1MCKA

Principles and pitfalls in designing site directed peptide ligands
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
216
structure length
216
Chain Sequence
PSALTQPPSASGSLGQSVTISCTGTSSDVGGYNYVSWYQQHAGKAPKVIIYEVNKRPSGVPDRFSGSKSGNTASLTVSGLQAEDEADYYCSSYEGSDNFVFGTGTKVTVLGQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immunoglobulin
molecule keywords IMMUNOGLOBULIN LAMBDA DIMER MCG (LIGHT CHAIN)
publication title Principles and pitfalls in designing site-directed peptide ligands.
pubmed doi rcsb
source organism Homo sapiens
total genus 39
structure length 216
sequence length 216
chains with identical sequence B
ec nomenclature
pdb deposition date 1993-02-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1mckA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1mckA02
2GQHA 3PGCB 5HTSA 3NA9H 3WEXB 4K23H 1J5OL 1Z0MA 2IALA 4GRLD 2P7TB 1FSKC 4K8RC 2DD8H 2IAMC 3O3AB 2BSTA 2HFGL 2PKDA 1TPXB 1KEGH 1MCJA 1AD9B 4EUPB 2WP3T 1FFRA 4Y8DC 4QTIH 3BKCH 3H42L 4JO4H 1RZ8A 4O2FA 1YEGL 5GS1C 4ZXBB 4C54A 5FO9A 5B39B 4XXCA 2DYPA 4WHDA 4DOHB 3LQAC 1YN6A 4L3EA 3B3IB 4JFPB 4QYOA 1NCCH 5F9DC 2E6QA 1HIMH 3SE8L 1OPGH 3HC0B 1CF8L 1GZQB 3OR7B 4MDJA 3CFJA 3QUMA 3HMXL 2JCCF 2EXYD 3SGKA 2F53D 3W0WB 2P5WE 5GS1A 2OQJA 3NZHH 4R96B 3KPRA 3O3EB 3O81A 2MKLC 5JQ6H 1RFDL 5DUPH 4HF5L 2IPTL 4UDUB 4D3CL 3G5XB 5D6CA 4JG1L 2WBJD 2BNQA 3U36B 1XF3B 2ESVB 3GB7A 1RZKH 1TVHA 4PJFA 5I1GH 4BH8B 1X7QB 5IVOA 2F58H 3FOLA 1Z2KA 5HI4C 5E8OB 4OZFH 2I60L 3BMVA 3F58H 1OARH 1SHMA 4ODBD 4G8GE 4LVEA 3X14B 4BM7A 4DEPC 2I27N 4BSWB 3OHXB 3FFCA 1C1EL 1WBZB 5CJXC 1F4XH 1YY9C 4F9PA 3LHPL 3PWJB 5D96C 5C0GB 2BSSB 2DQJH 1TTUA 2DLEA 2X1QA 4ZNEE 2XZCL 1XT5A 5JW4Q 3FN3A 4KFZC 2I07A 3T0WA 2ESVE 3VXRA 2DI8A 3MACL 4HFWB 2FX9H 2EZ0D 2A6IB 2EEAA 2E6PA 3LZFH 4MAUL 5CZKA 43CAB 2BRRH 5EC2B 5CCKH 1IGJA 1CFNB 5K59E 4XNMB 1I8IB 2UYLA 4LSUL 1N59B 4FQIL 4MJ6A 4FQXA 4JO2L 2ZUSA 3REVB 3CCHA 3MRPA 4YXLL 1FPTH 3MRFB 3EOYG 3ZKXB 4PBXA 3RVTD 4NZTL 5C1MB 5IG7A 4LF3A 1U8PB 1YMMA 1FZJA 1ZGLM 1F4WH 4Y5VC 3BJLA 4GQ9L 5FKAB 1E4XI 1MAML 1A7OH 1SMAA 1KCRH 4FQLH 4ENEC 4KVNH 4CVZA 4ELMF 5DQ9B 4BK4A 1G84A 5IESH 1KELL 2WUBL 2GIYA 4MQ7B 3U1SH 2VLJE 5CIPA 2ARJQ 1JGUL 3SGDH 5K9JL 2QQLH 1I9IL 2OI9B 2YXMA 4R26L 4O9HL 4BJLA 3GJFK 1ORSA 3N1FC 1I1AC 4Z7QF 4OIIL 5F96L 1S7WB 3NPZB 1A6TA 4Z0XA 2NXYC 4FFVC 4CJ1A 5A16A 1D5ZB 5TDNB 4L4JA 1C7SA 5FYLH 1H8NA 4ZNCD 2DIJA 4Z7WA 3CX2A 3NIDF 1CD1B 1F8TH 3G9AB 1I1AA 3MV8D 3V0VA 4HAFA 2H9GB 3QDJA 1WEJL 5GS0L 4OLVL 5F9OL 4WV1B 1VGEH 4Y16B 2X41A 4NRYB 3QUMH 1A6VL 4NYLA 4CN6A 4LCYA 5L88L 2XN9A 3HE7D 4OGZA 3T4YB 3NH7L 3MXVH 2VDPH 1BFOB 1A1MA 3L3HA 3QXTA 3MRNB 2DQDL 2IH3B 4HZAA 4HWZA 4WO4D 4KUCF 4NIKB 4HKXB 2V2TB 1ZEAH 3LKNA 4NC1E 4BKLA 4Z8FH 1BVLA 5C9JA 4L4VE 4DAGH 1SJHB 4XPGH 4AT6B 4MDIB 4OV6F 1AI1H 1A14L 5D70L 1NEUA 2BVQB 4DK6A 3TVMD 1MH5B 4P23D 3V2AR 2P4AB 1KJ2A 1X44A 5IMKA 2BNUB 3L6FB 3OAYK 4U1JA 4Z7OF 5HI5C 1T21A 2UVFA 3MZGB 5MP6H 4Z78B 1GPOH 2ERJC 2P43B 1FYTB 2ITCB 3O3UN 3CFEB 4LBEA 3SJVD 4JKPL 5EH1A 4KY1H 4X6DB 3DHMA 3M8OL 5BQ7B 4M62L 4F7EB 3O4LE 2AJXL 2W0FB 1YEIL 4HCRA 3U4BH 5DJ0B 4DW2L 3GSVB 1Y18B 3V5KB 3TO2A 2PTTA 3U9UA 2JELL 4YHIB 4PJAE 1KN2L 1BEYL 2BY2A 3NVQA 3DRQA 3B2VL 2NX5A 2ARJB 4XB7A 3X3FH 1U8IA 5C0EB 5C0DB 3EO9H 1P7KB 2R2BA 4Z0BL 3W11C 3MMEB 4EIZC 2UUDH 4LHJB 4LKXA 1PX3A 4X6DE 1SYVB 1I3UA 3S4SA 5KS9E 3IAGC 1Q1JL 5MHSE 1MCEA 1MJ7L 2XKUA 3MYJB 4PREB 3H0TA 3WHXA 1KF9B 4LQ1A 5ACMA 3QNXB 2NXZD 3QO1A 4JN2A 4DKFL 4AIZA 2Y23A 3Q5TA 3L3IB 4XB8A 3RY5A 3PQYB 4PJ8C 4QHNB 4Y88A 3CMOH 1NEZB 2A6DA 1FGVH 4DWHA 4HUMB 5LBSH 1JPTL 5KANG 1AJ7L 3UPRA 1B88A 4OUUA 2HVKB 4ZSOA 3W82A 4ZAKC 5DHVA 2DDQH 3WDIA 4PJ8A 1CWVA 3S35X 3D25B 1NBVH 2DM4A 4GXVH 3OAZH 4HEME 5ERWB 2JJSC 4G9FB 4L8DB 1BQUA 2F74A 3EUUA 3TWCL 1DANU 1BD2B 2ZKHL 3CFDB 1EHAA 5HVFB 4Y4HC 1JPST 4M6NH 4X83A 2IFFH 1SVCP 2JB5L 1U3HC 4CUCA 1I7ZB 4WTWA 4X4ZA 3RWHA 2G9HA 4PLJC 3GSXB 5E6IA 3EJZD 5D1XD 4BH7A 3ZTNL 3BWAA 3WIIL 4WI2A 5IHLB 5IFJA 2G2RB 2ZP0T 5SX4H 1A4KB 1C7TA 4PJEB 4Y4HA 1I3RA 1QUNA 1RUMH 1YNTB 1AKJB 4KTEL 2WWKT 3CAFA 1CK0H 1KJ3L 4G9FE 5C3LD 1U3HA 4Q9QH 1P4BL 2AJYH 3C09B 2B2XH 2PYED 3RIFF 3MLTB 4JM2C 3WO3B 5C0BB 4LKCB 2GITB 4LCUA 5DA0B 4AIXA 1PYWA 1UH2A 1M71A 1KNOA 1OWRM 4Z7UE 1P5UA 5DO2D 2R1WA 3ZDXF 4WTZG 5EORH 1H0DA 1E27A 4OGAD 5HI3D 3IFNL 2X44D 4WFEE 4FFYH 1BM3L 1TTFA 1UWEH 3HUJB 4KV5F 4NOFA 4ODHL 4FQHA 1C5CH 2CRYA 1YUHA 3WLBA 1FNGB 3DIFA 1KB5H 3HRZB 1ZAGA 3O45B 5BRZB 1JNHB 3VG0L 2CR3A 4PRDA 4PUBH 5BS0B 3V6FB 1HSBA 1ZHNA 1D9KA 1DVFB 4WFGD 3C6LD 5KZCD 4G6MH 4GW1A 5JXAH 4KJQD 4YH6A 4HCRH 4JZNA 4J8RA 3BP4A 3UAJD 1ORQA 3SN6N 1QBLH 1GGUA 4MD4A 4F2MA 2OTUA 2A73B 4OZGB 4GFTB 3KS0J 5DHYA 5BMFL 3OXSB 3P4MA 3QQ9D 3QB7C 4I4WA 1CXLA 3KYMA 3NZ8A 5DUBA 3MJ9L 5BJTB 2XZQL 2VZVA 3NOIA 1JWSB 1RJZA 4Y19B 1FFPB 1NGXA 4FTVE 4X6FB 3H7BA 2JIXB 3OGOE 1GC1H 2ZCHL 3UTZA 3G08B 1DBJH 1S7RB 2IPKB 3QPXH 1ZS8A 3OX8B 4XAKD 5FDYA 2E8YA 5EIQA 2QHRL 4YDVA 3CXHJ 3WS6A 4X7TB 3DYMA 1MLBB 2HKFH 4JO3L 4UT6L 3VFUB 3QULB 3HLAB 4M3KB 3MRIB 1UVQA 3HR6A 3H9SD 3AB0C 3GO1L 3B8YA 4I0PC 2SEBB 3SGDI 2J5LB 