1MCEA

Principles and pitfalls in designing site directed peptide ligands
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
216
structure length
216
Chain Sequence
PSALTQPPSASGSLGQSVTISCTGTSSDVGGYNYVSWYQQHAGKAPKVIIYEVNKRPSGVPDRFSGSKSGNTASLTVSGLQAEDEADYYCSSYEGSDNFVFGTGTKVTVLGQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Principles and pitfalls in designing site-directed peptide ligands.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immunoglobulin
molecule keywords IMMUNOGLOBULIN LAMBDA DIMER MCG (LIGHT CHAIN)
total genus 40
structure length 216
sequence length 216
chains with identical sequence B
ec nomenclature
pdb deposition date 1993-02-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1mceA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1mceA02
1KUMA 4U6YA 4M4PA 3WN5C 3LRHA 1KIPA 4PJAB 1F4WH 1MI5E 1MRCL 3U36A 3DVIA 1JHTB 1NDMB 4Z7UE 1U8OB 5K59F 1ZLWK 1YEGH 2PXYC 2FEEL 5IVXE 1VEOA 3L95A 1TITA 4EN3D 3SGKC 3FMGH 4ZAKA 3UTPD 3QH3A 4KVNL 1UCBL 4JY5L 1OWWA 3A67H 2VL5A 3AS1A 4IRSA 2QKIA 1TZIB 3INUL 2RFXA 3DO7A 5CWSB 3T65A 4LVHB 4TRPL 3IETB 3T08A 4LSQL 2JB6A 3DOSA 1T7XA 1HHHB 3EO9H 3UJJL 4I48A 2CGRL 4TVPE 3VGFA 2B5IB 1TFHA 1U8OA 1ZT4A 5C8JB 3GEWB 2V9RA 3LRSA 5DMIL 4TUOB 5SWSA 5BS0E 3FT2A 3NA4A 3KDMA 3MUJA 1X5GA 2EDLA 4R4BA 3P40A 2K7QA 1YEJH 3SCMB 2DWDB 5E08L 5ICYB 4HH9A 2JJSC 1YEHH 3JWNC 3BN9D 4MAYD 2GSGB 3H9SE 4OBSA 5ESQA 1AQDB 3CFDA 4K3EH 3KPQA 2ZG1A 4JHBA 4NKMA 4QLRA 2P46B 1RMFH 3IU3A 4GXUM 1Q0YL 2HLFC 4OZHA 4LSRH 1B4JL 1D9KB 1LHZA 5I15H 3ZKMC 2HFEB 1QLFB 5L2JA 4U4BA 5F9OH 32C2B 1IGYA 4P3WA 3P73B 4XP5H 4WU5B 3S37H 1I7RB 3QDMD 3WCYA 3FAWA 5C0AE 3GMPB 1HHJB 1XF3A 2XWTA 4JFYB 4XPTH 4Z7WB 5MENA 4ZUSB 2WAHA 4GBXD 4CW1B 1U8JA 3IVKA 3DVFA 2HN7A 3B9KB 3MNWB 1H3PH 3NN8B 2GTWA 2P44B 4P0DA 1NGXA 1JV5A 5GRZA 3S6CA 2UWEB 2OZ4H 5DD6A 2WBJB 5D1ZA 3W0WB 1A21A 4PP1D 2DWEA 2YR3A 4JGMA 3O4OB 5E6ZA 5TH2A 2CDEA 2YRPA 4R4NC 3HAEA 3Q5TA 3DX9B 5I75B 2HFGH 4I3SL 5I15L 3C87A 5DXWA 2F53E 1AHWC 2GFBA 1A6UL 5DEGB 4ZSOE 1G6RB 3D48R 1HN1A 1XCQA 2ICES 2NXYB 4R7NA 4WFFE 2W9DL 4P3CH 3VD5A 1FFRA 2ICWB 4LPXA 2ZUWA 4MXVE 1KENL 1FAIH 2MCPL 4ZOEA 2V2WA 4I3GA 4U6XB 1Z9OA 1F11B 4IMKA 4XP4H 3QWRA 4Z77B 4HZLB 4DN4H 2FATH 1PD6A 4GAGH 3SKMB 2GY5A 3GHBL 1U95A 4P2RB 4XPHH 3VGDA 1A47A 1N6VA 3FAXA 4O2FB 4Y4HB 1QRND 1G9NC 2YPLA 1JV5B 2Z8RA 4W70A 4ORGA 4Z7QF 4L3EB 5IVZB 4ZAKC 1N3NB 3C6LB 3CXDL 2X4TA 2J5LB 3SE9L 4P3DA 5LAXB 1OD7A 3LS5H 1MJ7H 5I1EL 2P5ED 1MF2L 4KK9D 4A6YB 1YY8A 2FRGP 4Z18A 3BSZL 3QDJE 3PIQA 2HLAA 4N0RA 2OTWB 3AROA 2ESVE 2E6PA 3MUZ1 4KUCD 2DBJA 3T2NL 5FUCE 5ICZA 4OCWL 1XGTA 2QR0A 3N1QC 2R23B 3RIFF 5MERA 3VG9B 5C09B 3QUKB 4XNUL 4JKPH 5D1XB 1R5IB 1W0VB 1U3ZA 4WI4A 4YO0A 1KPRA 5IBLD 3C60D 1LO4L 4LAQH 3RPIB 4AM0A 3Q5OA 1IKNC 2Z31B 3PP4H 3MXVH 1F6FB 3V5KB 3BT2H 1MNUH 4R4BB 5FM8A 1YNTA 3NBNA 2IAMC 4M5ZH 4HMEA 1AGDB 3WIIH 3JVGC 4UV7L 1ETZA 4KZEL 5EU4B 5BQ7A 4ZMAT 1Y6KR 3HMWH 5BS0A 3PGDB 2VXQH 3O6LH 3RUGE 1H3TA 5GXBB 3RL2B 1TVBA 3OKDA 3T1FB 3MLYL 1A6VL 2DYPD 4MA8H 3VGEA 2V7HA 4DK3A 4B0MM 5T3ZL 5SWZB 3LEVH 2RJMA 2BOBB 3OGOE 3DVNB 3MYJB 5INCA 5I1CL 4PJDB 4NNYB 2FECI 1X3DA 2VB5A 1RZFH 5HHPA 3OKLA 4UV7H 3VDBA 4WDIB 1U8IB 4GOSA 3ILPA 5I66B 4NQED 3QHTC 5EWIH 1YMME 2QQNH 4UMGA 4G9DA 5DWUL 1I7UA 3SGDH 3U36B 3ZYJA 5DYOA 1FFPA 1WFNA 2DDQL 3NIDF 1BECA 1S7RB 2CK0H 2YXFA 2HWZL 3SN6N 5F3BA 1ZXQA 3H8NA 1LEKB 1AR1D 1VFMA 1NGWA 4J3VA 2NW3A 1WTLA 1DQJB 3V8OA 3DVNA 3MYJA 4Y4FA 2BVPB 1KG0A 1INDL 3QP3A 5E5MB 3SPVB 2OR9L 4JG0L 4ZFFB 1PZ5A 5INDA 3RGVB 1T7YA 1GL4B 2OJEB 2JJVA 3RWEB 4WI9A 2GK0A 3I9GL 4OJFL 5TQ2L 3HR6A 4W4OC 3EAKA 4WUUA 1CLYL 2IGFH 5I1KH 3PP3K 4YHIA 3QDME 4G6AC 4NP4L 2AJUL 2Z4QA 1MJ7L 4I3RH 1UZ6F 2IH3A 1QKZL 3QCTH 1NJ9B 3WBDA 2BSSA 1RIVH 2WMPA 5CD3B 4M9OA 4OD2B 2R4SH 1XGRA 3KGRA 4WW2F 4EVNB 5JIPA 2APVA 3CIQA 2EYTA 3H7BA 3JTTB 3GIZH 2P48B 4OFIA 2AQ3A 4U1GB 4JKKA 2HTLD 4R7DA 5TF0A 1HXMB 4XWOC 4BQCA 1UKQA 3ZSSA 4FQ2L 3X3FH 3GRWA 5HSFA 2MHAA 4AIZA 1BZ7A 5EBLA 1TTFA 1F3JB 5GGRA 4O9HL 1DN2A 2MFNA 2IPKA 4QHKI 4XVJL 3SKNB 2HJFB 1IGTB 5F21B 1UG9A 3IAPA 5EZLB 5KTEH 1K4DB 4CL7A 1KLFA 3LCYA 3LN9A 1QPXA 4F7TB 2VC2H 2CDGB 1CDUA 15C8L 3ARBB 4GFTB 4WFFD 1MEXH 2GK0B 2VZ3A 3QI9D 5DURB 4XBPB 3L6FB 1HHKB 2K3TA 1J0JA 3EYOA 3QO1A 2FR4B 4G3YH 4YBLC 3WYRA 2W59A 2NY6D 1LNUA 3GJEA 1RUKH 4Y1AB 5FKPB 4DAGL 2DQHL 3QIWC 5BMFL 2IALA 2YSSB 4QRRB 2ICCA 5JNYA 1QSZA 3CUPB 3BXNA 2A74B 3PXJA 4L8SB 1MCEA 3V8CA 2WQ8A 2VLRB 4KRPD 3V5KA 1XCTB 5HVFB 4JHWH 5KW9H 1UXWA 1VPOH 5GS1C 3HRZA 5FO7A 4OF3A 5CZVH 2GJZB 5JHLH 2XTJE 2Q76B 4ONGH 3R06B 3UPRA 1XCQB 3TCLB 5KS9F 4ZPTA 3EJYC 5HHOE 4AYFA 1NGQH 3TA3A 5I8CB 3ULUD 4Y19B 3NFPA 5DS8B 2C4FU 2WUCL 1QSFD 5F7HA 3MRBA 1RZKC 4L4VE 4XNZB 4H1LA 1BJMA 4GRLC 4LARL 1XAUA 4RGOH 1MJJB 2X44D 4QXUL 5FYKL 3M8OH 4AIZB 2DQFA 3BKCL 3G6JE 1V8HA 4OZFH 1CDBA 5GS0L 2AV7A 3MUGB 4AH2A 4DN4L 4LU5L 2NX5D 1LILA 2YN3A 4L8BB 4LLUA 1EV2E 3S35L 4OLWH 2PW2B 1T66D 4G6JL 5IFHL 3MRMA 2FDBP 3O9WD 4L5FH 1FL3B 5ALBH 1RZIB 3K8KA 4K8RD 1HILB 5HYQB 4JRXA 2PYEE 4BK5A 4M6MH 3UJJH 4XX1E 4BSWB 2A0LD 1GRWA 3FO2A 1T04A 3CDCA 1NGPH 