSGNTASLTVSGLQAEDEADYYCSSYEGSDNFVFGTGTKVTVLGQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IMMUNOGLOBULIN LAMBDA DIMER MCG (LIGHT CHAIN)
publication title Principles and pitfalls in designing site-directed peptide ligands.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immunoglobulin
total genus 40
structure length 216
sequence length 216
chains with identical sequence B
ec nomenclature
pdb deposition date 1993-02-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1mceA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1mceA02
4LAJH 5IMOB 4JO3H 5IGXH 3MRIB 2VISB 1S8DA 3HLAA 4LCWA 3I02A 3FN3A 3QDGE 5DMIL 4DCQB 1CXKA 1U8HA 1QLEH 2C4XA 3FQXA 3GBNH 3QDGB 4OGAD 4X9GA 1UT9A 4Z95H 2NY5L 4JN2A 5DLMH 1IM3B 4P4RB 1SHMA 2P8LA 2UY7A 4PRBA 2JB5L 1K4CA 4ACPA 5JIPA 3W82A 4U49A 4OCRL 3MODH 3N85L 4XI5C 4OKDA 1F11A 2YMXH 1CICA 2BP3A 3I3BA 2IEPA 2W1NA 1Z5LA 4HWBA 1R6VA 5EOQH 3QO0A 5JDJA 1I1AC 4NYLA 1OTTC 2CUMA 3D39A 4X7EC 5T3XH 2X6MA 3NFSH 1HHIB 3GSNL 1MSPA 4KGLA 2K7PA 3MCLH 4M43H 2CD0A 2X7LB 1HINL 5DUMH 1NGZB 2F54B 4M48L 2Z91B 4NN7C 3IFOB 4LCCB 1QKZH 4NWUH 4LLVB 3AS3A 4YHPB 2VUOA 4KRMB 1I9RL 1EEZB 3JV6A 5DMJB 5GGQH 2DM2A 2AKRB 5HVGB 1OHQA 2APFA 4RX4A 2P5EA 5MP6L 2E8YA 4U1GC 2A83B 4QEGA 1J8HE 3QISA 5DMIH 2DM3A 5FYKL 4U6XA 1XZ0B 5IMKB 5JPMA 3GUTA 1VKXB 5ABDE 2WBJA 4JN1L 4XXCC 2NY5H 3W11C 4ZPTB 2EIZA 1KJ2H 4PJEA 4XB8A 3QFJB 1J0ZA 4ZTPL 2HMIC 5JW5A 4GOSA 2JB5H 4OIBA 5DVLA 2H32A 3SE3A 2MQ3A 4GAYB 4OCRH 3UYOD 3T4AA 3T0EE 3N85H 5IB1A 3B2VL 5JHLL 3T0EB 4QTHB 5LAXA 4HQQL 4DQOL 4XP6L 3IXAB 2W38A 4NRXA 3MJ6A 3QUXB 1NFDA 3X17A 3W39B 5IIEB 5D96C 4DN3L 3QEUA 4P23A 2WUCL 1CDJA 5IBUB 5TH2A 2IH3B 4TUOB 5I8CA 1HINH 2V7HA 4EUPB 2VDNL 4HG4K 4M48H 4QYOB 1KYOK 3GBML 4RFNC 5C0AD 1IC5H 1RHFA 4NRZB 3VWJA 4MNHB 3GSWA 2FO1A 3M8OH 3GRWA 4NKDB 1SVZA 8FABA 3IKKA 4YDJA 5DD3H 1ETZA 1HHKB 1K2DB 1MREH 4NRYA 4QXGH 1C5BL 1YJDL 4Z7UE 3GM0A 5MP6H 5TPWL 5L8LB 4L8SC 5DJ0A 5GS2D 3VGDA 1HNFA 3QCTL 5FYKH 2YA0A 3QYCA 3SGJA 4OF7A 3MLSL 4JN1H 5J12C 2JIXB 1A14L 3ZKNC 3TYFB 1QA9A 4JVPA 3MGTB 5I75C 1EEUA 3CDGA 5SWQB 4ZTPH 4Q6YA 5KJRL 4OFPA 5FCUH 1UJ3A 3HI1B 1P4IH 4K8RC 3FQTB 3OL2A 2YUZA 1QPPA 4PJHB 3SDAA 1M6OA 3NCJH 2IBBA 3B2VH 2EECA 2OJEB 4IS6A 4BQ9A 4G8GE 4GAJL 3TBSA 4XP6H 3RZCA 4G8GB 1MJUL 3CDFA 5T1LB 1NGWB 2V9RA 4TVSa 2EXWC 2ATPB 1T1WB 2OXHA 5HHME 4YPJA 5C0DA 1DN0B 2LAAA 4BZ2L 4Z0XA 2WUCH 3SO5A 5FO8B 3AS2A 1Z9OA 2VDNH 1CN4A 3NCFB 3DWTA 3GBMH 3HZKA 1CYGA 3LKSA 4C4KO 1YMHB 3IRPX 1FZJA 1BBJB 4DGIL 5IB4A 3O4LA 3GJFH 1FG2A 2BSTA 3VI3F 3IDIB 3E3QC 1F3DH 1K4DB 1UCBH 1D7FA 2NY7H 5T5FL 4M1CD 5GS0L 4ZSOA 5J6GB 1HIML 1M71B 4HULB 3BZ4B 2ORBL 4UAOC 3LPFA 4XZUB 3HMXL 1BEYH 5AYUL 4G6FD 5I1KL 3HNVH 3QCTH 1TMCB 4QNPF 5IMOA 4LFHG 3MRIA 3MLSH 5CBEB 2VISA 1IM9B 1A14H 2EZ0D 5C0BD 3MRNA 2J12B 2PTTB 3QDGA 3C8HA 5I0DA 2J8UE 4KU1A 3JUYA 1X3DA 2FZ3B 1U8OA 3FHAA 4P3WA 4ZAKA 5KJRH 4AENA 2J8UB 3UCRA 4X80L 1I9IL 1MHEA 1TNMA 2CXKA 1IC7L 4LEOB 5ESVB 3ARED 1QO3B 2E9JA 2VQ1B 2RBLA 4JVUA 4XCEA 2DLEA 2NMSA 3HG1D 1BECA 4UILL 4GAJH 1GSMA 5FF6A 1EEYB 4RWHA 4P2RD 1I8KA 5E4EC 3TPUB 3FTGB 4W68A 2CLZB 5EC1A 3WS3A 1EAPB 1MJUH 1XF5B 2GTZB 5BJTB 4L5FL 3UJJL 4CVXB 1EJ6A 1A6WL 5TE6L 2R2BB 1RZ7H 2O61B 1DUZA 2UUDK 3ILQC 1ROWA 3GSNB 3ZSTA 2W91A 4DFIA 3RHWF 2HTLD 4DGIH 1OAKH 2Z91A 4QHKI 1E4XL 3BW9B 4ZUWB 4AJ0A 2ATKB 2YN3A 4Y4KD 3BFOA 4Z76A 4LCCA 5T5FH 5GS0H 1HIMH 2ORBH 2C3VB 1PKQE 4EVNB 2W59A 3HMXH 2AKRA 1B4JL 4R7NB 4V2CB 4WWKB 5AYUH 3B9KB 1CT8B 1B6UA 1H3UA 1HSBB 5E9DE 1P7QD 1YNTB 1M7XA 3RBGA 5E9DB 4BYHA 4GW1B 1AC0A 1J8HA 1XZ0A 5DC9B 5IMKA 1VKXA 1EIBA 3EO9L 5F7UA 1WCQA 4G9FE 2G5BB 2MWCA 2GKIA 5IKCB 4X80H 1I9IH 3V4UL 4N90D 5DTFA 5D1ZD 1IC7H 5J6HA 3GMLB 1F4XH 4GRLA 1BOYA 3OKLB 2E5EA 4FQXD 4UILH 2DWDA 4GAYA 4PRDB 4OV5A 4OLZL 1H8SA 4WUKL 5D9SB 3FMGH 1I85A 3T0EA 4QTHA 2YRLA 3DRTA 1T80A 4L5FH 3UJJH 3GKWH 1SJXA 1KN4L 1EVUA 3HZMB 5CGTA 2YWYA 2XPGB 5A2FA 1A6WH 3B8SA 3MR9B 5IIEA 5TE6H 1A47A 3SDXE 2AXHA 1L6XA 1WJ3A 4JM2B 3ILPB 3G5ZB 3SDXB 2OYPA 5C08E 4EUPA 1DQJB 1TETL 4AIXA 4QYOA 2X4TB 1E4XH 3VDAA 3MLTA 5C08B 3NPZB 4MNHA 1IKNC 1UH2A 5F1IB 5CIPA 2WBJC 3K1KC 4Y19D 4TRPL 3UBXB 4ERSL 5IEHA 2AJXH 2YEZA 4GKZA 4HZAA 4GRMA 2PXYB 1NJ9B 5D72L 5DJCA 1R3LA 3L9RB 1HXYB 1WTGT 2Q7YA 3ELAT 4N1HB 4Z7UA 2R0KL 2UZYB 3SE3C 5D8JL 3RWEA 2BVOA 3QG6A 4OIIL 3OR7B 4PBWD 2JIXA 1MFAL 4F33B 3CU7A 3EO9H 3PP3H 2MPAL 5BW7A 3MGTA 3BPCB 2X9XA 1BLNA 1DUYB 4KUCF 2XXMB 4TUJB 3QUYB 5A2JH 1DEEB 3K7UA 2DLTA 4P23C 4OLZH 4WUKH 1J1PL 1Y6NR 3BSZL 1MHHA 3QAZB 1BQLL 5K9OA 5EOTB 5DK3A 1OARL 5HGBB 1S9KC 4L1HA 3VWJC 3U83A 3U46A 4U3XA 5T1LA 1BVKA 1NGWA 5BZDA 1KN4H 3TJEL 4PUBL 4PY8J 2EDFA 2KBGA 1DN0A 1J12A 3WKML 3QXAB 5T1DL 2LE9A 1NCDL 3QWQB 4Z7OE 1RIUL 2ITCB 4PJIB 2EE6A 4L3ED 1A6UL 3R8QA 4MA8L 1U8KB 3BWUC 1TETH 3WFZA 2Q3AA 2C7UA 1Z6JT 2AK4D 1AGCA 1WWAX 2OR8A 2EDOA 1YMHA 3SGJC 2FGZA 5F97E 3S3JA 3IDIA 1RK1B 3ETBF 4ERSH 4ZUUB 1A4JA 3C8KA 5FYJU 4LCIH 5J6GA 4Z0BL 5HDBF 4HXAL 3BZ4A 1Y6MR 3P4LA 2X4SA 5D72H 2G9HB 1AC6A 3ZT7A 1QVOB 1UJ3C 4O2EB 4WHYH 3WBDA 4FG6D 4WGWB 2R0KH 1NC4B 5D8JH 2YA2A 