4XWGL 5DHVH 1X9QA 3WHE1 1WZKA 2CPCA 3BPNB 5F7NC 2A0LC 4IDLA 2DQGH 5TQ2H 1PZUB 5DURB 1G7PA 5DD0L 5CKAA 1WIUA 4O4YH 3PIQB 4WCYL 4OFIA 3EFFB 3FFDB 1F90L 1LD9B 4I0PA 3FRUA 3QNZA 3ARFB 2Q8AH 2J8UB 5GSRA 1RPQA 3CUPA 1DDHB 3G5ZB 5GISL 1U8QA 5DVLA 1X3DA 4FXKA 5AYUL 4MCZB 1FDLH 3L7FA 1ODAA 3UTTE 4JGUA 4HKJB 3VH8B 1L6XA 3MV7D 3RDTD 3D6GA 4ODUA 3GSWB 2ADGA 2GFBB 2Q8BL 5TE4H 2H45A 1MI5A 3CFCL 1QSVA 4DTGL 5CEZH 3REWB 4XP9H 3H3PH 4AK1A 2X4RA 5CP7B 2NZIA 4POYA 3IXAB 2IH1A 1C5DA 4KRPD 5IW1B 1DR9A 4X6DF 3QUXC 1Q9LA 5D2NB 4M7LL 2MSPA 5JR1L 3G5YA 1KB9K 3JWOL 4NHUA 1D5IL 3T0EA 12E8H 2A9ML 2DMKA 2GUOA 2DRUA 1FBIL 4H26A 3B5HA 4RMQA 4AEHH 1S7TA 1ES0A 4UAOB 3T77B 1MHPL 4HT1L 5DRXB 3MGOA 4WUKL 1EGJA 2JJWA 5CJOL 5KW9H 4R7DA 3JTTB 4WI5A 4NUGL 1Q94A 4Z18A 2MCPL 1LMKA 5GRYA 3BQUD 5DEGB 1JJUA 1FV1A 3U6RB 3QUZD 1H3GA 1DP0A 1LK3H 1GZPB 2DQFB 3SDCC 2NY3B 4H5SA 3QWRD 4N0FA 3U30C 5GSVB 1LO3L 3EOAB 3LQZA 4ZUSB 1IKNC 4GG8B 4FQ1H 4J3UA 2R1XA 4M43L 4WW2B 3DX6B 3C87A 4LVOC 2AXGA 1CD9B 2AV1B 4M1CD 1CL7I 4I2XA 3RVVC 1MCSA 3FB6A 3U4EA 3LKSA 5FM8A 3BP6B 1MFBH 4ZO6A 2ICWB 1AD0B 2HFEB 4GW5A 4ODSL 2QQNH 1E4WH 1JTPA 4JFFD 3NCFB 4NCC2 3MXWL 4X7FC 2DWDA 3IETB 1UCBH 1I1FB 3QHZH 1JN6A 5JW4N 3ZT7A 5TFSL 3V52H 4H8WL 4OLWH 5DHXB 5BXFB 2CK0L 2EE9A 5L2KE 2HLAB 2HLFC 1U58B 1ONQA 2HJKB 2R29H 2YK1L 4P2OB 1FC1A 1AR2A 2R2HB 1YEFL 4R8WH 5ESVB 5ADPL 1H3XA 3P0GB 4HWEL 1BQHG 4FZ8L 4ZFGH 1R3KA 3HR5B 1IEBB 4LSTH 4PJEF 1R5IB 2LE9A 1XGYH 1S78D 3STZA 5IMMA 4POZD 3JUZA 4OJFH 2FECL 5D7LB 3KPLB 4IDJH 4CNIA 3ZKNC 2DJUA 3CZFB 4NFCA 3MBEB 3I6GB 4GAFB 1BREA 3EO0B 4UQ2A 4PRIE 3HE7B 5DEZA 5DK3A 3TFKC 1LP9F 2UZYB 4YFEA 1B4RA 4L8SB 3SKMB 4JDVB 4QKXB 1BLNA 1JF1A 3K1DA 3WUWG 3BIAX 4WO4B 5EZOH 1I7RA 1CGVA 2OL3B 3M1BB 3HUJF 4K2UH 5L0QC 3RVWD 3BHBA 2NY0C 3HZVA 2PCPB 4GAGL 3BT2H 3B83A 2VXQH 4JY6A 5JPNA 1KIRB 3OKEA 1G6RB 1F3JB 5E2TL 1TJGL 2FGWL 1UJ3C 2G5BB 1GVIA 1SYSB 3RX5A 5L7XH 1U2CA 4LSRL 1FJ1A 2P5WD 5MEQA 3HPLB 4PTUB 5GZOC 1PQZA 5IFHH 4OT1H 2XI9A 5AG8A 4PP2B 3EYSL 3I2CH 3SJVB 4PRHE 4OZGF 1HI6A 2DKMA 2XQYG 1UJ3A 4LP5A 4PBWD 1A7RL 5DJ8B 3MRBA 4F57H 2BHYA 2QKIA 1BQLL 1DBMH 1EGJH 1IGIL 4Q0XL 1R24A 4FHBD 4G7YH 3ULVE 1CG9B 2AQ3A 1FCCA 2WAHA 5MEPB 4G8GD 1NMBH 3L9RB 2C7UB 1WLHA 2EDYA 1QSEA 4PJXA 4DGIL 4LLVA 5D7JB 5IMLB 3FL7A 5B8CC 2DQHH 1G9EA 4GW4B 3GMQA 1P7QA 2FEEL 1UA6H 3G04A 4WWID 4ZUTB 4JFEA 4EXKA 3FQUA 1LHZA 1JUFB 4OKVA 4LSQH 1CDIA 2J4WL 6FABH 1RIVL 4R0LC 1JPSH 1I1CA 1RZJC 3OPZL 3RHWK 3AS3A 1OB1A 3C5ZB 1FFOB 3LN4A 2IGFL 3DSNA 1DE4A 3PL6A 4U1NA 3LEXA 2EYSB 1UG9A 4XVSL 4I48B 1GOFA 4QLRA 1OTSD 4KHTH 1PG7L 4NN6B 3IGAA 4GG6B 1NC2D 3WD5L 3MV01 2A6KB 4CVXB 1S7XB 2J8UF 3N9GL 4R0LA 1QBMH 3V0WH 2FATH 2XXCB 3HZYA 3WIFA 2ID5A 3GI8H 1QLFB 3NACH 5HHOA 3IS0X 3BZEB 2DQUL 1MAKA 1XIWD 5AUMA 5C09A 2GHWB 4N1EA 3WIHL 4NNPH 5FYJU 1GHFL 3O6FA 1XF5B 4QF1A 4U6VH 2KPNA 3C60D 2VLJD 3EO1A 2O26U 4PGJA 5JHDE 3OKLB 4N0YL 1RUAH 4U7SA 3VE0A 4FS0A 3AS0A 5D1XB 5LCVH 1H3WM 4HQQH 3OTTA 2J88L 5H37H 3QG7L 5HGHA 3RWJB 2P48B 4MA3B 1DEDA 3NCYP 4OZFB 1FZMA 1C12B 5D7SL 1EERB 3V4UH 4L9LB 1DN0A 4NQTA 3LV3B 3RJQB 1KPUA 2WMPA 1Y0LB 1FL6B 4LVHC 2ED8A 3FAWA 2K1MA 4L5FL 4XNYH 1NQBA 1YQVL 3C9NB 4P2RA 2X7LB 1A21A 2NNAB 3ZTJH 3LB6D 4U6HB 2MJWA 2BERA 2W65A 3RWDA 1F8TL 1MQKH 3HC3H 4WEBH 5ETUA 4GMTL 1LO2H 3DXAB 1HKFA 5KSAB 4XMKL 5BZWB 1AXIB 4AIOA 1KXQE 1X5GA 2FGZA 2VQ1A 2XQYK 4FQCH 3EYFB 4K3DL 3ULUE 3AFLA 2NY1D 5CHNB 2R56H 3U0PB 4X9BA 3WFEH 3VXPA 4EN3A 3CVIL 4UUJA 4WI6A 4WW2F 3SGJC 4R97C 1IC5H 1CFQA 4KK5D 1FNSH 2OZ4L 1AXTH 4XP6H 4KXZH 2GEEA 4N8VG 4JPVL 5CAYB 5IJVB 4L4VD 1G7IB 1RZ7H 4NQDA 4OLZL 5HD8D 3E6HB 4JFZL 5TE7H 4PJ5A 5BOPA 1NGPL 4JRXE 1AI1L 1LQSR 4W4NA 1T3FA 43C9B 1NCAL 1X4ZA 2PTVA 3AM8A 3ZT6A 1A7NL 4KROB 1QFWL 4N9GB 1XR9B 3LKRA 2IC2A 4ONGL 1RIHL 4FP8L 3VXOA 5ALCH 1P5VA 1QNZH 1QHOA 1XGUA 1VESA 5EULV 3TPUA 5J6HA 4IJ3C 2YD8A 3MRRB 5HJ3A 3QO0A 2BC4B 2E7HA 1QQDA 3BPLC 2JTDA 2GY7B 2MQCA 1S9KC 2BSTB 1WF5A 1UWGL 1U91A 4BSVB 5GRUH 1CXEA 1IGTA 2RGSA 1RZ8B 4O2FB 1CL7L 5BV7H 1F11B 3ABZA 5L9DL 1FIGH 5FO9B 25C8L 2DYPB 1Z5LA 3TT3L 3BDYH 4Z9KB 5CJQH 1YN6B 2Y5EA 4L3EB 4GS7C 2J8OA 4KQ3L 3F6LA 1IC4H 4MDJB 1EV2E 5MHSD 5FM5M 3CFJB 3QUMB 4RAHA 3U83A 2OQJB 3OKNA 1IGCL 1FNHA 3KPRB 3PWPA 3PWVA 2Y5TA 2CDGB 4X99B 4OF3A 2VDMH 2DB8A 4QXTB 3RWCB 2V6HA 5D6CB 5DSCB 3RJDA 3LVEA 3FB8A 4PJFB 4XT1C 2R39A 5EO9A 4XCFL 2ZG3A 2NPLX 2C4FU 1A6WL 4UNVA 4YDLB 2DDQL 2X4SA 5T3XH 2UY7A 5FO8A 3KPRE 5DQJA 2HTLC 4TNVF 3O9WA 2X6MA 5F6HJ 3ZO0A 1T80A 5DFWH 1NFDA 4ZUVA 3O8XC 2OXHA 5GGQL 4I18A 1R0AL 4GT7A 3O11A 2I07B 4XNZB 1KT2A 2BNQE 3B9KD 2DM3A 5IW3A 4WTXA 4LGRB 4MX7B 2ZUTA 4Z95H 4UU9A 1LO4L 1OQXA 1IGJB 1S5HA 3FFCE 3TA3D 4AMKL 4PBVC 2DBLH 1EZVY 1UXWA 5I19H 1X5IA 4MJ6B 4FQXB 3KJ6H 1OAKH 3DUSA 3SBWC 2HRPL 3MRPB 3VXRE 4PJBB 3QEUA 5IG7B 1AO7A 1FL5A 1H9VA 3P77A 4LF3B 4KPHH 4HS3A 1FZJB 4WFED 2HWZH 4U7KA 4DQOH 5B4MC 1Q38A 1Q8MA 4OF0A 4FFYL 1K4CA 4AQOA 3ARDC 1BX2A 4YHLH 4CVZB 3RX7A 4GG6F 1WBXA 5DK2B 1MFCL 5HHMB 2Z4QA 1WAAE 1J1OH 2B1AL 3OF6A 5DJYA 5GGRY 3WS3A 3K80A 4AYFA 1OSPH 1W8OA 3VWJA 2ICWJ 5FB8B 4JFOA 4D9QD 4WUUD 4ELKA 1INEH 4PPTA 3H7LA 4J3VA 