1MCKA

Principles and pitfalls in designing site directed peptide ligands
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
216
structure length
216
Chain Sequence
PSALTQPPSASGSLGQSVTISCTGTSSDVGGYNYVSWYQQHAGKAPKVIIYEVNKRPSGVPDRFSGSKSGNTASLTVSGLQAEDEADYYCSSYEGSDNFVFGTGTKVTVLGQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IMMUNOGLOBULIN LAMBDA DIMER MCG (LIGHT CHAIN)
publication title Principles and pitfalls in designing site-directed peptide ligands.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immunoglobulin
total genus 39
structure length 216
sequence length 216
chains with identical sequence B
ec nomenclature
pdb deposition date 1993-02-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1mckA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1mckA02
3FTGB 4RAUB 4IHOB 4P46B 2YS4A 1D5BB 5E6IC 4OQTA 1NMCC 2FLRT 3U1SH 1WBYA 3WEXB 2BOCA 4HMDA 3HNSL 4K7FB 5EIQA 4C83A 4DAGH 1CR9L 2VB5A 3BH9B 4P23C 1AE6H 1XCTB 4FFVD 1MFCH 2Q20A 4JRXE 2X4RA 5DJ8B 2CR3A 2DKMA 3RZCA 3K0WA 2VLMD 1LQSR 1D5XA 2H2PD 1SEBA 5C07A 4NQDB 5JXEA 1OD9A 2YA1A 4NO0B 4Y4HB 3PP4H 5DVLA 2FWOA 2AKRA 4XH2A 3GKWL 2IPTH 1YNTA 2BY3A 1KB5B 4O9HL 4QXTA 3QCTH 4Z7VF 2RR3A 4S0TD 5FF6A 1FRGH 5ALBL 3S88L 2Z35A 4MNQD 1MCHA 2FH8A 3MYZA 4QT5A 4PG2A 1J0KA 4PJHE 4AQ1B 3SBWC 5CBAB 1QSEE 2JIXB 2R0ZL 5FIEA 3U9PH 2AVGA 4KKCD 3QIBB 4OBRA 3WFCH 5J6HB 1RFDL 2XPGA 2B20A 2WUCH 3CLEH 5C3TA 2IGFH 1ZA3B 3HZKA 3WBDA 1NC4D 3N1FC 1UB5A 4HIIB 5J11C 1FZMA 2EEBA 5IG7B 2A74B 3ARZA 5EFIA 1JZ3A 4R4FH 4R4NC 2BCKB 3U0WL 4KK6C 3B5GA 4YFLF 5C0AE 1A4KB 5ERWB 5I1IH 3QPXL 2BRQA 3MJ6A 1CYGA 1HINH 3EKCA 3CD4A 2NYYC 1GJIA 2QTEA 3CPLB 1KJ2H 2B4CH 4FXKA 1CF8L 3LQMA 3ZT7A 4IM8A 1CT8A 3GJEB 3REWA 4GW4B 4JQIH 3BUYB 4U1LA 2X09A 3SDAB 2R56L 