1Z3GL 1TJGL 4MCZA 3VRIB 1S7VA 3KYMB 1LK3L 1H5BB 1MY5A 3ZE2F 1U58B 3LSOB 1EK3A 4XMKL 2E27H 1EEZB 4UUJA 1AKJD 4GRWF 5EO1B 1ZA6B 5AEAA 1LO0L 3CXHK 1QZ1A 1DZBA 1NCAH 4QY8A 5JPMA 5ETUB 4PJ7F 5HHNB 3EO1A 1F3DJ 1KG0B 4NHUA 5CGYC 1FJ1A 2F9BT 3P4LA 4PB9H 4OM1H 2VDPL 1A3QA 3K2MC 5DJAA 1IAKB 1CTNA 1UGNA 1U8HA 4DTGH 3U7AA 5JPNA 3O4LD 5AD0B 4KJQD 1CS6A 1CD9B 4Z5RA 4IMKC 3VXUB 2WBJA 1OT2A 3VFRA 3TV3H 1QKZH 3QCTL 4XI5C 1FLRL 3IDGB 4YHPA 1FV1B 4UT7H 2XWJB 3C2SA 5A3ID 1K6QL 4HWZA 2E6JA 4WEMB 5LGHH 4PJ8C 1KYOK 4YFLF 4J7RA 4I2XE 4Q97A 1S5HB 1ERNA 1ADQH 4G9FA 1UWXK 1TMCB 4PBWD 2IH1B 4OZGF 3VCLA 4HKBA 1K5NB 4UILL 4HIXH 2BCKA 1ZHBB 1OQOA 4WO4C 1G7JB 1URLA 3MCLL 5AD0A 3OKEB 5DD3L 4AMKL 1HQ4A 2F53B 5DVNA 3S4SB 5J13B 1P9MC 5EZIL 4WFEE 2ZCHH 3IXTB 5TDOB 3VFNB 1N64L 2D7PA 1L0YA 5C0IA 3WIFB 1CICD 1DL7L 3VFOA 3WXVL 3F5WB 4FXLA 5ETUA 4D2NA 1JE6A 1PY9A 2A6JB 1GZPA 2C7UA 2BVOA 2NW2B 3QRFM 3TA3C 1JIBA 3GZKA 3QDGA 3WD5L 2NY5C 3HMXH 2HG5B 5IFJB 4HC1L 3PHOA 3OKNA 4Z7WA 2AJXL 3JVGA 5MENB 4OZFB 4JPKL 4LHJB 4R4FL 3MLRH 4XVUC 5GJSL 3V0VA 4U2YA 3RWDA 1QR1B 4NQDD 5C2UB 2NPLX 3P73A 1UC6A 4HDIB 3P9LB 4OZGA 1WC7B 4JFOB 2VDQL 4R26H 4LP4A 1CIDA 3QCVH 2VLKB 5C07B 5E4EC 2QADB 1OSZB 4HS6A 3KPSD 5IMKA 1BFOB 4KI5D 4XPGL 2F58H 4UDTB 2CR6A 4HGKC 3OR6A 1S7SA 5KSUB 5DJZB 1OGAE 4YXLH 4UNUA 3MRNB 4KK6C 3SKMA 2OI9C 4V2CB 4QTIL 3FOLA 1EEYA 1YA5A 1MCWW 2DQDL 3HMXL 3PABA 4XCNA 4OLWL 4Z78B 3NGBC 5M94B 2OLDA 4ZTPL 1D3CA 1CGYA 2CK2A 3AFLA 3OAZH 1OVZA 1JNLH 2WQRA 3TPKA 1NMCB 2VO5A 2LAAA 1FZMA 1BFOA 3OSKA 1I1AC 1ZT1A 3KXFE 5C07A 3ZYIA 1VFUA 4I9WE 1QRNE 3MYZA 5F7UA 4JN1H 2P8PA 5KG9B 1A5FH 3P4NB 4O02L 4F3FA 1J7VR 2P5EB 5D7JA 3KLSA 1F45A 5F7FA 4TSBH 4WV1B 5FYJD 3BUYB 3GJEB 1FVDA 4UDTA 4P9ML 4LCIH 1VA9A 1Q38A 2Q86A 4XPFH 5H37G 1VACA 2H45A 5DUPH 5FK9B 3RVTC 3CZFB 1T0NA 3QULA 1I3VA 1YPZB 3EJJX 4CW1A 4NM8H 4ZS7H 4LNVA 4MA7H 5D7IB 4O51B 3MJ9H 5JW3L 5D1QA 1E4WH 4RAUA 4JZJB 4GO6B 3IDJB 1CFSB 3S4SA 3ARFD 4I2XB 2R1WB 3MO1A 3BZFB 3HI1A 5FYJH 3X13B 3N1MC 4WFGD 1C7TA 3R1GH 4IRZL 4OTXL 3MRHA 1D5IL 2LAGB 3FHQA 5DF0A 4GKNB 1LO2H 4ACPA 5DR5L 2AABL 4JRYB 1A6WH 3RKDC 3P4OA 1S5HA 2AEQL 1CLZH 3FQWA 2H9GA 4HXAH 1NAMB 3BP6B 3VFWA 4OLUL 1QR4A 3SDAB 1UB5B 4E42A 1G7IB 5KBNC 5F88A 2DQUH 3B4NA 3HE6C 4OUOA 1UM5L 4D0BB 3GMLB 3GSQA 3LDBB 1X5HA 1KJMB 1P5UA 3PHSA 5IIEB 2BRQA 5HHPB 2A73B 3FQNB 3GMQB 5ERWA 2NXYC 4P46B 1OAQL 3V5DA 3V6ZB 4J6RL 1FJ1B 1DQTA 3QJHA 4YQXH 4KROD 1B9ZA 4OM0L 3IDXL 2GEEA 4G8GB 3BP7A 2ITDA 5IEKB 1FV1A 3SOBL 1DBJH 4P4KD 3W9DA 4M5YH 5DYOB 4KKBC 2EICA 4O2EA 1V7NL 3LKRB 1BFVL 4JKWA 2QHLA 5GSRB 1NCTA 4HCRH 1Q9KA 3EJZC 3U48A 3VXRA 4XCFH 1RY7B 1K2DB 4GG6E 4BZ2L 5J6HA 3TPUA 5LBSL 1B3JA 5IESL 5DD5H 3ZT6A 5DTFB 4XPGH 3MRMB 2IH3B 1AXSA 3IDNA 4L4VB 4Z9KB 1L7TH 3LKOB 2Z4QB 3VH8A 3BZEA 3HE7D 5MERB 1EIBA 1BBDH 1FPTL 4Q2ZA 2XZQH 3P9MA 5L2KB 1K4DA 4MLSA 4QRRE 2V2TB 3RU8H 4X6DB 1QA9B 2XWBB 3P30L 4ZXBB 3BVNB 3ULVF 4PJCF 1KV3A 3ZKSD 1BZ7B 4JO3L 5DHYA 1IM9D 3K46A 4CVXB 5FYJU 1TETL 5J6HB 4PTTB 1A7RL 1IFHL 3O8XB 4HK3J 4KJPD 4N0FB 4EKXA 4KZEH 2HJKB 1D5ZA 4RBPH 4MHHG 4L8BA 1A7OL 1FRGL 4UU9B 1KN4L 2FLBT 1GZQA 3HI5H 4N8PA 1Z0MA 4DKFH 4BSVA 4NGHH 5DURD 3E2HB 1N8ZB 5FM5O 3OJDA 5KANI 2W0PA 4D9RD 2C1PB 4MAUH 2BXZA 2VLRA 5LXGL 1CFNA 4ZXBC 2NXYD 4X6DA 1JYXA 3RUGF 2GQHA 1K4CA 4NN7B 4PGCA 1OP5H 4WHYH 3QO0B 2V2WB 3LV3A 1I1AA 1LNUB 2AAVA 1IKFH 5E99H 1N3NA 3C6LA 4OUUB 4U1NB 4XPAL 3U9UB 3MJ9L 5JW3H 5D7SL 2LTQB 4G7YH 1EO7A 1BWWA 1CD8A 3O6FA 4JM2A 1G6RH 4XC1H 2F5AL 5JW4Q 3OPZH 4GG6B 5FCUH 5GIRB 43C9B 1EX0A 4LCIL 1M4KA 3FQTA 4Y19D 3WHXB 5CCKL 1INQA 1BF2A 4K71C 3BZ4B 3MJ8B 4LCUA 4XVUD 2NY5L 4RRPG 1OSPH 2Z31C 1C5CL 4AM0B 1IC5L 1U93A 4MDJB 5T1KD 1QFHA 5D1ZB 5E6YA 3IFPA 1B2WL 3C09C 5I76A 3I2CL 2QQLH 1YMHB 5D1QC 1YJDH 2ED7A 3BJ91 4DUVA 3Q3GB 4PRPE 2MSPA 4PB9L 4NQCB 3RUGA 2A9MH 2DI8A 3IDYB 4WW2A 5TPWL 1OGAD 2CK0L 3QFDA 4X4MA 2DQIH 4JFDE 3FB7A 5GGQL 3L3HB 3VXNB 1KJMA 5D1XD 4OFPA 1KC5L 1U91A 2CMRL 4FQXC 3TJEL 1LEGA 3X11B 4QRPA 1R3HA 3NABH 3BGFB 3EYVB 4KTEH 3QYCA 4S1RH 4TQEL 3FO1A 2BVEA 4DW2H 2WWKT 4JN1L 1KJVB 3IDNB 3FB5B 2J8OA 3C6SB 1F4XH 1N2RA 3VXMA 4B50A 4JO1H 5KZCB 3L9RA 3ARFC 2DD8L 4PV8A 4X9FA 2QSCH 1KTLB 3OZ9H 5C0IB 5GGSB 4PJAE 2X4SB 4MB4A 5DO2C 1I3RB 2YHGA 4Z0BH 5JQ6L 2CO7B 5D9SB 5F7NC 3S36H 3EZJB 1MIEL 3VFGL 4NBZB 5I74C 1F90L 4TSCH 2CUIA 3TO2A 5CD5C 1J0HA 1OLZA 1UWEH 4NFDA 2DKSA 4D0DB 1Z5LB 3ILPB 5I66A 2Q20A 5DJCA 1OF2B 4P2QB 3CFDB 3FFCD 4LSUL 3EHBC 3GSNH 2OJZH 3MGTA 2AJYH 4TSCL 4WUUE 5JW4M 5EFIB 4X7TA 4M5YL 4NDMB 4EBQL 5KN5B 2MNUA 4LRIA 4JKPL 1T6VN 4H20L 1EAJA 1T7ZA 3DX7A 3OGCB 5ISZE 4KI5F 4G8EB 4YEFA 4HUXA 4IHOB 1ORSB 3MFGB 4R2GB 4PGDB 4UZGA 5KSUA 1F2XK 1ORQA 3UYRL 1CXKA 2BHUA 2UWEA 4Z5RB 4JPKH 4YHZH 2CUMA 2IQAA 4KJYB 4KU1A 1PX4A 5J3HC 5FCSH 5JR1H 1FL6A 2FGZA 4TTGA 4JLRA 2AERT 3QNXA 4ZSOA 4MD0B 5MP6L 2X1WL 3CH8A 5KN5A 4F7CA 2A2QT 1S7WB 4OGYH 2VNCA 2YMXL 1DSFL 3TVMB 5E8NA 1P7QD 3I6LE 2E8ZA 3N50A 5F7DB 4G8FB 4F7MA 1ADQL 4AK1A 1T1WB 1TPXC 5FGRA 4P2OC 4Q9BA 1CK0H 3VXOB 4NFCA 5L6YL 5BQ7B 4RA0C 3S8WA 1PEZA 1NFDE 2GFBB 4B5EA 2AK1L 5GSVA 1R3LA 1X5ZA 3C08H 1EZVX 3I6KB 4M43L 1R0AH 