1MCKA

Principles and pitfalls in designing site directed peptide ligands
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
216
structure length
216
Chain Sequence
PSALTQPPSASGSLGQSVTISCTGTSSDVGGYNYVSWYQQHAGKAPKVIIYEVNKRPSGVPDRFSGSKSGNTASLTVSGLQAEDEADYYCSSYEGSDNFVFGTGTKVTVLGQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Principles and pitfalls in designing site-directed peptide ligands.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immunoglobulin
molecule keywords IMMUNOGLOBULIN LAMBDA DIMER MCG (LIGHT CHAIN)
total genus 39
structure length 216
sequence length 216
chains with identical sequence B
ec nomenclature
pdb deposition date 1993-02-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1mckA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1mckA02
3E0GA 4GBXC 2Q7YB 5DMJB 4GLRI 3MRFB 2AV1A 5IR1B 4X6CE 1AR2A 3SKMB 4XP4H 1U3HB 4Z0XA 2GAZA 2R1YA 4XVTL 3K7UA 3V0VB 4L4TD 5ELIA 2BVOB 4ZQKB 4JR9H 1QSVA 5DVKA 2VAJA 4ZAKD 1SYVA 5EOTA 2IAMD 3EBAA 4MD0A 4WUUA 3QIUA 3V5DB 4MXQD 1NFIA 1X4XA 5BQ7B 1YY8A 1A3QA 1S7TB 4KU1A 4XHQA 5FV2A 1CGVA 2J7LA 5ALCL 2A6JB 5D71L 5DJ2B 2RJMA 3W9DA 3EDKA 1WWWX 3AMLA 5JR1H 5CKGA 2GEEA 1ERNA 2GJJA 1HIML 5DJDB 5FM5M 5FYJH 5GGSB 4HIXL 3PWPE 4GMTH 3QWOA 2P5WE 5E5MA 2VXTL 1ZAGA 4JQVC 1FYTA 1C5BL 4N8PA 1VFBA 1UVQA 4NP4H 1J1XL 4WGWB 5D7IE 3DOSA 3PV6B 4U1MA 5F6IB 3W0WB 5IBTH 5HVHB 2AABL 2YBRA 4XPTL 2WZPD 4XH2A 5EZLA 3QNYA 4MD5A 3JWOL 1RJYB 3GZKA 1NDGA 1I3VA 1OPGL 4GRWH 4FQQB 3EYQC 5DJXA 2DDQL 3PQYB 5H94A 4KK8D 4KGLA 4UV7H 2UYLB 4DWHA 4PRIB 4LEXL 1RY7B 3QWOB 5E6IC 4PTTB 4Z95L 5EIQA 5E08H 2D7QA 5A16B 1BEYH 3MUGB 4KY1L 4UIMA 3HMXA 1JNJA 1AGDA 3DUSA 5TF0A 1G7JB 5EG6C 2WAHA 1QZ1A 2GJ6B 1R3IH 3VWKA 1P4LB 4L9LB 1ZANH 3EYSL 3QNXB 3EJYC 4K3GA 5JORB 4HH9B 2VDML 5F96L 4Q2ZA 4XNZC 2CDEA 3U7WL 3V0AC 3P9WB 4LSTL 3QDMB 1S7QA 3KYKH 1KCRL 2WP3T 3WKML 5ILTH 3NACL 1H15B 1BAFL 4FQCH 5GGRY 4PJEF 4Y5VC 3ZL4H 2YRPA 6CGTA 3I2CH 4FABL 3I50H 1XR9B 3QDGD 1CICB 1ZLUK 2VWEC 3GDBA 3GSRB 4TOYL 4XVJH 4PRDA 3FT3A 2QV2A 3E6FA 1DUZB 4UZGA 1CD0A 3RVVD 3UCRA 2ESVE 5ACZB 3ILPA 1QLFA 3MBEA 4MNHA 3UPAA 5GS2H 4F37F 3VMPA 1CGYA 3RZCC 3V7AE 1UZ6F 2KUTA 3DRTA 3VDAA 3WIHL 3BEWB 5E6ZA 4M1DL 1W0WA 3KGRA 5D70H 2ZNXA 3TH2T 4I2XB 2G75B 3LMJH 1MJUL 3NIFF 3LVEA 5BXFA 4LRIC 3CDGB 4P23B 3NFNA 5BS0E 4FFWC 5E94B 1BFSA 2VITA 4EUPA 3P0GB 4GLRH 3K8MA 3KPTA 4K94L 1S3KL 1XF5A 1R3JA 3BI9X 3GHBL 4ZS6C 3DYOA 5CZXD 4UB0L 5IHUH 3RWCA 1JPGA 5DO2C 4PJIE 1HK6A 2YK1H 3FFCB 4G6AC 4RWYH 1DDHB 3AS3A 1DUYB 1CFTA 4TNWK 1F42A 3WXWL 4AK1A 4BJLA 1FSKC 4GOSA 4XP5L 1VACA 2DWEA 4QRUB 1XGUA 1XGYL 2CJUH 4I3RL 3P4NB 4U4BA 5AWNH 3RNKA 3EOTH 4XRCB 3U7YL 4YDLC 1ZVHA 3VFGL 2DQTL 1T7WA 3BHBB 3G6DH 3MLSH 4LLDA 1FGNL 1QLEL 4D0BA 1N5YL 3KNBB 1N6QL 4L8CA 2EH7L 1XGQA 1C5CL 2PXYB 1FNLA 1UB6B 3J7HA 4XPHL 2IAMC 4WEUD 3KWWA 4FFZL 2QQLL 3BAEL 5FO8A 3TF7C 3L7EA 2DD8L 4OKVB 4YE4L 3E6HB 4XC3H 4ODTH 2VE6B 3CLEL 4OAWA 2AJ3B 4ZOEA 5C6TH 1RZ7H 5HHOD 3TZVC 1RMFH 4QXUL 5HGHA 3SKOB 1PQZA 1U92B 1Z3GH 1YQVH 4JY6B 2MOVA 3TIDB 3IDIA 3L5WA 1AE6L 3LV3A 3CLEH 5E8DH 4D0CB 4P3WA 4JANB 1GC1H 3TA3A 4JO3L 3LKNA 5IB1A 3DECA 4CVXB 5D4QA 5TE6L 4PJ8B 2QADB 4GG8A 1LMKA 5FYLH 1AO7D 2BSSB 4KRNA 1PX4A 4NOFA 2IQAA 1UQSA 4ZDHB 3REVA 4L3EA 4HIEA 1J1XH 1TQCC 1IM3A 5IQ7L 2X89A 4RMTA 3VG9B 1LO5B 2QHLA 3B2UD 1MPAH 4YXHL 4BK5A 5SWSE 4NQEE 1DBKL 1HHKB 4MQXD 4AMKL 3BH9B 1PFCA 4JFXB 5LKNA 2BZDA 3P0VL 3KR3H 4MQTB 1PYWB 2GTZA 3CU1A 1I1AA 4JFHD 5DC4B 3HG1D 3KLAA 3EZJB 2W59A 4H1LG 3NGBB 3MODL 4NUJA 1T7ZA 5MEPB 2AKRB 3SJVB 4KHTL 4YHPB 3PL6A 1JGVL 1ZTXL 2CUIA 1MJJA 1VGKB 1OSPL 4XGZA 4UV4L 4JEGB 1UQSB 4ZDHA 3C60B 5KVFH 3L9RA 4ZAKA 4RZCA 2QSVA 5EU4A 5DMIL 4OCRH 4KWUA 4PRNA 3GGWB 2VQ1B 4PJ7A 2CR6A 3MFFA 3QEUA 4C56E 2GK2A 4ENED 1LO3H 1R24A 3ES6B 4O5LH 5LXGL 3UTZB 3R4DA 4ZTPL 1GC1L 4KK9C 1W72B 4B50A 3SKNA 3BD3A 2A77H 1CU4H 4KJPC 1H3XA 5FYLL 2NNAB 4AQOA 3DVGA 4FQHB 3VFRA 1ND0B 4FQXD 4F7PA 2X4NA 4BYHA 1FN4B 3O2DL 3O4LB 5DQ9A 4AY0A 5IIEA 1V05A 5HDBE 5BS0A 3IJYB 1G6RA 4HC1H 4UT9L 3FFDB 3QCUL 4YUEH 1H3VA 3BXNB 3IETA 4HT1H 3P4OA 5IB5A 1JHLH 1JHKL 4G7YL 1PEWA 1MHEA 4HFUH 1XR8A 4RDQG 1T0MB 3DTXA 3EFFA 4HWZB 1BOGB 4JPVL 4M7LH 5KW9H 4HWEL 2VC2H 1JRHH 2ENYA 2H41A 5JUEH 1PG7L 3CXDH 3M8OH 3B9KC 3VFPA 2E9WA 3MREB 3AC0A 5ID0B 5EZIH 4ZUWB 3ZDZE 4NQCA 2R29H 3T3ME 1MFBH 1R5WB 1CZ8H 3O3UN 4GW1A 2XACC 3WFDL 1WTLA 3VFTA 4CVZB 4PJCA 3NCBB 5D7KE 4MWFA 3T0AA 2F5AH 1YEHH 3NN8B 1HHJA 5F9DC 4BM7A 4N0UB 4UT7H 1FPTH 2Q8AL 5IB5B 4KVNL 3GSUB 3W11D 4G8GE 3DARA 3BZFB 5I8EB 3VRLF 4UILH 3HMXL 4D3CL 4LLUB 4S2SA 4JZJB 3DPBA 4CJ1A 1DQJA 4E42A 3QEHB 1MAMH 1LDSA 2EE3A 1FDLH 4CDHA 1WT5A 4FNLL 1FFNB 3OL2A 3Q6GH 5C0FB 3TZVD 3L5JA 4DFHA 4F9PC 3E2HC 1HSBB 2W0FB 4CADA 1BFVL 3VFNB 1P5UA 3MO1A 5DRZA 1H3WM 4D9QD 4NN7C 4OCYL 1X5KA 3UTSB 3V79C 2J8UB 3SE9L 3WNMA 3VXNB 3SGEH 4PGEA 4U31A 5DD3L 3ARFC 3C09C 5ESAA 5E8NA 2B0SL 4PRAB 3ZYJA 3JTTB 4N0UA 3HLAB 5DUBA 3LIZH 5C0BA 2ARJQ 3BKCH 4NKQB 2PN5A 4NO2A 4U6YA 5IEKA 2R2EA 1H5BB 2D7TL 3SBWA 3IGAA 5DF0A 1S9YA 4CGTA 5JO5B 2XWJB 4LCYA 4F15C 1CICD 1N7MH 2FHCA 3DV4B 3CFBA 2ZUXA 3U2SA 