4OIIH 5L7XH 2IG2L 3CXHK 3ZE1E 2CMRL 3F8UB 1MFAH 3BPNB 2DYPD 5E70A 4GQPH 3S35L 3RZCC 4LSPL 1CDUA 3LKQB 2FZ3A 2XACC 4WUUD 2I9TB 2JJWA 4J3SA 2VLKE 1R5IB 1GOHA 1RUML 3JV4A 2J8UA 1DZBA 2R8SL 2HWZL 2VLKB 4U6YB 4NGHL 3GHBH 2VQ1A 1CGSL 4WTZA 2DMKA 1OVZA 1J1PH 2D7NA 3BSZH 1BQLH 4X98B 32C2B 3KVQA 2P8MA 1F6LL 1OARH 2M8XA 3FTGA 4PJFB 1EAPA 4G7VL 2GTZA 5BJTA 3TJEH 2DTML 4PUBH 3OG4B 3EYUH 3WKMH 5T1DH 1QBLL 5F7LB 1RIUH 1D5ZA 3RWIB 4GW5A 3ECBB 1A6UH 3VDCA 1KIUA 5HDLA 4MA8H 2CLVA 1AXSA 3GSNA 3OKOA 3MO1B 1BIIB 1WC7B 2NY0C 5EUOF 5KANG 3WNOA 1T1YB 4JCLA 5BXFB 2D0FA 5I76B 4ZUWA 5HPOA 1JWUA 2ATKA 5DK2B 2ZSVB 3MACL 1T04B 3HE7B 1W72L 3FZUC 3JZ7A 4OF3A 4Z0BH 5DGRA 4NQDD 4HXAH 2ADJA 4E42B 4ZAKC 3IDMB 1KTDA 2HA1A 5D1XA 5MEPB 1PKQA 5GGTL 4GAFB 2IFGA 5JXEA 1EEQA 1RZJL 1YNTA 3O11B 5C07D 3R8BB 1VEPA 1C5DA 1MCIA 5H94A 1U8NB 4TYUA 5E9DA 2DM7A 2IG2H 1CFTA 4GW1A 2BCKB 2CMRH 2GAZA 3VFPA 1MCQA 3S35H 4OFKA 4LSPH 3RVWC 1ZA3B 4I0PA 5I1AB 1RUMH 4L9DA 2FDBP 4Y8DC 4AMKL 2R8SH 3SY0A 1FCCA 3BGMA 5IKCA 2HWZH 1U3JA 3C60D 4G9FA 3LKNA 4F3FA 4NGHH 4YHLL 3SEPA 5SX5H 2JJTC 3SDCB 1CGSH 1SY6H 1UXWA 4LLAA 1AD0B 3SKMA 4PRDA 5FYJD 4MDJA 5D9SA 2B39A 1G7HB 2Y06L 1QBML 5D6CB 3BXNA 4G7VH 3E6HB 2QJDA 5IVZA 1NANI 2JJSA 5HI3D 2DTMH 4J4PA 2WMPA 2E7LA 4LCCC 1IGJA 4OLWL 1QBLH 1J1OL 1LO2H 5FCSH 2UV3A 4NN6B 4JM2A 4J2XA 3DOSA 3G5ZA 1NCNA 1X7QB 3F62A 3SDXA 1DQDL 1IEAB 5INDA 4JEGB 2X4TA 4ELME 1YUHB 1MLBB 3PWVB 5C08A 2GK0A 1TIUA 2JTDA 5EU5A 3VXUE 4KROD 4FQQB 1W72H 4DUVA 1RI8A 1EHXA 1X4XA 4MD0B 3ES6B 3QIBD 5E7BA 1JZ7A 5GGTH 3L9RA 4WFEE 5I71B 1HXYA 2BY3A 4GRLC 2OK0L 3T4YB 1AKJA 3LQZB 5FDWB 2DIJA 3OR7A 4DOHE 3V6OE 4I77L 4F33A 1I85C 1XEDA 4N1CA 3GI8L 3T0EC 3MXWH 1INEL 4DOHB 3PNWA 3TP4A 2J7LA 1DUYA 1RZIA 2W9LA 5E5MA 3MRRA 5D2NE 4PRPE 3KYKL 4YHLH 2DQJL 1R3JB 3BWAA 5ACLA 5J1AB 2GQHA 5D2NB 4PRPB 2BY0A 3C6SB 1DEEA 2AJYL 3BISA 3BKCL 4D9QD 3WDHA 5F21B 3C6LD 4KK6C 1AGEA 1AQDB 4GO6B 5CHNA 5GS2H 2Y06H 3MBED 5DMGC 5DQDL 5HGBA 3RUGB 1U41A 4KHTL 2APBA 3QI9D 3AMLA 3ZDXE 4S1SL 4DJMA 4OLWH 43CAB 4MAUL 1C7SA 1J1OH 3HA0A 1DBML 3QXAA 3ARDA 4YDLB 1YYLL 3QQ9D 1DQDH 5KSAA 1JGVH 3PHOA 3EOBB 2FJFA 3C87A 3HFML 1IAIM 4QOKE 2DQFB 2DOCA 4L3CB 1V3KA 4HFUL 1KENH 4HIXL 1N59B 4PGEA 2HTKD 3ULUD 5FA3B 5B39A 4O2EA 3QJHA 4NO2A 1FAIL 4N0CD 4Z78B 3S97C 3CSGA 2OK0H 1NC4A 1W8NA 3KWWB 4HS6A 4NKQB 5HBBA 2NYYC 4JFPA 6FABL 3VFVB 3OKMB 5ESQB 5TE4L 4I77H 3GI8H 1XMWA 4I9WD 4OD2A 5IK3B 3MROB 2QKIB 2I9TA 3QNYA 4JM4H 3KYKH 4YFLF 5CD3B 4QRSB 4CGTA 3MLRH 2VLKA 3WFHA 4U6YA 5IBLC 1RK0A 2AJYH 4ODWA 5CJBA 3GMPB 2HFFB 1S9XA 3CFIC 2VXVH 4ETQB 1UENA 1MLCB 3DHMA 3RA7H 2OBGA 4X98A 3ZDZE 32C2A 1QRKA 5DQDH 3DETC 4WCYL 2O93L 2Z9TA 1FAKT 4KHTH 3REWB 3OX8B 4NC2B 1PX4A 4S1SH 4MAUH 4XRCA 3MJ9A 4Y88A 1DBMH 2DQUL 1QFWI 5F88B 4N9GB 3NA4A 5DXWA 1OCWL 3RFZC 4OI7A 3SGEH 3RWIA 1F6FB 5E2UH 3ECBA 4A6YL 4P5MB 3T65A 2FSEB 2D0GA 2ZOKB 1S5IL 1BIIA 1WC7A 3HFMH 1T1YA 5BXFA 5TF0A 3LKRB 5JLZA 1UM6L 3SJVD 1KXVC 2W9EL 2ZSVA 2CRIA 5DK2A 4HFUH 4UNUA 3I6KB 4I0KA 3MGOB 3MRKA 1YEFL 2VZ3A 1LO3H 5T1MA 2YK1L 1ZT7A 5MEPA 5LGJB 1FAIH 1BQSA 5B3JE 4ORGB 3WEXB 3U2SB 4PTTB 3O11A 3DUHA 4R2GC 5MEOA 4F7PB 4W6YB 4NQSB 4C83B 5TE4H 3N1PC 2XOTA 3WO4C 5IMMB 4Q2ZA 3FOMB 1V7NL 4NOBA 1PG7W 3EJJX 5C0AB 1OP3H 4NO0A 5D70L 4V1DD 3T77B 4RRPG 3EYSL 3WNNA 4IIQC 1AD0A 4WEMB 4EN3D 4XCNA 5HYJD 2WBWB 1TLKA 3I50L 4WCYH 2EDXA 1G7HA 2XA3A 4FNLL 3FAWA 5CEXB 4LASL 1W0WB 1F02I 3SGDH 1BJ1J 3P11L 3WFEH 2DQUH 3KHOA 4KJWC 25C8H 3CZJA 1OCWH 5E7FA 1ZS8B 2JK5B 4A6YH 3RWHB 5D1XC 1WIUA 3CPLA 2HRPL 4UDUA 3IDUA 5CEYB 1S5IH 3E1F1 1X7QA 2E27H 4KI5E 4FA8A 3PWNA 4Z7VA 1BVZA 5JXEC 1IEAA 1YNKL 5DHXB 1YUHA 1MLBA 3G9AB 5EU4B 3TN0D 1UM6H 1FNSL 1DEDA 1EDQA 4XNMB 2W9EH 2VJXA 5F96L 4ELMA 1XR8A 3C5ZD 4FQQA 1BGXL 4HIHA 3VXUA 2BOBA 4JO4L 5KSBE 4PFEA 1YEFH 2FECL 4I0PC 3QQ4B 4QO1A 5KSBB 2JCCB 5KANI 3VH8G 4UIKL 4DFHA 2VL4A 1DQQB 5FXCH 3T2OA 3LQZA 1CG9B 1FO0L 3H7BA 5FDWA 3P4NB 3KYMA 2IBZX 1V7NH 1A9EB 5E6ID 3T0XA 4HLZH 5FUCE 1RJZB 4GG8A 4JDTH 3V6OA 1YEGH 5F6IB 3LHPL 3EO0B 2CJUL 5DQJB 1DR9A 2JJSC 1WLHA 1TQCC 4J4PC 4XC3L 5D70H 2NW3A 2E7LC 1GJIA 2HT3D 2FHFA 4PRPA 4J3TA 3T8XB 4MS8C 1KCRL 4PJDE 1CFSA 2RFXB 2H1PH 4JFFD 5FO9B 4NQEE 3I50H 4FNLH 1T66D 1FZKB 1E6OL 1S9YB 1HOCB 3GHEH 3PQYD 4JREC 4LASH 4G6FB 4M6ML 4XCFL 5D7JD 3P11H 3Q1SL 4GG6E 2IAMD 43CAA 4YFDB 5C0BB 1RZKC 2OR7A 3LRGA 1SYVA 3K74B 4G80A 3UMTA 1KULA 3L3IB 1MH5B 1YNKH 1YJDC 2IFFL 3AREB 3HG1E 1FNSH 3VGBA 2XN9D 5ETUA 5F96H 4D0BB 3VXRD 3HG1B 1BGXH 35C8H 4L3CA 2A6DB 4U1HB 4QOKA 4JO4H 2EYRA 3BUYB 1Z3GL 4XB7A 4P2RB 4PGCB 2EE3A 5C1MB 1BJ1H 5FA3A 3SO3C 2KDGA 4UIKH 1RFDL 3G6JE 1JPFB 1CVRA 4Z78A 3CFEA 4BQBA 2C3HA 3VFVA 1QTYT 4OZIE 3B43A 4KPHL 3ESVF 5JMRA 3ZDYE 3LHPH 3MROA 1FL3B 3IJHB 2CJUH 4XC3H 5CD3A 4QRSA 5EO9B 1J87A 4Y4KB 1HXMB 4JZNA 4GS7B 1BFTA 3GMPA 1KCRH 3ARDC 5AD0B 1BBDL 3GB7B 5KSAC 3U6RB 1E6OH 1MLCA 2MCG1 4AIZA 1ZANL 3R0NA 4HMCA 4RWYH 1P7QB 4M6MH 3T04D 1KIPB 4XCFH 2NY3D 3REWA 3Q1SH 3OX8A 4DZ8A 1XF3A 3QRFM 1JN6A 5IEKB 1UVQA 1JWMB 4N9GA 4AY0A 5C0RL 5D5MF 1YZZA 1ZGLB 1AHWA 1D9KA 3HZVB 4LVNB 1QQDB 1X5ZA 4RGOL 