3ARTA 4GOSA 4XP6L 4BSVA 2DAVA 4JREB 2WWKO 1FV1A 3QIUD 2XY2A 1EAPA 3WUWA 3FB6B 5KVMC 3BP5B 4J4PA 2CH8A 2NY3C 5HHOE 1U8PA 1QSFD 1CFVL 4HULB 4JRYD 4XI5D 5EBWB 3KPOA 1BZ9B 1D9KD 4QHKI 1BLNA 3S35H 3BP4A 2Z92A 1AIFB 4PRHE 4I18A 4UQ2B 1ETZA 2NX5E 1I85A 3QRFM 2VOTA 5TQ2H 1G0DA 3FQNB 1FLRL 1FVDB 4FTVB 4QRUB 3QWOA 3DIFA 3CVIL 4X6FB 2R0WL 5H37G 2DQHH 1EMTL 4ERSH 4PY7A 4ZFOA 3ZYIA 5KSAA 5HGHA 1K2DB 1RZ8A 3S36X 4DGIH 4YBHA 5T1KB 1I1CA 5DF0A 5C0CA 1SHMA 3O4LD 3P4MA 5IB5B 3TIEB 1MFBH 1UQSB 3WJLA 3CXDL 1AC6A 4NQEA 1UEMA 4HK3J 2Q76A 3EDDA 1H5BA 4ODTL 4YWGL 5KANG 5CKAA 1QBMH 4ZXBA 1V5JA 1BD2D 4AIXA 5E5RB 5IR1B 5DFWH 4GXVL 2YPLB 2OP4H 2VXQH 2ZOLB 4KJQC 4N0UE 5J12C 3MLXH 3U30C 1BOYA 4MA8L 1SYSA 1HH9A 3EYQD 3T0EB 1I3RB 4NM8L 5I0ZA 1R0AH 1K6QH 3HPJA 4KK8C 1KIRA 3ES6A 1MPAH 5SX5H 1WBXB 4TNVK 4KTYA 3FOLB 4KPHH 4D0CA 3K4AA 3T1WA 4XT1C 3VI4F 4NP4H 3TT1H 4K71C 4ZPVB 3PL6D 3C60D 4LLWA 3KS0H 4F7PB 4QCIA 3RNKB 2NW3A 3VFMB 3IDJA 4APQC 3MPCA 4PLKD 1DEEB 4HS8H 2X2YA 4POUB 1R3LB 1Q0XH 4LLQB 2GK0B 4PJBE 5A2JH 2ZUSA 4M93B 5DTFB 4DCQA 1KCLA 2F8VA 5ACZB 3CZJA 4JGJA 3NACL 3Q1SH 2KL6A 3PV6A 3DMMC 2BHZA 5F6IC 4M3KB 4GW1A 3LDBC 4HF5L 4LLUB 4M4PA 4CU7A 3PGFL 1IBGH 3RA7L 1MJUH 5DSCB 3OXSB 1KEGH 3MV7D 3H6JA 2BNUA 5HTSA 2X05A 4P2YA 2XOTA 1OGAE 3AS1A 3OX8B 3IFLH 4M5YH 5FCUL 5CLTA 4Z7WB 2PTTB 2VXVH 1RZIA 1EEYB 1PLGH 4G8FB 1JWUB 4PJIB 1ZT7A 4HKJA 4U3XA 1H3VA 1RUPL 3G6AA 3I75A 5LQBL 2XY1A 3OKNB 3ZO0A 2G2RA 5D72L 1MLBB 3EDKA 3S4SG 1E6JL 3OAYH 3PWJA 4QGTA 5FHBL 5I73C 2W59A 3S5LB 3WYRA 1I7ZB 3QH3B 3OGCB 4PJDB 4JE4B 5DRXB 3I50L 4HXBH 3O8XC 2VZSA 5K59F 5HD8D 1NANH 1T0NA 5EOCH 4JKLA 3RX7A 3M17A 1RUML 4Y2DA 4OLVL 5AAWA 2Z9TA 4OZIB 4O51B 1IKNA 4WW2A 5I1DB 3ALWA 3MRHB 3GMOB 2AS5M 4X7SL 1RVFL 4P5TC 2W0KA 2YKLL 1QRKA 4LARH 