3KDMA 4EI5D 4DKAA 3TN0A 5B3NA 4CADB 3L3OB 4U1SA 3LKQB 3ULVF 1P4BL 5JIKA 3SQOH 3VFWA 2EXYC 3ULUH 2H26A 3P40A 3MRQB 5B4MC 1Z9MA 3BW9B 2XTJC 1YA5A 1G9MH 3D69A 3ZTNL 5ABDE 1OLLA 5JNYB 2DTML 3U0PA 4QOKA 3IRPX 3BPOC 4UUJB 3TCXA 5HYJE 2D7NA 1MCNA 4JN2B 4JO1H 4R4ND 4M93B 4L3EE 1S9YB 5J3HC 2NY4C 1I1AD 1NBVL 4N9GA 4ELKA 3MRMA 3QQ9C 3PGCA 3SDXB 3DURB 4M48H 5T1LB 1H3PL 2E8ZA 1NDGB 4YK4B 2C5DC 2JB5H 4OB5H 3VG0H 1MJ8L 2IBZY 5BZDB 1JPFB 1AHWC 3VDCA 5T3ZD 3ARBD 3F7YA 4PRID 2R0WH 4GKOA 4RMQA 3MRRA 3RVTC 5KN5B 4YNYB 1QLRB 3WDIA 1KNOA 2YPVL 4RA0C 1I3RA 1OTUD 4KAQL 1GAFL 2VZTA 1EIBA 2LU4A 2YUZA 3IXTA 3F5WB 5DMKA 2HTLC 1P7KB 5KTEH 3U0PB 3JV5A 2OJEA 4U1KA 5F3HB 4G7YH 4X6DE 2DDQH 3FQTA 4X7DC 4OLXL 4OT1H 1X6NA 4BZYA 2IANA 4X9IA 5I1GL 1UENA 4ZYKB 3OB0H 4WUKL 1YEFL 3O6LH 2AJYH 2JCCA 5T3XL 1RUAH 4G9FD 5CJBA 1LP9F 3WD5L 3QRGL 5EU5B 4U2ZA 4BH8B 2V7NB 2C1PB 5DYOA 3NCJH 1TTGA 3PABA 3DVNA 3E1F1 4JJHA 4XX1E 1PG7W 2VJXA 5EZOH 1QRNA 3VG9C 3RQ3A 5DJ6A 4Y1AB 3U9UB 5FB8A 3KPQB 3RKDD 3MGAA 1XF4B 2DTMH 3NCJL 1M7DB 1L0YA 3IYLW 3O3DB 5DFVC 1K4DB 5DZNA 2CLVA 3FT4B 3IJSA 3OR7B 4HPYH 4TTGA 1PVHA 3MLRH 3SKMA 1UJ3C 2EDTA 4A6YL 3HG1E 3I50L 4KI5F 4U1NA 4UQ3A 4OZGA 1F58H 1AKJA 5ACLA 4PJIA 2AEPL 3V2AR 4NZRH 5B8CC 2JELL 5BW7C 5TQ2H 2WIIA 4HFUL 3VXPB 4QCIA 5I15L 3L3DB 4WW1B 4O58H 4QLRA 3T4AB 2YPVH 4YPJA 3T0XA 4RNRB 5J1AA 1TPXC 1FCGA 2VIRA 4HWBL 1FNAA 5T1DL 5F7HA 3GB7A 4MB5A 4ZS7H 3ULVH 2ZJSH 4HMDA 4N0RA 3GKWH 1T2QH 1T03L 3ARFD 4LVOC 4JG1L 3TZVA 3KLDA 2Q6WA 2PXYD 3T0VA 2JB6B 5D8JL 5ISZE 2KZ1B 2ZG2A 1V7NL 2YA2A 4JRYE 5JPMA 1DUYA 3CX5J 4XHJD 2D9QB 3BUYB 4I3GA 4H0HB 3TP4A 1T22B 1HXYB 1V8HA 1CBVL 3GJFA 4LAQH 5ITBH 4JY5L 2EZ0C 5KOMC 2OXGA 1ZHLA 1QPXA 3F62A 1T1WA 1MFAL 5AZ2L 4L8SA 1YUHA 4EI5C 4R96A 2NZIA 3ALWA 3RDTC 2IFGA 4YFEA 4Q9RH 4BQ9A 3OPZH 3O11A 5D6DA 4HIHA 4ISVA 4WW2B 3X14A 3S4SB 4Y5XC 1WV7T 3PWJA 4G6AD 4ZFOL 3ZHKA 4H26A 1WSST 5KSBB 1IGFL 4NKOA 4QTHA 2LU7A 4JFPB 4XP9H 3LIZL 1KJ3L 2E7LC 4ZS6D 4KZDH 1P2CA 4ORGB 3MRCA 3WNLA 1Y18B 1RZ8B 4MXVE 4OCXL 2G2RA 5CHNA 4XX1G 3WJJA 4JHAL 5E24E 1AR1C 1BM3L 4HLZH 4XWOD 1KENH 4GAGL 5L8JB 3IDJB 4UOW0 3VXRA 3ARED 1J0KA 3JSSA 3LKNB 4KMLB 3MA9L 3VXRD 1F6AB 4TVPE 4PG9B 5C0BE 4GG8B 1WK0A 3SQOL 1RD6A 4KHTH 1E4XL 1JPSL 5KS9F 3NZ8B 1NFKA 1KTDB 3FJTA 3AY4C 3SDCA 5EU6A 1UH2A 4BA8A 4PBWD 4NSKB 2OMBA 2NTFB 2R8SH 3FT3B 5E8DL 2NW2A 5K59E 3WE6B 2FO1A 4GAYB 3RVVC 1EGJH 4EN3A 1KN2L 3D85A 4PJAA 3QA3B 2BSED 5EFIB 3WNOA 2FR4A 1DL7H 4JAMA 2GY7B 1J0ZA 1CE6B 4NQDD 4PJFF 2CIIA 5C70A 3BKYH 4ENEC 3GMNB 2IPTL 4S1SH 3HMWH 1U91A 4ZMAT 1H5BC 5DJCA 4JQXA 2IALB 4L1HA 1HHHB 4QRRE 5CP3A 4HPYL 3VGAC 2HH0H 4AIOA 3FB5A 4Z78A 2HFEB 3KJ6H 1LGVA 3KYOA 4XP6L 1INEL 3ARXA 1VADB 2BVTA 4KMTH 1T2JA 1GAFH 1IQDA 4M5YH 1C5BH 1J11A 2EKJA 3KYKL 4M43L 3H7BB 3CK0H 4OF6A 3CZFB 5T5NG 4BELD 1QSZA 4MDJB 5E7FA 1WIPA 3QCUH 2MJWA 1JGUL 3IDXH 4EQ2A 3V5KA 4I18C 3WHE1 4XPGL 4ODXA 3ZO0A 2CKNA 3GSQB 3VFUA 4NQDE 5DD6B 3S9DB 1LE5A 2E6JA 4NM4L 1ZLSL 2Q3ZA 1KCVL 4Z7VE 5DRNA 4Y19B 5CILL 3F58L 2FBOJ 1ZHBB 3QUXB 1KTLA 3C60C 3MYJA 2IPKB 1O7VA 3GI9L 3IFNH 1FN4A 3B83A 3KPLB 5I1JH 4CDGC 5GIRB 4H1LH 1GIGL 3WUWG 3HE6B 2BX5A 2VDKL 3LKSB 1FC2D 4ZG1A 2CDFA 4EVNB 3GHEL 4ZUVA 3HG1A 2FX9H 5D1QC 4P48A 3K74B 5HDQL 1G9NL 4PRPA 3PG2A 1JYVA 1WZLA 4RGMB 1G9MC 2DQCL 1NBVH 4PLKD 1UFUA 4WU7A 4GG6B 2P5EA 5EBMA 5BOPA 5ID1A 3ULUC 5JLZB 1A1OA 1PG7X 5DR5L 3ARGA 3Q0HA 1RIUH 3S6CA 3ECBB 2R4SL 3BZEB 1RHFA 4IRZH 3N9GL 5FHAH 5EA0H 1D5XB 2W9DL 5IK3A 4JDVA 3CK0L 2E6PA 4B0MM 4OD2B 5DK3A 3SE9H 4A2LA 3OF6D 3WSQL 3PWPD 1J05B 5ITFB 4HKXB 2XI9A 1D5IL 1MIMH 1Q0YH 4L8DA 5I74B 4GG6F 4LSPH 1S9XB 1XIWC 3KAAA 3GMLB 2A2QT 4CU6A 1I1FA 1N6QH 2UZYB 1DE4B 5GGTH 4CU7A 5DHVH 1JNHA 3WO4B 4MNQA 1BJ1H 4PJGB 4S1RL 4JFZH 4M7ZC 3RBGA 1K5NA 5D70L 3WNKA 3K2MC 5T3ZL 3H9SA 3RDTD 3B2VH 3HI6L 4KVCH 5J9PA 1IARB 4ZSOA 4Q6IC 4JFEA 5EPMA 3PJSB 2X4UA 1UG9A 3O8XD 1L9NA 1CTOA 1UM6L 2NZ9D 4XTRC 5DJ8A 4XMLH 2YD1A 3MOQA 4FXGB 2X4SA 3WL9A 5C0CA 1QFPA 2LAGB 2IMNA 4L8DB 2CMRL 1XH3A 1F4XH 4XBPA 5CZKA 5F88B 4IRJB 5IVOA 2V9RA 4XNUL 2K7PA 3FN3A 2Y7QA 5DJZA 1XAUA 3FRUA 2F53D 2HYMA 3HMWL 4Z77B 3IDNB 5CJ8A 3C60D 1BIIB 3E2HB 3VFSA 1S9WA 1LP9B 2ZUSA 4KRPD 2I9TA 5ILTL 4KC3B 1MJ8H 2V7HB 1OLZA 4LDLB 4KKLC 1U9KA 2IGFH 1DN2A 1YNKL 2DI9A 4HEPG 4OFIA 4BFIB 1FGVH 3D0LA 2DWDB 3VXMA 4UT9H 5ADOL 2ORBL 4NFBA 4V1DD 4NQDA 1FYTE 5DTFB 2CK0H 3MACH 5DWUH 1BFOB 5KSUA 4PJEB 4OJFL 5HGAA 2WINA 4WO4C 3O2VH 3SDCC 5DUPL 4ZO7A 4QRRA 2ZUUA 4MHHG 5CD3A 1A9BB 5BVPL 3EHBD 5IOPA 4IOFD 1NLDL 5DD0L 1Y6MR 4LLQA 3TO2B 1JRHL 4S1RH 2D03L 3QUKB 2A6JA 2ZOLB 4FTVE 4OLUH 5GHWL 2D7MA 2M2DA 1NC4D 2NY6C 4J7RA 1BVKB 5EUOE 4MYWB 2QADD 2Y23A 3WJJC 3HN3A 4PJ8D 4Y8AA 4D9RD 4ONFH 1LO4L 2GJZA 4JQIL 4S1SL 3S5LG 1TLKA 1DQQA 4NCC2 5DVNA 5D7JB 1UCBH 5I1HL 4UDTB 2CMRH 1UVQB 2JB5L 3SJVE 1VB9A 1NL0L 4K8RL 4X7FC 4PJFA 3GMOA 1C5DA 4Z7OE 2B2XL 4DZ8B 3PNWB 5F1OB 3VXUB 4LVOB 1UB5A 4R4BB 1RJZB 3LS5L 1LDPL 4MJ5A 3RWFA 5JQ6L 1KJVA 4EI5A 2H9GB 4NQXA 3UBXA 1OGAA 2X9WA 1D5MB 5HYJD 1PKQE 2DQFB 4KK9D 4XP1H 3B5TA 1KPVB 3NA4A 3LH2H 1J18A 1RZGB 3ZE0E 1F5WA 1YMME 2CIKA 4WTXA 3BZ4A 2D4DA 1EEZA 1FNEA 