2Z31A 4BELD 4ELMA 1G7PA 1OAYH 2Q1EA 4Q9CA 1A9EB 4RNRB 2CKBL 3FZUC 1Z2KA 3EJYD 4UINL 5IVXA 3MV01 4LNRB 1A02N 5EZOL 1DFBL 3RX7A 5KSAB 1MHEB 4BQ8A 5JOFA 2B2XH 2ZP0T 1YUHA 3P9LA 4MWFB 1JPTH 2AK4B 1U95B 4O58H 4P2RA 2OTWA 5DC0A 3O4LB 5FDWA 2YPKB 2ZSWA 4I3RL 1KFAH 4BQ6A 5A3IC 3GUTA 4KZDL 4O5LH 4GRWE 4L1HA 1OTUC 3V5HB 3IFLH 3KYAA 5D2LB 4ZPVB 1OM3L 4RIRA 5E8EB 3HZYA 2CQVA 4R97C 3CFCL 2XWJA 5GQBA 3I02A 3UPRB 2ADFL 1EO8L 5EIIA 5C6TH 1CYGA 5ESQB 3JV6B 3RU8L 3ARFA 2Q87A 3FJTA 1P4LB 2OXGA 4JO4H 4PJEE 3FONA 1FSKB 4POUB 4XBGB 2F8OA 3KJ6L 1X9QA 3U46A 5DMKA 2DLTA 3MRFB 4Z7UF 4Z7OE 1HI6A 1TLKA 2Y9RT 4QHMA 2XZCL 5E70A 4MAYA 4MD5B 5CJXC 3SDXA 1YY9C 2J2ZA 3PDOB 3E8UL 4HEME 2E7HA 4IRJC 5FGBC 5IVXF 2BRRL 4JJHA 5MEQA 4D9QE 1HKLH 3BPCB 5DT1H 1QSFB 2MQ3A 2VE6B 4KK5C 1KF9B 4CAGA 4D0DA 4WW1A 1W72L 4ZDHA 5T1LD 1CD1B 4OUUA 5FYJE 1UACL 1RIHL 4OIBA 2IPUG 3MRCB 1CICB 2DMBA 3B9KA 3QEHA 4X9GA 3KHQA 1DLFH 3E2HC 1FGVH 2VL5B 3QO0A 4X6CF 4QOKD 4ZFGL 3FO2B 5CBEB 3L3DA 5I1JH 3KLHD 3MX0A 2C4FT 3SKNA 2CRYA 3O9WB 4M93B 4UBDD 2UYLB 3PHOB 5KW9L 1T89C 1JTPA 5IB4B 1QHOA 1FO0A 3MFFB 4LCWB 3RJQB 2WINB 1EEUA 1JGDB 2EIEA 1RJLB 3WNKA 6CGTA 3CFEA 4R7DB 5L2KE 2Y7QA 3PWPB 5EPMA 4UAOB 4BSJA 3H9ZA 1BEYL 5IBTH 2EEBA 1I4FA 2PUQT 1W72B 4OFYD 1UCTA 3T0EE 4F2MB 2FEDD 5DJ2B 4UI2A 1MAKA 2BVQA 1HNFA 1VPOL 1R3LB 4DKEH 3CVHA 4R0LC 3SDYL 4KHTH 5E6IC 4LARH 4PLOB 2V2TA 4G9FD 2NTSP 4CADA 4F7EB 1YYLL 3LRSB 1J1PL 4FXGA 2H26A 3VXOA 4OZHB 4M1GH 4IJ3C 2NYYD 3AS0A 3STZA 5EU3B 3MOBL 4JREB 3BQUC 1MAJA 1NBYA 3SE3C 2X4NA 2OQJA 4KUZL 3I3BA 2E7LC 5H2BA 5DSCB 1X6LA 3O3BA 4ZFFA 1S7WA 2BMKA 4ENED 3HE7A 5ISZD 3VXPA 2I9TB 3GMRB 1AD9A 4X98B 3G08B 1NGWB 1CL7H 2GSIA 4R97B 1AC0A 5C2BH 1GOHA 1S7RA 3FCTB 4UT9H 3VMPA 4M7ZC 2YPLD 2HVJB 4KZDH 3RDTB 4MNGA 2O61A 4LLWA 2FO4A 4JR9L 4FTVB 4G8GD 3UC0H 2PO6C 1UJTA 1AO7A 3DSFL 4IS6B 3KPTA 2HH0L 2E6QA 5EBWA 5DLMH 2AJZA 5HGHA 4S11A 2ADJB 1HEZA 4OFKA 3U30C 1ZGLP 3GJFA 3RAJL 1RZ7L 4PJ5B 7FABH 4TUJA 3RY6A 4MXQC 2JKXA 2ZUXA 1OARL 3TA3B 3OXRA 3ZHLA 3GMQA 2A73A 4WI7A 1F90H 5TF1L 5FEBA 3GSWA 3MMEA 4WW2C 1HKLL 3H0TB 5EBLB 3ARSA 1YN6A 3VXTA 1CXFA 2P5EE 4W6XB 4TTDC 4LCUB 5HPOA 1BFSA 1Y18B 4ODHH 1KEMH 5EC1A 5DK3A 3VFMA 1A2YB 4HS3A 2PCPB 3CFJA 2JJSA 1LP9E 3BXNB 3VRJB 3BPOC 3V0WH 2BSRA 4CMMB 1NCBH 4JM4H 3SBWC 1LE5B 4RRPA 1FN4A 4HUKB 5GRVK 4JFXB 5ANMA 4HUMB 5ICXA 2Y25A 2Y36L 4Y89A 5KSBA 3UTTD 3QXDB 1QA9A 2XWBA 2NY0C 1CN4A 2YWYA 5DSCA 3O2DH 2G75A 5C9JB 5MP6H 5LJYH 1AC6A 4PB0H 3HC0B 4YHML 4MA3B 4N5EC 2OM5A 5C07D 3LIZL 4JZOA 4YWGL 2VAJA 5HHMD 1BHGA 1FH5L 4OCSH 1MJ8L 3QHZL 1EBAA 3T0VA 1NMAL 5E4IA 1XF2A 1OSPL 1I9JH 3EYQC 2Z9TA 5F3BB 2DJ4A 1AY1H 4O4YH 5DHVB 1CF8L 3DGGB 3GJFB 1INEL 5I1CH 2CKBH 4NJAH 2B4CC 1RJLA 4TUKL 3O8XA 4N0FA 3CPLA 4OLVH 1F4YL 1HDMB 2MPAH 2YS4A 2F5AH 5EOCL 3SDCA 4B41A 4NO0A 4KROB 3T3PF 5JTWA 3ETBF 1UZ8A 3OKMB 3DUUA 2QQNL 2X4QA 1U8KB 4LMQI 4XTRC 5JMOC 2R0KH 3AREB 3S35X 4ODWA 3C9NA 1XH3A 3Q6GH 3VG0H 2P47B 3MRGA 1DEEA 2DKUA 3LKSB 2X4RB 2R56H 1DLHB 2IANB 4K07A 1MELA 2OQJB 2XIDA 5I75C 3QNYA 5AWNH 1Y6MR 3DI2B 1MRFL 2EXYD 3WN5A 3BP5A 4PRID 4I8DA 1MWAA 4YLQT 2APXA 3WFCL 1AGEA 4I1NB 1Z6JT 4BFIB 3D0LB 3MRPA 1KB5A 1CTOA 3HE7B 4YXHL 3DUUB 1F3JA 1T3FB 3QUYD 2XZAH 2PTTA 3PQYE 3NIDE 4NC2B 4PJXB 2EECA 4GKZA 5B8CB 1DSFH 1ES0B 1XEDA 1NL0L 3CPLB 5DJZA 3JWDC 3RVVD 3QFJB 3CC5A 1NANI 4FQCL 4NN6C 2D7NA 2IQ9L 2C9AA 2V5YA 3G5YA 3QUYC 1VB9A 4PJDA 1I1YB 1R3JA 4TUJB 1IC7H 1ZS8A 5EUOE 4U2ZA 4GXVL 4RAHA 3O41B 4DVBB 3GMPA 1JGEA 3PWUA 2VISA 1S9XB 2VMFA 1H9VA 1J8HB 5CP3A 3RKDD 5JIHA 3BSZH 3OPZL 2D2OA 4J3XA 3RWCA 4KRLB 4H8WL 3MZGB 2Z93A 3L3GB 4XMLL 4K23H 1GGCH 4E0RB 4CVZA 4S1DC 4FMFA 5CJQH 2ZZUT 1IGFH 3ARXA 3O0RL 3VXRD 4L4TE 5IB2A 1PKOA 2OSLB 4MNQD 1I3UA 1FLTX 4NRXB 4M6NH 1EFXD 2IANE 5TDPA 1KEGL 1F4XL 3S34L 1MIMH 3RHWK 1PFCA 4M3KB 4CMMA 5D7LA 4NQXB 1R6VA 3RNKB 4L9LB 5F1NA 1VDGA 1W0VA 4M48L 4YX2L 4NCC2 3KR3H 4YGVA 4XBGA 2G5RA 1OM3H 3FQXB 2DQTL 3P0VL 4K2UL 4WJ5A 1IEBB 4PJDF 3QWRD 5C1MB 2F74A 2BCKB 3OKKA 3GNMH 4EI5D 2A83B 4XP5L 4NGHL 5BRZB 2IH1A 2E27L 5ITFB 4RAUB 2D4FA 5HYSA 3ECBA 3WHE1 2RFXB 3QWQB 3KPPB 3W2DL 1C08A 3CH1A 2BOBA 4KQ3H 5KVFL 2Z91B 2QV2A 2FWOA 1E4KC 4NPYB 5EOCJ 1X44A 1UM4L 3MODH 2X4OA 1PJ9A 1WTGT 2AJZB 3TYGL 4LBEA 3WFBH 2NMSA 5FYKH 5M95B 1JWMB 4M7ZB 4NQCD 2EE9A 3MV9A 3S34H 3SDCC 3R4DA 4JDZB 2R8SH 1WICA 1EGJL 5FGCE 3NCFB 5IMLB 5HTSA 3MPCA 1UFUA 1RHFA 2W9EL 4PJIB 1G6RL 4Q6IC 5FOBB 3UAJC 3GMNB 3RWFA 3G5VA 3P0YH 4FFZL 4I77H 3VXSD 5JIKA 1OP3K 3ME0A 4OCRH 1T22B 1J5OH 4RMTA 4HKZB 4UB0L 1KIRA 2YMXH 4JKMA 3ELAT 5TF1H 3TNMB 3DROA 1NC4A 4U1MB 4YZFF 4NKIL 2AQ1A 3ZZ1A 2R1YB 1KB9K 3B8YA 5DUPL 4JM2D 1I9IH 3PIQB 5T1LA 3VG9C 5JQHC 4JPVL 5DJDB 1KTLA 5I1DB 4YHYB 4MXWH 3UDWC 3EW3B 3HZMA 1EXUA 4P2QD 5DUBB 3GMOA 4FXKB 3RWJA 5F6IB 4LSVL 3NOIA 3MA9L 3VD9A 2PW2A 1U92B 4U1SA 1WFOA 4JO3H 2XQYG 4HAFA 1A5FL 3U4EA 5IB3B 3X14A 4I48B 2A9NH 3GUTB 2ERJB 4WV1A 2H2SC 2O5XH 2SEBA 3ZDXE 1JWMA 4JRYE 4AQ1B 4E5XA 4YBQD 3PXHA 5AZEH 3ZE2E 1WBXA 3KPNA 2DLFL 5DI8A 5LGKA 4JKLA 4WO4B 2VLMD 3SDDD 4JY6B 1T2QH 3MLXL 4D9LL 5DEFA 5KTEL 1GZPB 3RTQA 1ZV5A 1CXIA 3IDUA 5JUEL 4FNLL 4YHYC 