2C7UA 5H2BB 3BKJH 3MQIA 3FFDB 1NCTA 3VFOB 4OCWH 5IWLA 4RMUA 1NDGB 1AQKL 3QUMA 3RWJA 2AI0H 3O3AB 4MA7L 2XXCB 3ARVA 1QRNB 4WRLA 3RWGA 1QBLH 3EFFA 3CVHB 2DM2A 1VFAB 1C5CL 1SJEB 3HAEA 4K23L 4M8QB 1T0MA 3LRSA 1G7LA 5HHMB 4LSPH 1ZGLP 1MNUL 1ZVHA 1JMXA 1PG7L 3DSNA 1FVEA 4IDJH 1JHTB 5DJYA 1WV7T 2F74A 1K9TA 1EPFA 3KLAA 5DZNA 2Q86A 4Q97A 4XAKE 1NCBL 2XZCL 3P4OB 4OTXH 1CDGA 4MD5A 2UY7A 3TPUA 5MEPA 4EXKA 5F1OB 3U46B 4K94L 3MLZH 1IVLA 3DSFH 2ATPB 4P2RB 3L3GA 3F58L 3Q5YA 1V7MH 3WHE0 4HMCA 4MNHA 1CXHA 3IRZA 3RJQB 4U1HB 5JQ6L 1T20A 2HVKA 3NVQA 5BCAA 5I6XC 4KRNA 5KJRL 3OXRB 4TUKH 4BQ9A 2Z31D 1VHPA 5SWZA 2IH3A 4P3DA 3O6LL 4WI2A 2QADB 1MCWM 3LPGA 3E3QC 2V2TA 5DS8A 3RPIA 4G9FB 2N4IA 2OSLB 2AK1L 4OLYH 2GW5A 1EXUB 3GMLA 4X6DF 1JVKA 1F4XH 1SBSH 2QQQA 4RISH 2XQBH 3TIDA 3NCCB 3DECA 1UVQA 3EYUL 5ID0B 4WU5B 3QNZA 5D7IF 3HE7D 4R8WH 5MEQA 3BPOC 3T4AA 2GJ6E 3GSVA 2Z8RA 3B8YA 2V2WB 4C56D 4BFBD 1J18A 5AD0A 3D3VA 1G9ML 5F89B 3P9LA 2IBZX 3LEVL 1J1PL 5E99L 3RL1B 1QQDA 3Q6GH 4U49A 3TN0D 5KSVB 2OJZL 1T83A 2HRPH 3G5ZB 2EEAA 1EUTA 3QULB 2JCCA 4YJZL 4NO3B 3RGVD 2WINB 1JV5B 1DQML 3Q3GB 3U9UA 3JV6A 1P53A 2WP3T 4X7TA 3QSKB 1VKXA 2D9QB 2XXMB 3O45B 5HHPA 5DO2D 5HDLA 4A6YL 3GMMB 5MEND 1H3PH 3BFOA 3OF6D 1LK3L 3F7VA 3FRUA 5HY9B 5HI5C 3FQTA 5T1MA 4JO1H 4CVZB 1HHHA 4G8GE 2ERJC 3S7GA 4IRSA 4JM2C 5FUCC 2F8XC 1KIUA 4WFGE 2EDQA 1RJZA 3D69B 4ODVL 4LSUL 4MQSB 3SCMA 4NWUL 4EN3A 5D6CA 4ZG1A 4G43B 2VL5B 3BPNB 1AI1L 4JB9L 2ARJB 5KS9A 4LGPB 5EO9A 3VCLB 2ZKHL 3FB5A 2BOBA 4L4TB 4W81A 4AM0B 4BSWA 4JG1H 2GY7B 2K1MA 1JGVL 4TVSa 1OM3L 4M7LH 4DTGH 4QY8A 1B9ZA 3TVMB 1X5AA 5AWNL 1UM5L 1FORH 4O4YL 4RNRA 6FABL 3H9SE 5INDB 5C0BA 3FO1A 1MI5A 2OZ4L 5GS0D 1B0WA 4IS6B 1EEZB 2C1OA 2ICCA 3MGOB 3BH8A 1AD9B 2BNRB 5L2KA 4Z7OE 3I3BA 1KTLB 4YH6A 