2XZAL 3K3QA 3DROA 4UBDD 2HWZH 3K1KC 1NKRA 2BNQB 4DQOL 1OOAA 5SX5H 4WFHD 1EZVY 2ESVA 5K33A 3LQAC 4LGPB 3IKCB 2B5IC 1A3LH 1CFNB 1P1ZB 4PJXA 2WIMA 2BHYA 3O4LE 4KJYA 3MJ9L 2H2PD 3VXNA 3GMQA 4NYLA 4P2RB 1MCPL 3X3FH 1KJ2L 5F7UA 3FOMB 4KUCD 4PY7A 4YDJB 4LKXB 1RURH 2XTJD 4OSUL 5GGTA 1T04B 3G6JF 1K2DA 1G7QB 2Y25A 5EOCH 3RWEA 4JFDB 2VL5A 2XFXA 1PJ9A 3ARVA 5CD5C 1I3UA 3DBXA 5BW7A 4YPGA 2EZ0D 3U30C 1QSEE 2VH5L 4K7FB 3OKEB 5I1IH 5JOFA 1MFAH 5KJRL 3GBLA 4S1DD 1LK2B 1LNUB 5E2TL 3MZGB 3I6GB 1IFHH 2EDRA 1EAJA 1QKZH 5ALBH 4IRZL 5FHAL 3U4EB 1RFDL 4KTDH 5FUCC 3NFPA 3GUTA 3R0NA 5JQ6H 4OFYD 4FQIH 3V6OA 1QHPA 5CJQH 3MV8B 5CMAB 1R3HB 3VRIB 2NY3B 1ZVSB 2A6DA 2DJ4A 1YY8B 1MWAB 4G6FD 2IWGA 1FGVL 3O8XC 5MEQA 4HAGA 4LLMA 3AU1A 4N0CD 3ARDA 1FIEA 1D5BB 1G7LA 5D1ZC 1F11B 4HUXA 5DWUL 2AI0H 1ZHKA 4LL9A 3ARZA 4PJ5D 3MV9D 1Q94B 2F19H 4IJ3B 4WU5B 3DIFB 3FONA 3BKCL 5D7LB 1AXSB 1JPFA 2BMKA 5FV1L 1A3LL 5B3JE 4F7CB 5IVZA 4NQVA 4BZ1H 1T3FB 1MNUH 1MEXH 4C57C 1EBPA 5C0JA 1CI5A 3HRZA 4PY8J 3VCLA 4QYOA 3S36H 2NW3B 4QKXB 5F9OH 3SCMA 2R0LL 1J1OH 3QI9C 2P8PA 2Y36L 3MRLA 2MCG1 5DMIH 1ZVSA 1BQLH 3QXWA 4ODWA 4RGOH 1J12A 5BRZD 3RKDC 1AC6A 3T0EA 1FNHA 3RX8A 3UJJH 4V1DA 4TSCL 4D0BB 4BH7A 4FZ8H 2HVJB 3RL2A 3AY4A 1X5LA 2YK1L 5INCA 2NQCA 5JA9A 4ODSH 1SMOA 1JCKA 1SQ2N 5DYOB 5HY9B 4G9DA 3BPLB 2GIYA 2P5ED 3O2WH 3UTQB 43C9A 5FHBL 4HAFA 4Z5RB 4OD1L 1SJXA 4W4OC 2XPGB 5KVDH 3U6RA 2APWA 2OJZL 2GT9B 4PGDB 4NRZB 5C2BH 4Z7NF 1KIRB 4N8CL 4YHKL 3KYNB 5J89A 5F7NC 1DANT 1EGJA 1FIGH 4M4RA 4X80H 3TN0C 1A3RH 2FATH 1EK3A 4I9WE 5I1DA 1EX0A 4X98B 4E0RB 1WC7A 5GHWH 1MCSA 3BP4A 4MNGA 4U0RC 4XNYL 1WAAE 2HKHH 5BS0D 3O45A 4C58B 3JV6B 4NM4H 4YHLH 2NY3D 3H9SD 3RDTA 3QO0A 1HOCB 4D8PB 2YKLL 4EDWL 1DP0A 1QR1B 4L5FH 5EZIL 1FYTD 3C6LB 5K93A 1QQDB 3O6LL 1G0YR 3X3FL 2OL3B 3HPJB 1F3RB 4LSDA 4D0DB 2ICEA 3G04B 1I85C 2O5ZH 4H1LB 2H3NA 1GIGH 1DUZA 3FB6B 3FO1A 4QF1A 1CBVH 4JM2F 4QRSA 4XNQA 1FAIL 2JIXB 2H1PH 3CFJB 3CH1A 4DJMA 4HG4J 2BXYA 3UBXG 4XNMB 4BSWB 2DL9A 2FX9L 5KANI 3TLRA 5AZ2H 4X98A 2VH5H 1F13A 5A2JH 2G60L 2WANA 3MCKB 4R9HA 2AABH 1FZOB 1HQ4B 3OKYA 1J8HA 5F97E 4G80A 3TJEL 5AZEH 4UI2A 5HHMD 4HFWB 2P5EE 1S9VA 5TDPA 1K85A 2B7DT 5DQJB 3VGEA 2G5RA 4EZMA 1S7XB 2BY3A 1ZA3A 3S36X 2XZQL 4EUPB 5T1KA 1A6UH 4QRSB 4XNQB 1FC1A 4C56D 1DVFC 2AQ2A 4J3OC 3EAKA 1S7SB 2CRMA 3MLUH 5T3XD 2QR0B 3ELAT 1R3KA 3ZT6A 4JHWH 4CJ0A 1X4YA 4H26B 1B90A 4NO5B 1UJ3A 3QISA 4U1IA 3MA9H 1V5JA 4R4FL 4XPHH 3QHFL 2XKUA 2VAAA 4DUXA 2RIKA 1B0RA 3LEYH 1YN6B 1B4JH 4BKLA 4HZLB 4HS8H 4QT5A 4TVPD 3BHBA 1YZZA 5GZND 2NY5H 2BHZA 1QRND 3ILQC 1SHMA 3MC0A 4R0LC 4MCZA 3T09A 4YEFA 2WLYA 3ZDYF 3ZSTA 5F89A 5ERWA 1N2RB 5GJTH 2GK0A 1ZE3C 1AIFA 2ICCA 3MRNB 1E0OB 2DIAA 4I0PB 3CFCL 4L3CB 2B2XH 4KROD 4X7CC 4BSVA 2DM2A 1NGXA 5JDJA 1R5VB 5JXAL 1U3HC 7CGTA 2X89D 1K6QH 3L5XL 4MVBC 3KJ6L 4PIRF 3TBWB 1N59B 2OTUB 2OK0H 1AY1L 5HYJA 2A74B 1CFSB 3BO8B 3FHQA 4JFOB 5MI0C 4N0YH 5ESQA 3TYFA 4F2MA 1GCFA 3QG6B 1G0XA 1KLGA 5I71B 2BNRB 4R3SB 5L2JA 3CLFH 2AEQH 1TDQA 1B9ZA 5JUEL 3T2OA 3EZ8A 4TUJB 3B9AA 1ETZA 1IILE 4DTGH 4AIXA 5FYJE 4NBYB 3BDXA 5ICYA 3KJ4B 4WEMB 5C0IB 1RHHB 3PL6C 15C8H 3UTTA 2ATPA 1CL7H 5IB2A 2VDQL 1QSED 2WBJB 1U8KA 3O6FA 3ZZ1A 5F3BB 5AG8A 1LP9A 2V2XB 2Z8RA 4I3SH 1KJ2A 15C8L 3CJJA 5EN2A 1OAZL 4X0KA 1N0LA 2LTQB 1P4IL 4PTUB 3RGVA 3F6LA 4YHIA 5DJ0B 3UTSA 5F7EL 1NDMB 4GRWE 5DDHA 4U1GB 4MNGE 1S3KH 4LLVB 2CRIA 4HUNB 4TUJA 4BK4A 1U8MB 3MJ8B 2R23A 2APFA 1G7HA 3LKOB 5IHZB 5H37G 5F7LB 3RTQD 5I66A 1FLRL 1P4IH 2NY0B 1D6VH 2Z4QB 5GRXG 4XP9L 1K8DB 4G8EA 5EC2B 3EO1B 4I4WB 1B4RA 1ZGLA 5IWLA 5FO9A 5HHME 2HAZA 5L7XH 4JO4L 1T1XB 1NBQA 2I25N 3TIEB 5I0ZA 2QQNL 4XB7A 3TA3D 3DSFL 4M5YL 1EEQA 5C71A 1MI5B 4NKMA 1TVHB 3TV3L 4F9PA 1WICA 5TQ0L 2BOBA 2V2WB 4KK6D 1CLCA 2P5WA 4LSPL 1E4XH 4X4ME 1OAUH 3G08A 5F1IA 2PKDA 3S96B 2UV3A 32C2B 1CTNA 1GH7A 2ZUVA 1W2KT 1P4BH 5DRXA 3B6SB 4MAYD 4WY7H 1RUPH 5CIPB 1BIHA 3MXVH 4CMMB 3SDCD 1MLBA 3QHFH 2Y4SA 2WQ8A 5CBAA 3BX7C 1REIA 4Y88A 3VXRE 3CC5B 2FSEA 4NC0B 1RURL 4C56A 2HT3D 1UM6H 4FQJH 5B39A 1TJGL 5SWZA 2ED8A 1WIOA 1IGCH 1GOGA 4KJQD 4TSCH 2AJ3A 1UZ8A 4JO3H 1DBAH 2XA8H 5B39G 1A7QL 5E4IA 3LS5H 4OGYL 3QDGE 3QR2A 5DMKB 1FPTL 1T89C 5LGHH 3TT3L 1LO0L 3DX9B 2I9LA 3U82B 3QQ9D 1AGCB 1WFTA 5F7YC 1B88A 1CK0L 1D6VL 5IBLD 1AGBA 2DB8A 2R1XA 4W81A 5DVLA 5JW5A 3FB7B 1LE9B 4LEOB 2W92A 1MY7A 4JCLA 4GXUM 1A7NL 4OZFH 5J1TC 2ZP0T 1GGBL 3V0VA 2RBLA 1OL0A 3QUXD 3V6OE 2HLAB 5AD0B 1F4WH 5C0DB 1BQUA 2VL5B 1Z6JT 3WIIH 3NCCB 4PJBF 3TV3H 3LQMA 1XEDA 4AJ0A 2LU3A 4IOIA 4YIQB 3SDDD 1NUNB 5ACMA 5CILH 5KOVC 5E0QA 3DX9A 4LKCB 1CFQA 1MQKH 4NGHL 1M1SA 3FB8A 2A77L 1EAPB 4GW5A 3I6KA 4AEIL 1F02I 1PYWA 1XIWD 3TPKA 2ADJB 2H32H 5GGSA 4PREA 3H9ZA 2QHRH 3DXAA 1MRCH 5FUCE 4EOWL 3QDHA 3IDUA 5BRZB 1I8MA 2DYPB 2BVPA 4LGRB 3O81A 2HT2D 1U0QA 3RVXC 1FE8L 2AXHA 4WEBL 4YO0B 4PP1C 3OB8A 5DC9B 2R2CA 5FCUL 2Y06H 1FRGH 1QFWH 5J8OA 5EZLB 1I9RL 1MHHB 2JE8A 1RVFH 5E8PA 3ILPB 4U05A 2R4SH 2CGRL 1SEQH 1AQKL 3MRPB 1D6EA 3RWJB 5EA0L 2MKWA 2JB6A 3H3BC 1GHFL 3WS3B 5GJSH 4Z9KB 5D93B 1Q9LA 3K81A 1W0VB 4UDTA 3QUML 4G6FB 5E6IA 4OLYL 1YPZB 2F5AL 3JXAA 1UXSA 2FECL 5HYFA 1KN4H 