1T4KB 3UC0L 4A6YB 5D1ZB 2ZOKA 2AEQH 2IFFH 1JUFA 5CJXA 1J5OL 3CVHL 2F9BT 3VRIA 3LKRA 4P46A 5DF0A 5GGRB 2AJZA 4FQXB 3M17B 3QHTC 4MQXC 4PRAA 2HLFD 5F70A 1ACZA 4AZ8A 3I6KA 3QUKB 1GCFA 4C55A 1IFHH 1TVBB 3V0AC 5EIVA 2XZZA 4K7FB 3VRJB 2AJVL 3KNBB 5LGJA 1RFDH 4ORGA 5F9AC 1IT9H 3FB6B 2R0WL 4LF3A 3S9DB 5JA8B 4F7PA 4KXZH 2UWEF 4NQSA 4C83A 1RVFL 5IMMA 3UJIH 3X13A 3H9SE 5GRYA 1K9TA 5K59F 3UTTD 4NC1E 1A3LL 3NA9L 1NAMA 1E6JL 2EDNA 2D7MA 5F7HA 1ZWIB 4XWGL 5FGSA 4Y19B 2C9AA 4OFIA 5B38G 4NO5B 2B4CL 1WBYB 3HC3L 1BD2D 2ZUYA 1AI1L 2CO6B 1ZANH 1H3XA 3L3OB 1QBBA 1K5NB 1Q9WB 1G6VK 4UINL 5IFAL 5IQ7L 1EK3A 3SKNB 1CDGA 3CC5B 4YAQB 1A21A 1X44A 1GC1C 3HNSL 1ZS8A 3TJHC 1V8HA 3BPLC 4RGOH 3SDYL 4P99A 5TDOA 3G5XA 1II4E 1YMME 1J5OH 4GW4B 5LVEA 5EU4A 4YUEL 1YMMB 2AXJA 2VXQL 2DQDL 5A2KH 2EDWA 2IPKB 4ONHA 5I1DA 2VZUA 3OMZA 5I8EB 2IPUG 2QEJA 5LBSL 4F15C 2XWJB 1C1EL 3NFNB 1A9BB 1ODAA 1WIPA 4PLJC 3VFTB 2AJVH 5KSBA 1GZQA 1JF1B 1X5AA 1C08B 1DBBL 1DANT 1NEZB 3RWCA 4WJ5B 2LAGB 1DQQA 3RVXC 1RVFH 1A1NB 3P4NA 1FO0B 1R5WA 4L3EB 1A9EA 4HV8A 3UYRH 2D3VA 1RJZA 2P49B 1KB9J 1A3LH 2AK4B 3K4DA 3NA9H 3CXDH 1XCQB 4YO0B 5F7EL 1MFEL 3EO0A 4K71C 3FRUB 4TNVK 4XWGH 3Q2CA 5CKAA 1INQB 3MPCA 2B4CH 3HC3H 4EBQL 2HFTA 3ULUL 2DLIA 3ZE0F 5KVFL 1EHNA 4NN6C 5D93C 4NHCH 4HG4J 4ZQKB 3U0TB 1AI1H 4PGDB 2RFXA 4GXUM 3P9MA 3TT1L 4D9RE 4PJDA 1FZKA 3MV9D 1S9YA 4UTBL 4BFEA 5HSFA 1XF2B 5ELIA 4J8RB 5IFAH 4NQEA 5IQ7H 3VG0H 1BQHB 1OLZA 4MNGE 4L9LB 4JDVB 1F8TL 3PGCB 2NNAB 3HNSH 2DYPB 2VDQH 4GG6A 4MXQC 4HMEA 1S7TB 4WUUB 1IQWH 3IJYB 5IVXE 5CJ5A 2YD4A 4OV6F 4N8VB 1A3RL 1J0JA 5I71C 5JOEA 5FEBA 4FQHA 5FB8A 1SEQL 3N1GC 4YUEH 2CLRB 3BD3A 4U1KA 3GEWB 4D0BA 2J8HA 3CCHB 3HG1A 5EO1B 2MNUA 4XNYL 5F93C 3HUJF 5I16B 1H3GA 5FM8A 1KIRB 3GSVA 5LBSH 3BUYA 3PDGA 4IMLB 5I18L 1C1EH 3MRGA 4OLYL 3U9UB 2EXYD 3FO2A 1DBBH 3LY6A 1FHGA 2Z92A 2YOCA 4Y16D 4JFEE 1KXQE 1CXHA 3THMH 1PAMA 3TA3D 3G6JA 3SDDA 2QSCH 5E8NA 3WJLA 3P4MB 1MCSA 3TIDB 4OZIA 1JL8A 5CJQL 2BSED 5F7EH 1FL3A 1MFEH 1BM3L 3K3QA 1Z0NA 3V52L 1CGUA 4ZXBD 4NZUH 2J5LB 4EBQH 3PWPD 3ULUH 1HDMB 4LSSH 3KJ4C 3OXSA 5DJ8B 5KVFH 1S7SB 4KZDH 1HQRA 5HXMA 4MJ6B 3TT1H 2J1KA 3U6RA 4UTBH 5IR1B 4ALAH 3V0WL 5C07B 1MQKL 2O5XL 2XWBA 5B22A 3PUCA 5DHYA 3QPQC 3TM6A 1MEXL 1OP5H 1OGAD 4X99B 1GRWA 5CCKL 3SQBA 1A3RH 5DWUL 2OP4L 2QHLA 1T4KA 4UUJA 4A6YA 4GT7A 3C60B 5D1ZA 1SEQH 2C3WA 1QNZL 3RVTC 2HT4C 3TLRA 3RGVD 3CVHB 5FYJE 3CIQA 1JPGA 2AI0H 3B3IB 4FQXA 1KCSL 1CR9L 4XNYH 3GZKA 3N1MC 5EBLA 1VEOA 5L2JB 5I18H 3T2NH 4I8DA 1TVBA 4HUVB 4OLYH 4YGAB 2F53D 2FBJL 3AFLA 3IDYC 4UU9A 4GMTL 1AY1L 1W8OA 4O00A 3F7QA 3QXUA 3OJDB 4WV1A 5DUBB 4ODHL 2UYLA 1QEWB 1MNUL 3FJTA 2VNCA 2QQKL 4M6AA 3EGSB 4FXKB 4MB4A 5IJVB 1OSZA 3QEQD 4CW1B 4KDTA 4GUPB 3D85D 3H9SA 4HKBB 4J3UA 4U1NB 1BM3H 1JYNA 3WXWH 4MZ3A 3FB8B 2NY4C 5C3LD 3V52H 4KROB 5FO7B 4H8WL 3KPOB 1LE9B 1CIUA 3FN9A 1UXSA 1AHWC 5T1KD 4NO5A 4L29A 1D9KC 1WBYA 5HDQL 4Q6IA 1ONQA 1MWAL 3HRZB 3WIFB 3BN3B 1LNUB 4HEPG 1WBXA 1Z9LA 1NGXB 3V0WH 4WI4A 5CJXC 2VL5B 1MQKH 5DA4A 1FFRA 3D2UD 2O5XH 3HPLB 1K5NA 1Q9WA 2V5MA 4P46C 3O2VL 4MA3B 1Q8MA 4HKZB 4YPGB 2FBOJ 1MEXH 4YAQA 1EFXA 3FOLA 4DWHA 1H3PL 3I6GA 5CCKH 3QJFA 4P2OD 5DWUH 2OP4H 4G3YL 1QNZH 5LKNA 3E2HB 4KK9C 5D7SL 4D9QE 4GW4A 4B50A 2R1YB 3KHQA 3PIQB 3GFUA 3QXTA 1K8IB 2GI7A 1YMMA 1CR9H 1A7NL 4NKOA 2B8OT 3C6LB 2EDLA 4YGVB 2MMXA 2IPKA 5I8EA 2NR6C 3MBEB 3WMSA 2FBJH 1A6ZB 4WI2A 4ZO9A 1ZOXA 1JYWA 2VZTA 3NFNA 4GMTH 2PW2B 1VA9A 1XGUB 1WZKA 3QI9B 1C08A 4ODHH 2P42B 5CLWA 5I15L 1MNUH 3B9EA 4K7PX 3WN5B 2XG4A 4WJ5A 2C1PB 3MRBB 1A1NA 3LN5B 3NCEB 5LXGL 3U0WL 1FO0A 3MA7B 1DE4B 3O2DL 5E94B 4K23L 1ZA6A 4NCC2 1DQTA 3WLBB 3RGHA 5EH1A 2OTWA 1BWMA 1A02N 4OZGF 1HEZB 2HJKA 4H8WH 1JHKL 5CBAB 4WU7B 2NTFB 5MHSE 4OKVA 5BVJB 5BQ7A 3WJJA 3PABB 1Q9OB 3G08B 4NNXB 4KMQA 1MWAH 3GSQA 5J4MA 4ZQKA 2W92A 3U0TA 4D0CB 4XI5D 5L8JB 5ACZB 1VSCA 4K94C 4L4VD 3DO7B 4J8RA 3V5DB 4HLJA 4KI5C 3O2VH 4S2SB 2YUVA 4DZBB 1F58L 1I1AD 1OTTD 4JDVA 3NIDF 4MNGA 1H3PH 4PREB 5EIIB 4HGWB 3TEUA 5J0BA 1S7TA 2HH0L 4PLNC 5GZNC 4NT6B 1MF2H 1QACA 3IJYA 4HCRA 4LDEB 4YC2C 5DVKA 4G3YH 2OZ4A 1MCKA 5D7SH 4M03A 5IVXA 1S5HA 2FX7H 4NZTL 2APWA 4XHJD 1ZEAL 1A6TA 4G8IB 1P1ZB 4CMMB 3OJ2C 5ICYA 1OB1B 1QYGL 2WANA 2Y5EA 3MUGB 3LOWA 5I16A 4HUWB 4OIAA 5H37G 1KIRA 5DSCA 5IWLA 4KY1H 2FRGP 3U9UA 3Q3GB 4RGMC 3T0DA 3VH8B 1IGYA 2PN5A 3DECA 5I15H 5HYQA 3PGDB 1RUKH 1JYXA 1KUMA 5GSRA 3NZ8B 5LXGH 3U0WH 4U1JB 4JFEA 3O2DH 1NCAL 3DVNA 3DTXB 4K23H 2Y1VA 4JFDE 3W11D 2RAMA 1UH4A 3SJVE 1YQVH 4YZFF 4PJ9D 5GISH 4CDGC 1J8KA 3SJVB 1JHKH 4MB3A 2A2QT 2IBZY 4MX7A 5LWYL 4G6AD 5IT2L 5AUMA 2MHAB 4U0RC 2PF6A 1OWRM 1S7SA 3HC4L 2VMFA 2N7BA 4MJ6A 3QH3A 4UQ3B 4G42A 5IR1A 1DANU 4Z7UF 1H8NA 3VI3E 4JLRA 1P7KB 1DBAL 1F58H 3PV7A 1KN2L 1MCOL 2WBKA 4F9LA 1G7LA 3KPNA 1NAKL 4WW2A 2HH0H 4X99A 4HUNB 1INDL 3V6ZB 4UI2A 4V1DE 4XNUL 3CXHJ 3NIGF 4V1DB 1ZEAH 4K3JH 3CVHA 3RKPA 1QYGH 2HP4A 3B3IA 1OL0A 3SDDC 4EN3B 3WJLC 3E6FA 12E8H 5FKPB 4PJCF 5HYJB 1KGCD 3LDBC 5L2JA 1F97A 1T5WA 4ZUTB 4E9LA 4LSVL 4HUVA 1NQBA 4F57L 3D5OF 4EI5C 4LNRB 3OJDA 2Y5TB 1QEWA 2GEEA 1T22A 2WQRA 4MMXC 3GIZL 