1U2CA 3E1F1 2CKBB 3QEUA 1F6LL 4OZFB 4WI6A 4S1SL 5IW1A 3M8OH 5I1KH 4OIBA 1JPGA 2PXYB 32C2B 4H8WC 4MZ3A 3UDWC 4R26H 3L6FA 4P9HL 1VFUA 1A5FL 1HIMH 2P46B 5TGBB 1UM4L 5I74B 3MLSH 1IJ9A 5C0GA 3EDEA 4LVNC 3QWQB 1J86A 3GI9L 1ZTXL 3V5KA 2GI7A 4NZUL 4AK1A 2VZUA 1TTGA 3HC4L 3UTPE 1EZVY 3ILPA 4X5WB 2HG5A 2UZXB 1U3ZA 4MD0B 4KHXL 2IAND 3GB7B 4ETYA 3FN3A 1Q9WB 1XR9A 2WUBL 4CKVX 1YEEL 4Y4HC 3FFCE 1FFRA 4N1EA 3PQYB 3L3KA 3T3ME 1PW3A 1GHFH 3D85B 3O3DB 1FNSH 1JHLH 5AAMA 2ILLA 4PUBL 1YEKL 5DQ9A 1U41A 4A2LA 4WCYL 3KJ6L 5IT2H 3BI9X 4RQQA 5MERA 4Z95H 3IJYB 2D31A 1E0OB 2JJSC 4XC1H 3GBLA 3HUJB 4XNYH 3RY5A 4CADA 3GHEH 1XGQB 5D1QD 1IGFH 4UINH 4UQ3B 1FN4B 4LSDA 1U3HB 3HI1A 4L9DA 4AH2B 3FZUD 1QNZH 5IP4A 4GBXD 3O2VH 4M7JH 1NAMB 1JL8A 1R5VA 4WWKA 2X4TA 4NQCD 3DV4A 2YEZB 4KFZC 1YEIH 5B39G 4YXLH 5HYJE 3C08L 1FSKC 4OM1H 2WBJD 2G5BA 3ARUA 4XAWL 4ALAL 5I8OL 3KWWA 4JHWH 3WNKA 3VGAC 1DN0A 1R3JA 3C5ZA 5IOPA 2GCYA 1UM6L 5FV2A 4FQ2L 4Q9QL 2RCSL 4PB9L 5C9JB 3OB0K 1KELH 3L3IA 3VFSA 4P48A 1D7FA 1N3NB 4OI7A 2O93L 3S3SA 5IFAH 1LO4H 5D7JC 1S7UA 1MFDH 1R3IL 1NUGA 2EDXA 3SDXA 1JNNL 5DFVD 1KPRB 1DDHA 2AXJA 3ZL4H 3HI6H 2ESVB 2Y1VA 5HVFB 5EU7E 4MA3B 2KKQA 4IJ3C 3MV9B 4M1GH 4WJ5A 1BQUA 2EH7L 1OAQH 3CLFL 4OM0L 5CUSH 1WK0A 1FDLL 4KK5C 2UVFA 3O9WD 3GM0A 4UDTA 4UT7H 4XMLL 1AR1C 1YMMA 4FP8L 1HSAA 4YBQD 4CGTA 4HUWB 3JTTA 2W60A 1MRDL 2H26B 4QRRD 2X4QB 4BELD 1M6OB 1B0RB 4HH9A 2FJFB 2OL3L 5C0JB 3HNVL 2W0FB 3ZE0F 1QFWM 4ZMAT 4DKAA 2PO6A 3FB8B 4N8CL 4JFXB 5L2JA 1DQLL 3OTTA 1G1YA 3IFOA 3SE9L 2FCBA 2HJFB 3FQRB 3UPRA 3T2OA 5JDSA 1UZ8B 2DS4A 3DYPA 4XWOD 3SPVB 4Z5RA 4GRMA 3QEQB 1PKOA 2Z93B 3KLHD 5ISZD 1DBBL 4BFIA 3SDDB 1MQKL 1JTOA 3UP1A 1PSKH 4X6CE 2NY4D 4WI3A 6CGTA 4UAOB 1NFKA 2Q8BL 5J0BA 3T2PA 3ZSSA 1N5AB 3KPRA 4UILL 1KTDB 4KKLD 