1TETL 3IFPA 3LQAL 5AYUL 1LQSR 3V4VL 3WO3B 1CG9B 3P4MA 3U46A 4RGNB 1JHTA 5DFVD 3W9DB 3QNXA 4NN6C 3C08H 3KXFB 3H9SE 4EIZC 1ZWIA 1ES0A 1ZT1A 4OLXH 4JJ5A 4OT1L 2PO6A 3O9WA 3TA3C 2WK2A 2IFFH 3MRHB 2PO6D 3O9WD 3UTTE 2ZKHH 1IKFL 2M26A 4ODHH 1U8JA 2A6KB 4YHNA 3CX5K 4EIGB 1GGCL 4JFDD 4ZUTB 2ADGB 5J4MA 1P5VA 4M61A 3IDYC 3OGCA 2XTJB 4MJ6B 3ARDD 2J5LB 1E4WH 2OI9C 5HI4C 1KLUA 4DGYH 1ADQA 4IOFC 2PYEE 1LWRA 3PE9A 4ERSL 3QNYB 4RWYL 4KJWC 1FRGL 1QFWL 4JDZB 1FZMB 4L3ED 2X4OA 3AXLB 3L95A 3V5HB 3HC4L 2ADFH 1SJHB 1OSZB 1XGTB 5DMGD 2WBKA 3RU8H 5I9QC 4OKVA 1MAKA 2F5BL 3QIBA 4WTZA 1MFDL 3U9UA 5FB8B 4NN7B 5IW3A 3VJ6A 4L8BA 3N9GH 3ULUL 1C5CH 6FABL 4XP1L 1RI8A 5HGDB 5A2IH 3QEQA 2GJ6A 1DR9A 2IANE 1GOFA 3MRBB 3ZDZF 1FO0L 4GBXA 2CKBL 3G6AA 4LHQB 5ETUB 2FBJH 3IJHB 3RNQB 2VDQH 3GMNA 1EO8L 2H6PB 4K2UL 5C0AA 5IESH 3D25A 2NR6D 4P46D 5MHSE 3AREC 1YJDL 2IFFL 4WHTB 2V5MA 5GS1C 2BSSA 5JR1L 4JO2H 1JP5A 4B7IA 1NCNA 1OTSD 5GRJH 2HRPH 4HKZB 4ZUSA 4P0DA 2IPTH 2Y36H 1ZEAL 5DRWA 4J4PD 3ROLA 1JGEB 2I26N 3T1WA 1X5XA 3BRDA 2ITDA 2R0KL 3K1DA 5C07B 1U3YA 1INQB 4X6CB 2NX5D 3ORJA 3KXFD 5HPMB 5IB4B 4JPWH 2H32A 3ZKNC 3QUZA 1FVEA 3CFCH 2DM3A 4QOKB 3H0TB 2WM0A 3MLZL 1AI1H 2YPLE 3M1BA 5FYJL 4Y19A 5EORL 2P4AB 1KTKE 1UWXK 2GY5A 3I02A 2A6IB 3KPPB 1OTTD 2VN4A 3CDGA 4XWGH 3HHRB 3QB7C 2HWZL 1S9KC 3QXDA 2FWOB 5FF6A 2DL2A 2AXJA 4XCEB 1GPOL 3QH3B 4FQPA 1T0PB 1NLBH 5E00A 5HHXL 4JZJC 5GRUL 4ISVB 4NFCA 1HI6A 5ICXB 3QEUB 1NCDH 3KPMA 1EHAA 4XXCA 3MRNA 4R8WH 2BNUA 3MOBL 3FFCA 3MLRL 4JVWA 5E2UH 2NY0C 5FYLD 1RZJL 1KIRA 4ZUUA 5CWSA 2J3SA 5GGRA 1SY6A 3PHOA 4FQ2L 3VXOA 4JLRA 3G5ZB 5EZOL 1AGFB 4QXTA 1A1OB 2A6IA 4ZPTA 4WFHE 4RAUB 2FRGP 1U8QA 1YY9D 3QJHB 5FGRA 3CDYA 4P57A 4Z95H 1A2YB 4DVBB 8FABB 4DGVH 5I0DA 3N06B 3UZEA 4PYGA 2JLLA 1M71A 3N0PB 3C9NA 5F9JA 5I8CB 3QCVH 4B7LA 5HDBF 1ITCA 2EICA 2P24B 4PRIE 3B9KB 1BF2A 2NXYB 4D8PA 1I1YA 2OBGA 3EGSA 2X9YA 1IGYA 4WI6A 2JK5B 3QO1B 2NY1D 1I8LC 1M4KA 4PUBH 1OWWA 3HB3C 4G7VL 3NACH 3CLFL 2Q20A 2MFNA 4FFVD 4DN4L 1ACYH 4OFYA 5LBSH 5TH2B 4PGCB 1DBBH 2XICA 1MIEL 2YXFA 5T5FL 1MIML 2CQVA 4X6EA 3HE7C 5D7LD 2GJ6E 5EU4B 3LB6D 1T20B 3B9EA 3V9FA 3FQRA 1Y0LB 3QP3A 1UT9A 1I75A 4NQCB 1SJEB 3SDYL 1A8JH 1T66D 4LVNC 5T1DH 5C08A 5EOQL 3QCTL 3NIDE 4KJPD 1RK0A 5HHXH 5HYIA 4MQ7B 5I6XB 4UQ2A 1HSAB 2FO4B 3BP5B 4OLVH 3GSNH 1SVCP 3RL1B 1KC5L 3KS0H 1HKLL 2BVQA 2XQYK 2FJFA 5DD1L 4ZFOB 1A4JA 1U2HA 1FFQA 4PS4L 1II4E 3QIUC 2PUQT 3WUWB 2J8UF 2OS7A 5F44A 1HCFX 3SDAB 3L6FA 4JY5H 3LPGA 1NANH 5KSAB 5AUMA 3BXNA 4V1DE 3HE6D 1QEWA 3ARBC 4YXLH 1DJSA 4Y4HB 2H8PB 1BM3H 4OM0L 2AJZB 2P8LB 3FN9A 4IEFB 1HILB 12E8L 4Y4KD 5C0BB 5C0EB 3QEGL 1KB5B 3VDBA 1NSNH 5TE4L 2BCKB 1YN7A 3LN4A 1YNLH 3PWNB 4GSDH 5GJSL 3B2UC 4MCZB 2AK1L 4F37K 5LGKA 1RJCA 2VSDA 2B0SH 3C5SB 4KTYA 3ABZA 4OJFH 5KSVA 2AK4B 3RWHB 5DA4A 1WCQA 4M1GH 3DMMD 4CN1A 5FECA 5HHOE 2QLVB 3DMMA 2AS5M 5JQHC 2R69H 4Z0XB 4LCCC 1V3MA 2XV6B 3CSYB 2IADA 3BP6B 2FB4L 1T21B 3VXSA 4LLUA 4OLUL 1QFUL 4DTGL 4G3YL 1PW3A 2OQJA 3LRHA 4DAGL 5EO1B 3UAJD 2VNCA 5LQBH 2OZ4A 3IXAB 3MLUL 5IEHB 4UUJA 4AEEA 3OXSB 4AG4H 3QG6A 3QNZB 5FKAA 1UADC 2Z8WC 3O4LA 3NPSC 1A7BA 4Y2DB 3QUXC 1ULVA 1I8LA 3O4LD 2D31B 4LSVH 1JUFB 3QJFA 4OTXL 3H9HB 1N64L 3AS0A 4YX2L 1KJMB 3IU3A 1LO0H 4I3SL 1FL3A 4IRSC 3IDMA 4XMPL 5IJVA 5D2LF 4JO1L 3MRKA 2OMNA 1HDMA 4DKFL 1F3JA 2O61A 2DLFH 4DGVL 4KTEH 5CEZD 2R2EB 1KT2A 1BZ9A 2P5WD 1SY6H 4MXVF 4NHUB 2X4RA 5FYKH 4HUKB 2AV7B 3SKOA 1M6OA 2XY1A 2ZCKL 4O02L 4WV1B 1P9MA 4OZ4B 4TNWF 1HH9B 4M7KL 3P77A 4MXQC 5I2IA 1AH1A 3IT8D 2I07A 1P9MC 3ZE1E 1MVUA 1A6TA 1KCLA 5CP3H 3BQUD 2IEPA 3JWNC 5IKCB 4XXCC 3QUMH 4DW2L 3HPLA 1EVUA 3BPCA 5FXCH 3TVMC 3QDJB 3L5HA 2A9NH 2AGJL 4PJDA 1BWWA 2FGWH 2EC9U 3DX6B 4S2SB 4FQ1L 1K8DA 4PRHE 4ODUB 5DHVB 5IMMB 4IRSA 2WUBH 1FFPA 4KK6C 5J7CC 3MODH 5J06A 4YGAB 2C1OA 3ARGD 1FO0A 2WSKA 3GSNL 3C2SA 4ONOA 5C0AD 2DQCH 5INDB 3WO4C 4MNHB 2B1AH 2A38A 2WNGA 1RUPL 5HHNB 1YNTB 2HP4A 4ZD3H 2BNRE 3NTCH 4K7PL 5CEZH 4U3XA 3U83A 1KNOB 1EXUA 2EXWD 4E41A 1CDCA 4JVUA 2A9MH 5DJYB 4TULL 4HS6A 4OKDA 5DUBB 1U8NA 2QJDA 3GBML 3LDBC 2B1AL 5B38B 5TFSH 5IMLA 2ZUYA 3QUZD 5FUOL 3STBA 3AU1B 3F7PC 1JHKH 3L3HB 3N1MC 5I8KH 4LCIL 3C87A 5C09E 1FFPB 3DUUA 4AM0B 4OZGF 4RGMC 5HVWA 1AD0B 5BO1H 1OCWH 4OZGE 43CAA 4KKAC 4QHKI 2FIKB 3F12A 3DXAD 3RWCB 5CSZB 5M95B 2WWKT 4C56B 3SDYH 3PABB 4LPUA 4U3CA 3S35X 2DI7A 2HA1A 2IH3B 5J13B 1J5OH 2NNAA 3WFDH 1QD0A 3CVIL 3QFJE 3S97C 3NZHH 5KG9B 4K9EL 2HKFH 5CJXC 3V5DA 4JM2B 1J87A 1W0YT 3HNSH 4G42A 4BZ1L 1U42A 4TUKL 3V0WH 3UTTD 4QRQB 1QFUH 3EYUH 5DGQA 4V2CB 1LP9E 1ZSDA 4GAJH 5KAQG 4GXUN 2HLAA 1MREH 3EYOA 2YEZB 1I3GL 3I9GL 4OUUA 1G7PB 5C0AE 3MRRB 2FX7H 5DQDL 1Q9WA 2DOCA 3U9PH 1E4WL 3DX7B 4XMLL 2VE6A 1QFWI 1J1PH 3DV6B 3U6RB 2CRYA 1YEGH 1FYTB 3C6LD 2HVKA 1VKXB 3WFBH 3HR6A 1Y18A 5DJAB 3O6MH 1IL1A 3WDJA 1Z9LA 2VLJB 3ARTA 4FQJL 4ZSOE 4FS0A 4OCWL 3FO2A 4X99B 3FQXB 3GIVB 3VI3F 4P9HH 5JHLL 1JF1B 2AVGA 1K9TA 2DQEL 4LMQI 3GSWA 3SGDH 1ACYL 1JWUB 1CK0H 3RIFK 2OXHA 1K2DB 4U7MA 1N7ML 3ALPA 4IS6A 1R3LA 4NZDA 4O00A 4RFOH 4HIEB 2GKIA 4HGWB 4PTTA 5TQ0H 4Y16A 4Y4FC 1RULL 1KCSH 1T1WB 2EDOA 4MMXC 4Y16D 1MCEA 3PWUB 5E9DB 