5EBGA 3P30H 2A9NL 3O2VL 5I9QB 3T4YB 3HAEH 4KI5E 2OI9B 5C0CD 5T1KB 5J11B 5DJ8A 1YPZE 4YHKL 1EEYB 5DJAB 4GG6A 1X4YA 1QFPA 4OGZA 4Z0XB 5C0FA 4HLZH 1JZ7A 3ILQD 2ATKB 2YD2A 1J05B 1HZHH 2EYRB 3OHXB 5J1AA 1FNGB 2ORBH 2QLVB 3BMVA 1PEWA 2R0ZL 4MJ6B 1YC8A 2WK2A 2F19H 2IANA 2R29H 5BV7H 1MVUA 1KLUA 3ARGA 1MCCA 1JWSA 1EH9A 4XT1C 4R90L 1H15B 4U1LA 1VADA 3DIFA 4NO5A 1AO7D 5LGJA 1R3IL 4K8RC 1GGIL 2ESVB 1UACH 1PQZA 3CVIH 1I7RA 1B2WH 1QOKA 2MTPA 5J8OA 5SWSD 2W9LA 5HPMB 4XPTL 1BVLB 4LFHG 3R0MA 2NTFA 1IEBA 4JDZA 2CJUH 4CNIA 5CCKH 4I77L 3D3VA 4Y5XC 4UQ2A 1JNHA 4XAWL 3VFSA 1KIQA 5IOPB 4TTDD 1KCLA 3CC5B 1D5ZB 5C08D 4LCCC 4PJ5E 5C0JA 5D96B 2AEQH 1KJ3L 1C08B 2KBGA 3CH1B 1RZ8B 4X7TB 2OMBA 4ZUUA 2R39A 2PTTB 5E2UH 5MEOB 4DUXA 3MRQB 2IBZY 3WHXA 5IF0B 3BWAB 1SYVB 3WJLA 1OF2A 2LVCA 3EDKA 4L8SC 1CE6B 1A1NA 2GW5A 4AT6A 2R1XA 3H3PL 5ISZB 4IOIA 1C1EH 1NC4B 1V3KA 5IFAL 3U2SB 4GW4B 3MXVL 3Q3GA 4JN2B 2XACC 4M7KH 4ELKB 4AEEA 4OZIF 2AGJH 3LQAC 3BZEB 2VZSA 2H8PB 3U0PA 3UTTA 3EDFA 4G5ZH 4Z7UA 2FYYB 4BSWA 1UT9A 3FHAA 3GSOB 4IDLA 4JFEA 1A9BA 3HA0A 5DFTA 4XNQA 2X4RA 4MX7B 3EOBA 3T77B 5EB9A 4YJZL 4MD0A 4NRXA 2VXQL 2QKIB 5CKGA 5DFWH 5ID0B 2WP3O 2A74A 3HHRB 3GJFK 3MRRB 2OTPA 5DUMH 35C8H 1S3KH 3ULUC 4Y16D 5GS1B 3V4PH 2B1AL 5ACMA 3TA3D 5MHSE 1GGTA 3V4VH 1N8ZA 5CJBA 4YIQB 3KLDA 2ENYA 4Z8FL 2XKSA 4MZ3A 4XPAH 2Q3AA 2DI9A 1P2CA 2A6KA 4ZG1A 1GH7A 3MREB 5F71A 1FYTD 5IBUG 3BRGC 3AXLA 5F96L 3SGDI 4OGAD 2YZ8A 2E9BA 3ECBB 4JFDA 4P2YA 4PG9A 1YEFL 2IBZX 4PLJC 5SV3A 5IHLB 3ULVC 4NO0D 3G5YB 2VITB 4ONFH 3DETC 1BVKA 5A16A 1RFDH 1RVFL 4H26A 1MHPH 4OGYL 4XGZA 3KS0J 3IKCB 3D69B 2VL4A 2HMIC 2XOTA 1MFCL 2AEPL 4WGWB 5T5NF 1ZWIA 1ONQB 1CLCA 3DPBA 1J1OH 3LKQB 1BJ1H 2UY6A 4HBQA 1SHMA 3BIKB 4RMRA 1FL3A 3WEXA 4P49A 3N1GC 4K7PY 3S3PA 5T1MA 1KPRB 1RZJL 3BEWA 1WBZA 3D2UD 3D85A 2OS7A 3WFCH 5HI3C 1WWBX 4XGZB 1QBBA 1S9VA 3F7YB 4HJ0C 1XGUB 1JZ5A 3GSNL 5DGRA 5EZLA 1KCRH 1B0GA 1U91B 2WZPD 3RDTD 3UYPA 4OLZH 1D6VH 4RGND 3HTLX 3BW9B 4YHMH 1RURL 4R8WL 4O51A 3RIAK 5BZWA 2B8OT 5DDHA 4MJIE 3OF6A 3VG0L 5L8LB 1PLGL 3JXAA 4XVSL 3S3JA 1FIGH 4L4JA 1M71A 2DJUA 5FK9A 1FGNH 1HEZB 2HJKA 5A2FA 4CRPA 4XNZC 5CSGA 5EORH 5DHVA 3WLBA 5HI3D 4UOW0 1EHLH 1EHAA 1U93B 4APQD 1JNHB 2BHZA 3KNBA 4J23A 1MCDA 2QHRH 2NR6C 1YEEL 1BFVH 1X7QA 1Z9SA 5FF6A 2UWEE 4ZUWA 2MPAL 4X4XA 5I18H 5F1SA 4KY1H 3F58L 3HUJE 1ZK9A 2VDOH 5E94B 5CJ8A 3FO9A 2HKHH 4NNYA 3K74B 1E0OB 4ZYKA 4PFEA 2H9GB 5TE4L 3FQNA 2VDML 2NY2B 1F00I 1T03H 1P84K 4QOKB 3CMGA 5FAAA 4G80B 3VGBA 5ESAB 2HMID 3NTCL 1QBMH 1FNSL 2FYYA 2AXFB 3QAZC 4LPWA 4KKCC 5K9QG 1CWVA 1MFEH 3OXSA 4ZS7L 3GJFH 3EYSL 4NJ9L 4Y4FB 2VABA 1H8NA 3HG1D 4O00A 3SKOA 5I1IH 1VGKB 4BYHA 4NBXB 4CADB 4F7EA 4ODVH 3RX8A 1I8IA 3CVHB 1P2CB 4AZ8A 1DCLA 2VTFA 5K9KA 4XCEB 5D7IE 1N5AB 2BNRD 3B9EA 3HNTL 2KH2B 4PJ8A 1IMHC 1YZZA 3NIFF 4HWUA 5DMJB 3GHBH 4Y19E 1RUAH 3QIUB 4JY5H 2P42B 5CHNB 3IGAA 3FRUB 3UZQA 2DOCA 1EJ6A 2ZOKA 4PJGB 4BM7A 5L6YH 2D03H 3GM0A 4N5UA 3ARRA 2B7DT 5SX5K 3O45A 5JUEH 2KZWA 4H1LH 2Z35A 1T5XB 3NPZB 1PQZB 1G9EA 2IAMB 3O2DA 1MFNA 5FUCC 1BIHA 1RZGA 4LKCB 1MI5B 3WFHA 4AY0A 3GIVB 3P4MA 2E9WA 2R2BB 4PJCE 1NGZA 2P8MB 3AC0A 4LLDB 4F9PC 4CJ1A 3SDYH 2GSIB 1A6TA 4M62L 1AXSB 3GMOB 4QRTA 2EEDA 1CU4H 2FBJL 1AQDA 4S0SD 5F6IC 3F7VA 3P4OB 4KQ4H 2W07A 4XMKH 5H35A 3B8SA 3I6KA 5BRZD 3GSXA 2JF1A 3LN4B 1JTOA 3DV6B 1NUFA 4C55A 1E27A 1ACZA 5ILTH 3MFFA 4LCWA 4XVSH 5T1KA 2VXSL 3R0NA 2AP2A 4EI5C 4RX4A 1MCIA 1D6EB 4GXUN 2UYLA 1IC1A 1T1WA 4L9DA 4PJGF 1GIGL 3ARPA 2IG2H 1M6OB 3MMEB 1MRFH 4BZ1H 4RQQA 1JYVA 2NY4D 4N0UA 4GAJH 4Q9RL 1J9CT 4WNQB 3J7HA 3BQUB 4JGUA 4JY6A 3MBEC 3TZVB 1MVUB 4OQTA 3U0WL 4PP1C 3KPOA 3L7FB 4TOYH 2LV4A 1M05A 3WO4B 3L95B 3BKCH 5IMLA 2W1NA 5TH2B 3Q0HA 3D25A 2D31A 4OKVA 1NKRA 3M17B 1KJ2H 1EHXA 5EU4A 3IDIA 5D7JB 2V9TA 3D1MC 4PJAA 1Q9OA 1A6AB 4RMWA 3TFKC 2P5WA 5GRUL 5KVDL 1KXQE 4WRLA 4X9HA 5HVHB 4P2OB 1NAKH 2EKSA 1ADQA 4CN1A 1MCRA 2FX7L 5SWZD 4K3HA 1JPFA 2VAAB 3JV6A 4FFVC 4HLJA 4H0GA 4R4ND 4G7VH 4C58B 7CGTA 4P2CG 2R1YA 1QSFA 2DBLL 4KQ3L 5SX5H 2CRZA 1Q0XH 3AREC 1NBQA 3MJ7B 2EC9T 5MHSD 3TNMA 1JGUL 4OCLC 4PRIA 3RVXD 4KROC 2H1PH 4LIQL 3L5XL 5D2NC 1NBZA 5F1KC 1OB1B 1OTTD 3C5ZA 4M3JA 1QTYT 5ADOH 1YEGL 3RGHA 1X4ZA 4QXWA 5BVPL 4LSPH 1BZ9A 4UQ3A 1PVHA 4LVNC 1AD0B 1ZANL 5JXEA 3MLTB 1JGDA 3OBAA 2VC2L 4KMTH 3ARED 3ZL4L 2Q6WB 5GISH 3HMXA 4PJAF 3DMMB 3ZE1E 4KK8D 3RGVD 4GAYA 5BVPH 5C8JA 1N26A 4ISVB 3MCLH 4J3SA 3HB3D 4X7DC 4UIMB 1KENH 3D3VD 3TCXA 1A14L 3UP1A 3O4LE 3TBWB 5F9WB 3O11B 1V7ML 1BX2A 3HMWL 5LG1A 5HYJD 3QEHB 2NY7L 2MOVA 4N8CL 4I0PB 1ZANH 2C26A 5DC9B 1I9JL 1P6AB 2YN5A 5BO1L 1IT9H 4I3SH 3PP4L 1XT5A 1G7PB 1LO4H 1KSRA 2FX9L 3WIFA 3MCKB 5JR1L 3OKYA 5IVNA 5C0ND 1XGPB 2EDJA 3MLSH 1E28A 5F7MC 3JWDH 2WBJD 1MLBB 4YDIH 4PGBA 3DURB 4RGNE 4HHAB 5DMGD 1EMTH 3OXSB 3EO1B 2OSLA 2FLRT 1R0AL 1P7HL 1CG9A 4CBPA 4N5ED 2PXYD 4P2RE 3HPJB 5SX4I 2BERA 5J9PB 5I17A 1CXLA 3VDAA 4YFLI 5EU6B 4U33A 1KJ3H 3QEQA 3MBEA 1LP9B 4J4PC 4NQSB 5IMOB 1NBVL 3HE6B 4KJYA 3FO9B 4TYUA 4CVWA 5JOPD 3UZEA 2XFXB 5IGXH 3IDGA 1CR9L 1S9WB 1U8KA 3ALWA 2VQUA 4NN7C 5EWIL 1ORQB 3TIEB 3ROOA 2HG5A 2X9XA 5IFJA 1PSKH 4DKDC 3ZLQC 