5KG9B 1D5IH 4HXAL 5CMAA 3MUHL 4X4YA 4KGJA 5D1XB 3GSWA 2Y36L 5EU6A 2FIRT 3RAJL 1EUUA 4HX1A 1IKFH 4C4KT 5FM5M 4QKXB 1HEZA 4TQEH 3BAEL 4HWZB 1KN4H 4R90L 3AM8A 1FFPA 4JFZH 2FECI 3BGFB 5DJ2A 3OKEB 1ZHBB 4XGZB 3ZLQC 5LKNA 4I0CC 1A47A 4UT9H 1CD9B 3NFPB 3R1GL 1OWWA 4XBGB 2VLJB 4YHOH 4H20L 4BKLB 4ETQA 4K2UH 4X5XA 1NLBH 4YHMH 3CFDA 2VZOA 3WO4B 3SDCC 2AJSH 3EJZD 4RGND 2HJKB 2DQUH 4JFPA 1TITA 3F7YA 1TCRB 2YC1B 1G9MC 3W11C 4GFTB 3VGHA 1RIVL 3MBEC 4D9RD 4JKKA 4DVBB 1PFCA 2DICA 1EK3A 1U8MA 4YHZL 5BMFL 3IDYB 4U1MB 4U7KA 2FJGB 1NCWL 1KT2B 4ZD3H 4OCLC 1BIIA 1ZGLA 3GSUB 3ZDZE 4WO4B 4LDOB 5E6IA 1GL4B 1XMWA 1OOAA 3QA3A 5GISL 5IQ9B 1CFNA 3O3BA 2EIZB 5C71A 1QFUH 4WW2F 4YNYB 5EZLB 5JHDB 3O81A 2VC2L 4ONHA 3ECBA 4XHJC 1GAFH 5C1MB 1I1YA 4B53A 5T33L 2XRAH 1YY9D 3TBSA 3QQ9D 5E5MB 3IJHA 3T77B 3LS4H 5ADPH 5DK2A 5EO1A 2Z8SA 1OP5H 3K46A 4P5MB 3TV3L 4EI5D 1G6RL 3C5SB 1KN2L 5FKPB 2X5PA 2AJ3B 4N9GA 4J3WA 3QUYD 2X41A 3I3EA 2H6PB 1KPUB 2V7NA 3BOVA 1AKJA 1CFSA 1GRWA 3MROB 1YECL 1JF6A 3F12A 2BSSA 4YDJB 5JUEH 4Y88A 2YBRB 4J3XA 3AS2A 1NC4B 3MLWL 4YZFF 3ARFD 4CMHC 1NPUA 1OP9A 3FO0H 5EU4A 3HG1E 3L1OH 2FB4H 4Y5XB 5B4MD 4LHJB 3WV0A 4IMLA 4PJAA 1WVZA 4N8VG 1HDMA 3IXTB 2X1PA 2X4NB 1RMFL 4JR9L 2Y6SD 4TSBH 5ENWB 2VDRL 3NPZB 3RTQD 1C12B 1RK1A 4P9HC 3TCXA 1P7HL 4KVCH 3QDJB 1AFVH 2JKXA 3MRDA 3MV8A 5EPMB 5LGJB 2X4SA 4V1DD 5K9QI 3S34L 3LEYL 2RFXB 4XZUB 1AY1L 2B0SL 1B4JL 1P7KA 4XP9L 4P3CH 1BM3L 5J1TC 3QIUB 2BHYA 4XP5L 1MLCB 2MQ0A 1QSFB 4FQHB 2X7LA 3JV0A 2OS7A 2W91A 4JRYB 1D5ZA 1D9KB 1I9JH 4U6HA 1DFBH 4PGCA 5FA4A 3RBSA 3WN5C 2J6EL 2XNAA 4XVUD 3UTZB 1S7SB 4G6AC 4HLZH 2DLTA 1FG2B 4RZCA 5E8OB 3RZCD 2LAGB 5CJOL 1AGEA 1FE8L 1F97A 1NBVH 5C07D 3TO4B 1O7SA 4XP1H 4KKAC 5T5FH 1DVFD 4ZAKB 4GG8A 4U0QB 1LVEA 2V5MA 4YK4B 1S7RB 2QADC 2VERN 