3GBNH 3MV9A 3ZDXE 2MQ3A 5IP4A 3MA7B 1UCBL 5BV7C 1I7TA 2AJVH 5I1HH 2HN7A 4HMCA 4K71B 1V7ML 4R26H 4NRYA 4QRPE 2EDQA 5DHYA 5L88L 1WF5A 5D72L 3O6KH 3TBTB 4DZBB 4D0CA 2BERA 4GMSH 3TYGH 2YMXL 2ZNWA 2MHAB 2Q7NA 5HGGS 1UM5H 1HH6B 3OGOE 1JNLH 3D39A 4JFFB 4PJ9B 4F58H 1P2CB 2CDGA 2EH8L 5D9SA 2OYPA 3HE7B 4RNRA 1L7IH 4XPFH 3RGHA 5DEFB 4Y4KA 5TE7L 4PJ9D 3VMNA 5MEOB 5L2KE 2GJ6D 4KQ4L 4OZIF 3MFFB 3LEXA 3K4DA 5A40E 1OP3K 3F7VA 3M07A 4C59B 2BVOA 4ZQKA 1MF2H 1R0AH 4LSQH 1YNLL 1MH5B 4GSDL 5CEYA 2BC4B 2AK1H 2YPKA 4MCYB 3HCVB 3O41B 1D5ZB 3NPSB 2OP4L 1XCTA 5I17B 3BESR 3X12A 3T65B 5HYSB 3WIIL 3QUZC 1EUTA 1TXKA 1LK3H 3ALXA 4KQ3L 2CLRB 5I1CL 1MJJB 1ZV5A 4RFOL 1FBIL 1FJ1A 4R8WL 4CBPA 1A6VL 1X44A 5DT1H 5IF0A 4TQEL 4N90E 2VTFA 1JPST 5D1ZB 3UTQA 3AS2A 1MHEB 2YOCA 4U1LA 3OXRA 4NQEB 1RZIA 5JW4N 3VGFA 1XGTA 2D0HA 5EO9B 4PJDE 3WLBA 2QADC 4Q7DA 3FO9A 3AS1A 2E7MA 1BZ7B 4TPRH 1VHPA 5EU3B 4MA8L 5GRVK 4WCYL 3RPIA 4XCFH 2UY6A 3CFEA 5DUMH 3BVNA 3NIDF 1NEZB 1UWEH 5TGBA 2VSCA 3GRWH 1I8KA 3QPXH 1UZ6E 4PJBB 1J1PL 2ATKB 2GTWA 3BH8A 1KYOK 4XH2B 4Y0GA 5D7SL 3S88H 2BSTA 1B3JA 3V5KB 1YMHA 3TO4C 4YXLL 5MENA 4JRXB 4P49A 3JWDL 35C8L 2R56H 1ORSB 1IFHL 2CGRH 4XNZB 4Q9CA 2IAMB 4F33B 2OK0L 4LDEB 5JHDB 3CPLB 5DFTA 4ZXBB 3UTTB 1WBXB 4KMQA 4M7KH 4V2BA 4CMHC 4H25B 1BWMA 4NPYA 3RPIB 1MEXL 3G04A 4Z7UE 1U3HD 4EUPG 4U3HA 3OJVC 1DEEA 3HUJA 2WQRA 4HEME 5EWIL 4HV8A 3TNMB 3TIDA 5F6IC 2VXQL 1NCBL 3CVHA 4IRSD 3HNTH 3QUYC 5DD1H 1KCSL 1YEIH 5CMAA 3HKFA 3MGOB 5CEXB 3NN8A 4K3HA 3RJDA 4GRLA 1FNGB 3BE1H 3BP7A 3VXSE 1NUDA 4IJ3C 3U9PL 1A4KA 1IEAB 3D5OF 3LKPB 3I75A 4K94H 2AQ3A 3KYAA 4OFDA 1TVDA 4FQCL 4FTVD 4HSQA 1DN0A 2BOCB 2XKNB 4X7TB 3TGXA 3JTSB 3E8UH 5D7LA 3QULB 1WBYA 3NPZB 3HFML 5FUZH 3BFOA 4NNPH 4F7CA 2W60A 3MLTB 1QO3B 3B4NA 1KJ3H 4JO2L 4TNVF 2Z9TA 2R1WB 5BVJA 2G9HB 2YC1A 1MCFA 3DETC 4X9HA 1WFUA 3TVMB 5J6GB 4L9LC 2PTVA 3DSNA 4NKMB 2WWKO 2GUOB 3D0VB 3MNVA 4GRLB 4HK3N 2VAAB 1E28A 2G75A 1KELH 1A4KB 3I3DA 3QQ3A 4MJIA 3NFSH 4WNQA 1A9BA 3ARUA 2DKSA 1MCBA 1C12B 1YNKH 2DF3A 4KZEH 3IU4L 5E94A 4LHUD 1U8OA 3ZMRA 3I3BA 5ADOH 3HE6A 1S5HB 3NH7H 3MLZH 3S4SG 2YN3A 1CLYL 2XN9D 5T5FH 5CBAB 3QG7H 4O9HH 2PXYC 2CO6B 2O93L 1FAIH 4U1SB 1YEJL 5EO0A 1N5AB 1VPOH 4MSWA 2HFGL 2W9EH 1DSFH 2BSRA 3RIAK 1H9VA 5HHQB 3TH3T 5CJOH 5DS8B 3OX8B 5LGJA 4EDWH 1J88A 1QFWM 1T20A 4WUUB 1IC1A 3GMMA 3KPSE 1QNZH 3WN5C 3T8XA 4M4PA 1CGTA 1IGCL 2ZSWB 3BGFC 5I16B 2C3HA 1EGJL 4IMLB 4KJQC 4JRYA 2GTZB 4PGEB 3BDYH 1CFBA 3IF1B 1W8NA 2ZUQB 5IQ7H 4P5MB 1QNZL 3SJVA 4GT7A 1K8IA 1RZGA 3WS6A 2ICEB 4R0LA 2PTUA 3H3KA 5JPNA 2FJHA 3CFKB 4WV1C 4NKDA 1S8DA 2P7TA 3HI5L 2ZOLA 5J6HB 1JBJA 1KBGL 4K3DH 4UU9B 5E1HB 3TJHD 3GI8H 3IU4H 4OD3L 3UTOA 3OKKB 1Z0NA 5BJTB 5DDHB 2LQRA 1NMAH 4LLAA 5CLTA 3KS0J 5JHDD 1HHJB 4Z7WB 1LEKA 5J11C 3JUYA 2AK4D 4HJGB 3GSNB 3ULSB 5DQJA 2B20A 4HUWA 3SPVA 2O5XH 4JRXD 1ZHNA 5FYKD 1UWGH 1X5IA 1U8PB 1RIHH 4MAYA 1XGRA 2KBGA 3FFCD 3V0WL 3K8LA 3VFSB 3MRGA 2DQUL 5GS2D 3MRMB 3IJYA 3A6CH 1B4JL 4UT6H 3TZVB 5HBBA 2X5PA 2VZSA 3R06A 5TFSL 4NZUH 2VXSL 4DEPB 1D5MA 1U8HA 3KYMB 3F7QA 3G6DL 3MLSL 4LQ1A 4PY8I 5JXED 3QCVL 5KJRH 1WWBX 5IV2A 4Z7VB 5IB3B 4NQED 4XMPH 4BUGA 5D1ZD 4Z7QF 4U1GC 1FNSH 1HYRC 1YUHB 3RA7H 4WWKA 4Y1AE 3UX9B 3I6LD 2HJFB 1VFAA 4NKIH 4CMMA 2W07A 2V9QA 5L8LB 1QRKA 4IOSD 3O3AB 5EIIA 4ZFGL 5L9DH 3DIFA 4P2RA 2VQ1A 2EDYA 2BY0A 1BMGA 2GK0B 1PLGL 1RJYA 2UUDH 3MGTA 1AI1L 3VI4E 5TE4H 3ES6A 2ED9A 5DJXB 5K9JH 2EO1A 3HAEA 5E8OA 3BQUC 1BZ9B 2V6HA 4JRYD 4QWWD 1LEGA 1A7PL 4GG6E 4XVSL 3S8WA 4EKXA 4Z7VA 5LAXB 1SBBA 3MX0A 5FA4A 2PW1B 2VXUH 2N7BA 1SYSB 4JFOA 3MV9E 3FO2B 4X99A 5GSRB 3QDMD 5ENWB 3LQZA 3O3AA 2HG5B 3O3BA 3HMXH 1ETZB 5ISZD 3QUMA 1F90H 3NFPB 4O2CB 1G9EA 5IKCA 1F4YL 3BZDA 4UINH 3OBAA 1N6VA 3L7EB 1WAAA 4GKZA 5DJDA 4OQ1A 1BQLL 2KQNA 4RGOL 1MCRA 2YWYA 1B0GB 4Y16C 5IVXF 1VEMA 3D39E 5J12C 2PYED 1GZPB 1BFVH 3CFDB 1F11A 4PLKC 3PWUA 5E9DA 1VERA 1TPXB 3QIWC 1E6JL 3PQYD 2Z31B 1TJHL 3W0WA 2C3GA 4ZPVA 1FFOB 5C3TA 1AD9A 1AO7A 4LQFL 4CVXA 4PJCE 4KJWD 4Z6AT 5SX4I 5IQ9B 2D03H 4APQD 4NO0A 4JN1H 5C9JA 4WFFD 1JGLL 3MLWH 1CLZL 4JKWA 3DSFH 3MUHL 3GJEB 4M6ML 3CD4A 5SX5K 4N5UA 4U6HA 2X2YA 4I77H 2EEBA 4TSBL 5DZOA 3V7AG 1CT8B 3C6LA 1TITA 3QEHA 4I4WA 1UEMA 1EFQA 4WDIB 5GS3A 1IGMH 1KOAA 4XBEL 1YEIL 3N85L 4X4YB 2FLBT 3LD8B 3MNZB 1DBAL 2K9UA 2XA8L 3MV7A 4MJ2A 1V3KA 5INCB 1JN6A 4GRLD 4JGJA 4AG4L 1KIPA 3ZTNH 5I76A 5GZOD 4JAMB 1P7HL 1U8LA 3G5XB 4GRWF 1N3NB 1NCAH 4DKEH 1EMTH 1UKQA 5DLML 1ZLWK 2X7LB 1G0DA 4NZJA 4ZXBC 3WDHA 3A6CL 3D3VE 3DO7B 3P9LA 5CJXA 1IC4L 2OX5A 4G80B 5F6HJ 5T3ZE 5I71C 3RWDA 3UBXI 5F1SA 4TYUA 5IEKB 3C2AH 3G5YB 3QQ4B 1B0WA 2F8XC 3S34H 5TDPB 1LVEA 2YHGA 1QSFA 3DNKA 3FQUA 5CEZL 2R0WL 4FTVB 4OGYH 3O3EB 1PD6A 4PRDB 4AEFA 1ZKAA 4XCEA 5D7SH 2R0ZL 3S88L 4PBXA 1DVFA 4L29B 4U2YA 3TBSB 3CZFA 5AAWA 3LRSB 2VXTH 4MD5B 3S5LB 5CS7A 4KKCC 4JREB 2F54A 4R7NB 1I7UB 4DQOH 2YS4A 4NN5B 3HC3L 5T33L 2MTPA 4XC3L 4KRPC 1EFXB 3QIBD 2ERJC 4NO5A 4M6NL 3C8KB 3DX8B 2HMID 5BZWA 4LHUA 3VI4F 1U93B 5IFJA 2W0KA 2CPCA 4G8IB 2IJ0C 4PP1D 4WUKH 5CGMA 1U58B 3LZFL 4HX1A 1HZHL 3PGDB 3DYMA 3HUJF 3GMRA 3HUJE 2FH6A 3OG4B 5TPWL 4AEHL 3D87B 3O0RL 