3AY4C 1CFTB 4XPAH 1ORSB 1DQJA 3WXWL 1IARB 1YMME 2E7CA 3FQTA 3BVNB 3QIUD 3CFBB 3THML 5K9OA 2CGRH 4AG4L 1A6TB 2ILLA 3W2DH 4Z0XB 1S7SA 1TQBB 2OP4L 5A16B 4XMLH 3KR3H 4TVPH 4L8BA 4V1DE 3TZVD 1VCAA 3AY4A 4HBQA 1EMTL 1F58H 4UZGA 4Y4FC 1KCSH 2YWZA 3TYFB 4JFHE 4IRJC 4ORZC 2HTKD 4FTVD 1AGEA 2ED9A 3QDJB 1M05A 3HRPA 4P57A 4NYLB 4Q9RL 5LGHL 4Y4FA 3T09A 1P53A 4LCYB 2XN9B 2AJUL 4ZD3H 4JB9L 2W1NA 3H9ZA 3L3HB 5EO1A 3V5HA 3I50L 2HMID 2VDQL 2ARWA 2W07A 3FMGH 4OCXH 1YMHA 1RIUL 1I3GH 4Y5XC 4Z7WE 3ZYOA 3BISA 1E6JL 2IQAA 1EVTC 3SE4C 2BHUA 1JWMA 2L7JA 4G6AC 3LKNB 9CGTA 1BVLB 5C9JB 5JXEA 4KMQA 2FD6L 1IGFH 2QTEA 2DL2A 2EDTA 1TITA 4AEIL 3QI9C 5DMYA 1YDPA 3QDMA 4K55A 1KJ2B 4PRBA 4YHMH 2VL5A 1KB5B 3GBML 4HWBH 4U1JB 4L8CA 3JBG7 2Q8AL 1MCWM 3OSKA 3SHSA 1T1WA 4ZOAA 4AEEA 4BYHA 2H6PA 3UTTD 2CKNA 1MHCB 4HLJA 3ALWA 2DAVA 5GRWA 3PG2A 1J0YA 3TIDA 1YY8A 3PDDA 5B21A 3TO2B 3U9UB 3WJLC 1B3JA 2R9HC 3VGHA 2O5XH 4HPYL 1MCRA 2NX5B 3BEWA 1NAKL 5C2BL 1U8IB 1G7JA 3KPOA 3UJTL 2YRZA 5BO1H 2UV3A 2R2BB 3WJLA 2UY6A 3I6LE 4LKXB 4HAGA 3S4SB 12E8L 4KXZI 1EEYA 2OCFD 3EGSA 4F58L 5CBAB 4XP1H 4AENA 3WHXB 5L8KB 3TT1L 4G6FD 2P5EA 3QO1B 4KJPC 4NQSA 3L95A 1OT1A 4QNPE 4XWOC 3QIWD 3C5SA 1DBBH 5HDBF 4IIQA 3UPRB 3J7HA 1MNUL 4OUUB 5TPWL 3K7UA 4NN7B 4UINL 1ZTXH 4C57C 2WLYA 4P4KB 5DHVB 5IBLC 1CZ8L 1G0YR 3BEVA 1K6QL 3MGTB 3LEYH 3RY6A 4WRLA 2BFVL 1NL0L 1RHHA 4WU5B 4HEPG 3QJHA 1A5FH 3ARGD 4KUZH 4OBRA 2F74B 1ZA3B 5DRZA 4PJFF 4J6RL 4YBLC 1K2DA 5D1ZA 4KC3B 3DYPA 2Q7NA 3PDGA 4BFGA 1SJEA 4ZSOE 5TDPA 4JREC 4UNTA 1OCWH 2G9HB 5KJRL 5E6IB 4LLDB 4BH7B 1ZLWH 2ZOKA 3BWAB 3UX9B 4G80A 1KIUA 2APBA 5T1LB 1YEEH 1I3RB 2VQUA 5C86A 5L2KD 2F19L 5HHXH 4DZ8A 3RUGE 4Q6YA 3ARBD 3LD8C 4HXAH 3WO4C 5E8NB 5C07D 4LCUB 2OMBA 4R8WL 1GIGH 1M71B 1KNOB 2DL9A 4ZFFB 2R1WB 3HPJA 1I7TA 1F45A 1LE5A 1OAQL 1H0DB 3WN5C 5C71A 3DMMA 1IZJA 5HGAA 4P49A 1L0QA 4P2YA 4WWKB 2DQEL 1F3RB 4FQHB 4IDJL 3HE6C 1YUHB 5CWSA 3DIFB 1VB9A 2XKSA 4PRID 4I77L 4NOBA 3V6BR 1OY3B 4PJBF 1MFDL 3DECA 4KK8C 3TJHC 4PRDB 4K3GA 1HSBB 1OGAE 4R2GC 1ZHNB 2YA0A 2BSRA 1D9KB 5TGBA 3HZKA 3IDYB 2HT4D 4I9WE 1WZ1L 4EKXA 4GW1B 1T03H 3SCMD 4JZNB 4LRNH 4J8RB 5FA3A 3BP4B 1S9YA 3PGDA 3JVGA 2DWEA 4MD4B 4F2MB 3DETD 2OTUB 1XH3A 5BW7C 4GUPA 3VFOA 3P4MB 3VFGL 1NGWA 1RMFL 3MLZL 3S34H 3KYMB 3NZ8B 4KHXL 1LDPH 2BCKA 1RJZB 1KENL 5D7KE 5C0AA 1MCNA 4LSPL 4MA8H 1NGXB 2NY2D 3C8HA 3H7BB 4XNXH 2P47B 4QOKD 4Z7VA 4PRHD 4RWHA 3TIEB 5D6DA 4HJJL 3UTZB 1MVFA 4S1RL 1ZGLA 3QHFL 1ZS8B 4YDKH 1FP5A 4LASL 1F3DH 4YDVB 1IT9H 2M2DA 2X2YA 3BSZL 5F7LB 2OTWA 5I16A 3ULVD 1SEQL 3PV6B 3SY0A 4G8IA 1SVZA 1UVQB 3BUTA 3VW3H 1W0YT 3P9WB 4Y89A 1MFEH 4RWYL 4GLRH 1P69B 3O6ML 1MREL 1IQDA 4TSAH 1NCBL 3T65A 1WSST 3A6CH 1TZHA 3RGVD 1LILA 4QRRB 4NQUA 3QIBA 5CEYB 4NNXA 1G7PB 1ZKAA 4X8JB 4HPOL 1WIPA 3KYKL 2A9NH 3QNZB 1IJ9A 1MIML 3MR9A 2DIAA 5BVPH 4UIKL 5IQ9B 3MUJA 5GSRB 2BP3A 1HINL 2F54A 4S0SD 1T6WA 1U8QB 3DNKA 5DC4B 4FXKB 4BFIA 1SEBA 4U1MA 4GSDH 5CD5C 5DC0A 4LRIC 1G9NL 2P24A 1L7TL 1TJIH 4OZ4A 2QR0A 1NMAL 4IOIB 1N0XH 2VLRA 4JY5L 2ADGB 4UQ3A 4NZUH 5I9QC 3PE9A 1MI5B 1G1YA 2X4RB 3L3KA 3TN0C 3H9HA 3LPGA 5CP3H 3IXTA 2VXUL 2IH1B 1T83A 2VRAA 2V9RA 2Q6WA 4GH7B 1C5DB 2W0PA 5IKCA 1Q9LB 4U1GB 4UV7L 4N68A 4NHUB 4DN3L 5FM5O 3T0EB 3B9KB 4HS6A 1WICA 2GUOB 2WSKA 3D87B 1KC5H 3SE3C 3BE1H 3I3DA 4OM0L 5T3ZE 3EOBA 5JW4R 4U3CA 3T3ME 1ES0B 1HXMA 2NY4B 4OIAA 3UYRH 4Q9CA 2I9TA 2F9BT 4HJ0C 3LN9A 3VI3F 5I8CA 1NUDA 3MGOB 4N5ED 1TETH 4R7DB 5DD6A 5B38A 4P99A 4TRPH 5LAXB 4CU8A 2PO6A 2VXVH 1MFAH 5JMRA 4LCIL 1IQWL 2EIDA 5ACLA 4P5KA 1MOEA 1GAFL 1FV1B 4OF8A 1CU4L 1EUTA 5C8JA 3Q3GA 3L5HA 3GNML 1KTLA 3F7VA 4H5SB 3F7QA 4N0FB 1OAXH 3GSNH 1JHLH 4BFEA 2H2SD 4MJ2A 1A6UL 4FXGB 5J12B 1NGYA 4XGZB 4MQSB 4M7JL 3CU1A 4X6CE 4APQA 2P42B 4PY8J 2X4PA 2AXGB 2DTMH 2EEDA 4P9ML 3KDMA 3RTQC 2W38A 3BIKA 3ULUD 4Q6IC 4MAYD 3LKSB 3ESUF 2QQKL 1A22B 4UTAH 1A9EA 2XQBL 1UM4H 1BIHA 4GRMA 4KK9C 1UACL 3L5JA 3RTQA 4K94L 1JN6B 1F00I 1NAML 2YPLA 4U1KA 4Q6IA 3QIUB 1V3LA 1WBYB 5L6YL 1BFVL 4H20L 3V6ZA 1B0RA 3VWKD 2R1YA 3FO2A 3S36X 1RI8A 1X6LA 3LRHA 3IRPX 4G5ZH 1HYSD 4I2XE 3GMOA 1VFAA 4JRXD 3QUYC 1EH9A 1KXTB 4QRSA 1UH4A 1R3KB 2BJMH 4P46D 1G6VK 1GGIH 4AZ8A 1B2WH 1PZ5A 2BX5A 1KN4H 2VN4A 4R4BB 1NCDL 1R6VA 3CZJA 3STZB 5IMMB 3DOSA 3HI5H 4ERSH 5IR1A 3ETBF 1J05A 4JDTL 4TUKH 4HZLB 3DHJA 3AAZA 2WK2A 4UQ2B 3MA9H 4MQXC 3UYPA 4XX1E 2W91A 4IMKC 1A6ZA 1WISA 2D2OA 5D1QA 4FG6C 3QFDA 2YOCA 1BLNB 3F5WA 5A43C 5ADOH 3AUVA 5IMOB 4OCWL 1I7RB 2GAZA 1QKZH 4NP4L 4XHJD 4NQVA 3B2UD 5SWQA 4KDWA 3NABH 4GBXC 3UZEA 1HHHA 1IAKA 3HZVB 4OLYL 3OKYA 1DL7H 1W0WA 2G60H 1UM5H 4JY6B 5JPNB 3OKEB 2D03H 2CRMA 3SDXA 4JHBA 2VLLA 4QGTA 2Q76A 3QEQE 2V5SA 5DGQA 4RZCB 4QRTA 1AGBA 4XVUC 3FB5A 3KLDA 1Z9OA 2BNRA 2Q3ZA 2ZJSL 3EDDA 1A0QL 1KPRB 3OMZA 5J89A 1FJ1B 5MEQB 4JDZA 4OSUL 4ZUWB 3IFPA 3KJ4B 1ACYL 2XRAL 5DRNA 1OLLA 3OAYH 1OP5K 3VJ6B 3KPSD 3ZKMC 1HI6B 1NFIA 4MHHI 2IG2L 2UWEE 3MRBB 5DVNA 4JFDD 2IAMD 1NJ9A 4U6YB 1A7QL 2QKIB 4JFQA 4ZTPL 1OD7A 3DV4A 4QRPD 1KLFA 5TF1L 2J8HA 1KYOJ 3MJ7A 4KI5C 1DQDL 3BN9C 3DSFH 5DR5L 4EI6B 3T3PE 1TXKA 2FJFA 3VRIB 4LLQB 5MI0B 1QSEB 2FWOA 3GM8A 4PJXB 5E8DH 4LLVB 4XMPH 