1UM6L 1D5MA 4NQCA 2VLRD 4JVWA 1ZHNA 4GQ9H 1CFTB 2VLJB 3RUGB 2C7UB 1JI1A 3CSGA 4P48A 4QF1A 1SQ2N 5CP7A 4GRMB 1QBLL 4Y5VB 7FABL 1Q8MA 4WHCA 4PREA 3KPQB 4XZUB 1UB6B 2IEPA 3ZYOA 1WF5A 5F89A 3MJ9A 4MNHB 4TVPL 4IOFD 5JO5B 3AGVA 3H2WA 2CXKA 4LL9A 3HC3H 3OTTA 4YBQC 3C6LD 2V2XB 1WWAX 1HCVA 5I30H 1A6PA 2DL9A 4FTVE 4NZRH 1B0GB 1MFBH 1KJVA 5KVGL 1AGEB 3SHSA 3T0ED 2AJ3A 4Q6IB 2GT9A 3O6FD 4IIQB 3MJ7A 4ZPTB 3O3DA 4WWKA 2ARWA 4S10A 1Q9WB 1VESA 4Q58C 4YGAB 3RWEA 2JCCA 3VH8G 4HUWA 1J1OL 1N6UA 4Z95L 1Z9LA 1NFIB 5FA3B 5FO9B 2DKMA 5TE7L 5ID1B 3O2VH 4QOKA 5TE6L 3WLWC 2Z8SA 3G5VB 4J12A 1E4XL 2DQUL 5E7FA 5E0QA 3KWWB 2O26U 4QRUA 2GJ6D 4JGJA 2EE2A 4JFFE 1C5CH 3DRQA 4LSSL 5DZOA 4AQOA 5GSRA 1OAXL 4NO0B 1KB9J 1F8TL 3UBXI 1OP9A 1XMWA 1NLDH 1CU4L 1B0RA 1INQB 2QSTA 1LO2L 4DQOL 4PRNA 4U3XA 5F7LB 3FQRA 4MJIB 4GRWB 5GJTH 3CZJA 5INCB 1HOCB 3QNZA 4M6AA 5CEXB 3REVA 4Y2DD 3BVNA 4JZOB 5D2NA 5GJTL 5JXAL 1F6AB 4ZOBA 4FS0A 1RZJC 4QHNB 1FHGA 1NC2B 5C0BB 3WDIA 2VQTA 4XH2A 3CLFL 1SM3H 4F9LC 1IGJB 1XGQA 5DFVD 5DJXA 5CSBA 4FQCH 4KY1L 5HI4C 4UIKH 5C0CA 3DYPA 1NAMH 4HKJB 4ZUVA 2IALB 2L4OA 3TJHD 3FQWB 1P53A 5LKNA 3QG6A 3NTCH 1N0XL 1S7UB 5FO9A 3FB5A 3O3AB 4PBVC 3FFDA 4QRQA 1YNKL 4DTGL 4HIIB 3VFMB 1XIWD 3TBTA 1Y18A 3LV3B 3NCYS 4QHNA 3WFHB 4KHXH 1U8QB 2VYRE 1XGTB 1KBGL 3T0XA 5D2NB 4NT6A 4ODTL 3W9DB 1NSNL 5C0GA 3ALPA 3PG2A 2MKWA 3V7AE 2XN9B 4P46A 3HR5B 5TE4H 2ZG3A 1MFBL 2AJVL 3IAQA 1HXMA 3EDDA 2M2DA 1TXKA 4LPVA 1HCFX 2A6KB 4TSAL 4LQ1A 3EKCA 2LU3A 3MV9E 4Z7WE 3JZ7A 4IDJH 3CCHA 3S37L 3MJGX 4ZO7A 3U83A 5KSVB 1Z9MA 1BVLA 5DRZA 4U1IA 2R2HA 3P11L 4EQ3A 2XFXA 1G1CA 3CSPA 3QXUA 1MHHB 5EORL 2AI0L 2R2EA 4TOYL 4LASH 5K59E 2D7TH 5I1GH 5MEND 1FYHB 4LCCB 2ZWLT 1UJ3A 4RWHA 3QUZD 4QXGH 2BMKB 3WJJC 3MCKA 4U0RB 5IQ9A 1HINL 4TVPH 4WFHE 1OW0C 3SDAC 2VXVL 5JOPE 4FZ8H 1MFCH 2R1XB 3T2PA 3C9NB 3UPCA 5EC2A 5MEPB 5J6GA 3CMOH 2CSPA 2D0HA 5JMRA 2HLAB 5FA4A 4HQQL 3DJ9A 4RGMB 4KKCD 1LP9F 5DRWB 1PYWA 1CGWA 5GHWH 4IRSC 4FZEL 4NWTH 5E00A 1S7SB 5L0QC 1U8IA 5IW1A 1JNNL 4AEIL 1T20A 5C92A 4E41D 4HMCA 3NCYP 5HHME 1N5YH 1OOAA 4KVNH 1AD0A 2JJTA 4PLKD 2IWGA 4LLMB 1FYTA 2N56A 2F8XC 4HS8L 5CGMA 4DWHA 1PG7H 1EMTL 4E5XB 4LKXB 4NO3A 1RJCA 5L88L 2KQNA 3AU1A 1QSEA 3ULSA 1DBBH 4GW4A 4ALAL 4DN3H 2H26B 1T4KA 1ZT1B 3RWHB 5I17B 5C0DB 4LFHD 3MLTA 1A7QH 1FLRH 4YUEL 1FNGA 4RNRA 1QLRA 5I71B 2UVFA 4QEGA 3QNZB 1W0WA 2O5ZL 3IFNL 2VN7A 3UTQB 3B2UD 4CU8A 4G42A 1EO5A 4M7KL 2YC1B 3ZKXC 1YPZA 1HXYB 3VU2A 2OX5A 4HMDA 4W81A 4XMPL 3PGFH 4XH2B 3DHMA 4CVUA 4HXAL 3HKFA 1U8NB 3QT2A 5CUSH 4MMZC 4HV8B 5C7XL 3TZVD 5IM7B 3ARFB 4PY7A 4G8FA 4TULL 1FZJA 1A6ZB 3ESUF 2HA1A 3S37X 3TP4A 1OAUL 3CK0L 1I1RA 1YY8B 3C5SB 1KGCD 5LCVL 3HFMH 5T1DH 3O6ML 3LKPA 4G7VL 4LVNB 4JY4A 3ROLA 1J0ZA 4PRNB 3OF6D 4F58H 4HUWB 1Q9LA 3MLUH 1UXSB 3QPXH 5I2IA 2CMRH 3VFRB 3TYGH 3WFBL 4PJ9D 4Z76B 4BA8A 4OFYA 5M7QA 4I0KA 3O6MH 3BKMH 4D0CB 3U6RA 2DQDH 2OR8A 5D7IF 5I8KL 4QTIH 1BQHG 1UB5A 5DUBA 2YOCA 3NIFE 2YC1A 4Z7QE 4NQTA 3MXWL 4RZCA 1A9BB 3KPMB 3QPQC 4MCYB 4K71B 2YKLH 1DQQB 4PLKC 3TBYA 1UB6A 4X6CB 4WU5A 1V5JA 1OW0A 3WJLC 1OGAA 2OCFD 2F53A 5HHOD 1NCDL 1JUFA 4K8RH 1O5DT 3VGGA 1NCBL 2IBGA 4PGEB 5ISZA 1OARH 1NGZB 2P8MA 4P4KB 1WEJH 2HTKD 3TIEA 5AZEL 4M1CC 4MLIA 4HKBB 1KEGH 1IAIL 4LPTA 3LB6D 3VFTA 1P84J 2WM0A 4NKQB 1GC1H 5F89B 2OBGA 3BDXA 3GI9L 3DXAA 2E5EA 4R9HA 4JLRB 1MRDL 1J10A 5IR1A 3TNNA 1E6OH 2VDRH 5KS9A 5E9DD 4RFNC 3UTSB 3VWJB 3MRIB 4DFIA 1GIGH 4AL8L 1T89A 3SKJH 4ETYA 5HPMA 4L8CB 1F4HA 1V7NH 3D39B 3ULUH 1N5AA 1Q9LB 2CGRH 4LHUG 1S9XA 4JANA 2FEDC 3DX7B 2LFGA 3OGCA 4PG2C 4LP5A 1U8HB 2V5MA 2BNQE 4LSSH 4PJGE 2VQ1A 3B6SA 4ZODA 1AE6H 3BAEH 4ZXBD 4KDVA 1ZMYA 1B88A 1NL0H 2NQCA 3T0DA 5J9PA 4DEPC 5FYLL 1CD1A 2VDNH 3BD3A 3DECA 3IXAB 3OKKB 1I1FA 1R5VB 4OIIH 5B3JE 4ZFZB 2FJFA 1RQ5A 2AABH 4MB3A 4YH6A 3QRGH 4KJWC 2D7MA 2GJJA 4FQ2H 3X3FL 5J11C 2Y6SC 3KLHC 4MD5A 4MAYB 3N1PC 2EDDA 1DUYA 4DCQB 2CUHA 1LO5B 1EUTA 1XGPA 4N9OB 5FHBH 2E7CA 3PNWB 3MLVL 2KL6A 1VFBB 5CIPB 3WXVH 3L9RB 1MWAB 1LEIB 5AAWA 4OFVA 4QGTA 2C1OB 5DVOA 3GBML 4AIXA 1NGXB 4RFEB 2X70B 4XC1L 4FG6D 1M71B 5C3TA 2AI0H 5D2LA 1YY9D 4NOFA 4HF5H 4NKOA 2PO6A 1GPOH 3BP4B 4Q9QL 4JJ5A 3DWTA 3SDDA 3VGHA 1T5XA 4YZFE 3DMMD 3O41A 4WUKL 4X4XB 2FX7H 3IJSA 4OCNC 5C70A 4PY7B 3L3JA 5I1HL 3W0WD 1WAAE 5IGXL 1I1YA 1ZHLB 1CDCA 3SDXE 3I50L 4ODVL 1BGXL 3K4DA 2YA0A 2F54B 5ENWB 2W9EH 3O2WH 4ODXB 1DANU 3X17A 5LCVH 1AP2A 4M61A 3I6GA 5HYJB 1RK0A 3FN0H 1Q72L 2PTUA 4WY7L 3UROR 4G6ML 5TDNA 4YPGB 2P5WD 5DJDA 3F7VB 3GHEL 2EH7L 3BIKA 4NHUB 3IJHB 1GGCL 4K23L 2FECL 3CVHH 2Q8AL 4NZDA 2ARJA 5FM5M 5LWYH 1AXTL 3L5JA 1WSST 4X5WA 3FO1B 2HVKA 1U0QA 4L1DA 5TQ0L 2BOCA 1C5BH 2G9HA 2F5BL 3MA7B 3LH2L 3QUZC 1KPUA 2FX8H 1M05B 4NN6B 2OL3A 4GBXC 3OJMB 3KLAA 5C0AA 1KCUL 5ADPH 1IGCL 2EKSB 2APWA 2DM2A 4ZS6C 2BVPA 1G7HA 4PRIE 2PXYB 2W91A 2ZOKB 3RIFK 1H5BC 3S36L 4B7IA 3ZKXB 1F58L 5HHQB 5KZCD 4D94A 1E4XI 4DVRL 1SY6A 1FZJB 2NY7H 4GW1A 2X4QB 1SJHA 3SQOL 2C3WA 3SDAD 3TESA 4LF3B 3M1BA 3MLWH 1T3FA 3D87B 4LVEA 1G1YA 1JZ4A 3JWOH 3QZWA 5AZ2L 4NPYA 1QNZH 3S35H 2EDOA 5IQ7H 3U7YH 3OQ3B 1NMBH 1ITBB 5D5ME 4HWBH 4JPWL 5EU6E 5KS9E 4A6YL 2VIRA 1G84A 