4OZGB 4H5SB 1MAML 3RY6C 1I1CA 3GGWA 4XTRD 3HC0A 4R7NA 4X5WB 2V17L 3A6BH 3FCTA 5FGCB 4R90L 2QHRL 2D4FA 4PJ9C 2RFXB 2E5EA 3CMOH 5T3XE 3D3VA 4XXDA 3H3PL 1XGUB 4KKNA 1TCRA 3RIAF 5DD3H 5JIPA 1N64H 4GKNB 1X6LA 1A1MA 3KPNB 1EPFA 4WEBH 4YC2C 1AC0A 3LN5A 3CVHB 4JDTH 4G9FB 5CAYB 1FZKB 2HRPL 3BH9A 3D25B 2EDNA 2VLKA 3WLWC 3SDXF 1VFOA 1ZLUH 4ETQB 4P4RB 2J2ZA 5I8EA 5GGVH 3B9VA 1EV2E 2CDGB 5EC1B 1F4AA 3W81A 2R2BA 4E41E 5IHBA 1DFBH 1BP3B 3DBXB 2DLHA 5A3ID 4RGND 4LVHC 4HPOH 1QRNE 3VFVB 1A7OL 4YDKL 1UXWB 4P5TD 4OGXL 1SJVA 3LN9A 4RIRB 1OD7A 4P5TC 1AGEB 4JKPH 4P5TA 1KB5L 2CLVB 1UACL 3NA9L 5GGUA 2VLJE 1O5DT 2V2XA 5C0RH 1JJUA 4MS8C 2UZXB 1CF8L 3D2UD 4N68A 1C08A 3WS3A 2FNBA 4PRNB 1DQLL 4WO4A 2IH1A 2PYEB 1GXEA 5C7XH 5J6GA 5IB1B 3E8UL 3MRIB 1KIQB 2BY1A 2KQMA 3BJ91 3OJDB 1SVZA 2XYCA 5C0EA 3IFOB 4Y89A 4DKEL 1FL6A 5C09A 3OHXB 1UM4H 4Y2DD 3MRDB 1AGEA 3CDCA 3JVGC 5KVDL 1BF8A 4YDVA 1RZIB 5MP6H 4X5XA 5HI4D 3BDYL 5CP7B 1XGPA 1URLA 3ARDC 4R2GB 1G6RH 1XIWB 5KZCD 2C7UA 4NRXA 1EEYA 1BFOA 1CS6A 1NC2A 2H2PC 5KSUB 2NY7L 4MNQB 2PR4H 2ARJA 5D2NB 4PJFE 4EBQL 5BMFL 4Q6IA 2XZCL 3ARRA 5I75B 1ZXQA 3SDDB 1MFBL 2VLRB 1CDHA 4FXLA 3SDXA 3RPKA 3Q5OA 5EFIA 3T0WA 3D6GA 5IM7B 3ARBA 2D3VA 5CIPA 1TZGL 3SN6N 3QWRD 4HW6A 1DSFL 4C4KT 4RZCB 8CGTA 4YHYC 3LZFH 2XXMB 1IBGH 4G3YH 4F3FB 1F6LL 2FCBA 3RP1A 2XZCH 2MWCA 4KKCD 1QLRA 4ODVH 5D1QB 4K9EH 1NGWB 3BZ4B 1HHGB 1AQDA 4WUUD 5CFHA 3V6FA 4K2UH 2DICA 4PV8B 2QTEA 1YDPA 3OR6B 1NCCL 2L7UA 4QOKE 2GSGA 3BE1L 5TF1L 1DBMH 3WN5B 5D93C 3CXHK 3PP4H 2NY5C 1LO5A 1PBYA 1TZIB 4RMRA 1NAMA 4X8JB 3NVQA 3WNNA 4TPRL 4X6DA 5C8JA 1N4XH 3PNWA 1CLOH 2F74B 5CBEA 1MVUB 3W5NA 1D9KB 5TDOA 2F58L 1KJVB 3R8BB 1BGXH 3GSQA 2R0KH 3PQYA 4KV5E 4LNVA 4X4XA 3VFUB 3D2UA 1AFVL 2DM7A 5EUOB 1T04A 1YEEL 4HJGA 1TIUA 2XY2A 1FP5A 5D1QA 2W65B 1F8TL 2VQUA 3SDCB 3UPRB 1VCAA 2QQLH 3BAEH 1HHGA 2Z92A 4K94C 1DQML 4X7TA 1NEUA 1A7NH 2I27N 1GGBH 4BSJA 1IKNA 4LLYA 5L2KD 1CDJA 4OZHB 4QHNB 2OTPA 4HIIA 1U6AH 3G9AB 2AW2A 5L2KA 3VXUE 4HDIB 1FORH 1DL7L 3K2UL 4JKPL 5JZ7C 4KPHL 4POUB 5IVXB 5ESVA 1CICC 2APBA 2GYSA 2P8LA 1CXIA 1A6PA 2DQGL 2LFGA 2NXYD 4CAGA 3WIFA 4LNRA 4AENB 2BJMH 1Q1JH 3BZFA 3DGCR 3ISWA 3MOBH 5TDNA 1ONQA 1MVFA 1I4FA 1B6DA 1F4HA 3ZKQD 4E42B 2PCPB 2NY0D 4JVPA 5CJOL 1E6OH 2QKIA 4DZ8A 5D5MB 1CGSH 2LABA 4DEPC 3BGFB 4PR5A 4G7VH 2X44D 1EJOH 3HZKB 5JXAH 1QSFD 2ZOKB 2EYRB 2OTWA 4M3JA 1MUJB 3VXMB 2PYFB 1IC7L 3HS0B 35C8H 3EFFB 4HWZA 4JG0L 4HCRH 2JCCF 4ONGH 1N6UA 4HF5L 3WIHH 4QEGA 5MP6L 2G5BA 2VZVA 5LVEA 5D6CA 1C8PA 2J8OA 5CZVH 3V7MA 4NT6B 5BV7H 2NXYC 1QSEB 4JY6A 4LIQE 1JZ8A 2XA3A 1D5BA 1G7LB 1H3UA 3ZKND 3QRGH 3FMGH 3EDEA 3DETD 3JV4A 1WLHA 1KEGL 4AZ8A 4OV6F 5MHSD 1J8HE 2C1PA 1LK3L 3HNSL 4OLZL 2Z93A 1FYHB 4BFEA 3LQAH 5AYUH 1VGEH 3VRJB 1BZQK 3BEWA 3REVB 1AE6H 5GS1A 2IMMA 5D7IB 5IGXL 4W70A 2F8OA 1KC5H 2I5YH 1L7TH 2LV4A 5LCVL 1RZKC 3KNBA 5TE6H 1HH9A 1UWGL 2EDEA 3W9EA 1N0XH 4A6YA 3M45A 1RIHL 3DWTA 3VFGH 1CIUA 2CUMA 1YMMD 2Z35B 5SWSA 2DLTA 2DJUA 4F80A 5D7LE 3KVQA 2RAMA 1GGCH 4G9DB 4NZTH 5GS0L 1JV5A 3RZCD 1JWUA 1JK8A 5D6DC 5LCVH 5DK2B 2VLRD 5C0DA 1U36A 4NQSA 3L3GB 3HNVH 3RTQA 2NX5A 4GS7C 4IS6B 1VFUA 3N1QC 4IRSB 3VU2A 4JGUA 1IEBA 1HINL 3BRGC 4J6RH 4Y4HC 4N9OB 3S35H 1WGOA 5INDA 4BSWA 2Q86A 4NJAH 4JFEB 4CNIA 4R2GD 1T2QL 5ANMA 3QXAB 1ZLSH 5I1AB 1HHIA 3O2VL 3X11A 4QO1A 4P4KD 2ADJA 2X1XR 1U91B 4XCCL 3ARGC 4MWFB 3TBTA 4DZBA 4M1DH 1T66C 1GZQB 4N5ED 5SWQA 3HRZB 2WP3O 2J6EL 5I73C 1BLNA 1NGQL 1S9VB 2VDPH 1BD2A 5FEBA 5FYLE 3HE7D 4MA3A 3QI9B 3EHBC 5E70A 3OGCB 2E7CA 5A1AA 3GMOB 4P59L 1HE7A 2Q8BH 3SKJH 4RFEB 1NFIB 3NAAH 1A14L 4LCCB 3C8HA 1RUML 1W72L 3VWJD 2PTTA 4C83A 4G6KH 5LQBL 2MQCA 3EDJA 4IMKA 4M1CC 5T1LA 4YXKL 3GHBH 1FZMA 4MDIA 1RUQH 2E27L 2X1QA 2AJXH 3MO1B 4PJ5A 3A0OA 3L5XH 4HK0B 5B8CA 2ADIA 4PRHD 4WI5A 1T0MA 3MUJA 1IRAY 4LRNL 4P23D 1AFVH 3PHSA 5SWQB 2C3WA 4I2XE 5EO1A 1X5JA 1L6ZA 3DROB 4KROC 4D94A 1IGTB 2OL3H 3OXSA 1BD2B 4PGZA 5CGTA 2VO5A 3FOLA 3B3IB 5D2LB 1CVRA 1CXLA 3QPQC 4I18A 5KS9A 3TH4T 3LQZB 3BGMB 2F53E 4O51B 2A9NL 2AGJH 3QJFB 4TTDC 3WFBL 4OFKA 2DQDH 2DBLH 3WV0A 3NMEA 4CVZA 3ILQD 3TCLB 2SEBB 1G7IB 4J8RA 1FNSL 1ZS8A 3RAJL 4WI8A 2LVCA 5B39B 2PXYA 5CUSH 4PJHF 3FHAA 4PG9A 4PRIA 3U36B 3MLXH 1KG0A 5SWZE 4OF3A 3NH7L 3RVXD 1OTTC 4JR9L 4JQXC 1AR1D 3DGGB 1M7XA 3UEZA 3KPSA 1T0NB 5J13C 3V95A 4P9HC 4MVBD 1CR9H 2QSCH 4CRPA 4ELKB 1JTOA 5DRZB 4ZTOL 5IJKA 3HZYB 3LSOB 1OARH 2YUVA 4LCUA 5JMOC 4HH9A 3QFJD 2DYPD 2EE2A 1R3JB 4LCWB 4OZIA 1TFHA 3Q48A 4X4MA 1DEDA 2Q1EA 3EGSB 3REWB 3SOBH 4Q97A 5M7QA 4HCRL 4LFHD 3SE8H 4Z78B 5GGSY 3SDDC 4HF5H 1AQKH 5F1NA 1G84A 4F7EA 3U48A 1IC4H 5GZNC 3QFJB 1S7RA 4X6FB 4F58L 4LIQH 5ICZB 1I7TB 5E9DD 4NZRL 5KTEL 1S7WA 1JPTL 4MLIA 4YGVA 5DO2D 2Y72A 3GM0A 3NZHL 1X3DA 3VD3A 4GJTB 3NBNA 4DUVA 1SM3H 3BP4B 1TQBB 2R23B 1IAIL 2VERN 4M5ZH 2VLME 4OFPA 4F7MA 2N56A 3UO1L 3D3VD 5J57B 2JCCE 5FDYA 5I1LB 1SYVB 1BQHG 4XAWL 4EBQH 5BMFH 1MWAH 1KTDA 1OAXH 2J88H 4RBPK 3GJFB 2Z91A 1NCBH 3P0YL 4P23C 2HMIC 3OTTA 5I1EH 1I9EA 1QTYT 4QT5B 5DI8A 1TJGH 4ZFFA 4FZEH 1TZHB 2XWTA 3K2UH 4OAWB 1KLFA 3P4LA 4PLNC 2D9CA 3O6FB 4IHOA 2VUYA 1NGQH 4U6VL 1FZJB 2VXUL 3LEXB 2DKMA 