2PYED 4PY8I 2J2ZA 4JFHE 4PRNB 3ZKND 2OMBA 1FLTX 5IJVA 2GT9B 1C12B 4GUPA 5K93A 4MJ2A 1P69B 4OGZA 4HKBA 5KVDL 3TN0B 2Q76B 3Q5TA 1AD9B 4XPGL 3FB8A 5LWYH 4NQUA 4XH2B 3KPOA 2E3VA 5ACMA 2O5ZL 5JW4Q 1R5VB 2PW1B 3HC4H 1YY9D 5DZOA 4LVNC 4G8EB 3UTQB 1HYSD 5ALBL 1HNGA 4BQCA 1LNUA 5JOPD 4H88H 1MWAB 2IALB 5D1ZC 3HNTL 3MRCA 2DQCL 1KG0A 1PBYA 2VLJD 3NN8B 1BREA 1KN2H 1IC1A 4HW6A 1OF2A 1MCOH 4MA3A 4IMKA 3WHE1 4FQXC 2EXWD 1NAKH 4GKNA 3MGAA 3IDJB 4P5TC 3FQUB 1INDH 1VFOA 2AXFB 3O3BB 3QNXB 4MVBC 5IMLB 5EU6E 3HB3C 4LP4A 3JTSA 5GRJL 5C0GA 3UTSD 4WV1C 4XNUH 3EO1A 3K80A 4QHUA 5MI0C 2EDJA 4OAWB 4RQQA 3WDIA 3VWKA 1KJMA 2X4QA 1PX3A 2P48B 1RD6A 2R1YA 4JFFE 4PB9L 4PV9B 1K8IA 4RFEB 1EGJL 2OL3L 3MJ7A 1FYTE 3O9WC 1IRAY 4JFFB 3PQYE 4YGVA 1TTUA 4KDTC 4HX1A 5E2JA 4LSVH 3MBEA 4MA1C 5J1TC 3PQYB 1A6ZA 4L8BA 3HI5L 4TSBL 3UZVB 4F57H 4NC1C 1P2CB 1XGUA 1OWWA 1ERNA 3QI9A 5D7JB 1OGTB 3ET9F 2IAMB 3JWDL 3WHXB 3B8YA 3MREB 4DN4L 3MLPA 4PP2B 1ACYL 3GIZH 3QG7L 2Q8AL 2C1PA 3MRBA 4Q6IC 4KV5F 4WFGE 1O7VA 5DFVC 5EBWA 3MA7A 1DE4A 1BOGA 3MLYL 5FDYA 5E94A 1FZMB 3RDTC 1CQYA 2XN9B 4XPGH 5B38B 3VXRB 1WICA 1CCZA 1HEZA 4TUKL 4CL7A 5CBAA 4WU7A 3L3GB 4KVCL 4MQ7B 1PEZA 1MFCL 4I18B 3Q6FB 1Q9OA 3G08A 4NNXA 4WW1B 4URTB 5ALBH 5C09D 3HNTH 3HR6A 3CFBA 2DQCH 4ODXA 4UTAH 4LHUG 5IJKA 4G5ZL 1CL7L 3TT3H 4DZBA 1XF4B 2FR4B 1J18A 4M4PA 4EQ3A 1S7UB 3EOAA 3L7EB 1MFBL 4CADB 5B8CB 4TTDD 4O51B 1YC8A 4X4ZA 4YXHL 3ILQD 3ZMRA 1GGBL 2F5AL 1LK2A 5GRJH 2E6QA 3O2WL 3MUY1 1ZVSB 5GGSB 5IFJA 4PB9H 2FH8A 3BHBB 1EGJH 2OL3H 3EYOA 4G8IA 4FTVD 4WTWA 1UCTA 5E8OB 1OB1A 4Y5YA 2Q87A 3KPPA 1U8LB 4YBQC 3QHZL 4TSBH 1XT5A 2AJSL 3HI5H 1T1ZB 3UPRA 1N3NB 2NY3B 3L6FB 3WFBL 3Q3GA 2PR4H 3VH8A 1PG7L 2YD3A 5J13C 4M7ZC 5FM5O 5JW4N 3F5WA 3PGDA 4JFQA 4DN4H 1ACYH 3WJJC 1JNLL 3ARTA 2H3NA 2A6IB 3LV3B 3GSXB 4U1JA 3MXVH 1JYVA 3MLYH 1MRFL 4NQXB 3BDXA 4JPIB 5DMYA 3NACL 3Q6GL 4KQ3L 3NZHH 3CX5K 4JFDA 3MRDB 4QRTA 4APQA 4Q9CA 2YPVL 1NGYB 1IAOB 2CDGA 1HE7A 1M05B 1Z9SA 3A6CL 3SJVA 3WUWG 3D39D 3FN0L 4U33A 3W9DB 4KVCH 1MFCH 4NIKB 4R9HA 1T0NB 3T0BA 1OAZL 4Z7QF 1EERB 3O45B 3LD8B 2X42A 3Q5OA 2PO6D 3S96B 1RHHA 4HEME 3VXNA 4G5ZH 5HGAA 3ZO0A 4YHNB 1CL7H 1GAFL 5J9PA 1MFBH 3F12B 4QLRA 2GTWB 5HDBE 1JGEB 1KPVA 5HHPA 5IWLC 3GMQB 1DQLL 5KVMC 4M9PA 4YXHH 2OTPA 4NN5B 3U7AA 1GGBH 2F5AH 3V6ZA 1HILB 2HJFA 4XTRC 4JB9H 3VGFA 5F9DC 4P4KA 1OW0A 4OCLC 2DWEA 4G43B 5KTEL 3WO3B 3HHRB 1BD2E 3PV6B 1N64H 3NTCL 4V1DA 3CVIL 2OTUA 3BD4A 1BD2B 2WBJD 2VDKL 1I7UB 3QHZH 4ZUTA 1WSST 2XI9A 4XP9L 4L8DB 1J88A 1HHGB 4OJFL 3WFBH 2D7PA 4D2NA 3IJSA 1PG7H 1AGBB 4JDZB 3OZ9L 3WNKA 5I1IL 3VMPA 3V95A 3C9NB 5EO0B 3FKUS 1MRFH 4HK3N 1DLHA 2DQGH 3LPWA 1HWHB 3NACH 1UG9A 3Q6GH 4KQ3H 5DZLA 5LGHL 1RU9H 1JRHH 2YPVH 3A6CH 1JGUL 5E6YA 1MAKA 1LGVA 4F9LC 5IW1B 1F4YL 4YFLI 4WW2C 3OB0H 1NUFA 1A7PL 1QLFA 3HAEG 4XNXH 1R5VA 2X2YA 1FVCB 1OAZH 3O3DB 3UTQA 1BJ8A 5SX4I 5LQBL 3JWOL 2OSLA 3VWJD 1XCTA 5EUOB 3NN8A 1OAYL 1D5BA 4P9HC 1GAFH 4JANB 3S88L 3GMRB 2P24B 1RQ5A 2XY1A 4OSUL 3ZE1F 4BQ8A 3BEVB 1CFVL 4KTEL 4ZNCD 1DQLH 4Q9BA 3SKJL 5C0CD 3FQUA 2AXFA 3DSFL 3K4AA 3PWLB 3MFFB 4UT9H 2DF3A 1EXUB 4N5UA 5EU6A 3L3JA 1JWSA 2ED8A 4OAWA 3CLEL 4PV9A 3U36B 1WQVT 4I3SL 4EXPX 4KZEL 4C59B 1D5MB 2VDKH 4MJ5A 4PR5B 4OM0L 4JFFA 2FEEI 2OL3B 1AE6L 3TNMB 4R97C 1FYTA 1RIVL 1FE8L 3MV9B 4XP9H 3PQYA 4OJFH 1ZGLM 5CWSB 5H35A 4PJAE 4H26A 5F89B 3MNWA 2CKBL 3OZ9H 1IC4L 5D7JA 5I1IH 1WWWX 1PZUB 1GXEA 2IAMA 3WHXA 1OT2A 1NUDA 2X1OA 2EKSA 3MREA 4OFYA 1T1XB 4LKXA 1VACA 2KL6A 2GJZB 2HLAB 4RBPK 3ZKSD 3IETA 2YUWA 1XF1A 1FZMA 3RZCD 1CF8L 1UZ8B 3D18B 3PP3K 2IADA 3QSKB 4KI1A 1JGUH 4IMKC 4NUJB 1NL0L 5B38A 4EI6B 2A6JB 3BYTA 2IAND 1ZV5A 1A7PH 2FL5B 3F7VB 1ZE3C 5F1NA 1R24B 4I18A 3HS0B 3V9FA 3Q6FA 2H6PA 5HPMA 4WW1A 3EIFA 3ZL4H 5LQBH 3JWOH 4K3EL 4MNQE 2GCYA 3VWKC 3O4LD 2ICWB 4Y16B 1NBYB 3S88H 1XF4A 4OSUH 3TA3B 2FR4A 4TSCL 4HJGA 3L7EA 4KTEH 2VQTA 3O3AB 3WE6B 3MBEC 3SKJH 5B8CA 3M45A 4OQTA 4KDWA 1I9JL 3QI9C 4L4JA 2R56L 3RWFA 2AJ3B 2YBRB 2WQ8A 2QBWA 2NY0D 3PWPE 4CKVX 1ZVSA 5GGSA 3CLEH 4ZXBB 4M02A 4RAUB 3PWPB 3BHBA 4I3SH 4OM0H 1AE6H 4GFTB 3QQ9C 3IS0X 4HUXB 5HHOE 1RIVH 3FZUD 4XVSH 4OUOA 1EH9A 1U8LA 4TNWF 4ZAKD 4V2BA 1N3NA 1IC4H 1N7ML 1WISA 3C5JA 3MCKB 3ZKMD 5C2BL 4DKAA 1OGAE 4F2MA 2EYSB 3CUPB 1YN7B 5DVNA 5CAYB 1D5XA 1OGAB 1UADC 3RL2B 5EFIA 3LV3A 3VD4A 1MJ8L 3ARYA 4Z7VF 4NQXA 1ZLWK 3GI9L 1CF8H 3RVWD 5IJKC 4LSRL 3GMOB 4K7PY 4K07A 3X14A 3RGVB 1NL0H 3MRDA 1MCBA 1RZFL 2F53E 5I74B 4TOYH 4UNTA 5DJ6B 4X4ME 1T0NA 4GQ9L 2NY2C 3I3EA 2F5BL 4LIQL 2F53B 3L3DB 4K3EH 1SYSA 1LWRA 1ZHNA 1KB5H 1L9MA 3QWRD 3S96A 2FJHB 3MC0A 3A6OA 4BKLA 1B2WL 2C5DC 3BUTA 3W0WA 4JRXD 3DYOA 5DJDB 1D5IL 3QEQE 4TSCH 3DVIA 1DQML 3F12A 5C2UB 4NUGL 4Y5YC 4KMTL 3KS0J 2GSGB 1GL4B 5JW4R 1JGEA 1NMCC 3QEQB 2CPCA 3X11B 1CD1A 3D85B 5HHNB 1TQBC 1I9JH 5JORB 2V2TB 3DMMA 4DVBB 4LSQL 4ONGL 2A73A 4K8RL 3K46A 4B7LA 1MAJA 4EJ1C 4YDKH 2VUYA 1PZ5A 1J8HD 5T1KB 4RAVB 1BD2A 1KTKE 4UT6L 3TO4A 1NLBH 1QFPA 5DHVA 3P9WB 3DBXB 3D2UB 3FO9B 1JCKA 1N7MH 2ZG1A 4N0UE 4APQC 1KLUB 1AGBA 4JDZA 4NM4L 5C2BH 1NFKA 4GRLD 4LGRB 1QG3A 5FA4A 1PFCA 1MJ8H 5EO0A 3VMNA 3EDEA 