5TE7H 4F2MA 5C0DA 4PRBA 4UOW0 4HK3N 4P5KA 5FYKE 4O00A 4FXGA 1NFDB 2ADGA 1KYOJ 4YPGA 2F58H 3JWDH 3KPSA 5MHSD 4GRWE 3TNNA 3DUHA 3V4PH 4ODXA 4MJ6B 4OF7A 4P49A 2VJXA 3E6HB 1U8QA 1RURH 5J9PB 4PJGA 5DRWB 5SWSB 3RVTD 4HUXB 4UTBL 4Z77B 2XN9D 4ZSOA 1W0VA 1N6QH 3G08A 2HJLA 4LSTL 1NFIA 4XTRD 4OD1H 1NGQH 4XVSL 3G5XA 1CICC 1RUAH 3RWEA 4KV5F 3GMPB 4PRDB 3V5DB 4N1CA 2E9IA 5DJDB 2MOVA 4JANA 5GSVB 4ONFL 4OFKA 4Y19D 2OLDA 4NC1E 3TA3C 5E2WL 4M61B 5I66A 4NDMB 4X8JA 1X5FA 4R4BA 43CAB 3PP3H 1MCPL 4YDLB 5SX4I 4PRID 3O41B 4UIKH 4H1LH 1HQRA 4LCWE 3MRLB 5DEZA 5ITBL 5KS9F 4APQA 5DHVA 3LQAH 1I1AD 3VH8A 4LSSL 3EYVA 1JI2A 4EKXA 4KY1H 3IFPB 1AD0A 2MHAA 5GHWL 2DIBA 4ZOCA 5GGSA 3GMQB 5L6YL 3WMSA 1LEGA 1BF2A 2VZ1A 3VFWA 2N7BA 4DN3H 4HGKC 3W9EA 2NW2B 1Q9KB 4JY5H 4MNGA 1F3DH 3MV7B 4RRPG 1ZLWK 3QUZC 4HS6A 1LEIB 1J0JA 5C08A 2CLZA 1I8KB 1UADC 4HK0B 4HUNB 1SBBA 5C0CD 1QLRB 1MRCL 3NMEA 5JXAH 2GFBA 3QUKA 5IVZB 4LLMA 2BP3A 2YWYA 3LN5A 2JELH 2BY2A 2B39A 1GVIA 5EN2A 5EC1B 3RDTB 4ZXBD 4U6VH 5F7DA 1MEXL 1NBYB 4YHLH 4OD3H 5D2NA 4QXGH 1RSFA 4U7SA 2AEWA 4JQVA 4HIEB 4MYWB 3O8XA 1IGCH 3NPSB 3VWJD 1CD0A 2JB5H 5I8CB 1A6UL 3K8MA 1IAOB 3KPNA 3H9ZA 3B3IA 3IFNH 4J8RA 5J4MA 1T2QL 2XWBA 4NQDE 1T66C 2CQVA 4G6KL 4P5TA 2DDQH 2UY6A 1NL0L 1AJ7H 3BHBB 1XF5A 3LKQA 4FABL 4PJ5B 2CRYA 4ZUUB 1A6VL 3WCYA 2E9JA 1HK6A 4R7NB 2Z91A 2M2DA 3I9GH 1OGTB 3WL9A 4KRPD 4LHUD 1RIUL 2EDTA 4KROB 5IK3A 4OKDA 4WUUD 2VR4A 4KTDH 4M7ZB 3WIHL 3TEUA 3WFEH 4W68A 3DPBA 1YEGL 2R1YB 1U6AH 2YSSB 1G7MA 3QUXB 4WHCA 1Q72H 1G7PA 4EBQL 2HKHL 4D2NA 1FNGA 5CWSA 2X4PB 4NO2A 2A6KB 2AJXL 3LKSB 3NIDE 5ETUB 1SJHB 4OI8A 4R97C 5KN5B 1ADQH 3RNQB 4W6XB 5ALCH 5C0RL 1FPTL 1INQB 2YN3A 3LKRB 4JFFD 4LHQB 1DSFL 1XF3A 3EGSB 4KZEH 4MVBD 3U4AA 3FMGL 3QDAA 2HKFH 3HMXL 3GRWL 3ULUF 3SDXF 