2H41A 4QTHB 2J88H 1X6NA 4YDKL 4OD3L 4JDTL 5F9WC 2N1KA 4Z7VE 3REWB 1D5BB 5D7LD 3GB7A 3QIUC 4TVSa 3LZFH 4PRBB 3N0PB 5GS1A 1JRHI 3VGAB 3X12B 4XVTL 4KUZH 5DTFA 3WL9B 2VZ1A 4YDJA 1JMZA 3NCEB 2ICWJ 1SYSA 1Q94B 4Y16A 1OAZL 3VDCA 2IF7A 5E6IB 5CHNA 1BLNB 1TNMA 5E7BA 4OLYH 4RISL 5JHDE 4ZNEE 4NJ9H 2AVGA 3U1SH 3Q6FA 2PYFB 2UUDH 5F7EH 1YN6B 4XRCA 3Q1SH 2EDXA 2Z35B 4C56A 3QHFL 4WDIA 1J12A 3MV9D 4YE4H 3WXWH 4FQQA 1ZLWH 2YPVL 3QXAB 1F4YH 2FIRT 4E41A 1CXEA 1A1OA 1EFQA 1BF8A 3BP4A 35C8L 2HT4C 4S1SL 2YD3A 3FRUA 4PJCA 1JZ6A 3D85B 3W82A 4KJWD 2V9QA 4OLEA 1BLNA 4PJEB 5D2LE 4YR6A 1A14H 4MJID 5C9JA 1SYSB 3TN0C 4R0LB 1HYRC 2FX8L 1J1XL 1ACYH 4X99A 3U82B 1V3MA 1C5BL 2BSED 2ZNXA 3ZT7A 3D0LA 3MRPB 5IW3A 1XR8B 3P3YA 4F3FB 3C8KB 2JTDA 3GSVB 2AK4D 1P69B 5GHWL 4D8PB 3VFGH 1MIEH 2H32H 2RGSA 3TH4T 1U3JA 4HGMA 4CMHB 4OF7A 1VHPA 3T77A 4EDWL 4PD4K 3DV4B 3HE6D 3A6OA 3EFDH 3KPSA 3ZKMD 3BPLB 1E6JH 4JDVB 4PJEA 3PV6A 3BZDA 2EH7H 3GHEH 3ARYA 5D6DA 2LTQC 1BBDL 1BQHB 1FPTH 2RR3A 1IAOB 3OG4B 3TH3T 2WIIB 1BOYA 5EG6C 4E41B 3KR3L 3BN9C 5HDLA 2ZG2A 2BY1A 3EYUH 3I50H 5GS0H 2RCSH 2V7HB 3G6JB 4P4RB 1DVFA 4ZS6D 3U4AA 3GKWL 4NRYA 4G8IA 2EIZA 3MLZL 1A7NH 1SY6L 1ZLUK 1R3IH 5EA0H 2NXZD 1V3LA 2D7TL 5I1GL 2FD6L 4J1UA 1ULVA 4YHKH 4M7LH 3I02B 5IOPA 4K3DH 4ZQKB 2CIIB 2KPNA 2IADA 1NAMA 2XTJB 2NTFB 1UYWL 1CI5A 4KAQH 8FABA 5FUOH 4PUBL 3WIHL 5I1DA 4HDIA 1JHKL 4XC3H 5DHXB 2ZOLB 5IEHB 5GGVH 5HI5D 2AJVH 3PL6C 1IM3B 4IOFC 4P57A 5GS0D 3U7WL 1R24A 4KFZC 4P5KA 3VD4A 1F02I 3REWA 5FYKD 1C16A 4JG1H 2FEEI 1U3HB 1UCBH 3LEYH 4PGEA 2NY3D 3MRCA 5HGBB 4MNGE 4CU6A 5IBUB 5DHVH 5FV2A 2ARJB 3HPLB 3HG1A 4DZBA 1CG9B 4XP1L 3REVB 1JPGA 4MJ5A 5DRNA 4KRPB 4NSKB 3SJVE 5CZVL 1JPFB 3DTXA 2AEIT 4EEEA 2PR4L 5DK2A 1VKXA 3UTSE 4JFHE 2DWDA 2C3HA 5KANG 3CXDH 4P2OA 4WTWA 3AUVA 4WV1C 1RU9L 1I9RH 3CFJB 1B6DA 1E28B 2X89A 1FFPB 2V5TA 4M8VA 5IVZA 5C09A 4QF1B 2IFGA 2YD9A 1FO0B 2VOTA 5BRZE 3JV0A 4MHHI 3U6RB 3HUJF 4XWGL 1FVCB 4GT7A 1QQDB 4KK5D 4EZMA 3NGBB 4G6FD 4GSDL 5BOZG 1TVHB 3VRLF 4LGRB 3VCLB 3LQZB 2WUBL 3BP7B 2VUOA 3FB6A 2GTZB 4XWGH 3P4NA 5E8EA 4V1DD 3PQYD 4LQFH 1ZVSB 3RL1B 3QEQB 5IG7B 4ZUSA 1FGNL 5C09E 3BESR 1I9RL 3BGAA 2LU7A 3QUXC 1ZEAH 3ARGC 5JW4R 4MXVF 4MXWL 4MQXC 1DEDA 3P9WB 1KPUB 3JSSA 3RWIA 4CJ0A 4AIOA 4KI5C 1G0YR 2NNAA 1YN7A 4IMLA 5LBSH 1MH5A 4K3DL 3A0OA 4CKVX 2AJYL 2VZUA 3T3MF 3KXFD 1FFOB 3UZVB 1OAXH 5MEOA 1KULA 1HWGB 1DQLL 1ZOXA 5KVMC 5DT1L 3K80A 2EDRA 4XPHL 3MXWH 2A83A 1JHLL 1P7KA 2EYSA 4JFED 1DBJL 3O3EA 2VDPH 2PKDA 5ICZB 1HK6A 2BNUB 1KGCE 3P11H 3GNML 4XCFL 3UJIL 5EU5A 2KUTA 3KYKH 2ADGA 3FN0L 1IEHA 1K3ZA 5DVMA 1DUZB 4F7CB 4TPRH 5BO1H 2VWEC 3BKYL 3GMNA 1MEXL 3E8UH 5GGUB 1S7TA 2VWEE 5I8EA 1R3JB 5IK3B 3KYOB 4W68A 5IMMB 1U8PB 4X6BA 3IU3B 2M26A 1WJ3A 2YBRA 3LD8C 5IVXB 3BFOA 2NY6C 3MNZB 1RK1A 1MH5B 3QZWG 1RUQH 1ZHKA 5FO8B 2DLIA 1JPSL 2OP4L 2H3NB 2AV7B 4GKZB 1JHTA 4WEBL 1FNFA 5B38B 5AYUH 2X4OB 1SEBB 2I07A 4OF8A 4U6YB 1OHQA 4OTXH 2BP3A 5HHMB 4XI5D 3BEVB 1I8KA 4FQ1L 2IBBA 1KIRB 2VN4A 3B9VA 3MOAL 5F8QC 5IP4A 1RIVL 4YDVB 4E9LA 1AHWA 1IQDA 3QCUL 1KJ2A 3PDOA 1TCMA 3SCMA 5I16B 1ZLUH 4NZJA 4ZAKB 1DTUA 4ONOA 3F7RA 4NZUH 4RGNC 4LEXL 3IRZA 1I1AD 3WFEH 2FH6A 4GG6F 1QLRB 3SDCB 1JCKA 4G6AD 1UWGH 3HPLA 4JQIH 1JYNA 2FR4A 4LOUC 4HS6B 2ZJSH 2YA2A 5HHVL 2DQCH 2HKHL 4S1QH 3QFJE 1JK8A 3L3IA 4WCYH 3FB6B 4FZEH 1RJZB 3BHBA 1KPVB 3T2NH 3NVQA 1UWEL 4WFGE 2WWMC 32C2A 2A77L 4WVRA 4LEOB 5B4MD 3U4EB 4HQQH 3QFDB 2BSTB 1JRHL 5DFVC 4P46C 1FBIH 1U92A 4EUPG 1ZTXH 4UT6H 5LQBH 2DF3A 3LPGA 2VR4A 4Z0BL 3BJLA 2L0DA 1YQ2A 4J1UB 4UAOC 1E4XH 3AVEA 4FQXD 1BFTA 4WGVB 5T1MB 3QXDA 1T5WB 4LK4A 2RB8A 1A3RL 1QFWL 1QSVA 5FA4B 3IXTA 4NCC1 3ZE1F 1JF5A 5GIRA 1TQBC 1S8DB 3RFZC 2VR9A 1A4JA 4NUJA 4QRPD 2FATL 4PPTA 3D9AH 3BKYH 4QXGL 3V6OE 5KVFH 5DJXB 4B53A 4NRZA 2LE9A 3AS3A 1IGJA 1TVDA 2Y23A 4OF0A 3TLRA 2BNQB 5AZ2H 4KV5F 4BH7A 3L6FA 3EFFA 5IEHA 1JGEB 3PWUB 4LAQL 3VXMD 4PY8I 1RUQL 3E3QE 2X6MA 1IBGH 1FDLL 4WIQA 2R69L 5HXMA 4CN6A 1FL6B 4IOSD 4M48H 4YX2H 3QAZB 2ICWI 2DI7A 3UJTH 4MNQB 25C8L 4QWWD 5CEZL 4DGVH 3SO5A 4R26L 5FB8A 3P77A 2ADJA 4FQIL 3FT4A 2F74B 4PJ8B 3L3OA 3DXAE 2UZXB 4HUXB 2H2PD 2HWZH 2P7TB 3BDYH 3DO3A 1AI1H 4UU9A 5EZIH 1T7WA 4YHOL 1EVUA 1GHFH 4H8WH 3T0EC 4ETQB 4J3TA 4DW2L 3L7EB 2IJ0C 4HC1H 4U1HB 5DVLA 4D9QD 2WV3A 3KPRD 5D7LB 4DK6A 4DKAA 1M7DA 4P5TA 2J6EH 4OGXH 3ARUA 5EULV 5C0GB 2AXHA 1IKFL 4ZXBA 1ZEAL 4XCYA 3KYNA 4NT6B 3WFEL 3OX8B 3CVIL 4L8DA 4PJ5D 4WWKD 5C3LD 3P9MB 2OTUA 1BJ8A 4KJQC 1RV6X 2WWKO 1HHGA 3MUHL 5JW5B 4F8QA 1MI5A 4X9IA 3MV8B 3QUXD 1U9KA 1XF1A 2ERJC 1YJDL 4QRSA 1LMKA 2O5ZH 4GUPA 1DFBH 5D96C 4F7PA 1CE6A 1SM3L 2H6PA 2YD7A 4S1QL 5GGSA 4YC2B 3WEXB 5E9DB 4U1IB 4MA1C 1QBML 5ILTL 1FRGH 3UTZB 1P7QA 1CE1H 4FFYL 3H3BC 3KJ4B 3VXSB 4BFGA 3H9SD 3WS3A 1R5IA 4Y5VA 5KSBF 4AH2B 4MJ2A 1CCZA 1ZHNB 5T3XE 4FXGB 5I0DA 1A1OB 3ULVD 12E8H 5FECB 2A0LC 1FORL 3FT4B 3U1SL 1NJ9A 4JFZL 1B6UA 1NLDL 4XPBH 4KC3B 2J4WH 3JUZA 4POZD 1U42A 1F4WL 5FV1L 3MNVB 4ZFOA 4FQPA 2CXGA 3W5MA 1FVEB 3IDMB 1JNNH 4Y2DA 3BYYA 4XAWH 1NGPL 1KT2B 5D93B 2DLFH 2R0KL 2DB8A 3VJ6B 5KAQG 1JNJA 1PG7W 4KAQL 4WW1B 3VXUE 1PBYA 2O5XL 1S7UA 5BJTA 4K9EC 2YUWA 