4P2OB 3GI9H 4LSRH 2H8PB 1FVDB 4HIJA 4LRIA 5F7YC 2CUIA 2V17L 1FNEA 3RX7A 3D25B 3PP4H 5D71L 1RZFH 5IW1A 4AQ1B 4JFOB 2R2EA 4JVWA 4GQ9H 4LIQH 1MRCH 5JR1L 2F5BH 4ZTOL 4KK6D 4Q0XL 1SEBA 1T7XA 5SX5K 5DO2D 1FVCA 4HUUB 4KRPC 4MJID 4P4KC 5H2BA 1OW0C 1JMXA 5DMGD 3BESR 1B2WH 3IKCA 2WP3T 5GGRY 2AV7A 1D5IH 3OPZL 1DQMH 4NUGH 3NPSB 4KMTH 4K55A 2W60A 3UZEA 2W0LA 3BEVA 5C0IB 2J88L 3ARGA 1CGYA 5C0JB 5KN5B 3L5IA 4LSQH 4ONGH 5JDSA 3MFFA 4K8RH 2DI8A 1EXUA 2F8OA 4LL9A 2R39A 2PUQT 2W0FA 3U36A 3KYNB 3W9EA 2A1WL 1NC2D 2JIXD 4UT6H 4O2FB 4L4VE 5IB2A 4PR5A 3TNMA 4F37F 3VFRA 3FT4B 4L4VB 1FPTL 4YR6A 4PJGF 1JZ5A 3CLFL 3AGVA 2DQTL 3PL6A 5F89A 4NM4H 1I1AB 2P8PB 3N50A 3DUSB 1XR9A 1X9QA 3VA6A 3VXMD 5F7DB 2CKBB 4PJAA 2X5PA 3KS0H 4FP8L 1U8PB 1V3JA 2NYYD 3I75B 1XGPB 3LEYL 2L7JA 2WIMA 2HLAA 3RPKA 2GSIA 8CGTA 2XY2A 1WCBB 3R06A 5MERB 4AH2B 2EEDA 3QR2A 1OAUL 1UZ8A 1WZ1L 1CDCA 5D2LE 4NN7B 2EYTA 5D71H 5GZOD 2KPNA 4N8CL 4Y4FA 5IBLD 4B53A 2FL5A 3D0VA 5JR1H 3PJSB 3D1MC 5HHMD 3MV01 4TVPE 4YHMH 3BP6A 4M5YH 4HIEA 1F6AA 3DETD 4OFDA 1N5YL 3S34H 4Z5RB 5IHZA 4U1GB 5T3ZE 1TJHL 4NNYB 5K9KA 4MNQA 2ICWA 3DRQB 4Y16A 1U8QA 3ZTJG 3OPZH 1BP3B 4JHBA 5C86A 3TA3A 3KPQB 3DGGB 3L95B 3MMEA 4KRNA 3ZSSA 5FKAA 3V6FA 1UB5B 5JHDE 1QBAA 1ZLVK 1DTUA 4PJ9B 2OMNA 1X5FA 5FOJA 2IAMC 2YBRA 5HYSG 3GGWA 3J7HA 4ZXBA 4YK4C 5HGDA 2VERN 5ID1B 2A1WH 3PWPA 4DGVL 3G6AB 3P40A 3QULB 3QO1B 4W6WB 4HUXA 4LVOB 1UWXK 3IDGB 4JO2L 1FPTH 1T20A 1YEIL 4L4TD 3CLFH 3STBA 2DQTH 5HHOA 4K3DL 1NFIA 2AXGA 3DXAE 2WZPD 5IESH 4FP8H 2ICEA 4R2GD 1CBVL 2ARJB 3AMKA 2OJZH 3LEYH 4I18C 3FB5A 2XTJE 1OGAA 1AFVL 4YHOL 1FG9C 4H1LH 4XCCL 1X5LA 1OAUH 2FYYA 4HFWB 1WZ1H 4QTIL 5KVGL 4RFNB 4KI5F 3QHFL 3H42L 1DDHA 4NZRL 4ODVH 4N8CH 2IGFL 5E0QA 3DLQR 1CLCA 4TNVF 5EG6C 4R96B 4MCYB 2NW2B 2F53A 1QLRA 2WINB 4X4MA 1N5YH 1FV1B 2ZCKL 3RI5F 4LLDB 2FJHA 1TJHH 4R4ND 2PYEE 1JZ6A 4YHYC 4DKFL 5ID0B 1YY8B 3O3EB 2PYEB 3U82B 4FXGB 5J12B 5I30L 3RWGB 1TCMA 2IH1B 4KJWD 5CP3A 4PV8B 4HWBH 3TV3L 2HVJB 3QEQA 2X4PB 5I75B 5F71A 3D85A 3T0WA 5D1XD 3V4PL 1JTOA 5HHQB 3BZDA 4YLQT 1BFSA 4LQFL 2VR5A 1J10A 4DGVH 4DUXA 1Y18A 4YX2L 1EHAA 2AEPL 1TITA 1FQ9C 1IGFL 2VLJE 4JO2H 1U8JB 3LH2H 1BFVL 4PJDF 1YEIH 4Y2DC 1ITCA 4I0PD 5DMKA 3WHE0 1M7DB 3GRWL 2VLJB 4K3DH 3DBXA 3D2UA 2AV1B 4GAGL 3FO9A 4G9FD 3P9LB 3RIFF 2PYFB 2OQJA 1AP2B 3FQWB 2I26N 4N0UA 4UOJA 1CBVH 3NAAL 4YHOH 1A6VL 5I9QC 1P6AB 4LARH 4XCCH 5HJ3A 4FABL 4P2OA 3LD8C 1AIFB 4DAGL 1U2CA 3UTSB 4QTIH 2VIRB 5DFTA 5KVGH 4X0KB 3QHFH 1DL7L 1OSPL 5GS3A 5BO1L 3DUUB 3H42H 3WUWB 3QA3B 4NZRH 3TBWB 1FFNA 4KWUA 4J4PD 2IGFH 5C8JB 1XAUA 1OM3H 1OP3K 3CFDB 2I60L 1NUNB 1E27B 4X6BB 1HH9B 4RDQF 4MS8D 4JFOA 5D5MB 3HI6L 4POZC 5I1JL 4NN5C 5ERWA 4UAOB 4N5EC 3DMMC 4HUUA 1DSFL 2ZCKH 2H32H 4JZOB 2RR3A 2CDFB 2FO4B 4XWOC 3PDDA 4HKXB 1V5JA 4NCDA 4DKFH 3BZEB 3PDOA 2VXTL 3V5HB 1YPZE 5I30H 1U58A 4U7KA 3TV3H 1EV2E 3TO4C 3LPGA 3G6DL 3MYJB 2ADIA 4OZIF 5C0JA 3V4PH 3JXAA 5GS1A 5HI4C 2QSTA 2H9GB 2F74B 2ICES 4LQFH 1UKSA 4P57B 3L7FA 1BHGA 3QXDB 2UWEE 1AKJD 3ULVE 3L3HB 5KG9A 4YX2H 2UWEB 2VDLL 3BIBX 1IGFH 5C09B 4LCYA 3GRWH 4L4VA 1FJ1B 4LRIC 3ZTNL 1KJVA 4GAGH 3MLXL 3PGFL 2Y7QB 4OB5L 1I1AA 2P8PA 1MCCA 3NAAH 2CKBA 1P4LB 5KZCD 1A0QH 5GGVL 3T0AA 4CN6A 2DBJA 2CRYA 3OAZK 5IB3B 4JAMA 4D8PB 1MAML 4FABH 2FIKB 2AW2A 1WCBA 4DAGH 4H1LB 2FHCA 4TQEH 3DV4A 5GSVB 4AH2A 1DL7H 1OSPH 3UTZB 4Y2OA 5BO1H 4FTVE 1D6EA 4M6NH 3HLAB 1F3RB 4K9EL 3HAEB 4FTVB 3VGGA 5D2LA 2I60H 4HH9A 3FQXB 4ZFFB 3ARGC 3HI6H 3ARDD 4XPFH 5I1JH 2Y6SC 4JN2B 5DS8A 2E7MA 1KCVL 1DSFH 5KVEH 5KSAD 1P5UA 2P8LB 4UV4L 3B2UD 4PPTA 4LDOB 3SKUD 4Z5RA 1MIMH 4NNYA 2VXTH 4ZFZA 3MRFB 1L9NA 4NFDA 1U3HC 1PG7X 3LEXB 3G6DH 1F11B 2QV2A 4LKCB 4X6DE 1MOEA 1PDKA 3PL6C 1UB5A 3DYPA 4JR9L 3ARBC 4PJ9A 4YXLL 2MJWA 5JHDA 3D39B 4ENEC 1NCTA 1L4IA 4H20L 5ID1A 2DTSA 4ODUA 4MQXD 4ORZC 2VDLH 2ED9A 3G6AA 1KJ3L 3QO1A 3D3VD 2PO6B 5DD6B 3ZTNH 2CRZA 1LO5A 3OTTA 3PGFH 1U92B 4OB5H 3ARWA 1GGCL 4NP4H 3WSQL 1VGKB 4Y4FC 5CEZE 1NDGA 3DXAA 2ARJA 3SGKA 3I2CL 3JV6B 3MRLA 1YEJH 4ONFL 1N26A 3TPKA 3RY4A 3K4ZA 3RWJB 5J7CC 4HFWA 3MJGX 4ELKA 4MQTB 4BK5A 5DC0A 4Y16C 3ZKXC 4U6XB 3CFJA 3TA3C 2WBJB 3BYYA 1ND0A 3CX2A 4CU8A 4CBPA 1KCVH 4R96A 2NW2A 5JOFB 2GUOB 4MXVE 4LHUA 4UV4H 3MLVL 2WINA 5JW5B 3H0TB 2MQ0A 3H9YA 2BY2A 4LLDA 2BNQD 2NZIA 3VFOA 2H32B 2I5YL 5ID0A 3HUJE 3T4AB 2PYEA 4FXGA 3QNZA 4WFHD 3HUJB 3MFGB 4M8QB 4Z6AT 2B2XH 5LAXB 1QHOA 2X4PA 1H8OA 3TJHD 2VSDA 5EUKA 4YXLH 1NH6A 4IJ3C 1PY9A 4MXWL 5L0QC 1YECL 1NFDB 1YEKL 4P48A 3D69A 4XP1L 1KJ3H 5E4IA 5TH2B 2ZOLB 4YDVA 5FHBL 3NCMA 5E1AA 4JHWH 1T5XB 4KDVA 4NM8L 3VWJB 5HD8C 2VLJA 4QRPE 3GSWB 4PLJD 1GGCH 2AV1A 4NO0D 3WSQH 5F72S 3ISWA 8FABB 3EUUA 3FQWA 1LO4L 4YDJB 1I8LA 5C0CE 1ETZB 4G7YH 3I2CH 4X8XA 3RVXD 5F7NC 5C0CB 2YXFA 5AG9A 4NRYB 5I73B 3P0GB 3VI4F 1AIFA 5IVXF 4KKLD 5DJ0B 1AJ7L 2VIRA 3DX6A 5B39G 3DUUA 4WI5A 3P4OB 2CXGA 1UACH 2X44D 2PTUA 1QA9B 3CFDA 1E27A 3VMOA 1G0DA 2DMCA 1OOAA 1WFUA 3CDGB 3HTLX 3MLVH 4IOSD 1UJ3B 2NTSP 4KKAC 4XVJH 4JE4B 4JZOA 2CDFA 2FO4A 2I5YH 1FGNL 3IT8D 1M6OB 3BZEA 1E4WL 5AZ2H 1N6QL 3L1OL 4FHBD 3VXUD 3NBNA 3TBSB 4ZUVA 1YPZA 4MXQD 