3U1SL 1U41A 4XNMA 2EIZA 2O26U 4XAWH 3MV8D 4ZSOB 1PY9A 5IT2H 2V5YA 3FTGA 3SGKC 3C9NB 5I8CA 4GUPA 2C3XA 3RUGB 4WFGE 2D2OA 1A9EA 3VE0B 2X4QA 2CDEB 4FFVC 3DX8A 3RWIA 2IBGA 4PJCB 1XCQA 3H0TA 5E2VH 4IM8A 2WWMD 2WIIB 1NEZG 1CGSL 4LAJH 3SKNB 5IT2L 1QA9B 1G7HB 1KCRH 1I8IB 4OF7A 2DKUA 3P4NA 1BBDH 3LHPH 3LKRA 3O2WL 3AGVA 4HKJA 2W9DH 4WO4D 3DI3B 4K3JH 1MQ8A 1WC7B 4DN3H 3HI1B 3STLA 5F7KC 3FQNA 1IGFH 4R2GC 3X17A 4QXWA 1HI6B 3TJHC 4P46B 1KELL 3W39B 1T3FA 1JWMA 3DRQB 3FCTB 4YEEA 3NFSL 5CEZE 5E2WH 3TFKC 4WHDA 3FRPA 3W2DL 1TMCB 3QI9D 4MSWB 1I7ZA 1ODAA 3WXVH 1T80A 1PG7H 2YSSB 5KVMC 4RWHA 2CKBH 2VKWA 4FN0A 2ATPB 2OL3A 1KENL 1CLZH 3WYRA 4PJHE 2JJTC 4MAUH 1HWGB 2ADFL 2P5WB 4X6DF 1CD9B 3RU8L 1I8IA 2VDLH 5CGYC 1LE9A 2X05A 4FFYL 1N8ZA 4EOWH 3L6FB 2D7PA 5DEGA 2VR5A 3NFNB 5DJ2A 3W2DH 4LAQL 3VWKB 5ITBL 1CN4A 3VFOB 2HT4D 3W0WE 2D31A 3QFDB 2UWEB 3EO0B 4RQQB 3LS4L 4YHIB 4MAUL 4GS7B 5FKPB 1H3PH 2Q8AH 4Z76B 1F4XL 3EOBA 3S4SA 4KK5D 1HHHA 3PP4L 5L88H 4PRPD 4XMKL 3M17A 1L7TL 3SQBA 3GSUA 4IOIB 4JPKL 4YIQA 5HI5D 4F15B 4L4VB 1MCIA 2IQAB 1YMMA 5SWSD 5EU6D 2W38A 3FQTB 5JLZA 3MLVH 5J3HD 1ORQA 3RNKB 1CDYA 1FVCA 1OGTA 2JJUA 4TUOB 5FOBA 5EOTB 1CFNA 1AP2A 1P1ZA 2HJKB 2YRLA 5D1XB 3ZKMD 3ARGB 4HG4K 1S9WB 3P0VH 2NY2B 5E4EB 5BQ7A 3BKMH 3MV7E 4OM1L 5LG1A 2VDNH 2V2TB 4M8QB 2GFBA 1WZKA 2YD5A 3T0BA 5CUSL 4GKSB 4HIJA 1GPOH 3ZE2E 3WUZA 4ZS7L 4MJID 3PL6B 2NY4B 4JZOA 4M6NH 4Z0BH 3MRDA 4KI1A 2BVEA 4ZAKC 4UIMB 4Y4KB 2VKXA 1CIDA 2Y07L 3C5ZB 1AHWA 4Y4FA 1MLCA 1AO7E 2OZ4H 3OJMB 4MA8H 1X7QB 4PB0L 1NAMH 4X5XB 4WRLA 4ZOAA 3WFZA 4YJZL 4MA7L 2J6EH 2FR4B 4EUPH 1NCWH 1JGDA 1OGAE 1CE6A 4TVSa 3X14B 3KDMB 1Z3GL 1KACB 3H42H 4R7DA 3VH8B 1IBGL 4KDVA 3H8NA 4ZFZB 4H0IA 3RI5K 1MWAA 4O9HL 5IBLC 5DK0A 2VDKH 5F88A 1OQXA 1WIUA 4LF3A 4NT6A 2VXSH 1IQDB 4JFQA 2BDNL 1QRNB 4S1DC 3UC0L 1Q94A 1NCAL 4NO3A 1ZT1B 1G7MA 1X7QA 2XZQH 1MFEL 3HR5B 3KPOB 3EOYG 3MUY1 4KI5D 3GSOB 4TVPL 4NQCD 4H8WC 3VFNA 3BWUC 5AWNL 5ICYB 3U4EA 2BK8A 1KPVA 3BP6A 2EDXA 4P2CG 4XPGH 1OCWL 4LPTA 4ODWB 1U8IA 3NCYP 1J0JA 1T1YB 4J1UB 3ARFA 1G7JA 4YAQB 3HZVA 3T8XB 5E5UB 5F3HA 5CLWA 3B9KD 3TWCL 1KFAL 2FL5B 3IFNL 2FIRT 4S0SD 5EUKA 4XB8A 2DTSA 3PWPB 4PJ8A 5ADPL 4BQ8A 4HBQA 5IVZB 4CL7A 4Y4HD 2BVUA 2RGSA 4MD4A 3OV6A 3NAAL 2GW5A 1U8JB 2A6KA 3BIBX 1YEDA 5CHNB 4HWBA 4Z77A 3H7BA 4X6EB 1OTUC 1JRHI 1OB1A 4N8VG 3SDAD 1BBDL 3LHPL 1CU4L 4YAQA 4F7PB 1M7DA 5C0FA 3F12B 3AMKA 4RRPG 2VLRE 1MHHA 2P8MA 5JDSB 1EHNA 2F8VA 5JOEA 5HSFA 1Q9OA 1HHKA 1INEH 3KHQA 4R90H 5L2JB 3UZQA 1PSKH 4MJ5B 2XN9B 1FH5H 2FECI 3ARWA 4HXBL 3L1OL 4QTIH 1IZJA 2VITB 5FO8B 4PRBA 3ROOA 3RL1A 4QGTA 7FABH 4XWOC 4JFYA 3ZE0F 4HIHB 5IBTL 2EDKA 4NNYA 1CFVL 3HPJA 4OCNC 4FABH 1PZUB 2A0LC 4RMWA 1PSKL 1DLFH 1NMBL 3C5ZD 2GHWB 2PR4L 3EJJX 3F5WA 4QOKD 3L9RB 2DIJA 3QXTA 2F53A 2DBLL 4KRLB 1NUFA 5CZVL 1OB1B 4HJJL 5ID0A 1H8SA 3MA7A 3TVMD 1CVSC 1KGCE 1OHQA 3AFLA 3GO1H 3F7RA 3VGAB 3C5JB 1R5WA 4L4TA 3TVMA 5DUPH 1MHCA 3WJLC 3EYOB 4B5EA 3MCKA 4NHCL 3TA3B 4PGJA 4Q9QL 2NLJB 4KY1H 3O4OB 1ED3B 2RR3A 3FT2B 2E3VA 1J10A 3T0EC 1DQQB 4HS6B 3QAZC 5F9WC 5F21B 2OSLB 4KKLD 2NY2D 1CWVA 1F00I 3T77A 4MJIE 3TO4B 1IJ9A 1VPOL 4RX4A 5E8EB 4E5XA 3QXDB 5F1KC 5FF6B 3IS1X 3MMEB 1CR9L 1AXTL 2QSCL 3C6SA 3IFLH 1S78C 4LLWA 2IAND 2ENSA 3NCFB 5DEFA 3MJ7B 5I8OL 3DUSB 1B6UA 1EVTC 1MCOL 5GSVA 1DLHA 2BJML 3ZKMC 3VA6A 4Y5VA 3VGBA 3QA3A 1T4KB 5K9KA 3P11L 4QNPF 1NC4A 4LPCA 3GMLA 4XC1L 1B2WH 2MQ0A 4Y4FD 2BHUA 3CCHA 4K23H 4YX2H 5HHOA 3BYYA 3O8XA 1I3RB 4DGIL 2DQDL 3U4BL 2ORBH 4HC1L 3VWKC 1D5ZA 3MCG1 4XCNB 2HT3C 3PHQA 4G42B 3V6OC 4P2OD 2XWJA 4LCYB 3IDIB 1QBLL 4XNYH 3VI3E 4HWEH 1KJMA 1T2XA 2J12B 1IAIH 4G5ZH 2VC2L 1I9JH 2AAVA 1AXSA 2BVYA 3VXRB 4KKBC 3DMMC 5IW1B 3ARPA 1GGTA 1KGCD 4K3EH 5I73B 3H42L 2JK5A 2Y1VA 3QO1A 4PV9A 3KWWB 2XNAB 1HOCA 3CCHB 3CFDA 4D9RE 5IMKB 2EYSA 2XKSA 1OY3B 4OBSA 4U1IB 2D0FA 3CFIC 4YPGB 1IVLA 4MMZC 2NY2C 5E4EC 5C07D 4ZD3L 3L3JA 1A7QH 1X5YA 1IM9B 3QHTC 2QBWA 3X11B 4P59H 2OI9B 2NR6C 1IM9D 4P46C 1TNNA 4JKKA 4WFEE 4JQVA 2AJSL 4JY4A 5D1XD 4FG6D 4LOUC 4E9LA 2JELH 4G8FB 2IQ9L 2O5YL 4XCYB 1N2RA 3PWLB 4MHHI 5CZXC 2YPKB 1I9RH 5F9AC 3RY5A 4XVJL 4ELMF 5DI8B 1HEZB 3BKJL 3IXTB 4P2QE 2YUXA 5I1KL 2O5YH 1ZHKB 1PY4A 4KUCF 2YD7A 3GMPB 4P2OB 4XVSH 4HBCH 1KFAH 2OR8A 1ZT4A 1WBZB 2GSIB 2Y5TA 4WGVB 5C2UB 2AERT 3KPRB 4ZFGH 2AJZA 1CE1L 1A6AA 5DD0H 5C0CB 1UYWL 2V7NA 3MRQA 3EYVB 3FFDA 3UTSE 2HTKC 3DVNB 3TT1H 4GAJL 3HE7A 3OKLB 3OKEA 5C09B 1LEIB 4YQXH 5DQ9B 3O2DA 1AD0A 5BXFB 1FE8H 4QRTB 5MERA 3TBSA 3FZUC 4RISH 5BCAA 3FQNB 3D85B 4PJAB 4FNLH 5HYQB 1QO3A 2EXYD 3BMVA 4HKBA 1KCUL 1TVBA 4NQCE 1LO3L 1WBZA 2Y5TB 2J8UA 3HAEB 5E8OB 4ZUWA 1NAKL 4NQUA 1AIFB 4D9QE 1S7QB 2N4IA 2X1WL 2R39A 1LO2H 3WEXA 4L3CA 2CKBA 1GSMA 3PIQB 4M48L 1YPZE 1VFMA 1XH3B 3IGAB 5EBMB 5IFHH 1FGNH 3RZCA 4YLQT 2VLLA 2VLRA 3OKLA 5FHBH 2YR3A 4M6MH 1E27B 1T5WB 5EZJA 1HXMA 4FQ1H 4HUVB 3UJTL 4PYHA 2BNRA 4R3SA 2X40A 5A2FA 3MGOA 4DCQA 1RULH 3EOBB 3QT2A 4LVEA 2DD8H 2V7HA 4KK8C 1INDH 4N8CH 4YHKH 5D7KD 2K1MA 2FGZA 1LD9B 2VLJD 5IFAH 1AQDB 4JZJA 3ZYZA 1FVDB 3D3VB 1NUGA 1DE4A 4XXDB 1P69B 2ICES 3PF2A 3CSPA 3RAJH 4Z7UF 4GKNA 1FG2B 1AGDB 1NGZB 3ESVF 4ZPTB 4PB9L 