4H1LA 4HIXL 2MOVA 3RIAF 1JMZA 4OF6A 4KU1A 1TZGH 1T0NA 2BNQD 2GT9B 1P7QB 3G04B 3RZCC 3O6LH 3QUKB 1NCNA 3ZZ1A 1OM3L 4UTBH 4OKVB 1WCQA 1YEKH 3E6FA 3UROR 1RK1B 3NFPA 2EKJA 2EH8L 1R5WA 1ZWIA 1ACZA 1OB1B 3RZCA 3LN4B 1MCIA 5E4EC 1DE4B 3PL6B 2KL6A 3LEXB 4I13B 4NFBA 2X5PA 4RSVA 5DQDL 5HI4D 3ZDYE 1MHHB 5BV7B 3IGAB 4J4PC 5EBWA 4K7PY 1IM9A 1CICC 1G7MA 2CJUH 2AQ1A 4ODTL 3VXRD 4FZEL 2EYRA 3HZYB 3IKCA 3JTSA 4JFEE 1YY9D 3SKUD 4NM8H 2HVJA 5C08E 4PJ7A 3AREC 2YRLA 1L6ZA 5HHOB 3S35L 4PB0H 3N85H 3HNSH 1BBDH 2VYRE 1DQLL 5AUMB 5CSZA 4J4PA 5GGRA 5C09B 4HXBH 5F7DA 3O6FB 2NY6B 4GLRI 4NHCL 4YHYB 2H1PH 1YYLH 4OLXH 2AEPL 3DV6A 1BVKA 5I75C 1IKFL 3C2SA 4NO5A 4QXUH 3UJIH 3NIFF 1SBSL 4WI8A 2VDKH 3K74B 1YMMD 4OD1H 5HHOE 4H0GA 1FZMB 3HC4H 3ULVL 5JZ7C 1HQ4A 1IAIM 2FX7L 3CXDL 1IBGL 3HMWL 4Y4KD 3H8NA 2ORBL 3OGCA 3IFOA 1DN0B 1KPUB 1QEWA 3IF1A 4V1DD 3Q5OA 1TLKA 3I6KB 4P5TA 4WTZA 1QFWM 4K9EC 2JJTC 4TPRH 4P2RB 4JFHD 2ZSVA 4RFEA 2W65B 2QADB 4N8PA 5ETUB 3IU4H 2R4SH 2VIRA 4ENED 3VGGA 2YD7A 5ISZA 15C8H 2ADJA 4UMGA 3SDYL 1ADQL 2VQ1B 1PFCA 4MNQE 4JQIH 2JJTA 3FAXA 2AK4D 4HS8H 2O5YL 4PJ9C 3LH2L 4G8FA 4ZD3L 4JVPA 3VXPB 4PJDA 4EN3B 1R5VA 1BZQK 2V5MA 5F1IA 3QDGE 5HDQH 4EUPG 4UUJB 3WFCL 5JIKA 2WQ8A 1DBKH 1Q0XH 1CFQB 4P2RE 5E5RB 1JBJA 1YNLH 5C0CE 1I1AD 5EOCH 4GOSA 5C0NC 4CDGC 2A1WH 1GGCH 2VLKA 2NXYD 1O5DT 4FFVD 4XCNA 5KAQG 5E99H 4NQDB 4WGWB 4PJ5B 1N3NA 2CRZA 4XAWL 4NGHH 1UM6L 1J1XL 3D85A 1T3FB 3E3QC 1U8JA 1W72A 3O6KH 1PSKL 2FJGA 3M07A 4IRSC 5F97E 3LKRB 3RAJH 2AABL 1S5IL 5EBLB 2PW1A 4LIQH 4KWUA 1HSAA 4I3RH 1PW3A 1X5HA 3D3VA 2QLVB 3TPUB 4KK6C 5J6HB 4KJYA 3QO0B 3IAQA 3BZFA 4F8QA 1QQDB 2VDLH 1NSNH 1QSFE 1Q9OA 3SO3B 3CC5A 1H3TA 3CMGA 4PJ5E 4XPHL 1BMGA 1QTYT 4IRSA 4G6JH 4M6OH 5DYOA 3FRPG 3CVHA 3QPQC 1AHWA 5I8KH 2LABA 1U91B 2XPGA 5ESAA 4LPXA 1IGTB 1FO0L 4XHQA 4XXDA 3G5VA 4X98A 2XNAA 4HDIB 2CKBA 2PETA 1Z5LB 2BOBA 1PKQA 2B1HH 5BO1L 3I6LD 5E08H 4Y1AA 5DMGC 4LCCA 5KVGL 4FQJH 4CADB 5HI5D 2EC9U 2B7DT 3PWPB 4S1SH 1LDSA 2O5ZL 3PWVB 3MV9B 2Y5TB 4MD5A 5DJ6A 3LS5L 1PX4A 3OBAA 3ULUL 1MUJA 2LU4A 4D0DA 1Y6KR 5EUOF 3G9VA 1R3IH 2LQRA 1MWAH 4PJCA 4J3TA 2Y9RT 5EO9B 1REIA 3S88L 5CUSL 3GMPA 3UP1A 1MQ8A 4YUEH 4L3AA 2OJEB 4PS4H 3BDXA 3EOTH 5JUEL 4UB0L 5F3HA 1D3CA 5I1JL 5I2IA 5FO8B 1KJMA 4JFYA 5DQJB 4YE4H 3O9WB 3CK0H 1QOKA 3JWDH 1NFDB 4ZUVB 4PJIE 2AXFB 4U1IA 3W11D 4CL7A 4U6XA 2W9EL 4PYHA 4I18B 1QRKA 4JHAL 3O11B 1KT2B 2IANA 2XZAL 2DKUA 2H2PC 3KWWA 1KULA 4NKMA 4FQ2L 3CXHK 5I8OH 4U33A 4Y7MA 2PR4L 4JKKA 2DLFL 2X4QA 4R90L 1LO5A 4PJXF 4PJ8D 4YFDB 4K07A 3D18A 4YWGH 4UT9L 5I15H 2YUZA 4E0RA 4XBEL 1QLEL 4LSSL 4NQXB 4QHUA 1UXWB 3S9DB 3UPAA 5T33L 2B4CH 1A7BA 3EBAA 4ZAKD 3W5NA 3DUSB 5JIIA 5DXWA 4K3EH 5GS2H 5ECJE 4RMSA 1K4DA 3OB8A 5IJKC 1AO7B 1FL5B 1FORL 3P77B 4HS3B 2Z31A 5JHLL 3PWNA 4KAQL 2FCBA 2VISA 5IQ7H 3LPFA 1KCUH 5ESQA 4YXHH 4M6ML 1DQMH 1K4CB 5TE6L 4M7KH 5FFLA 5I76B 4PB9H 4CMHB 1W72H 1BJ1H 1CGSL 2Z4QB 5DJYB 1U3HD 1D7FA 5I1KH 2NW2B 3I9GL 4PLJD 1FVCA 1K5NA 3VWJB 5IJKA 4DKDC 4CKVX 1ZHKB 4JFOB 1OGAD 4FMKA 1TPXC 5T1KA 3DGGA 5T5FH 1RZGB 4Z6AT 4K8RL 4O5LH 2OBGA 1B9ZA 4YHZH 4AJ0A 3T0AA 3QFJE 4ZXBC 5C0JA 3P9MA 2P7TA 3LRGA 5EPMB 3CVHH 4ZUUA 5D72H 5DT1H 1EHLH 2ADIA 2CIIA 4JM2D 5K9OB 3O3AA 4HC1L 5IWLA 1BQHA 1S7SB 1IGML 4M8VA 1XGTA 4G3YH 4L8BB 2FZ3A 2LVCA 4TNWF 5DJZA 5INCB 2WZPD 3U7YH 4RGOL 5F7UA 5EFIA 4BK5A 2CKBH 1HKLH 3V9FA 4WJ5B 3LQAL 5CBEA 5IVXA 3ARUA 4MMXC 4TULH 3QWQB 2GJ6D 1AGEB 3MLRL 1ZE3C 1M05B 4KI1A 4JFPA 1CBVL 5ANMA 1F2XK 4P57B 2YUVA 3VXUD 4WFHE 3O4OB 1UEYA 3W0WA 1J8HA 2APXA 4O2CA 5ALBL 4GKNB 3T8XA 1H3PL 3HN3A 4Q7DA 5EO1B 1CLZH 2R69L 3BH8B 3W39A 5HVHB 3HNTH 5AWNH 2Z93A 3BW9A 1TDQA 2IQAB 4U1LA 2IPUG 1KFAH 5IVNA 1JWMB 2BVPA 1P7HL 4MJIA 3VRLE 2C1OA 1X7QA 5TQ0L 2B0SL 5E8OA 3JUYA 2VB5A 3PGFL 5FECA 1YDPB 3QDMB 4M5YL 4PD4J 4XH2B 4PRBB 1F13A 1U8KA 2VL5B 3EDEA 4L8CB 2P46B 3IKKA 3L3GB 4IOSD 1T1WB 2C5DC 2X9WA 2VXSL 5FYKH 4EZMA 1FG9C 4NQCA 3ZDZE 4RGNB 1MLCA 4LOUD 1QFUL 4QRPB 3TIDB 1YY8B 1OW0C 4X7SH 3ZE1E 1CR9L 3ZKXC 3HI1A 1CFNA 2YBRA 4I0PD 3U0WH 1I8IA 1N4XH 4W6WB 5I18H 2BVUA 3BEWB 3VFRA 1EFXA 2EH7H 3N0PB 1ZXQA 3KPOB 1UEMA 3D0VA 2A0LD 1OW0A 3D39E 2IADA 5HYJE 3QEHA 1P1ZB 3REVA 2DJ4A 1S7QA 1NGQH 4RMVA 2X89A 4JR9L 1EEYB 3EGSB 1KEMH 1JI1A 4AENB 2IMNA 3NBNA 2ZZUT 3LIZH 1IRAY 3NCEB 1C5BH 1RVFH 2OI9C 4NQSB 2EE3A 5IM7A 3L95B 4JO1H 4JLRA 4PLKC 1TETL 4RQQA 1RURH 3UCRA 4IIQB 3P30H 5IGXH 5HHQA 1FVEA 2AJVL 2DLGA 4NWUH 5I71B 1JNNH 1FNEA 2V17L 3V6OC 3ILPA 1VACB 5E9DE 3UYOD 2DQIH 3QUXD 5KANI 3D69A 2P5EE 5CLWA 3K2UL 5ITBL 3QJHB 5DVKA 1T20A 4UBDC 5C0RH 1NUGA 4WV1C 1MJJB 2CLVA 4Y16C 1K2DB 3HAEG 3GBNH 3QSKB 4ZS7H 3IT8D 4X6BA 5D1ZB 5I1DA 4U1HA 5TDNA 1E0OB 3V6OA 1JHKH 3BKYL 5ENWA 3CSGA 1SJEB 5TDPB 3E2HB 2RAMA 4PFEA 4EI5A 4MCYA 3QWOA 5I6XB 2ZOKB 1Q72L 1UM4L 1S3KL 2EDFA 4G80B 4NRYA 5FUOH 1NFDF 1JNLH 1JGVH 4XP4H 5GGTL 4NZRL 1OSZA 1MCPL 3EYUH 4H0HB 2IPUK 3KYOB 3MOQA 2AJSH 3T4YA 2J3SA 2CLZA 4F9LC 5EA0H 3WSQL 3GK8H 4Q9BA 3SDCD 3P0YL 5F6IB 4JZOA 3TBTA 1RUQL 4N90E 3HPJB 1I7TB 2Y06L 1LE5B 4L1DA 3DMMB 1KN4L 1SJHA 4G6KH 3W81A 1DANT 4RAVA 3CIQA 4AT6A 3H2WA 4MDIA 3RVVD 1JRHL 3LMJL 1B0GA 5CWSB 