3MYJA 3RZCB 3EDKA 3J8F7 1RUQL 4POYA 4XVUD 4MXWH 2IANE 2F74A 1TJGH 3BH9B 1YEKH 2VOTA 4PJXF 2IANB 5C0DB 1V3LA 3VDBA 4M7JL 4XP1H 1X6LA 4EUPH 1JV5A 2UWEA 2GK2A 2YD6A 3IS1X 5FHBH 4P2OC 1PLGL 1MCPH 2E7HA 3IFLL 4NM8H 1NEUA 4ZODA 3W2DH 1FZJB 5CIPH 3O4LB 1FG2B 2BSTB 1CGWA 2Y7QA 1LO4H 2QADC 1YDPA 5F9WC 2DM4A 1P4LA 4ZSOB 2VKWA 4Q58C 5FYLD 3LKPA 4HBCL 5M7QA 4O58H 3OAYH 5IB3A 1T6WA 1A64A 3HE6B 1AJ7H 5GSVA 4OZHF 4LHQB 2NY0B 3QRGL 1CDYA 4OT1L 5AZEL 3HAEA 4FTVA 1N0XL 1S7WA 3MRNB 1QSEE 3NPSC 4ZFFA 1U8OB 1DP0A 2XNAB 3DPBA 3HN3A 5GS1C 5D7LD 4ZAKB 3RAJL 4AENB 2K9UA 1MHEB 1ZHBA 4P59L 4X4XB 4FMKA 3BP7A 4WO4C 3FO0L 4ZOAA 2Q8BL 1FGNH 1E4WH 4XCEB 3UTOA 3MRFA 3QPQD 3L1OH 1BF8A 4QOKD 4W81A 3LEXA 5FF6B 4PBVC 1I8KB 4LKCA 1X5XA 5EC1B 3WS3B 1GIGL 1RUQH 1RULL 5IV2A 1A4KB 4X6DA 1NCWL 1RURH 4GLRI 3NFPB 3CAFA 5DJZA 3RVTD 2HT4D 1VDGA 4M7JH 2A0LD 1DUZB 3ARRA 1EBAA 1PLGH 1SMAA 2AK1L 3IFLH 3O0RL 3VXQB 2PO6A 5DD6A 4JRXE 1YYML 4QCIA 4OZGE 1U92A 4CVUA 4OI9A 4XHJC 2IQAB 4J3XA 4JRXB 4OZGB 1VGKA 5E2VL 3SCMA 4Z76B 1UM4L 2X4NB 1D6VL 3NCBB 2AAVA 4KMLB 4HBCH 3S6CA 4XNZC 5EIQA 3V7AG 2YD9A 1NCUA 2IWGA 4K2UH 3RWJA 4NQTA 3QRGH 2KKQA 2XT1B 3NCYP 4OT1H 3UPAA 4FFYL 1BIHA 2MOVA 1RJCA 3NIDE 1UFUA 1IKNA 1J8HB 1N0XH 2NY4D 2VDML 5SWZA 4NJAL 4ZFGL 4GXVL 4F7EA 2BNRE 1D9KD 3HPJA 4ZO6A 3RAJH 4HHAA 5HVHB 5IM7B 1JP5A 3U48A 1TENA 1TJIL 5JOFA 2GUOA 2N1KA 1L0XA 4PJ9C 5DTFB 4AEFA 4P59H 3H0TA 3FO0H 5J6HB 4GRLB 3V8CA 4KJPC 5EBMA 3VGAC 4F8TA 4G6AC 3HCVB 4P46D 1J7VR 2DWDB 4R3SA 4OV5B 1F3DJ 2WP3O 2V7NA 3QP3A 5JMOC 4LVOC 3HUJA 4M8QA 3B5GA 1GIGH 2BRRL 3DRTB 5L2KD 5HYSB 2HKHL 1OP5K 1NCWH 5EZOL 1KB9K 2FWOB 2ERJC 2X41A 4LFHD 1E4JA 1EO5A 4KK9D 3H2WA 3SGKC 2EDEA 1HHJB 3GSNH 4MJIE 3JTTB 2ZOLA 2AK1H 2XTJC 2NR6D 4MJIB 3O0RH 4UMGA 3CX5J 4QXTB 5CJOL 4YZFE 1YYMH 2RQ8A 3IU3B 3MLTB 1T5XA 5DEFA 3AC0A 5E2VH 5CIPB 1UM4H 4QRPA 1RZKL 3MTRA 2R1WA 1D6VH 5EN2B 4AEIL 2AQ3A 1I9RH 5IEHB 2YEZB 4GKZB 2VN4A 4GRMB 1OAQL 5C0CA 1S9WA 5DJCB 3SE9L 1R3LB 2R15A 4N0FB 2BXYA 3ME0A 1F45A 2HFGL 2Q7YB 4Z7UB 4FFYH 3RWEB 2BVOB 5JA9A 2HKFL 3QG6B 2VDMH 3P4OA 4NJAH 1JRHI 1NC2B 1CLOL 4GXVH 1HZHL 1N0LA 2Z8RA 4S1DC 1BLNB 2COQA 1TPXC 1TJIH 4I5BB 4MJ4A 1KIQB 5E5RB 2ID5A 3VXME 2VABB 3NIGE 1KPUA 2P7TA 3VXMB 4KI5D 4OCXL 3L5XL 4X4YB 4PJCE 1YY9C 1T2JA 4JKPL 1E28A 1Y0LA 1R3KB 5JHLH 1HYSC 1MHHB 4PJCB 5FFLA 5K9OB 4HQQH 4DQOH 1KLGA 2BRRH 1GOGA 4OLXL 3FQRB 3MRPB 5GZND 2HKHH 5EZOH 3GJEB 3U46B 3K0WA 5BZDB 1BVKB 1HYRC 3BH9A 1I8LC 1I1YB 3UAJD 2IANA 4DN3H 2UVFA 5HHMB 1UH3A 3UJTL 3BH8A 3STLA 1CFNB 3PWJA 5CJOH 2C7UB 1AGCB 3TCXA 3V7MA 2Y07L 4N0YL 2EIDA 2NY1C 1RZKH 4PBXA 4YH6A 4Z7WF 1A4JB 4AEIH 1X5IA 1SVCP 3C8KB 5F44A 3HC0B 4HWEL 1OAQH 5A2LH 4LPUA 5A3ID 2X4SB 1EHLL 1C5BH 1YJDH 3SE9H 3HE6A 4IOIA 5CZXC 5TPWH 3D0LB 4QRRE 3OHXA 2HFGH 4NQED 2JJUA 5IHUL 2HKFH 5C70A 5TQ0L 1JPSL 1NBZB 2DQIL 4HJ0D 1CLOH 3OGOE 1VFBB 1HZHH 4L4TE 5LCVL 3CGTA 3ZE2E 4QRUB 2HJLB 1QSEA 4H0GA 4L4TB 2XNAA 4HPOL 1GGUA 3JV4B 3TESA 4PY7A 4X4XA 4OCXH 3RHWK 3L5XH 5EZIL 4R2GB 1WV7T 3QQ3B 3N0PB 2X4OB 4JKPH 2C3XA 2R2CA 3WO4B 5IROA 3ROOB 3ULVC 2RJMA 2P8MB 4EDXA 4OLXH 5FV1L 2X89A 3MX0A 4LCUA 3K8KA 1A4KA 3MJ9L 1R3IL 4HUKB 3NFPA 4BZ2H 2JJTA 4KV5E 2D4FA 5F3BB 1D5ZB 4IIQB 4GW5B 4TTDC 5E03A 5F9OL 3SDDD 3UJTH 5JIIA 1CWVA 2CLVB 1AXSB 5GXBB 4P3CL 5BV7C 3OKOB 2YS4A 1JZ2A 3QWRA 3VXQA 3GSRB 2Y07H 4N0YH 4D9LL 1Q9LB 2X9YA 1JWUB 1FNAA 4EI5D 2IQAA 3MOBL 4JRXA 3UTPE 5GHWL 4OZGA 1GC1L 5E8DL 3EW3B 2X4NA 2ADJB 2DJ4A 1EHLH 4RFOL 4OZFG 1KTDB 4G8FB 5D1XB 1TNNA 1PKQB 2XZAL 5I1KH 3DROA 5IHUH 1WTLA 4BJLA 2D2OA 5CMAB 1C5DB 5H94B 1CFTB 2B0SL 3DI2B 2DQIH 2GAZB 2Z8VC 4U6VL 3VFPB 3MNZB 1PQZA 4YDIL 4PYHA 4N9OB 4HPOH 4I0PB 3EDDA 5IM7A 3SY0B 3BGMB 4S1QL 2BNRA 4G9FB 3LKNB 4F3FB 1HHHB 5D6DA 5EZIH 4MMZC 2Z4QA 4UV7L 3VFUB 3HCVA 2NXZC 1UXWB 4XBEL 3SKMB 3MNVB 3OKNB 4OF8A 4MDJB 5B3NA 5ISZE 3OKEB 4DEPC 2PO6C 4P5TD 2Z31A 5BRZE 3BXNB 4MVBD 3HB3D 1I7TB 3MJ9H 4HPYL 5BRZB 5HYSA 5IVZB 1R3IH 3FB7A 1TQCB 4ZMAT 2FWOA 3KYOA 3SCMC 1IGJB 1FNFA 4WDIA 1UWGL 3FONB 1FFQA 4HZLA 3QB7C 1MVFA 1HHJA 3LSOA 3O9WD 2CSPA 3JTTA 4WEUD 4HMDA 4M7LT 4MJIA 4U05A 3CFKA 5INDB 1SQ2N 4JREB 3H9SD 3CU1A 1N2RB 2VZSA 4QXTA 3FRPA 3UPCA 3IU3A 2DKMA 4G9DB 2GK0B 2JELL 3MOBH 5EU5B 3ZYJA 5GHWH 2Y23A 1GC1H 5E8DH 4ZFOA 1TZGL 5EN2A 3E8UL 4RFOH 4Z7QE 1N8ZA 1WFTA 5IVNA 1B4JH 3BKYL 4XNQB 5DFVD 4RDQG 3VXOB 2XZAH 3QDMD 3RDTD 4KH2A 5DK0B 2Q86A 4N0FA 2V5RA 2HN7B 4RBPH 1G6RL 3MUZ1 5TQ2L 3VD5A 3VGHA 1AKJB 2B0SH 3O81A 1ZMYA 4AYFA 4HXBL 4NPYA 3V4VL 1MI5E 3TVMA 1WAAF 1NC2A 1EFXD 3ORJA 2K1MA 5DD5L 3EJYC 4MWFB 3CH1A 4A2LA 5EU3B 3PNWB 4BSWB 1RZIB 2ITDA 4DGYL 4S1QH 5E5MB 3MRRB 3V4UH 4I5BA 1KIQA 4I48B 3TFKC 2VABA 1QSFD 4J1UB 3BWAB 2PKDA 3SO3B 5I19L 4PJ7F 1S3KL 1ZHLA 4RIRA 4KQ4L 2VLRE 4UV7H 5FYLL 3VXMA 5KZCB 4XBEH 2PCPB 1YMMD 4X4YA 2F8XC 2BMKA 1JZ3A 1AGEB 2O5YL 4TTGA 4P9ML 5CHNB 1R3KA 3FAXA 3TZVD 2YHGA 5DEZA 4F8QA 1LP9E 3RUGF 4PJCA 2ILLA 3ZHKA 4NQCE 1Q0YL 3FQRA 3MRPA 4HPYH 4HC1A 5FM5M 3GJEA 3H9ZA 4HSQA 4X7SL 1I8IA 2DICA 1UWGH 1I1YA 4OLVL 3W5NA 3ARDB 1PEWA 5I73C 3RWDA 5KSAB 2X4RB 1CFNA 2KH2B 3PHOB 4YBQD 3OR6A 2FJFB 