4LLWB 1JF1A 3DI3B 4D8PA 1JF6A 1F97A 4B7LA 3TIDB 1B0WA 5DEZA 4JQXA 1DDHA 2KKQA 2DIBA 1Q0YH 1JL8A 2E9IA 2CLRA 1SY6H 3S36X 3CFKA 3GKWH 5JHDD 2R4SL 1KJ2B 3S96A 1CGUA 1CZ8L 1MCOH 5MENE 3C5ZD 3CNKA 4IRSD 4Y7MA 4JFDD 4G43A 4RMUA 2VZOA 1KT2A 3WUWB 2XNAB 4NN5C 1JN6B 2WUCH 3SKUD 4YXKL 1QBLH 3G5ZB 1ZHLA 2ZUQB 4OZGE 5E1HB 3BZFA 4R96B 1V05A 3AREA 4NZTL 3PABB 4XCNB 5J7CC 2XTJD 5AUMB 5F1IA 4U7KA 4YPGA 2PYFA 4RMVA 2Z8WC 4BKLA 1S9VB 4OT1L 4PJXE 3H9HB 1YQVH 1TTGA 3E6FA 1ZGLM 3FTGA 4DGIH 1AKJA 5F7KC 4ODHL 3B9KD 3NN8A 1RIHH 1MAMH 5JXEC 1YEEH 1W8OA 1G7HB 4HX1B 5KVEH 5L7XH 1TIUA 3D2UA 1KBGH 4M1DH 1NEZA 4F58L 3D3VE 1VFAB 5EU5B 2A1WH 1CLOH 1MFAH 1L7IH 1NBZB 1WGOA 1AIFA 3KXFA 5C07E 2XY2A 4NZUL 3CVHL 4XB8A 5C0EA 2BSTA 4R7NB 3QEUB 1IE5A 1G9MC 2B1HL 2ICEA 3VWJC 1I3GH 1SYVA 3S5LA 3D39E 1TPXB 1J88A 2NY6B 3U0TB 4APQA 5EO9B 5D1ZD 4GS7C 3FOLB 4J4PD 4UV4H 4MGXA 3QEQD 4HJJL 3MRNA 1RU9H 4YNYB 4P9HC 2VLLB 3JBG7 1DQDH 2UV3A 4GH7B 3QIBB 1HH6B 1QLEL 4PD4J 3OR6B 1WIUA 1OP3H 3QQNA 5F7DA 4K7PL 1GOFA 1OTSC 2QQKH 3WE6B 5ALCH 5DEFB 3T2OA 4DQOH 1PX3A 4KK6D 1RFDL 1RVFH 2WBJC 3RY5A 2VUYA 1CICA 1WBXB 3I9GH 1LVEA 4LSPL 5EA0L 1QSED 2CIKA 2B39A 4U6TA 3MLVH 3RGVC 4N68A 4K94C 2YD5A 3STZB 4OSUH 3DYOA 3LEXA 3VE0A 1AGBB 3LS5L 1GJIA 3UEZA 5C0FB 4X6DF 3HI5L 2HAZA 4KI1A 3L1OL 1LO5A 3JWOL 4J3OC 1NEUA 4OIAA 4AEIH 4OD3H 5GRWA 1WBYB 1A9EA 1KXVC 3LQMA 4WTXA 4JHZA 1M7IA 5HY9A 2M8XA 4KUCF 4Y5VC 4M7JH 2DWEB 2UUDK 5BW7C 4M1DL 4ZFZA 1L0XA 4TSBL 1ZHKB 4HS8H 3RZCB 5DJCB 3EYFA 1ZA6A 3VWKC 4OF5A 5CP7B 5EU3A 2Z93B 3UJTL 3FT2B 1LDSA 1FGVL 4P9HL 2HKFH 2J5LC 4GW5B 1EVTC 3F7PC 1NKOA 3E3QC 1QFWH 4V1DE 4X83A 2MJWA 3NFNA 4OF6A 3RZWA 1YEDB 3ES6B 2HP4A 1MSPA 3V0VB 1MCKA 4G6JH 5IFHH 3T0BA 4RZCB 1EERB 3H3KA 4PLNC 5HYQA 4LLMA 3QNXB 4DVRH 3PP3H 5HHXH 1UM6H 5LWYL 3U0WH 3WE6A 4NC1C 4HFWB 1G0DA 4FXKA 3RWJB 3KYOA 3M07A 3D6GA 5IMMA 1WWCA 3GRWH 3EYVA 3GFUA 3ARDA 3HZMB 4O2FA 1NLBL 1BQSA 5IW6A 1IVLA 1UEMA 4HV8A 1QFUH 1YMMB 3PWNA 3LH2H 3SJVB 1R3HB 2FHFA 5A2IH 1MLBA 5ELIA 3KPOB 3L7FA 1ND0B 1KCKA 1T1YB 2HKFL 4J3WA 4RX4D 5DD3H 4AMKH 5I8OL 2HT4D 3BUTA 2IFFL 3HZKB 1IAKA 1HXYA 3NZ8A 4LPCA 5KJRH 5E03A 1AY1L 4EJ1C 2W92A 5JQ6H 4L3CB 5D5MA 4QHLB 4ZAKD 2EC8A 4NM4H 4XNMB 4CN4A 3VD3A 4YC2C 3RTQB 1HHIA 4BJLA 5C86A 2A9ML 4PJFA 1U2HA 3SDCD 3HS0B 4Z7VA 5J13C 2VSCA 4NBYB 5T3XD 3EYQD 3L1OH 3BKML 4KPHH 3S4SG 3IU4L 3UTOA 1XIWA 1JI2A 2GUOB 2E7MA 4RFNB 3NABL 1XF4B 4U6HB 3SJVA 3IB4A 4OI7A 1HIML 1FNLA 4XNXH 1CVSC 4JAMB 2K1MA 3QIBA 4Z76A 3TVMC 2XT1B 5DVKA 4LEXH 4R0LA 4CVZB 2DQIL 2APBA 4EQ2A 5E1AB 3CK0H 3ARWA 1QFOA 5IW1B 1GGBL 4HK0A 3LHPL 1ED3A 4LCYB 4OV6F 2P43B 3H9YA 4PGCB 1J8HA 2DQFB 5I1AA 4FFYH 2FD6H 4C56E 4NKDA 4FQXB 4OZFA 1HIMH 1I85A 1Z5LA 4CDHA 3RNQB 3NZHH 2N4IA 4UUJB 3WDHA 1WCBB 1TJGH 4WJ5B 1S9YA 1FVCA 3Q2CA 1I75A 3DBXB 3FL7A 4M8QA 1ZVYA 3FB8B 4XBEL 3SBWA 3V4PL 1DANT 5JORA 1C16B 3FQXA 3A6BH 4X7SH 5EIQA 1C7SA 5ESVA 5C0BE 5IQ7L 4G43B 1YEIH 2CRMA 2VLKD 4ZOCA 3RZCA 1I7TB 1VERA 4NQXA 3KPSB 4OB5H 3RRQA 4HPYL 3TT1L 2X40A 3QI9B 3TV3L 2BNQD 4QKXB 3UJIH 5HY9B 1SBSH 3BMWA 4HX1A 2X05A 4N1EA 2B4CH 1EAPA 1YC7A 3QEQE 2BSRB 5JLZA 1XR8A 3T3PE 4U1JB 2NLJB 4O02H 1L7IL 5DRZB 4TNWF 2D31B 4OKVB 1T1ZB 3M8OL 2BY3A 2XTLA 5HGDA 3B83A 5CMAA 3PL6B 5A1AA 5CKAA 5I18L 5DGQA 4NN5B 4RAVA 4KWUA 3WO3B 4M6NL 1MJJA 3IKKA 5IQ9B 5E56A 1CICC 3GRWL 5CJQL 3H9SA 1EFXA 4HUUA 3NFPB 5DS8A 1ZVSA 3RL1A 5B3JF 1IAOA 2CIIA 3QIWD 3NMEA 3T09A 1U8MB 4AEFA 3WUWA 1FIGL 4OZHE 2NR6D 3C8HA 4ZFOL 3TO2B 1QD0A 2EIZB 1WZ1H 4PJHA 4YE4L 3WXWL 5F44A 1IZJA 4FFVD 2QL1A 4NZTH 5DZLA 4HF5L 4ESKA 3LN4A 2X4PB 1DDHB 1L7TL 3V6ZA 3V5DB 3V9FA 3QCVL 4F57H 2R2CA 3DMMC 1XF2B 1AGCA 3A6CL 1PW3A 2E8YA 3WHE0 1IM9A 3LKNB 2X1PA 1HWHB 3NH7H 1UM4H 4H25A 3HC3L 4YQXL 5CSZA 5EUOF 3LVEA 3PL6A 1CL7L 2XKUA 1H3XA 5MI0C 4LOUD 2P5WE 3GSVA 1WVZA 3HI1B 5C0AD 3AU1B 4QRPB 3SDXF 3N85L 1CFSA 3FO0L 3L3HA 3VXNA 5GGRB 4FNLH 2EXWD 2O5YL 3QIBC 3FB7B 2BVYA 4X4YB 4L3ED 3SE4A 4BSVB 1U8LB 3KAAA 2G2RA 4C4KT 4XMPH 4M1GL 5F7YC 5FYLH 2B0SH 3IGAB 1TZHB 3V4UH 3BAEL 3AM8A 1MVFA 1UQSB 4KPHL 5B8CA 5CBAA 4UQ2B 1A6WL 4TULH 3DBXA 1DVFB 5FGSA 2JLLA 1UWGL 5BS0D 1I85C 2WW8A 5FB8B 2ADFH 3MLWL 4KGJA 3VXUD 3V6FA 1UH2A 4PJ9A 4DOHB 4PJDE 5EU7C 2EO9A 1BM3L 5EU7E 4C59B 4POYA 2P4AB 4LSVH 2M1KA 3GIZL 5HGAB 5BXFB 1IL1A 1V7MH 1NCWH 1YYMH 3WNPA 1BP3B 4MA7L 3RL2A 4YUEH 4HIHA 4ODSL 1WFUA 1I1AB 5JDJA 3UPAA 2B2XL 3FOMA 1DQML 2CLRB 1NLBH 2ATKA 1IT9L 2GT9B 3MBXL 3BPOB 5HHOA 4BQBA 4XBEH 1MFAL 1H3UA 1MFDH 3VXPB 4IRJB 1S7QA 2DYPB 2NY2C 2WSKA 1Y0LA 3GSNB 1YDPB 1F3RB 1NC2A 5C0BA 3QUXB 3HS0A 4FFWC 3OB0K 2WLZA 5E2UL 4U1NA 4W6YB 2ATPA 5EIIB 4K9EL 2VIRB 3OZ9L 4PREB 1L9MA 1MAML 2MQ0A 3MRDA 3F7QA 2NY2D 5A2LH 5GGTH 2IGFL 1AI1L 3HR5A 2DDQH 1GHFL 2VXUL 3VXQB 4N1CA 1A1NB 3H9SB 3HZKA 3NZ8B 4DZ8B 3KPNB 4KTEL 3MLYH 4WUUD 4JZJA 5DJ6A 4M93C 1OCWL 2V7NA 4Y4KB 4MJ4A 3RY4A 4FTVA 3LS4L 1NEZG 1T0NB 2ILLA 3FKUS 4OFDA 5E5UB 2WBWB 3ARVA 3G6DH 4MNQE 4NQVB 4P3DB 5GPRA 5LAXA 4UTBH 3MC0A 2EDFA 2R29L 4U7MA 5IB4A 4EDXB 2RQ8A 4G6KL 2X4UB 2GAZA 3WL9A 4MX7A 2RIKA 4KXZH 2BZDA 5F7EL 3BGFC 3QDGD 1UA6H 1LK2A 4Y5YB 3MGOB 2BY2A 2NY0B 1XGQB 4V2BA 4Y4KC 5IJKC 