4MJ5A 5HGDA 2DM2A 5HY9A 1INDL 3KXFA 3L6FA 5T5NF 4NJ9H 1EJOH 5CILL 1J10A 5E94A 2O93L 5KVEH 5D71L 4Z78A 4GMSL 5TGBB 4M48L 1HQRA 4N8VA 2ITCA 1J5OH 4W70A 1KPVB 5F93C 1KCKA 1WTGT 5BQ7A 5FA3B 1S9YB 3PGDB 2HLFD 2J1KA 5DA4A 4C56B 4KVCL 2DWEB 3RWIA 2XACC 2HFGH 3BX7C 5DJ0A 3QEQD 1YJDC 4GUPB 4HK3J 4MD0A 5EDXA 1DUYB 3VFOB 4YHIA 1EX0A 1NGWB 2BRQA 3H42H 2BVTA 3FO9A 3VD5A 5E2WL 1EZVX 3X3GL 1YEGH 2BCKB 5L8LB 5C0AB 4JQXC 4HGWA 3SPVA 4C4KO 5C0EA 3ZKND 5ABDE 1P7KA 3UTSA 3SE8H 1NKRA 4LDLB 1CF8H 3O0RL 2OSLA 3MNVB 2XKNA 3HMXH 3TFKD 5H8DA 5IEKA 1ZGLB 1HEZA 4GAJL 2Q86A 4PREA 3ZE2E 3HNVL 1QRNA 2OTWB 1RFDH 2IPTH 3UZQA 4HUKB 3L3IA 4WDIA 2FB4L 5F72S 4D3CH 3PQYA 4G8IB 2F8VA 3EDJA 4QHNA 3SY0B 1NEZA 3GKWL 4JG1H 2NY0D 4R6UA 5A1AA 3DWTA 1MCDA 2VDNL 1KIPA 5C6TL 4MNGA 4QO1A 1IQDB 3T65B 4JM4L 4Z7VE 5HVGB 4P2QA 5EU3A 2I60H 1TZHB 3OKMA 1PG7W 2OMNA 2Y36L 1C1EH 3QIBB 4NNXB 3R4DA 3LHPH 1G0XA 2FBJL 4KH2A 3QXVA 5GZOD 4L8DA 2XZCH 2F54B 2H32A 2QSVA 4QHKJ 5B3JE 1SEBB 2HH0L 4HSQA 2I5YL 4CBPA 2YPVL 3MACH 2FIKA 3Q1SL 3MGAA 4OZ4B 3NA4A 3TF7C 3C09C 2VLRB 4MAUH 4UQ3B 4PJGA 4I1NB 3N1GC 2G2RA 1T22A 5KG9B 4JFED 3H9HB 4PJEA 2UZXB 1CXKA 4KKBC 4LSUH 5C08D 5J9PA 1WFOA 4FQIH 2WLZA 4RBPK 2FEDC 3SDAA 2Q6WB 2PNDA 4JO2H 5D2LE 2MFNA 4YXLH 4YO0A 3VXSA 3EZ8A 4Z7NF 2GITA 4HS6B 1OP3K 1LP9A 4NZTH 3KPTA 1N2RA 1JYVA 2Z0BA 3VXMA 1SM3L 4GQ9H 3RVUC 4LCWD 1MAMH 1HXMB 1KACB 4Y2DB 3WDJA 2YRPA 3HUJA 1DVFC 1EHXA 5I8CB 3DVGA 1KELH 2WUBH 3PV7A 1A64A 1VGKA 3MRCA 1K8DA 5IHZA 5IOPA 5B38B 1NLBL 1I1RA 2PO6B 2EC8A 5BRZA 5K9JH 2H8PA 1JF6A 1HILA 5AYQA 5BS0A 1B0WA 1LO0L 3QISA 3Q3GB 1AE6L 4O9HH 1KTLB 5IK3A 3F7VB 2BSED 1HDMA 4OIIH 5F96H 1N8ZA 1SY6A 4XI5C 4IRZL 4B53A 5J3HC 3U79A 3BXNA 1C16A 1K8IA 4APQB 3VCLA 2X4PB 5KBNC 1X5AA 3TO4A 3BIKB 5F8RC 3EFDL 4MNQD 1MPAH 2DOCA 4Y19A 3LKQB 1G9MC 3ECBA 2O61A 5E4IA 1JZ6A 1WEJH 5GS0H 1FFPA 1A9EB 4OLVH 5F9OH 5BCAA 4HUWB 3QDGD 4GRMB 2XT1B 1A6VH 1CFSA 4AEFA 3G08A 1S7RA 1LVEA 4ZFZB 2PN5A 5C0CD 1AGDA 5L88H 2IPKA 4GRLA 1YNLL 3NH7H 4U1KB 2FYYB 2J5LC 3V6ZB 1B0RB 2R1YB 2C9AA 4BZ2L 2DQDH 3PHSA 3BPNC 5DD3L 3SKJL 4JCMA 1F6LL 3GMOB 1VFAB 1KJVA 4QRSB 3TEUA 2LTQB 2GJ6B 3ARFC 2SEBA 1PZ5B 4N1CA 1RZFL 5CMAA 3SKOA 3JV5A 5TH2A 4OGXL 1FZKB 3U2SA 5IR1B 4N0CC 1J05B 3QBTB 2H41A 3OXRA 5T3ZL 2YPLE 5D70H 3AAZB 4L4TD 1RAMA 3NCMA 2B20A 2F53A 1VEPA 3EFFA 1A6ZB 1QSFD 2H32H 3DTXA 3EDFA 5D1QB 2F15A 3QFDB 2WM0A 1T66C 3F5WB 4NO0D 4JKPH 1P84K 2GAZB 3M8OH 2WBJA 4NQVB 4M62H 5SWQB 2AJXH 3VH8A 1YEIH 5D2NC 1W0WB 2JE8A 4DW2H 4M61B 2JELH 1WWWX 4NKQB 2VLLB 3SDXB 2Q76B 3JSSA 1KN2H 2NZ9C 1AGBB 1BEYH 1L9MA 3FB5B 4QRTB 4DVRL 5JA9A 3QXAB 2BNRB 4OAWA 5JDJA 3IXAA 3B2VH 5JW3L 3MJ9A 4YXKL 4YHKL 5MEOB 1KTDA 3QEGL 4JDZB 1CDUA 4UAOC 3IFPB 1H8OA 1NLDL 4Z0BH 2HRLA 3OG6B 5DRNB 3V4PL 3FT3A 7CGTA 1Q1JH 1NFIB 1MJ7H 5F9JA 3LY6A 1GCFA 1DCLA 1NJ9B 4RDQF 1T2QL 4DKFH 3PUCA 1CE1L 3WYRA 1V3JA 1ZSDA 3DV4B 5CKGA 2XTJB 3MJ7B 2YKLL 1AXSA 2NY3C 1JPTH 2BVOA 2FJFB 1AJ7H 2R0KL 4UI2A 4EDXA 1GGYA 2IBGA 2E6JA 4GRWH 3MCKA 4WW2C 4H1LB 3LN5A 2QBWA 1ZLVK 3U6RA 5C6WH 4W6YB 2DQFA 1T0NB 4KDVA 3TBYA 2X1WL 1J0KA 1JV5A 5CS7A 3ZL4L 1TTGA 3WNPA 4GG8A 3TWCH 2XTJE 1H3UA 2ZKHH 3DX6A 3E6FB 5AEAA 1ED3A 4HUNB 3NFPB 1NGZA 1R5WB 1ZWIB 2JB5H 4S1QL 4IMLB 3BP6A 3EJJX 3ZTNH 4NN5B 4P2OC 1ZVSA 3WIIH 4CN4A 1W2KT 4JN1L 4KI5E 5EBWB 1IM9B 4KTDL 1G7MB 4QRQA 1S7VA 3QCTL 3IKCB 3JTSB 1I1FA 2QSQA 4KTEH 2HVJB 1KJ3H 2HTLD 1YPZE 5BXFA 1P4BH 1QA9A 4RMRA 4YPGA 3ZKQD 3O8XD 2HLAA 3IDNB 4X4XB 4JCLA 2R2HA 5TF0A 5CSZB 5LQBH 3GUTA 3MBEC 5HHNA 2BZDA 5IBTL 3HE7C 1IC7L 1B6UA 1BZ7A 2WBWB 4L8SC 3H9YA 3IFNH 4TQEL 5J4MA 3ILQC 1BM3H 3ARRA 4ODHH 1MWAB 3DV6B 5D7LA 3KPLA 4WO4C 4NO5B 4JZJA 3CZFA 1PLGL 2OYPA 2AGJL 3I6GA 2E27L 4PJ7E 3QFJD 1L0XA 3HE7A 5FGSA 1QR1B 1HOCB 3BZ4A 1NDGB 3VG0H 1HQ4B 5EZLA 3B5GA 3DO7B 5EN2A 2ZUUA 3OGCB 2IBBA 3CSYA 3IFOB 4PG9A 5BVJB 1QEWB 5EBGA 3IF1B 4OQTL 3C08L 4WO4A 1ZA6B 4P5TB 4EJ1C 1RY7B 3M1BA 1TMCB 1XF4A 1FAKT 5JDSB 1WC7A 3UC0L 1M7XA 2PCPA 2ZSVB 4RFEB 5B4MD 4C59B 5IB2A 4KZDL 5BMFH 2MQ3A 3LQMA 3ARDD 4EXPX 3MJ9H 2GJZA 5ISZB 2XZQH 4LMQE 4LNRA 2ADJB 5KOMC 2CK2A 3TVMA 4P23A 4P9HL 4WFHD 3ARQA 4X4ME 3WE6A 4OCSL 3JXAA 4G8FB 4V2BA 4NUJA 5DK0B 4W6XB 4URTB 1QFPA 2AEIT 5L8JB 4PJDB 5F1IB 2JCCE 1EBPA 2ZCHH 5KN5A 3SJVA 4JJHA 5JORA 3S6CA 2WUCL 2QHRH 3KAAA 4NRZB 3V4VL 1A3LL 3MRJA 2VLKB 5D7JC 4JO3H 4UT6H 5K9KA 5E03A 3VFWA 4XCNB 3B43A 1CG9A 4Y4FD 1BF2A 5INDA 1M4KA 3GO1H 3D85B 4IRJD 1U8JB 1ZVYA 1OF2B 4XWGH 1W72B 1MRFH 4U2YA 4PJDE 2FJGB 5JNYA 4HLZH 5D7JA 1HN1A 2PW1B 1CXFA 1HSAB 3CFKA 2DLHA 1J87A 1JTTA 5DD0H 3C5ZC 4DGYH 3SKNA 3CGTA 4WCYH 4ZUTA 4Y0GA 3BZFB 1F90H 5FYJE 2FSEA 5IT2L 1RZJL 1Q9OB 4NN6C 2CDFB 5GISH 5EU6E 5FUZL 4RRPA 5AYUH 5KTEL 3CVHB 1AHWB 1ITBB 1O7VA 4XRCA 2D0FA 1OAYL 3MCG1 4LPVA 4EDWL 1BBJA 3GMMB 4G6AD 4L3CA 4XXDB 3G5VB 4X98B 2XNAB 2B5IB 2Q8BH 2CKBB 4MA1B 3CFCH 5E2UL 4DTGH 1QG3A 1IEAB 5HYJD 2GK0A 3D39D 3G6JA 3QI9D 2BOBB 3D3VE 1S7XA 1PKQB 3BPCA 4CVXA 5GRJL 2GY5A 4M6AA 3E3QE 4QTHA 4Y1AB 3HG1B 4LCCB 1QLFA 3CJJA 5DD5L 5D1XC 5IB3A 1OOAA 4M7LH 3RKDC 5JR1H 4PTTB 3JWOH 2PXYD 3TBSA 1RZKC 3MRHA 1D5IH 5H94A 2X10A 2A6JB 4MD5B 5DJ6B 4N5UA 2A9MH 