2DN7A 3NIFE 2EH8L 2JELH 1HN1A 2XXCB 4X7TA 4TRPH 4Z7NF 2V2XA 1TZGH 2X1WL 3I85A 4F7TB 4M00A 3HC0A 2WM0A 4PGEB 4WI9A 1EJOL 4R0LA 2HFEA 1LVEA 1KCLA 2WWMD 1MCWM 5B39B 1P4BL 5ITBL 3QJHB 4NO2B 5I17B 3D0LA 3MJ8A 1VFMA 2FJGB 3DI3B 4D9RD 4HS6B 4JFPB 3VXTA 3M1BA 4HXBH 4QRRA 1RJLA 3V4VH 1ZLWH 1NBZA 1U6AL 5DD5H 3D3VE 5ITFA 1VFBA 2MPAH 4XPBL 3O6FD 4OD2B 4LRNL 3D3VB 4QRUA 4DGYH 2HJLA 4L4TA 3CSYB 3QNYB 2R0LL 1B4RA 1LEKB 1I8MB 5I19H 1S3KH 3WFHB 5FYLH 4L3AA 2YPLE 1RK0B 4ODWB 4OBSA 5K9QI 1S9XB 2ZWLT 3QQ3A 2O5YH 3MV8D 5ESAA 2XWTA 3G04B 2X4OA 3OWEA 2NLJA 3ROOA 1CS6A 1Q0YH 4XTRD 2HRLA 1KV3A 4DK6A 4X7SH 2GFBA 5I66B 4XRCB 3WIHA 4OGYL 3IAGC 4RMRA 4OLVH 1NCDH 3KDMA 3HKFA 4Z9KB 5F3BA 4H5SB 4IIQA 1B88A 3B83A 4JFED 4X6CF 3HE6C 5IW6A 3T65B 4KAQL 4OF5A 2BNQE 3G9VA 1JE6A 1Q38A 2XKUA 2YA1A 5CSZB 2BNQB 4W4NA 3GSRA 1Q9LA 5JLZB 4BSVB 4WFHE 2P46B 4U1IB 4K9EC 2ED7A 4PJ8A 3MRKB 5HHXL 4I13B 2AEIT 3PXJA 5T1MB 4G8FA 3BPLB 1P4BH 1I3RA 1ZT7B 3ZKMC 4UNVA 1K8DB 5F7FA 5MEOB 5SWSD 5GRXG 5CMAA 4HK3J 1J0IA 1U6AH 5IROC 1A6AB 4Q2ZB 4XPBH 4AM0B 3MNZA 4QWWC 4NBXB 4RGNC 1NAML 2VZOA 4F15B 5I1LB 4U4BA 2R0LH 4NO0B 4MAYC 5CP7B 2P1YA 7FABL 1HHHA 4PJAF 1F4AA 2WIIB 3LS5L 4IRJA 3QPXL 1ZT4A 3VFUA 4JQVC 3F6LA 4NBZB 4PLKC 3MNVA 1CD0A 1DVFC 2D7OA 3OKNA 4UOW1 4XCNB 5CZKA 3OKEA 1IQDB 5C9JA 3QZWG 5ISZA 5M95B 3EBAA 1I7TA 3NH7L 2V2WA 5BRZA 4K71B 4RISL 4GRWE 1ED3B 5INCA 4JRYE 3JBG7 3FONA 1DBKL 4XC1L 1YEEL 4Z7VE 5D93B 3IDNB 4KAQH 3CPLB 4UDUB 4ISVB 4K94L 4Z7VB 3PWNB 3NVQA 4HIIB 1N2RA 3REVA 1BVLA 1P9MA 1XH3B 4G9DA 4ELMB 3MACH 1DJSA 2HAZA 1XR8B 3V7AE 5BZWA 4HIHB 1S9VA 3GMNB 3VXUB 2BOBB 5HHXH 2NQCA 3T09A 2JCCF 5HVHC 1OT1A 1UM5L 4XNQA 2Z93A 3VXOA 5DK0A 1RZJH 5D6DC 4YEFA 5C0NC 2HN7A 4XPTL 4DW2L 1UB6A 2FNBA 1G6RB 3H7BB 2C4FU 3KYMB 4LLQB 3O8XA 1SBSL 3IFNL 1NANH 5TDNB 1MHCB 2Z31C 4MWFA 1NAMH 1MI5A 4GG8B 5EU3A 1MIEL 4DVRL 5FGRA 4AMKH 4BSWA 3QDHA 2ENSA 1CFBA 3OB0K 2NW3B 1FSKC 3OXRA 4I48A 7FABH 4J1UA 5FYLE 1Q94A 2IPTL 3QPXH 3VWKD 1FFPB 4X5XB 1T0MB 4RMQA 3B9DA 2PCPA 2R2HA 3IVKA 3QUMA 2VLRA 1CFSB 1F4HA 5DO2C 1B6DA 4Y1AD 2ZSWA 1QBMH 3VFNA 1F00I 3GO1L 4ZOCA 3VCLB 2C3GA 2LQRA 3NH7H 1LP9A 1IAII 3DYMA 5EPMA 2DRUA 1YEDA 3CFCL 4NQCA 1FZOB 5ECJE 2Z8WC 1ORSB 5DUPL 1DBKH 5D7LE 5DT1L 1ZLVH 5EZJA 1SYVB 3KJ4B 4G80B 3TBVA 4K94H 4ZYKA 5D7LB 2EDQA 2NXYC 3QEGL 2X4RA 4EIGB 1IVLA 1BAFL 4JKMA 1QOKA 2YUXA 2R1XA 3MRQA 5ETUB 1HKLL 4OZFH 1CDIA 1UWXH 1JGLL 3TVMC 1FL5A 4CMHB 3BO8B 4QOKB 4F7TA 2EYRB 2GIYA 4QXUL 2NY6D 5MHSD 4YBHA 5F1KC 2LU7A 2JB6B 5I17A 2FJGA 4XPTH 4DW2H 3ALWA 4HGMA 3CFEB 3VW3L 3ARFA 1XGQA 1SBSH 3IFNH 4JPVL 1ZK9A 4ESKA 1INEH 3MRJB 1MIEH 4DVRH 3D3VA 1NKOA 2NY2D 4FQCL 3CSYA 1QFWL 3IDYB 3K8LA 4PGBA 4JFYB 1IE5A 1LEKA 2DQJH 2AGJL 1I8MA 5GZOC 4M6OL 3TO2A 1U3YA 4JZNB 4U1LA 3ZYIA 1XGTA 3BKCH 3K1DA 1PY4A 1JI1A 1QSZA 2G5RA 5CS7A 3BRGC 2YPLA 1S7VB 4PGZA 3DV6B 3G04A 1RPQA 4PJ5D 5GJSL 4PJGE 4AIZB 2EE2A 1AH1A 2YC1A 2V5TA 1K3IA 2NX5D 1KTRL 2CGRL 4DZ8B 1XF3B 1I3UA 4ODSL 3CFCH 1JN6B 3LQAL 1MJ7L 2NY4B 5I66A 2BY1A 4KTYA 4RNRB 1UVQB 1U9KA 5DT1H 4PRHD 4C58B 1AHWB 2H41A 4H5SA 4R0LC 1D9KB 3TH2T 5E08L 1T3FA 2LTQC 1YYLH 1A7RL 3QEGH 4BFIA 3LRSA 4KUZL 5KBNC 3ZLQC 1JUFB 5CSZA 2BNQA 4JFDD 3DX9A 3VRIB 4APQD 4P46B 3CK0L 2AJZB 4BSVA 4X8JA 4PRAB 4U1IA 5J06A 4PJBE 4DTGL 4HIXH 4KTDL 2ZNXA 7CGTA 1CFQB 5L2KE 3RTQA 5CINL 5L2KB 4HT1L 3RU8L 4FFWC 1T7VA 5BCAA 1K8DA 1J0YA 2CO7B 4HAGA 4LF3B 3VW3H 6FABH 1C5CL 5CJ8A 4JPVH 4WI3A 1A6AA 5CUSL 5GS0D 3X13B 4AM0A 4N8PA 3VXSE 1NDMB 4FQCH 1QFWH 1NCCL 4KRPD 5I1LA 1NAMB 3DVFA 4P4KD 2AGJH 2ZUQC 4OI8A 5CP7A 3GKZA 3AU1A 3IAQA 3TF7C 2WIIA 4LU5L 2J6EA 3MBXL 3MA9L 3MLZL 5GJSH 5T33L 5IHBA 5KSVA 1IQDA 5JTWA 2JF1A 4R4NC 2CGRH 4ODSH 3SE4A 5GRVL 1ED3A 5D2LF 4PJ8C 3UBXG 3U7WL 5E08H 4YHIB 1GGTA 1TCRA 4JRYA 4JFXB 3IDNA 2X70B 4ISVA 4KUZH 5TDOB 3G5XB 4JFHD 1S7QA 3KGRA 1CLYL 4HIIA 4HK0B 5E8EA 1XH3A 1HH6A 3CK0H 4EOWL 1CI5A 1KEML 4DTGH 2FX9L 4ONHB 5I1DB 2M1KA 4OZFB 2NZ9C 4U1SB 4HD9A 1F2QA 3GMNA 4RA0C 1AQKL 1W0YT 2BHUA 5CINH 3RU8H 2AP2A 2YK1H 4YC2B 1GZQB 1MY7A 4M7KL 1PKOA 2VAAA 3RWCB 3OAZH 4IRJC 3E0GA 4LSUL 1C5CH 2XFXA 1G6RA 4MB5A 5CUSH 4LLQA 1R5WB 4HV8B 3O6ML 1DLFL 5TDNA 1MHCA 3NGBC 2GJ6E 1NCCH 1REIA 3UEZA 2Y4SA 4RGMB 1AXTL 2GJ6B 5EU6D 2EEBA 2XQBL 4MDIA 1A5FL 3EYSH 2W07A 2V5SA 4LU5H 3T1FB 5GRZA 1FFPA 4X5XA 1T0MA 3MBXH 3MA9H 4CN1A 2PNDA 3MLZH 5T33H 3RP1A 1VGEL 3DIFA 3P9MB 1FYTD 4PJDB 1G9NC 5HGHA 1A7BA 4NQEB 1P9MC 3VCLA 4P2QD 3VG9C 5DJYA 1FIGL 5FV2A 1SJEA 1N5AA 4QY8B 5BS0E 1FZOA 4OFYD 1I7RA 1T0PB 3U7WH 1ORSA 4GG6B 4HCRL 4U0RB 1WK0A 3VFSA 2OZ4L 2HRPH 5D7LA 2CR3A 3QQNA 5JUEL 4WFGD 4FQHB 5FB8B 1WIOA 1T2XA 2CUHA 1CLYH 5LG1A 5IGXL 1MCEA 1GZPB 5JNYB 1A1MB 1KEMH 4U1KB 1RY7B 3O8XC 4DKEL 2FX9H 5FGCE 4IHOA 5DYOA 1QLEL 4Z95L 1J05A 3BO8A 4ZNEE 1AQKH 3GSVB 5I1EL 5DLML 4PRIE 4FQ1L 4OCNC 3MRGB 15C8L 1LDSA 1GH7A 4FFVD 1JTTA 3FO2B 4X5LA 2R9HC 1V05A 2JB6A 1T7WA 4U3HA 5DD1L 3T0VA 2Z92B 4LSUH 1U8MB 3QDJE 4JKWA 1FO0H 2WNGA 3G6JB 3SDDB 5E8NB 3O6MH 1Q0XL 5D7KE 1DLFH 2BRQA 3LDBB 3MRJA 4OZIB 1KXTB 3RY6A 4XGZA 1AXTH 2Q1EA 1WT5A 4JFYA 3IGAB 5F7MC 4EI5B 2XQBH 1A5FH 5CKGA 1RUAL 