4JHAL 4J6RH 4KRMB 1HSAA 4O2CB 4U6VL 4PRIB 4LASL 3WNNA 1YJDC 2Y5TA 3IS0X 3CDGA 4XWOD 4XXDB 5FCUL 3FB8A 5JORB 2LVEA 1S9YB 4GMTH 5IROC 2GCYB 4PJBF 5ALCL 1KJ2L 1PZ5B 1WIOA 4R4FH 1FG9C 1MI5D 1GCFA 4OCYH 1AGCB 4N0CC 5EOTA 2YUXA 4QCIA 3D18A 3AXLB 4KDTA 2VQ1B 1VCAA 1RULH 2BJML 2VDQH 4OLYL 4RISH 4PJEF 3U46B 4KK9C 4GRMA 2W0LA 3SGKA 5IWLC 5FUZL 1IC4H 1CL7I 1W0YT 1MNUL 2CDEB 5HGGS 1FVDB 4Z7OF 4GAFB 4YEEA 4U7SA 4OI9A 3DMMA 4XP4L 2JK5B 3FT3A 4LLQB 3VXSE 1P1ZB 2QADC 2VLKE 3CLFH 4XHJC 3KWWA 5IK3A 4I0PA 3GMRA 2GIYA 5J57B 1S7TB 5I8EB 2I60H 1FCCA 3B3IB 1D5XB 3UMTA 3UYOD 3ARGB 5GGSY 1A1MA 3RWDB 1WK0A 1MFDL 4X6CE 1FL5B 4Y8AA 5E2TH 4LGSB 5DQDH 4HWBL 4JN2A 3MV7A 4UIKL 4ELKA 1MF2H 5TPWH 4E42B 4QHMB 3N9GH 3LN5A 2YUVA 4P2RD 4PRPB 1T80A 3BWAA 1DQQA 3TBYB 4K8RL 3T4YA 5GZND 4L8CA 5T3XL 2H3NA 1AO7E 3TBSB 1FNAA 1LDPH 2DQEL 3P0YL 4FFZH 4U3HA 1JHKH 3MV7E 4KKLC 4XC3L 4K3JH 5AAMA 4EI5B 2NZ9D 5LGHL 3IS1X 1CQYA 3OKEA 3PWJB 4PRAA 3VA6A 1B4RA 4P23C 5C0EB 1FAIL 2MCPH 2IPTH 1WCBA 4MAYC 1FL5A 2YRLA 3ZMRA 3QUML 1IGML 3OJ2C 1F8TH 4OJFH 2VXTL 2FHCA 2Y4SA 2ADIB 5K9QI 1FNSH 4PP2B 4LVOC 3UAJD 4H1LB 3MLZH 4HKXB 4TNWK 3DHJA 8FABB 4U1LB 2P8PB 4OZ4B 2XV6B 1PKQA 3TN0A 1XFPA 1EA9C 3FN9A 4PS4H 2X1XR 5ABDE 1W2KT 2Q6WA 4UNTA 4U6VH 5K9JH 1DBKL 4LLUB 2CR3A 4KTDH 1YEHL 4LRNL 4EIGB 3TBSA 5J12B 1HH6A 4LAJH 4HEPG 3KPMA 5E5RB 1PYWB 2MMXA 1JPTL 4IHOA 2VXTH 3BE1L 2HJLA 2GUOA 4GG8B 3MV11 4RBPK 4HULB 4KTDL 1I7ZB 4YHNB 4GBXA 5KVGH 2OR7A 4X9BA 4NDMA 3I2CH 2E7BA 4X8JB 3T2QA 4WNQA 3U9PH 1DQLH 2J8UE 3BISA 4LSQH 1UXSA 4U0QB 1SMOA 2GJ6E 3QR2A 5FHBL 4ZTOH 1H8OA 1DLHA 5FGBA 1G6RA 4JRWA 4L4VD 2Y06L 5SX4H 2BDNH 3FMGL 4XMLH 4HKXA 1XH3B 3BN3B 1KXTB 5D7SH 3MRJB 2FNBA 1A6AA 2VRAA 4JFEE 3TJHC 1FYTE 1P6FA 5HYFA 2J8UA 5GZOC 3SE3A 3MRIA 4X6DE 2HFFB 2JCCE 4YK4B 3OJDB 5FXCH 1KN2H 1QVOA 5L88H 2E7LA 4GXVH 3T3ME 2BFVH 4PJGA 1IC7L 3OAYK 4QOKE 4HIEA 2YD4A 1NAML 3BH9B 4G8GE 3O4OC 3TN0B 2PYED 3HLAA 1BIIA 5HHVH 3EGSB 2V17L 1QACA 5JHLL 4LKCA 4JFYA 4G3YL 4G42B 4G8IB 1HHJA 1XF3B 4EVNA 4XPFL 3T4AA 4N0YH 1ZLSH 3RVUD 5D72H 2ED8A 4M7JL 2EZ0C 3BD4A 3TC9A 5EC2B 2PW1A 5DQ9B 1U8NA 2FJGA 4FABH 3A67L 4LHUD 2Y07L 2ZSVA 2Q8BH 3O3EB 1F2QA 2APFA 4O58L 1TZHA 3MGOA 2OJZL 4PJHF 2OK0L 3G5XA 1A7PH 4I18C 1QFUL 5GS0C 2JIXA 3MOAH 1IILE 1AQKL 5KSBB 3PL6D 3L3KA 4G9FE 4KKAC 2X4UA 1GXEA 4JFXA 4PRPA 5K9OA 3MCG1 5E9DA 1LO3L 4NHCL 4HPOL 3Q48A 3Q6GL 4X4ME 4JPWH 5J56B 2X2YA 1SJXA 5JOEA 3M17A 3RWCB 3D69A 1EPFA 4PUBH 1ORSA 1CFQA 3KG5A 2OL3H 1HHKA 3EYOB 2CIKB 3MLPA 3E1F1 5A16B 2X7LB 4HH8A 1FG2B 3HC4L 2UZIH 3STLA 2J8HA 5I9QC 1ZVHA 3LKSA 2EDQA 3SQOH 2Y06H 3ARBA 4IBLT 2XTJC 5I8KH 3BI9X 2P8LB 1OTTC 3BX7C 4TQEH 4QCIB 1BQHA 3VXME 2QSQA 4U49A 4ODWB 4X4ZA 3W9EA 3I3EA 4Y8DC 2DAVA 5D8JH 5FECA 3VXUA 3GSQB 4P59L 2R0LH 1NAKL 1CDIA 4PJXA 1HDMA 3UX9B 5K9KB 2DYPA 5E8DL 5I1KL 3CLEH 5GS3A 5D9SA 1CFBA 3HZVB 1Q0XL 1F4AA 2G2RB 3RP1A 3GK8H 3PWPD 3VI3E 4JPIA 5IV2B 4JE4B 3K2UL 1T03L 4EDWH 3WS6A 5BJTB 1KLGB 4EDXA 3QNYB 5TJWK 4PRHB 2OL3B 3AY4C 4I5BA 1BBJA 3PDGA 3AS2A 5CAYB 4PRBA 5D1XA 2XRAL 2XA3A 3V79C 1NCCH 4ERSL 1KTDA 1TZGL 3W11D 3CLEL 3S3SA 1J1XH 4PJIE 4PJ9B 4LLVB 3QXAA 1RMFL 2YRZA 1KEML 2DTSA 5JZ7D 5JW4N 4DZ8A 2BVQB 1U3HC 1HILA 2VLRE 4K94H 1X7QB 1I4FB 1TNNA 3SJVD 3RPIA 3FFCB 2AKRB 2Y6SD 3QULB 4HIIA 1K2DA 4JVPA 1BD2B 1DE4A 3MOQA 3WS3B 3IYLW 2YPVH 1UEYA 4MSWA 5E00B 3VFSB 3NIGE 2DQHH 2YPLB 3MBXH 4O2EB 1FE8L 4CNIB 2CLZA 4WU7A 5F1IB 4FTVD 1OY3B 3EUUA 3RKPA 2ORBL 3LD8B 4Q0XL 5DMYA 5C2BL 2DQJH 3MV8A 3TWCL 1L6XA 2JELL 3ZL4H 3QUYA 4LVHC 4HXBH 4NIKB 1LD9A 1LO3H 3TBVA 4N9GB 2V5RA 3QO1B 4Z7NF 1HHIB 1C5DB 4KH2A 4MA1B 1CBVH 3RGVA 5INDB 4D0BA 3MLRL 5GJSH 1OAKL 3C2AL 3QUXA 2OL3L 5I1EH 2I27N 4OZHF 1XCTA 3BWUC 2D7QA 1DQJA 2VERN 4EOWH 1JGLL 2XXMB 3DX8A 2NW3B 1EEQA 4X6EB 4LMQE 3MA9H 2X4PA 1QYGL 1MHHA 1YYLH 3TO4C 3QSKB 1I7ZA 1LK3H 2VXVH 2FIKB 5KSVA 3QEGH 3EOBB 1I7UB 3KVQA 3NH7L 3QI9A 4XNYL 3SGJC 2XPGA 3UTTB 1MCBA 3SO3B 1TQCB 2D03L 3W9EB 3WKNA 3RX5A 2EH8H 3QUKA 4RGNB 4HG4J 1ROWA 1U8LA 4RIRB 4EI6B 1MQ8A 4Y5XB 3IVKB 3B6SB 4LLYA 5B22A 3ROOB 4FA8A 5F9JB 5CD3A 3K81A 2AEWA 4HD9A 5DJ0B 4YXLL 3O11A 5EOCH 4GQ9L 3BPLC 4N8VA 1KPVA 4K55A 3QIWA 1INDH 3T0WA 3JTSB 5E24E 4NO5B 1NDGA 1T1ZA 3AAZB 5CZKA 5BS0B 1IAIH 1SJEB 5JA8B 1OAQH 2ED9A 3MNZA 4U1JA 4QYOA 3O3AA 1MCNA 2IMMA 2EYTB 4EI5A 1FH5H 1JP5A 2XRAH 4OCSL 4RFOH 5GGUA 4OD2A 4Y4HA 3F5WA 2O93L 4JPIB 1VFBA 2AJXH 5CIPA 2AGJL 3WS6C 4ONGL 1T5WA 1CT8A 4MNHA 2H6PB 3AY4A 2AW2A 1MJUH 3RA7L 3B43A 4Z77A 1DBKH 1WAAA 4QRSB 4ONHB 2FZ3A 1QFWM 4JEGB 4Y0GA 2HT3C 4PR5B 1S5IH 3SCMD 3VXRE 4PJHB 2FJGB 4DGYL 5KOVC 4Q6IA 2BC4A 1JUFB 3LMJL 3KJ6H 5A43C 2YEZA 4JO4L 2UVEA 3PWLA 5IB1A 4F7MB 4IRJD 4R3SA 1IM9B 1QSFE 2ZCHL 1HNGA 2AK4E 5DR5H 1HOCA 4OB5L 2ENSA 4HK3N 4DGYH 4PIRF 1DN0A 3FQUA 4MJIA 4JCLA 4QT5B 1I9EA 5C0RH 2XQBH 5DI8B 5FYJL 2P5WB 4N90D 3RWGA 1QG3A 5DD0H 1S78D 1T1XA 2R69H 3DX6A 3IDIB 4IS6A 1YPZF 1YN7B 4IMLB 4U1KB 5IB5B 4MB5A 3IJYB 4HCRA 3SEPA 3C5JA 4UNVA 3VGAC 3EOAA 4LRIC 4QO1A 4HFUH 4JB9H 5I6XC 1F13A 3DUSB 4UINH 3W39B 5EO9A 4XB7A 3FQUB 4WO4A 4WTZA 5JXAH 2EDKA 5CLWA 3ARQA 3UTPE 3KLAB 4N1HB 3QH3B 4FP8H 5EDXA 5C0AB