1MUJB 3MLXL 2MCG1 1QZ1A 4N8CL 4D0DB 5HXMA 4LEXL 1FBIH 5IB5A 3SDXF 2D4FA 1XF5A 1YYML 4X7DC 3O2VL 4EQ3A 4PJCB 4ELME 3P30L 4L9LC 5D1XA 2BY0A 1MHPH 2WWKO 4DGVL 2F5BL 3GMPB 4HT1H 5F7FA 4LFHG 4WUKH 5CJOH 1B4JL 2R9HD 1OHQA 3D2UD 3PABA 4Y1AE 1FRGL 5F3HB 4NUGH 5I2IB 3PJSA 2XG5A 3WKML 4AH2A 2MCPH 5E9DD 1KJMB 1C12A 2HFFA 4JFYB 2P5ED 3OL2A 2PYEA 5IFAL 2I24N 1X5ZA 4UOJA 2A83A 2VMFA 5KSAC 4U6XB 2J12B 3LV3A 4Z7QE 4K3JL 3M17A 3KPNA 3GHEL 5I1LA 2DTSA 2IANB 1LO3H 3MPCA 2D7OA 5EU4B 4NKMB 5J13B 2NNAA 3LKPA 4KJPD 4M43H 2X4QB 1LO5B 3NIDE 4XWOD 3TCLB 1DSFL 3D18B 3ZSTA 4HWNA 3HI6L 4E0RB 2JKXA 3EYFA 2EDLA 3SE9L 5CHNA 4FRWA 3RNQB 4NSKA 4ODSH 5AD0A 3MXWH 4YJZL 5IBLD 2C4FT 3C6LA 5EWIL 1FIEA 3MLYL 3TESA 4N90D 1Q0YL 5TFSH 4H8WH 2CK0H 1FQ9C 3AVEA 1K4DB 4KROC 2YK1H 2VAJA 2Z31B 3PWNB 1G7IA 2KDGA 4KDTA 3AU1A 3JWNC 1MCOL 2VISB 3L1OL 3E6HA 5E1AA 5FGBA 5ADPH 4HWEH 3P4LA 4FZ8H 3E0GA 5C6PB 4KKLD 4OZIA 2C3VA 3WIHA 2Y07L 2Q1EA 5FF6A 5SWSB 1IL1A 4LPTA 1JZ3A 1GYAA 5T1KB 3DGGB 2EDQA 1SJVA 3W9EA 5HBBA 3OKDA 5AAWA 4Z7OE 2X05A 4CRPA 3MRRA 2BC4A 5C0JB 3P9MB 5F9WB 4WEUD 4XXCC 4ZQKA 4ZUUB 2ADIB 2CIIB 4ZPVA 2KUTA 3AXLB 1BQHB 3NFNB 1XGTB 2GI7A 3RGHA 3S36L 2ICEA 2FZ3B 5DJZB 1JZ8A 4BSVA 3H9SA 5EFIB 5CBEB 3SGKC 1F11A 5CJBA 2DMCA 5IVXB 4GAGH 3RWFA 3I3EA 1JVKA 4AL8L 4LP4A 5E2TH 1TJGH 2FGWH 3HE6D 1KTRL 5ANMB 1NBQA 4LSRH 5FGCB 3MUZ1 3ARWA 4KK8D 3TJHD 1U95A 4XPTL 2XTLA 1J8HB 1GL4B 4O2CB 4R2GD 3T8XB 4O02L 2PYFA 1U8NA 4NPYA 4Z77A 1VFMA 2CDGA 2G5RA 3EYSH 4X99A 4XPBL 1U8HA 3W39B 4QXTA 4PGCA 4E42B 4YDLC 2K9UA 1A7RH 4LAJH 3RWCA 4NKIL 2Z93B 3BW9B 4F9PC 1GSMA 5DSCA 4U1LB 1BQLH 2VERN 3MV7A 2BVPB 3RDTA 4DOHE 1IGIH 4MJIB 4Q0XH 2C1OB 2WANA 1A6AB 3WXVL 3PHQA 1ZLUK 4XNZC 4OCYL 4PJDF 5FECB 4U1SA 4YDIL 3FT4A 3W0WE 3V95A 4DGIH 1G7HA 1U8KB 2OR8A 1F4AA 2CXGA 4YFLF 1T04B 2DQTL 4U2ZA 1OP5H 2E8ZA 1NCUA 3ARYA 4NQCB 2X4OA 3RY4A 3S97C 3MCLL 2J4WH 1MLCB 1D5MA 4FQXC 4MX7A 1RIVH 1FC2D 1CYGA 5K9QG 3C2AL 4HD9A 3F12B 1AR1C 3OPZH 4ZG1A 4GXUN 3HI1B 2YBRB 1QPPA 2IGFH 1YC8A 4LLMB 4XVSH 3VFRB 3UDWC 3BQUA 2MKWA 4ZS6C 1EFXB 5KSBA 1PG7H 3ESVF 3IJSA 4H25B 3WD5H 3D0VB 3N9GH 1CGXA 2IADB 3QUZA 3QEHB 4B5EA 4PRPB 1S7QB 2HN7B 3QWRA 4I3GA 4PJBA 3ZSSA 2DQUH 3UDWA 5CD3A 1VHPA 3LSOB 3WIHH 3TGXA 3ZDXE 5IM7B 1I4FA 1GHFH 5CD5D 4OFVA 4JLRB 4F7CA 3O2DL 5DK2A 4N0YH 3R1GL 2OS7A 4RQQB 1TNMA 4WI4A 4LAQL 4KV5E 4ZFOA 5HHQB 1FVEB 2NW3A 5D7IA 2C3XA 2J88H 5FB8A 3QG7H 3CD4A 2R0ZL 5E0QA 1TQBC 3MLUH 4P0DA 3TN0D 1NCWL 2VL4A 1FNEB 2LV4A 3MLSL 4YK4B 1CFTA 1FZOA 3TYGL 3FONA 4MYWB 2DJSA 1JPGA 4XNUL 5D7SH 3ILPB 5IBUG 5T1MA 1FFNA 1S78C 3BVNA 4JRYB 5HPOA 3D69B 3IJHB 1Q9KA 3CFBA 4LHUD 1T20B 4PJCF 5DMJB 4OZHB 4MSWA 2CLVB 4M3JA 3IYLW 4X6BB 5I1DB 1N5AA 4L5FH 4U1HB 3HFML 5SWZD 1YQVH 5ENWB 3TYFA 4HGKC 4D9LL 1MPAL 3FZUD 5DEFB 4LLWA 4E41B 4GMTH 4EI5B 4HJ0D 4MCYB 3QWOB 4UILL 4XMKH 2FRGP 1YNKL 1KYOK 4EIGB 5A40E 4XTRC 4K3DH 1OSZB 1WV7T 3EIFA 1WCBA 5D8JH 1MEXL 1FNAA 3QXDA 4GKZA 4CVUA 3MRDA 3SQOL 2CLZB 2DF3A 3CVIH 4O2EB 5JOFA 4DFHA 1WT5A 4JZOB 3V6OE 3TBTB 2OZ4H 3DURA 4JPVH 1FN4A 1CVRA 4K71B 1S9VA 2IEPA 4OM1L 4OLZH 1AC0A 3P4OA 4JFZH 2VZ3A 4UDTB 1NGPH 4RAVB 2KH2B 1T0PB 2Q7YB 3MZTA 4FXLA 1B0GB 2OTPA 1VPOL 1NCAH 4MJ5B 5HGDB 5HY9B 1A7NH 1QFWH 3KXFB 1KB5A 1X5LA 4ONGH 2YEZA 1RIHH 4FP8H 5E94B 4KK9D 2F8OA 3VFTA 4IOFC 4S1DC 1HQRB 4X80L 4ZDHB 4N8VB 1VERA 4UNUA 1MHCA 3WBDA 3RWIB 3UXFA 3UJJL 1UWGH 4BUGA 1BVZA 2DQCL 1CGUA 3QUYD 4MD0B 3RHWF 1OTUC 2B8OT 3FO9B 2D0HA 1CL7H 1GC1C 1A1NA 1N7ML 3ROLB 5L9DH 3KXFE 3QR2A 25C8H 4M1GL 5CLTA 3QRGL 4Z76A 4HGWB 3FQRA 5GPRA 3TT3H 1BJ1J 3SPVB 3VMNA 4HH9A 4KQ3H 3UTSB 1FYTE 3D1MC 2OSLB 2XKNB 4MQXD 5FO7B 5IEKB 3VGAB 4BZ1L 1HEZB 5CBAA 2Q86B 2W9DL 1IGCH 4HUUA 4KGJA 4NN7C 4FG6D 4TYUA 4OIBA 2W0KA 1QRNB 5IVXF 5EU7C 5JTWA 4P4KC 2XWTA 4WDIB 1DLFL 3HTLX 4GBXD 2X42A 1KIPB 4XCFH 4MNGB 2FECI 5E1HB 1NC2A 4P2QB 4JFXA 4XVUD 5EU3B 1A6WH 4P4KA 3OKMB 2CMRL 4KZEL 5B22A 1R3HB 4QWWC 5FXCH 3MGTA 3DVNB 1T7VA 1ZANL 4WU5A 2PXYB 3A67L 5E6IC 5GHWL 1XIWA 5GGQH 3OAUL 3LS4L 1R0AH 3MOAL 1ZA3A 2V7NA 2H32B 3PQYE 3ZKMD 3UMTA 5DD1L 3C60A 2VLJA 4E5XB 2FIKB 1OLZA 4LEOA 4LLDA 5F9AC 4PJGB 4KI5D 2XG4A 1LO4H 3BN9D 1I8KB 1P4LB 1T22B 5T1LA 3KS0H 4AMKH 1CN4A 2YR3A 4LU5L 4QY8A 5T1DL 5J9PB 4HULB 3VFNA 1VENA 3SDAB 2RB8A 1ZMYA 2ENSA 1BD2E 3ZYIA 4WWKC 4F7TA 2HRPH 2YD2A 3VXSB 3K4DA 4YO0B 5E8NA 3RZCD 1LP9B 5LQBL 3IDUA 1UCTA 1N2RB 1DEEA 4ZFFA 1ND0A 5GQBA 3VXMB 4R3SB 1FH5L 2FHFA 1UZ8B 4NQED 3WJJC 4WWKA 1D9KC 4PJEE 3IDYC 4KK5C 3QQNA 3DVGB 5KVDL 1MFCH 1I9RL 1A1OA 2B1AH 5AZEL 1VGKB 3MRCB 1K8DB 4EUPH 5IHZB 5IOPB 3P0VL 3RA7L 4NCDA 4XX1G 3S37X 1N6VA 1L4IA 5HD8C 2H8PB 1HILB 4J4PD 3LOWA 3VXSE 5CSGA 5C0BE 1CICD 4GRWB 1T1ZB 2FEEI 3WJJA 1LP9E 5IK3B 1JPFA 3WXWH 3VXME 4PGZA 2YMXL 3ARED 4B0MM 1HDMB 1N8ZB 1UGNA 5EIVA 4L4VA 3THMH 3EYVA 4AG4H 3BO8A 3KPMA 3BXNB 3HUJE 2OP4H 4HK0A 1C16B 1K8IB 2VITA 5EB9A 3VCLB 3TO4B 1EMTH 4PV9A 3EAKA 3FO0L 1UKSA 2X40A 5BRZE 3U9PL 3WS6C 5BS0E 3ECBB 2O61B 1WFNA 4MB5A 4FQPA 3RI5K 1CFSB 2C1PA 4L29A 3TIEA 4Q9RH 4OZHF 5LGHH 4MNHA 1FVDA 1AGDB 2AJUH 4GRLB 5JZ7D 1PD6A 4JB9H 4OZGE 3DPBA 3I50H 3EHBC 2VDQH 3PV6A 4PJAA 2I26N 1RIUH 