2Z31B 3CSYA 4GS7B 3LKNB 5FDWA 3OB8A 5EIIB 1ZVSB 1CBVL 3C8HA 4IOIA 4CVXB 4Z7UE 3L95A 5GS2H 2KZ1B 3L9RA 3ARBD 5J3HC 4AL8H 5SWQB 4X99A 1QUNA 2OI9B 1DBJH 2DBLL 3EHBC 2F5BL 5E2VL 4MWFB 4LEXL 1EBAA 4R0LB 4NUJA 5CD3B 2EXYD 5IBUB 3MJ7B 4Y2DD 3KNBA 4ELMA 3R8QA 1F58L 2OK0H 4XCYB 5FGCB 1I9IL 1T1ZA 4FTVE 3O6FC 4OGAD 4KMTH 1R5IA 4MD4A 1TZIA 3L3OB 3MREA 2QKIA 2O5ZL 3DRTA 3OR6A 3HE7B 4Z7VB 3MA7A 2AJUL 3V4VH 4H26B 3LH2H 5JHLH 4ZUTB 4MXWH 1HHIB 1A7NL 1T22B 3BXNA 4C56B 3MOAH 4KAQH 1OT1A 5DUMH 2E7HA 3GHBH 3GSOA 5C0NC 1EJOL 2IH1A 5DMYA 2VXSL 4O2EB 4ZYKB 5F1IB 2I07A 4BQCA 3QI9D 4ZFZB 1P4BL 4LMQE 3JV4B 5F7LB 1N2RB 2DI9A 3QXDA 5F1NB 4PS4H 3TN0B 2BSTB 3BDXA 3HZYA 5DQDL 5E2UH 3UC0L 1WWCA 5LGHL 2ZG2A 4F7TA 2X70B 1FLTX 1FO0B 5DUPH 2DQJH 4WHYH 2YPLE 3CK0H 5T5NF 3SY0B 2EE3A 4XPFL 3EJJX 4ZO8A 1E4XL 3A67H 3CXHK 5BXFB 4G9DB 3VXQB 2DD8L 3SDDC 2XTJD 1FIGL 5DR5H 4Z7QE 5DURD 4JZNA 4UBDC 1PVHA 2OBGA 5D8JL 2CDEA 5E7FA 2I9TB 4KVNH 5C0IA 1DN2A 1GIGL 4RIRA 1IGML 3QCVL 3Q6FB 2AK4D 2DM4A 1IGJA 4M7LT 1KGCE 2HH0L 4RMWA 5I18L 3DX8A 2MQCA 4B0MM 2IBGA 2NLJB 3ALPA 4GW5A 4LDLB 3OAUL 5I17B 3SGKC 1Z9SA 3DETC 1S78D 2EIEA 4PYGA 2IG2H 1JGEA 5E1HB 1TETH 2BX5A 3MLYH 4HWUA 2PTUA 2DOCA 4HKBB 4JJ5B 2CIKA 4DN4L 9CGTA 1MWAH 5IVNA 1AGBA 3V4UL 5C0EA 1P4LA 2A73B 3KYAA 1CN4A 3ROOA 3TESA 4L8BB 5TQ0H 1BVKA 4BM7A 3DTXB 3KPPB 2DRUA 2UZIH 1QLFB 4LAJH 4OKVB 4OAWB 3AU1B 3ULVE 3PGCB 2R23B 5FYLE 1HHJA 3FO2B 5FECA 3MA9H 4JPWH 2DB8A 3BD5A 2A2QT 3C2AL 1ZHNB 3PIQA 1RJCA 2GAZA 2XKNA 4ODHL 1X4ZA 4HHAB 1CDCA 4Z7WE 5EU7C 1IC1A 4NKMA 3TZVD 1EHNA 4HFUH 4OB5H 2GY5A 2EYTA 5GGQH 5AYUL 2C3HA 3BDYL 5HDBF 2AXFB 4I3RH 3QNXA 3UDWA 3BZDA 5IEKB 3QP3A 1IC5L 3VRIA 1RZFH 4GAGL 1BIHA 3FRPG 5CHNB 4FFVC 5JW5A 4ELKB 1AQDB 5C2BH 1IGYA 1PD6A 2IANB 2H2PC 4FQ1H 3KYOB 