5FOBB 4PD4J 3OXSB 4QT5B 5IF0B 4JY5L 2YN5A 4OLEA 4GBXA 3TNNB 3TH4T 1HQRB 1S7VA 1VGEH 3DV6A 3KXFD 3C2AL 3B2UC 5GGUB 3BGFC 3IU4L 3S37L 1G0XA 3RKDD 4KUCD 5DVMA 4PJGA 1TVHA 1JMZA 3AY4A 2XWBB 1FIGH 1OTUC 4YBLB 1MCDA 2ESVE 1HI6A 1I7ZB 5DHYB 1QKZL 4NWUL 3S7GA 1H5BC 5E00A 1WVZA 2UZXB 3BP5B 4RNRA 3O41B 4HCRH 3LKOB 4XPAL 2OZ4H 5GQBA 1IGIL 2VH5L 1J11A 3BP4B 4CU7A 5JUEH 3L3KA 4UUJB 4Y2DD 2D7QA 1C16A 2E7CA 2ZP0T 1M4KA 4P9HL 3SHSA 1G7QA 3ARFC 4DKEH 1JPGB 5IQ9B 2CIIB 5FYJL 5EBLB 4HS8L 5I1EH 1Z3GH 1JPTL 1YPZF 2FH6A 1J1XL 3JV5A 4FQ1H 1CFQA 1KJ2L 15C8H 4P5TB 4PJBA 1CGXA 3KPLA 4P3DA 1KT2A 1J0KA 4UU9B 5L2KA 3D6GA 4DKDC 3U79A 2DIAA 5F9JA 5A1AA 5DD1H 5MI0B 4WV1B 4PGJA 2KZ1B 2UYLB 1A1OA 4M1GL 3W0WD 2BOCA 3RVVD 2ZUXA 4KGJA 1Q0XH 3O9WB 3ULVF 4JCMA 4KPHH 1OSZB 3JVGA 3QIWA 1K6QL 4NKMA 3BMVA 1S78C 1NDMA 4MA1B 4POZD 4EIZC 3H9SB 4E5XA 2H2PD 4N5ED 1I75A 3DMMD 3JWNC 4P5KA 5EZLA 1IGCL 3VE0B 3VXSA 1LD9A 3BPOB 1RUAH 4J6RL 4K3HA 5CSBA 4XWOD 4ZOEA 1UXSB 1R3HB 4CNIB 4JY5H 2F54E 1BBDH 4L29B 5E99L 3QDME 4Q6IB 1ONQB 2WLYA 3TO4D 1LDPL 5GRWA 3C2AH 2VXUL 3QDMB 3RDTB 3IU4H 1WBXB 4YXKL 1IC5L 3S37H 3M8OL 5HI4D 2E9IA 1OTSC 1UEYA 5DGQA 5DD3L 1U91A 2X09A 1EFXB 1MREL 1W0VA 1BFOA 3FOLB 3I6GB 5ENWA 1GVIA 4XPAH 5C0RH 1IGIH 2VH5H 1NPUA 3QJFB 4YHIA 3RTQC 2A6KA 4I3RL 3HR5B 4QXGL 4JFXA 5DDHA 1QSFE 2X70A 3UC0H 1RZ8B 2DI9A 1QSFB 3X3GL 4P9HH 3CVHH 4HK0A 4JZJA 4WHYG 4NHUB 5FK9B 5FYJH 4NKOB 4HS8H 3B9VA 4HWZB 2PETA 3QFJE 1JPTH 1WWCA 4OZFA 1J1XH 4ZD3L 4U1SA 4IRSC 2I9LB 3TZVB 3KG5A 2CR6A 4R8WL 2L0DA 1TVDA 2WW8A 3WS6C 3VJ6A 5FCUL 1GOFA 4H25A 4X6DF 2BVTA 1P4IL 1MCWW 2R0WH 4M1GH 4J12A 3NCJL 4HWNA 4OFVA 3A6BL 5DJ2A 4NFCA 3BRFA 1K6QH 3ARGD 1X5JA 1ZA6B 2Y6SD 4KKLC 4GKSA 1IGCH 3SE4C 1E6JH 2VR9A 2OTWB 2VLLB 1QD0A 2IBGA 2GJ6A 3FFDB 4FMFA 4J6RH 3HZYB 5J13B 1ZGLP 2HJKB 3OG6B 2QQLL 4M7ZB 1HKFA 3MSPA 4OKVB 2CDEA 5BQ7B 3T1FA 3ULUF 1OPGL 1AR1C 3TBTB 5E99H 3GSQB 4QHLB 1U3HD 1LDPH 1FIEA 3QZWB 5A16B 2VXUH 4ZS6C 4YXKH 5IHLB 1OQOA 4UINH 2QLVB 3PL6D 4D0DA 3ARBD 1UCBL 4OF0A 2NY7L 4QY8A 4MNGB 4ENED 3C09C 5BS0A 2VE6B 3O6FB 4I3RH 3LN4B 1BEYL 3VI4E 3WNPA 3SDYH 4XVUC 4AQOA 5JO5A 5HI5C 3HNVL 3X3GH 1S5HB 5IVXB 1BX2A 4MXVF 3KPRD 1AO7D 1Z9MA 1RJYA 3S35X 3MV8E 1GZPA 5JNYA 1A1MA 2VXQH 2DQDH 1A6TB 3OBAA 1L0YA 1B90A 3MV8B 5ICYB 1KEGL 4Y4FD 3P30L 3UBXI 4ZD3H 3UX9B 4R8WH 2OM5A 5DSCB 3RJQB 4J7RA 4ZNEA 4PJHE 5F6HJ 4PRIA 3BQUD 2XQYG 1IGYB 5HYQB 4CN4A 1A2YB 4LHJB 4MNQD 5GSRB 1U8MA 3A6BH 3JSSA 3P77B 3QDJA 4JFEB 4U2ZA 3DVNB 3OSKA 2VWEE 2VN7A 3OF6A 3KLDA 1VB9A 3EKCA 3MRHB 2XZCL 4C57C 4PJXE 1OD7A 5CLTA 1SMOA 2V5YA 2G60L 2QQLH 4EI5A 3IGAA 5T3XE 4MX7B 1VPOL 3TCLB 3MLWL 4PJXB 4XMPL 1OPGH 1RZ7L 3R1GL 5AUMB 5FOBA 4QT5A 5IF0A 3IAPA 3TNNA 3IXTA 2BNUA 4BZYA 3QH3B 3KPMB 3A0OA 4G42B 5SWSE 1OAKL 4MLSA 1AGFB 3RNQB 5GGUA 1QUNA 4JLRB 5HHOD 5SWSB 3W81A 5IP4A 1F8TH 1I7ZA 4CMHC 3BP5A 1G7LB 3KPNB 2ESVA 4WW2B 3O41A 3CD4A 5JZ7C 3LKOA 1H15A 1NMBL 1OLLA 3BEWB 5CGMA 4JY6A 4GXUN 3GK8L 1CE6B 3BP4A 3K8MA 4OZHE 3FO1A 4OZHB 5D1QC 5HD8D 3QT2A 4UOW0 4DCQA 2YR3A 1IAMA 1KEGH 3P30H 5IQ9A 2A0LC 2CIIA 3E6FB 3WYRA 1T5WB 2E6JA 1IM3A 4P4RA 3RY6C 5I8OL 4P5TA 1F90L 3T2PA 1KJ2B 1WT5C 3T3PE 1LEGB 2FHBA 1F4XL 4XP5L 5MEQB 1T22B 4GBXC 4M7LL 1KSRA 2BC4B 3FMGL 3O9WA 4QHMB 2R0ZL 4R97B 5CJQH 4ZPVB 2XZCH 1TTFA 3AY4C 3I84A 3VE0A 3GKWL 3RJDA 3RL1B 4KKAD 2G60H 5I6XC 3EOYG 5ICXB 1VPOH 2X1PA 3MLWH 4XMPH 2ADFL 3R1GH 1HHIA 1LE5B 1R3HA 4CNIA 4BFBD 1IZKA 1P5VA 2X7LA 3F7RA 3SE8L 2YD2A 3VU2A 1NGZA 2F54A 3MRCB 3QDMA 3RDTA 3RRQA 1KG0B 1OF2B 2JLLA 3IFOA 4LLVA 4YHPA 4C56D 2EDRA 4GKNB 2X1QA 1EEZA 2AJXL 3SKOB 1NMBH 2N7AA 3GK8H 1V3MA 3HR5A 3JTSB 5C0GB 1RZ8A 2A83A 3EO1B 4LP5A 4QHUB 1X4YA 5FYKE 4RQQB 1QSFA 3NCYS 3VWKB 1KJMB 2X4QB 1ADQL 4NHUA 1KCSH 3EAKA 1E4XI 2CK0L 3MJ7B 4Y1AE 5FK9A 1CICC 2QADD 3GMMB 3JVGC 1KOAA 3PG2A 3QIWC 4HWZA 4Y1AB 4ZPTA 3TZVA 4HX1B 2I9LA 5I8OH 4MA7L 1F90H 4L8BB 3QFJA 5J11C 3CNKA 1AY1H 3DNKA 5BVPL 4XP5H 5CILL 3BT2L 4J23A 4M7LH 2QQKH 5EBWB 1XGYL 2R0ZH 1BOGB 1DBJL 3IXAA 4TN9A 3QBTB 1YQ2A 5F3HB 3QUXA 4S1RL 2VLLA 3W39A 3FFDA 3HZYA 1FORL 2ADFH 4WO4D 4HBQA 2IH3A 4TUOA 5HDQH 3TBTA 3SE8H 2NY6B 5D7IF 5KOMC 4QHLA 1QFOA 3QZWA 1MCHA 5A16A 3CFBB 1CXLA 4ODXB 1BZ9B 4NRZA 4JZJC 4NKDA 3GJFB 3SPVB 1HHKA 1K2DA 1NGQL 3EOAB 2YZ1A 4LCIL 2YD8A 3UYPA 4OQTL 2C1OB 2VE6A 3O6FA 4D94A 3LN4A 2NY2B 1RMFL 4Y7MA 1LK2B 2I27N 1CVSC 3AB0C 3S8WA 3G5VB 5L7XL 1ADQH 4AT6B 3UAJC 5IFJB 2Q20A 1EO7A 5DR5L 1HCVA 2CK0H 4PJ5E 3EYOB 1A7NH 4OF6A 3TYFA 2X10A 3MV8A 4WFFE 4PJ5B 4Y5YB 2OR9L 5C7XL 1IKFL 1NMCB 3KPPB 4MA7H 3VD9A 1DFBL 2NX5E 5SWQA 4YFEA 1DCLA 3UPRB 2GITB 3HI1A 1TQBB 4KKBC 2NX5B 4TVPD 3FQTA 5BVPH 3OAYK 4PRHE 4PJHA 3F5WB 4JFQB 5CILH 3BT2H 3GHBL 1A2YA 2DAVA 3I3DA 4W4OA 2H3NB 4MLIA 4PRHB 2OJEA 5T3ZD 4TPRL 3P77A 5A3IC 1XGYH 2EH7L 1DBJH 5J3HC 4LLYB 4G8GA 3ABZA 2AVGA 5C0FB 2BX5A 1G7PB 3X3FL 5CFHA 3MRHA 4JFDB 4QRTB 4S1RH 4APQB 2ATPA 1T1WA 2CDGB 1FORH 4PJIE 5JHDD 3EYUL 3F6IA 4HJ0C 4MSWB 3TCLA 4KJPD 4PJXA 3RBSA 5FO8A 1RV6X 2EDTA 4AG4L 5EORL 1CLZL 3LZFL 4X9HA 3KPMA 2C26A 1RHHB 1BBJA 3VXNB 1AGFA 3RNQA 1GGIL 5HGAB 5SWSA 2XA8L 1K4DA