1KJVB 3MFGB 4Y19E 1E6JH 4JPKL 4WFFE 1CDJA 4TOYL 3S96B 4JG0L 4WI7A 2MNUA 2J6EL 5CMAB 3SKOB 2FD6H 5TH2B 3MRQA 5MEND 2E7LA 1MRFL 4D9RE 4AEIH 1ZK9A 3SO5A 3U2SB 5I1AB 4OD2A 5KS9A 4HUVA 3OXRB 4QRRA 4HG4J 1U3YA 5CEYA 2PTUA 4PJ9D 4DGYL 4X8JA 2F53B 2EECA 5FYJD 3WFBL 3WFHA 2PW2A 3GBMH 3QDHA 3DTXB 5EU6D 4F3FA 5IQ9A 4JQVA 4CU7A 1EK3A 1U41A 4A6YL 4TVSa 5IUSA 3TJEL 2AERT 3MLWL 3VFSA 2HG5B 2WBJB 5C0ND 5IHUL 3C5JA 4P59L 1I75A 4IOIA 4U1GC 1R3LB 1CFVL 1CLOL 3GIVA 4MLIA 1J86A 4X9FA 3D3VD 1FLRL 3T0EC 4PR5A 3B9KC 3AS2A 4OAWB 2F53E 4CW1A 4HPYH 1NAKH 5C2BH 4YHNA 2J8UE 1KTDB 3DX8B 1LEKA 4LL9A 3UJTH 1ZOXA 2D31B 2NY4C 3QYCA 3V7MA 4LQFL 1VKXA 1CI5A 4KK6D 3B9KA 3FT3B 3T2OA 4R4FL 4F58H 3TV3L 5F9JB 2RR3A 2JK5B 4Y2OA 3TT1H 4QCIA 3QPQD 1ZSDB 1KLUB 1MAJA 4YGVB 1AXSB 3C6SB 2VDRL 4HKZA 1AGFB 2BVOB 5LAXA 4EDXB 1D6VL 1QFWI 2XY2A 3SDDD 1MNUH 5D2NE 5TPWH 5J12C 4UINH 3FQNA 5DFVC 3MCKB 3LN5B 4QHLA 1S8DA 5JLZA 1JNJA 1CZ8H 5IROA 1K6QH 5DMGD 3TBYB 1F42A 2YUXA 2BFVH 1NL0H 1MCBA 2YD5A 5FV1L 1RHFA 1JV5B 4FXGA 4XGZA 2JB6B 5DI8A 4OF7A 4J6RH 3DUUA 2NY5C 1ED3B 4TUOB 1T2XA 1NGZB 3MFFA 2QL1A 3QIUC 3TPKA 2ZUQB 3OJ2C 5KJRH 1A6PA 5AZ2L 1U6AL 1HHIA 1EVUA 4WUUA 3WNNA 3P73A 1ZVSB 2IBZX 1UZ6F 3IDXL 4QRQB 4RX4A 1S7VB 3O2WL 5EZJA 4PD4K 2BK8A 2V5RA 3BP5B 2ZG2A 2HTKC 2Y72A 3QIUA 1WBYA 1QA9B 3GZKA 2F19H 3I75B 4YPGB 4KUCD 3HAEA 3IU3A 5IP4A 2QSCL 1EHNA 4HMDA 3TZVA 2CDEA 2FH8A 4PJGF 3GUTB 1OAUL 5HHNB 1ERNA 2H2PD 5SV3A 1HH9B 3LDBB 3BAEL 3QJFB 1OAQH 1EO7A 3MV8B 4N0UA 1BZ7B 4FTVA 3K8KA 4R4BA 1AQDA 1P9MA 3NAAL 2R2CA 2DQEH 1RULL 4JZJB 1LGVA 2BDNL 4JVUA 4I77H 4HZLA 2L7UA 1MFDH 3BZ4B 5EZLB 3MNZB 3QHTC 3GMNA 1LNUB 5EN2B 4V2CB 1IFHL 3CSYB 1XCQA 4PG9B 4YX2L 1WZ1H 5EOQL 5IMOA 4ONFL 1XF4B 2EO9A 2R0WL 3BD3A 1WC7B 1JGLL 3KJ4C 5D7LE 4ZOEA 5IB2B 1WZMA 2J7LA 5EUOA 3VFGH 1RMFH 3MLZH 4X5XA 1JGDA 4RZCA 2GJZB 4KHXH 4LNRB 4GRWF 4DKEH 1KENH 3TVMB 4P23B 1KPRA 3RPKA 4ESKA 4LSPH 3WE6B 2Y7QA 4ZUWA 4NUJB 5K33A 4LPCA 5IV2A 4P9HC 5F70A 4XP5L 1FE8L 3VJ6A 3HCVB 5LWYL 4HJJH 2HT3C 5KN5B 5JORB 4S1RH 3QHFH 4ZXBD 3UTTA 4LASH 5EZIL 4RMWA 2AJ3A 5MI0C 2VN7A 4U6YA 3BSZH 2VR4A 3INUL 3MRJB 3CSPA 5K9KB 1SEQH 3SGEH 3VFWB 1PDKA 4M5ZL 4EBQL 3FN0L 5INDB 4B7LA 4EI6A 4J23A 3W0WD 4RWYH 2VXTL 4M1DL 3VRIA 4AM0A 1Z9LA 3O6MH 1MREH 2OR9L 4LLQA 1NCBH 1S9WA 4RGMB 1TJHL 3IFLH 5JNYB 2NTFA 3L3JB 4TNWK 3SJVE 4EOWL 1A02N 4X6EB 5GJSL 5C0FA 3CFKB 2GT9A 2ESVD 4FQQA 5E95B 3SKNB 4HPOH 5LJYH 3KYKH 3QUKA 3PL6C 4XC1L 2AVGA 1MIMH 2FSEB 4UIKH 3EYQC 1MJUL 1HINH 2NXZB 5BV7C 2H26B 5E2JA 1NFKA 4MGXA 4JHZA 3MODL 1RK1A 4XRCB 5CSBA 3QIWA 3UO1L 3CNKA 1G9NH 1BBJB 1U2HA 1L7TH 4L3CB 1NMAH 1WK0A 4JY5H 5ICXA 1X4XA 1MHHA 1QR4A 2ZUXA 2GK0B 1QYGL 3G6JB 3UBXG 3BPCB 3CDGB 3WFDL 2VXUH 2AJZA 3O6FC 2EDNA 2NY6C 4QTHB 1RU9L 3HAEH 4YHYC 3QZWA 3BGFB 5IB3B 3ARGA 4F37K 4UV7H 1CQKA 1EBAA 1N26A 3NCJL 3TBSB 5H94B 3MRHB 4DN3H 3MYZA 5I0DA 2VKXA 3GGWB 5IB5B 1RK0A 3IRZA 4UV4L 4OCRL 2BHZA 3SEPA 4OM0H 2Z8VC 3CDYA 3KLHC 4GG6E 1BAFL 5J1AB 3DARA 4NC2B 4M8QB 3MLUL 3PABB 2XWJA 5C9KA 3PJSB 3FQWA 4AH2B 2VQTA 5HPMB 4LCIH 3X13A 2HFFB 1IQWH 2RIKA 3CPLA 4IS6B 2QADC 2PYEB 1K85A 1U8OA 1GAFH 1DFBL 2A83B 4RBPH 1QLRA 1CU4H 3ARBA 4K9EL 3GNMH 5C07A 3M17B 3KPNB 2FLRT 2VUOA 3I6KA 4MXWL 5I1LB 1A6UH 4JGMA 1OP3H 3G6AA 2EC9T 3LKPB 4M7JH 5D4QA 4EN3C 1QP1A 2ZCLL 2DLTA 5JIHA 4P9MH 3ZT5A 5FYJL 2Y6SC 5DJCB 1AY1L 5D8JL 2QQKH 1U8LA 5F88B 2XQBH 4NSKB 5AD0B 1AQKL 1MRCH 3TNNA 1LEIA 1T4KA 4YR6A 1UACH 1RJCA 2P1YA 5LGJA 3C6LB 1UC6A 4ZO7A 1CGYA 5KZCB 4K94H 3SQBA 1NAMH 4QHMA 2E9JA 3SCMA 1JGEB 3HS0A 3AM8C 1BFVH 4H20H 5DGRA 5L6YH 4UBDD 3DXAE 4LPUA 4Y16D 3AU1B 2R23B 1UKQA 5E1AB 5HGBA 1FAIL 1IAIL 2V2XA 5ID1A 5FHAL 4OZIB 2C3VB 3NGBB 4W68A 5JOEA 2YPKA 3LEVL 5IB4A 1CDHA 1VEOA 1EXUA 1NCDH 3SO3C 5FF6B 3L3DA 1IL1B 3ZE0F 1K3IA 1O7SA 4WFGE 4QOKA 4JDTH 3W9EB 4L1HA 3OKDB 5EBLA 3K3QA 2EE6A 3L7EB 3DI3B 4RFNB 3O4LD 4NT6A 4KMTL 5MERB 3A0OA 4ZQKB 1CLYL 2D7QA 4TSCL 4XBPA 4OFYD 4ZPVB 5KVFL 5FYKU 3PWUA 4OCWH 2ICEB 5DZOA 4NP4H 3TCXA 3H9SB 4ISVA 2C3GA 1GH7A 3EW3B 3GIZL 4OLYH 5EU5A 1BZ9A 3ISWA 5GGVL 4HDIA 5DWUL 3RWFB 5MENB 2V9TA 3BGAA 2P8MA 3RGVA 1FYTD 3Q6FA 4ZTOL 2ZJSH 3TH3T 1A0QH 2VABB 4UOW0 3VDCA 1ADQA 4OSUH 1U95B 4CADA 4BUHA 1ACYH 2XRAH 2PYFB 1U8NB 2GSGA 4NPYB 2WQRA 4Z77B 3MV9A 4O58L 2ZPKL 2HYMA 1U8HB 4HKBA 4PGCB 2IG2H 3LRSA 2F5AL 4LSVL 3NFSL 2D4DA 1A4JA 4OFKA 5FYLE 1A7QH 2WWMC 3MV7B 3RDTB 3O9WC 4ZTPH 3VMOA 2HT2C 2VJXA 1UWXK 3ZHLA 3VD4A 1WFUA 4L3EE 5TF1H 2CSPA 2AI0L 5DJAA 4I18C 3OB0K 1DQDH 3PHQB 4BQ6A 5HDBE 2OJEA 5DR5H 1KUMA 4P4RA 3BMWA 4U1SB 3FT4B 1WVZA 3QCUL 4KRPB 4Q2ZA 2CUIA 1G7HB 1HHKA 4HIXH 2AXFA 2VAAA 3PQYD 4HWBA 2XA8L 4N0RA 2X4OB 4PJFE 3MBXL 1OM3H 5DLML 1A2YB 5EG6C 4DN4L 4XCCL 1MIEL 4WW1B 1D5MB 1NUFA 5JIPA 3MRGA 3ROOB 5J11B 2EH8H 2HKHL 3PP4L 1XF1A 4FN0A 3UTPE 3SDDB 4G9FD 3DYOA 5DQDH 4NQXA 3BQUB 5KSBB 1NC4D 1BD2D 5DUML 5BZDA 4NKDA 2YXFA 3IJSB 4MA7L 5A2IH 1MJ8L 4ODTH 2VSDA 3QUZB 4FZEH 1MY7A 2WIIB 4CMHC 1ZLVH 5E5MA 4OI7A 3S35H 3JV0A 3VWJC 4G8EA 4X4YB 2LU7A 3SGEI 5CD3B 1DQLH 1JZ2A 1JK8A 5GRXG 3VU2A 1UKTA 1I4FB 1P4IL 5DZNA 1AKJD 3G6JF 4F7CB 5I76A 4M03A 1DBAL 4MAYA 4NHCH 2NW2A 4DZBA 