1INDL 1ZHLB 4K8RD 4OSUH 4CUCA 5I1EL 4P57B 2UWEF 3BKYL 5DRXB 4D2NA 3L7FB 1AJ7L 4M8VA 3BPNC 2X70B 5L6YH 4NNXB 4XPAH 3AAZA 5E8NB 1XF5B 1ORSA 4IRJD 4JANA 4G8GA 3QWQB 5BO1L 1K3ZA 1PKQA 1NBYB 1H15A 2UZIL 5T1LD 3BEVB 3Q5YA 4HQQL 1U95B 2A6DB 2EEDA 1A21A 4UIKH 1IGJA 5IMMA 2O61B 3L3IA 1RK1A 2ZWLT 1LO2L 4P2QA 1VFBB 3G5VB 5JXEA 3A67H 1VENA 1BVLB 4RFNC 1OAQH 5FO7B 2DQHH 3RJQB 5C2BL 5DURB 3BRFA 2BRRL 3QEQE 1RIVL 4F2MB 1A47A 3RUGA 5JIIA 5KSBF 2IG2L 5F9WB 1KN4L 1TETH 3DXAB 2A0LD 3AREA 1R3KB 3BD4A 5C0JB 4OD2A 2NXZD 5ESVB 5JA8B 4N0UE 4PJCF 3L3KA 4YC2B 3T4YA 4G8GB 4HLJA 4Y5YB 5IMLB 4M7ZB 2UYLA 3BN9C 3RZWA 2JF1A 5CWSB 1T83C 5E2WL 1NCWL 2Y6SD 3ULVL 4K7FA 2FX7L 2NCMA 3MYZA 3GKWL 3O3EA 2ICWI 2NTFA 3VXTB 3GJFH 4U6YB 4L5FL 3U0TB 4NHCH 3WE6A 3O3DA 5C3LD 3QULA 1JGEA 5CINH 4ODTL 1EHXA 2AXFB 4ODHL 1FL5B 4LBEA 4DVRH 3MREA 2ZUWA 1Z0MA 4LPXA 4OZFB 3PDGA 5E2TH 1BVZA 3Q6FB 5JORA 4BZ2H 2HT4C 2C7UB 4KJYB 3QIWB 4RX4D 3QDMA 4PJEE 3UC0H 3RHWF 4RISL 5F96H 1F58L 4JZNA 5IMOB 1ROWA 2DAVA 2DQUH 1U8IB 4J1UA 1EO7A 5C92A 1OM3L 4GG6A 1RZ8A 1BPVA 1S8DB 5JNYA 3IFPB 5DEGB 5J1AB 2I9LB 4PRHB 1CXHA 1JHTB 1ND0A 5D1XC 4Z7QE 1FSKB 5C1MB 4AM0A 5I2IB 4RQQA 2Y6SC 1XGQB 3QZWA 1QP1A 1NFDA 3O45B 1X5HA 1RZJC 5GPRA 5ITFA 5GGTL 2E6QA 1D6EB 3RWJA 2DLGA 2RFXA 2NXZC 3DRTB 1FIGL 5EULV 3VRLE 1CFVH 4G6JL 3RHWK 4DFIA 1XF3B 4MD4B 2NY1C 4YHZH 5ESAB 5T3ZH 4PJIB 3UO1H 3NIFE 4N0FB 3TNNA 1MRDH 2BOBB 2EC9T 3DUHA 5DRNB 2P46B 4ZO8A 4APQA 5KG9A 4OLEA 4HZLA 3UPCA 3IDGB 3S96A 5F3BA 2ATKA 1H5BA 3T0EE 1J0HA 5E6YA 1J8HD 4HXAH 3MJ6A 2QEJA 4JM4H 3VA2C 1JGVH 1ZTXH 4Y2DC 2YZ8A 3HZMB 5TDOB 4NWUL 4PB0H 5A2LH 4MA7H 4PJIF 5DJCB 4ODSL 4ORZC 3IF1A 4PRPB 4Y7MA 4D3CH 3ZDYE 5C7XL 1NJ9B 1EBAA 3FB5B 2ZG3A 3LDBB 4KPHH 1IZKA 5I66B 4RIRA 5FAAA 4U6XA 1CD1B 4XZUB 3BN9D 2P45B 4PJHB 3UXFA 3TBWA 2P8PB 4PJFB 4Q74A 3QIUB 2VLJA 5LBSL 3WHE0 4PJ5E 5KSVB 4E0RA 2CLZB 5AZEL 3ZT5A 3BZEA 4HDIA 4KDTA 2QSQA 4N8VA 1AXIB 4JHAH 5IVXA 1FBIH 3MTRA 3FT2A 3BKJH 4KRMB 3UP1A 1RJLB 1AKJB 3SE3C 4HUWB 1W8OA 4YHPA 4LF3B 4LARL 1JGUH 1NMCC 1D3CA 2VZ1A 1FV1A 1A6ZB 1Q0XH 4U6XB 3OAYH 4LLQB 2ZSVB 3SDAA 4Y5XA 4PJHA 3MRCB 4S1QL 2ZJSL 5KSAA 5I30H 2NY6B 4UV7L 1OP5K 2B1HH 4Y5VB 1JGLH 3MLWL 2X4UB 3HG1B 3BMWA 3ETBF 3PDOA 3DV4A 4HGKC 3I6KB 2B4CH 1T5XB 4I77L 3TESA 4Z8FH 4K8RC 4NWUH 5HHVH 2IALA 4UBDC 2J8HA 5EU5A 4C4KO 1UEYA 1FG9C 1W72A 3T1FA 1ZT7B 2E9JA 2R0LH 3GEWB 2ZG1A 3DV6A 1NGXB 2AQ1A 4ONHB 1CQYA 4FFWD 1HH6A 2F58H 4XPBH 4BZ2L 1YEJH 3RWEB 4OLZH 4EEEA 3VFRB 4Y19E 2VDMH 3R0MA 1T89A 2EIBA 3GSXA 4NN5C 2Y9RT 1MJ7H 4HK3J 1AO7B 2ESVD 3RWHA 4EI6B 2VISA 2VOTA 1G7IA 1RSFA 2VYRE 3IJSB 3OR7A 1HSBA 3OMZA 4QY8B 5FK9A 4Q9BA 5K59F 3PWVA 4UNVA 1FHGA 3SGJC 5IVXE 4KHXH 1FORL 1T6WA 3MV8A 1ZT7A 2R0ZH 2WINB 5J1SC 3F65A 4X8JA 4PJ8C 4JHBA 2HFTA 1F97A 4ORGA 1T1ZB 3LEYL 4LFHG 4BFGA 4DW2H 4WJ5A 4Z7NE 5EPMB 3GMRB 5BV7B 4MNQD 1F4WL 1MLBB 1MRFL 3MRBA 1HNFA 4LSUH 3OB0K 4J6RL 2P1YA 4I0PC 2VIRB 4ZYKA 4LU5L 5KVFL 3U2SB 1YJDH 2YEZA 4OCSH 2ITCA 2VQTA 4YDLB 4OZIB 4QY8A 4ZXBA 1NFDE 4LKXA 2FZ3A 1UH4A 2P48B 3DI2B 1MQKL 2ED7A 4NGHH 4ZXBD 5HHVL 3WFHA 2IBZX 1HEZA 2D0GA 4QYOB 5IWLC 1H0DA 3ESUF 2A1WH 4X7EC 4AEIH 5L6YL 2YPLB 2EIEA 4ZUUB 4N90D 5F7FA 3LS4H 5C0ND 3GFUA 3ECBA 4RAVA 3TPUB 4ZPVB 5HGHB 4XMKH 5D96B 3TIEA 1NCUA 3I85A 5K9OA 4H88L 2BY2A 4BQ6A 3LV3B 3BJLA 5IHLB 4P4RA 3ZKSD 3RGVC 1U93A 4PJDB 4MX7B 5A2KH 3QG7L 2QQQA 1JHLL 4XPTH 4HX1B 1M7IA 1KEGH 1BBJB 2HTLD 5C0GB 1QHOA 1UXWA 2EH7H 3P3YA 2J4WH 4H8WL 4X9GA 2B39A 1BX2B 4CW1B 4X4YA 4DOHB 5DSCA 3PL6D 1ZA6A 1KJ2B 4YFLF 5T1KB 1JVKA 3IDXL 5D8JH 2V9TA 2ADIB 4FMKA 4HCRA 3VFTB 4HS3B 3P0YH 4MA1C 2R29L 4LLVA 1A7OH 1S7VA 1MCPH 4HJJH 1IEHA 4WW2F 2P5EB 1FQ9C 1J05A 1KB5A 5H94B 1E4JA 2CR3A 4XCNA 1G7QA 2A9ML 4ZUTA 3K4ZA 3QDGA 3C08L 5C6WH 1KCUH 2NY5L 3D85D 3R1GL 5EIVA 5I1JL 1FLRH 3QZWG 5EU6B 1YN6A 4POYA 3EO9H 2J1KA 2GITA 4JDVB 3RL2B 5AAMA 1HWHB 5GS0C 4PLOB 5DSCB 4U33A 2HH0L 3WBDA 4XPBL 1Z5LB 1FDLL 4JFEE 4P4KA 1YC8A 3Q6GL 5EDXA 3ULUF 5JW4M 5EBWB 1N5AA 3AVEA 2CDFB 1QBAA 4HS3A 5I75C 1SJHA 3ULUD 4NQDB 3MRJA 1RZKL 2EYSB 4XP5H 4I1NB 5HGAB 3SBWC 5IFJB 1L0QA 4NPYB 1NMAL 3MV9B 2R4RL 5ENWA 1I7RA 1JL8A 1KPUA 1MCLA 5HYJB 5EOQH 4L3EB 1QPPA 3WSQH 1KB9K 2VDOH 3CFBB 3B5GA 5IK3B 3IDMB 5ACZA 4OGAC 4D9LH 3VXUD 1F3JB 2R1YB 3H7LA 5HD8C 3BEVA 3DYPA 1BQHB 4PJXF 2JJTA 3EYFA 4JPVH 4ODXB 4AT6B 4RSVA 2YD9A 4IIQA 3W0WD 5HHQA 1QBBA 1I9JL 3BVNB 1YMMB 1HXYA 1IC5L 2ZPKL 2DMBA 1EO8H 4LP4A 5IESL 1AGBB 1X5AA 4M1CD 1S7WB 4PBVC 5CD3B 2J88L 5HDLA 3FQXA 1VGKA 3MR9B 3JUZA 4IIQC 4DVBA 2A1WL 2A73B 4M7LT 3S34L 3OAUH 4NQXB 3UBXB 3LKSA 3EIFA 25C8L 2I60H 2RCSH 3HPLB 4IMLA 5EOCJ 4LHUG 5HTSA 3TJEH 1FVEB 1W0VA 4I48A 2GFBB 4P2RE 4ZUVB 3O11B 2V5TA 4YZFE 3B9KA 4Q58C 2DQHL 2FSEB 5CSBA 2WMPA 4L3AA 1CT8A 3UROR 3T4AA 5DLMH 4WTWA 5HYSA 4AT6A 2BRQA 4U1JB 3IVKB 3K4AA 4ZNEE 5E2VL 3P4MB 3U46B 2BCKA 1I85A 1ZA3B 5DJZB 5EUOF 2AJUH 3KLSA 2KDGA 4HT1L 3V6BR 4WUUE 3FONB 3SGKA 4KZDL 1BIIA 1TVBB 2F54D 1VEOA 4QRPB 5EORH 3KJ4C 5KBNC 4AL8L 4HHAA 3IDJA 4QHMA 3JWDC 3MJ9H 4Z7OF 3BP7B 3BWAA 2BVPB 2BSRB 2OZ4L 4JFFE 2HKHL 4YK4C 1IAKB 4QHUA 5MEPA 1TTUA 1U6AL 1QQDA 3AUVA 4AIZB 4Y1AA 3DUUB