4ZFOB 3N1QC 2NW3B 3BD4A 5D7IB 1YEHL 2AEPH 4LDEB 2X1XR 5C0BD 1ZHKA 5BOZG 1KCVL 4JFFB 5M95B 1IKFH 32C2B 4JHWL 1RZGA 4FNLL 4YQXL 4PJBE 4KKBD 1FZOB 1SBSH 3FONB 1JPGB 3ARXA 2FEDD 3ULVH 5T1MB 2FX7H 3CXDH 1FFNB 4W4OA 3FKUS 3VWKA 1IBGH 3A6BL 3HMWH 4OCMC 3T08A 5EPMA 1UADC 3IDJA 4QRUA 1Q9KB 4OGYL 4J2XA 2ORBH 1BPVA 4MSWB 3MJ6A 4MB4A 4JRXA 2X09A 5HHME 4LGSB 5INCA 4ALAL 3OZ9L 1N5AB 4PJHB 3TH2T 1XZ0A 2CR6A 1U0QA 1XGPB 4P46A 3O4OC 4R7NA 4WJ5A 4A2LA 3RVUD 2QQQA 3CX5J 1RJYB 4LLWB 5GGSB 3N1MC 2AEQL 5CGYC 5I1HH 2KZ1B 1DVFD 3SOBL 1V7NL 4KQ4L 4G7VL 2KKQA 5HVHC 3OR6B 5C7XL 1I9JL 1ADQH 3SDYH 4OD3L 1WCBB 3QXDB 4GKZB 2O5YH 3MRDB 4GQPH 3LH2H 3AROA 4XVTL 5JXEC 4GKNA 4H88L 5C0IA 1Z3GL 2WBKA 5JOFB 3WFCH 3DVIA 3QXUA 3BH8A 3GM0A 4Y19D 2BXYA 1X5KA 4TTDC 4WFFD 3DURB 4XI5D 1FN4B 2DN7A 5J3HD 4X8XA 1S9VB 3QDJE 1V7ML 4HIJB 2JIXD 4NBZB 3P4OB 3NIGF 4XAWH 5DMIH 1UM6H 1E4KA 2VC2L 5KSVA 1J1XH 4OTXH 4YHPA 1F5WA 3Q5YA 4RGNC 2XN9E 1N5YH 1NMCB 7FABL 5J1SC 2P5WB 4P3CL 4F15B 4XH2A 5ID0A 1PSKH 2YEZB 3L3GA 3IDMB 1EIBA 3BKML 4YPJA 3KPSA 3VFTB 2AABH 5CEXB 1S5IH 35C8L 4GKOA 2EXWC 3HHRB 4U3XA 1VADA 4F7MA 4M4RA 4JFDA 1BIIB 2IAMA 4OZIF 2RFXA 4XPHH 4XVJL 1JWUB 4QRPA 1Z0NA 2R4RL 2RCSL 4G8GB 4HC1A 5DURD 2OK0L 1FO0H 2Q20A 3NMEA 1A1NB 3ARFD 5L2JA 3VGDA 4Z76B 3FQRB 3GKZA 4N0CD 4ODXA 2C3HA 4HH9B 1G1CA 1P1ZA 3BDBA 1JFQL 3T2NL 8FABA 5EO0A 5IIEA 2ADFH 5KVGH 4A2MA 1I9EA 4IIQC 2Z92A 1XMWA 4HUUB 5I71C 2O5ZH 1DQQA 1ZHLA 4W81A 1T66D 2Z8WC 3LS5H 3ULUH 2NMSA 4J1UA 2R0LL 3B6SA 2XWTB 3Q6GL 3W9DA 3RFZC 2NX5E 3U82B 3RY6C 3X11A 3VI3E 1D5BA 1XGRA 3S88H 5CUSH 1NC2B 2HFTA 4JFXB 5E7FA 2FX8L 2NZ9D 3G6DL 1F6FB 5JUEH 4UB0H 5D1ZC 5I1JH 5CJXA 4D94A 3V5DA 2GYSA 1S9XB 1VACA 2LAGB 1MRDL 3E2HC 3GI9L 1EO8L 5FHBL 1XIWB 5F6HI 5I6XC 2W9EH 2GTWA 2V7NB 4Y5YB 1MJJA 3BJ91 4LHUG 4MZ2A 4JHAH 1Q9WB 1OL0A 2XFXA 2XZAH 1WAAA 5E2VL 2APTA 3C60B 2VLJB 5B38G 4FQ2H 5FIEA 3BN3B 3FCTA 4Y4KC 1AFVL 1L9NA 2PR4H 5F1SA 1NANH 2DLFH 4LEOB 5EU7E 2XXMB 1N64H 4R90H 5IEHA 2NY3D 5F6IC 3S7GA 4QEGA 3NTCL 4UT9H 4YEEA 3WL9A 3MRKA 4XBEH 1QLEH 4LSSH 4J3WA 4QY8B 1AC6A 5CP3A 3VFNB 3KYOA 4Y4KA 5T33H 3DMMC 3A6OA 1I7UB 1IAMA 4M93B 4V1DA 4F7TB 4I3SL 3MA7A 2MWCA 1YZZA 1DEEB 4Y5VA 1FORH 4MMZC 1A3QA 1ND0B 4FFZL 5JHLH 3DX9A 4KAQH 1BQSA 3MOBL 1WWCA 5KSBF 1X6NA 4M6MH 5TE6H 4OLUH 5CEZE 4CU6A 1CGSH 1GOHA 5CINL 1A1OB 2XICA 2NY1B 3I9GH 2FJHA 2AK4A 3JVGC 3IDIA 4P2OD 4HFUL 5I1CL 3KNBA 5DS8A 2ICWI 4K8RH 4IM8A 2A77L 1NBYA 2EDEA 4NKOA 1JPFB 1WWAX 1KPVA 4HH8A 3U7WL 3V7AE 1YJDL 1M7DA 3VRJA 4L4VB 5GJTH 4I0KA 5D7LD 3EYVB 4C56A 4CJ0A 3BO8B 3KPMB 4HC1H 3GSNA 1IGMH 4HK0B 3U7AA 2VITB 5D7IF 3VD9A 3MBED 1DUYA 5D6DC 4RGOH 4PV9B 2V7HA 2IWGA 3LQAH 1XFPA 4DKEL 3ILQD 3MLRH 2R2EB 5A2LH 1T7WA 1CBVH 2YSSA 2C1PB 4XC3L 4L29B 1L0YA 1SJXA 3MNVA 4MNHB 2H3NB 1FVDB 3TC9A 4F7PA 5GGTA 3D5OF 3RL2B 3O4LB 4PJHF 5ALBH 1H3PH 4QXGL 2R69H 3QCVL 3GJFA 3QAZB 4PJAB 1J1PL 2YHGA 3L5WA 4HIIA 3RPIB 4U7MA 3QIBC 2VWEC 5I1EL 3NPSB 3FO1A 4YAQB 4YC2B 1EEQA 4CAGA 4G9DA 5TQ0H 1E6OL 4JANA 4ONOA 5J1TC 3MRQB 2B0SH 5GRVL 3PGFH 3IFLL 2D3VA 1HWHB 2IQ9L 3BPOB 4OD2B 4K7PL 1ULVA 5KS9B 4HUVB 3WV0A 4M5YH 3TH4T 5CGMA 5IW6A 1BFSA 3WFHB 2VDOL 2PW2B 2ZNWA 1FGNL 4F3FB 3PDOA 2VXSH 1UYWL 3VFSB 3VD7A 4UIMA 1T83C 3MSPA 3BKJL 4FABL 3C5JB 2I25N 5D7JD 1QFUH 1HZHL 5H35B 3PWLB 3S5LG 2WW8A 4H1LG 3GIVB 1CR9H 4OV5B 4QRRE 4PR5B 5KG9A 1ZLUH 4CW1B 2XWBA 4YHNB 4WHCA 1LEKB 1V05A 5D93B 3ZYZA 3T2PA 4Y2DC 5CIPH 5KAQF 3B5TA 1VKXB 4P2CG 1KSRA 2JJVA 4BFBD 1ROWA 3C5ZD 4OCLC 4F33B 3OKOA 4JR9H 2C4XA 2PO6C 3P11L 5JHDD 2VH5L 2MHAA 2MPAL 3CLFL 1MI5E 2FO1A 4OI8A 4QCIB 1EA9C 4Y2DA 1L7IL 1BWWA 1SY6L 3ELAT 4NWTL 3E8UL 1OAZL 3TA3B 3R0NA 3MUGA 4HKZB 2EDXA 3EDKA 1OGTA 2Y25A 2AJVH 1NC4B 4XNQA 3FQNB 3RUGA 1T7ZA 4ZAKA 3NIFE 2R8SL 4APQC 4LLUA 3GMLA 3N06B 4QHLB 1S8DB 2G75A 3T0EE 5JLZB 2V17H 3BD5A 1YECL 3GRWL 1T5XB 4Z7UB 5HGGS 1RUKL 5K59F 5JO5A 2JJSA 3RKDD 3K2UH 5ITBH 4M7ZB 5DJ2B 5DI8B 3CU7A 3RU8L 3DUUB 4K3HA 1G9ML 4C83A 1GXEA 3BKYH 2LU3A 3MFFB 2BY3A 1ETZA 5FK9A 3LKQA 2L4OA 4ZYKA 1FG2A 3WLWC 4N9OB 1HHIB 1MY5A 1OGAA 4WUUB 4XZUA 5IVZA 1Q72H 3P73B 5I1IL 1TQCB 1S3KH 3BUYA 4HUWA 5E24E 3T2QA 1MRCL 2BXZA 4LVNB 5GGTH 4NZRH 4RNRA 5SV4A 4NM4L 4NBXB 5EZJB 1MCPH 3T1FA 4ZFZA 2EKSB 1PJ9A 3ZYJA 1PKOA 2LTQC 2FYYA 1JYWA 1FL3A 3GJFH 3DXAD 4JM2A 3WSQH 5KSAD 1GOGA 3HAEB 3IU3B 1KJ2H 1IILE 3QNYA 1I8MA 3P0YH 2EDDA 3TZVB 2CDEB 1RUQH 2NLJB 2Y06H 3LAFA 5FCUL 4D9QE 4WUUE 2D7MA 4N0UB 4PV8A 2GJ6A 3ARZA 4FTVB 1AQDB 5D1QC 1FZKA 3JZ7A 4KKCC 1JRHH 3LMJH 4YHOL 3VXUA 4ODVL 1CD0A 2NY7L 1INDH 3MUY1 3KYNA 1CGTA 5CILH 5I74B 4WENB 3GMNB 5D71H 4GMSH 1XCQB 2AK1L 4JPWL 4M48H 5E8PA 5HHVL 2JF1A 2XOTA 1CIUA 3EZJB 2YZ1A 4N0UE 4KJWC 2FL5A 4KROD 5E6ZA 1YEDA 2AEWA 4KVCH 1NANI 1TVDA 3ARTA 4M00A 1EFQA 5EUOB 4M61A 4GXUM 1EO5A 4X5XB 1JGDB 5CFHA 5E2WH 1P6AB 3X3GH 3QXAA 4DK3A 4LOUC 5MEOA 3MLVL 2Y7QB 2X4UB 1E4XL 5J7CC 5IV2B 2UZIL 2XTJC 3O0RH 4LLAA 1IAOA 4RA0C 3UTTB 4GAJH 5FYLD 4K8RD 2AJ3B 2DYPD 3HNVH 1NAMB 1W0VA 5EUOE 2D9CA 4L3ED 5DDHA 2V9QA 4GKSA 2FB4H 3QRFM 4HBCH 3GKWH 4NJAL 3RKPA 1U36A 2VDNH 4RISL 2EDOA 3KPRD 1BGXL 5C6TH 4AM0B 1S9WB 4JM4H 1UXSA 1P2CA 1M6OB 2NTFB