5DK3A 1CQYA 4MJIA 3ARWA 2CUHA 5HJ3B 1MUJB 4LQFH 4YUEL 4OZIE 4BFGA 2UV3A 2PNDA 4YR6B 5IB2B 3MNWA 3BP7B 1MELA 3KYNB 5JO5B 2PN5A 4U1SA 1C08B 4QRQB 4LCYA 1IQWH 2LV4A 5HXMA 4IRSD 4M6OL 3BZ4A 1KIPB 3EYSH 3JV5A 4EIZC 4PJAF 1F42A 5DRZA 4EN3D 1FNFA 1YN6A 1R3HB 2JJSA 3DURA 1SEQL 4PRNA 3D1MC 5GZOD 1SVCP 3IVKB 4GBXB 1FGNH 3QDHA 4L8SA 4KKCC 4ZFGL 4UT6L 4WDIA 1PEZA 2EO9A 1JNLH 3VXNB 1U8NA 3V6ZA 4G8IA 3QDGA 1EHLL 3GSNH 4S1DD 4C55A 2WBJB 2BDNH 4F7EA 2AJZA 4JFYA 4EDWL 1BBDL 2BNQB 3MO1B 3QDMA 1H9VA 5ICXA 3O2DL 3TP4A 1L0XA 1MVFA 5BJTA 4D8PA 4PLOB 3FL7A 5C0BD 4E41E 1F00I 4LGRB 2DBJA 4X6BA 5D7LB 4YHYB 2AJVH 5L2KD 5T3XE 2W9DH 2R8SH 4HWBH 5FYKU 2GJZB 4R2GD 4QOKA 1BBJA 1FBIL 4OD2B 3K4DA 2OR9L 4KMLB 2A0LD 1MHHB 1T5WB 3UBXG 4P2OA 2AGJH 4Q7DA 1XH3B 5D7JA 3UTOA 3W39B 3NCMA 1OTTD 4TPRL 2ZCHH 4P59H 5L0QB 3RVWD 3KDMA 2FATH 2J3SA 3NGBC 4HG4K 5E08L 4XI5C 1Q94A 3O9WB 3HCVA 4WY7L 4YC2B 5I15L 5B38G 2K3TA 3MGTA 2YUWA 3MMEB 43C9B 1K4CB 3ARRA 1J8HB 1P4IH 1EFQA 1U2HA 1NCAH 4LEOA 3MCG1 2Q6WA 5SX4H 4PGDA 3VI3F 4ZUWB 3GJFH 1TZGL 4UNUA 4FQCL 3FT3B 2YZ8A 4DFIA 2P44B 3VXTB 1ZANH 3SO3C 1VERA 2ADIB 1ES0A 2V9QA 4DZ8A 1OQOA 5IFHH 1N5YH 4PJGF 1T7VA 4LP5A 1P69B 2YD7A 5FA3B 3FCTB 1ZHKB 1HSBB 3MRQB 5F9AC 4FG6D 1DBKH 4EUPA 3JUZA 1I8MA 1LGVA 5I75B 4G80A 1NJ9A 2BRRL 1N64H 4PGBB 5ISZB 2OJEB 1TZHA 1ZT4B 1H3WM 2X1XR 4XWGH 3G6JE 4KUZL 4MXQD 3SJVB 4NHCH 3F7QA 5IHBA 5EB9A 1MREH 5EC2B 4M9PA 1XF2A 1S3KL 3E6FA 1E4KC 1FL5A 3QQ4B 4OZ4B 4WUKH 4WWKD 5GGRY 1HWHB 1FQ9C 2R0ZH 3O0RL 1P1ZB 4U0RB 2IFGA 3THML 1C8PA 4WTZG 2A6DA 5D96C 2YRPA 3EYQC 4LPVA 5ESVA 2IPKB 1QSEA 2ZCLH 4HJJL 4H0GA 5C7XL 1W72B 3ZDYE 2CUIA 3MRJB 3U7YL 2A9MH 1INDL 4GAYB 1TNMA 3P0YL 3L7FA 4D0BB 1FFQA 4EVNA 3BE1H 3NCJL 4WEBH 5F7NC 5FYKH 4XC3L 1S9XB 1OD7A 1XGTA 3PL6C 3C60C 2BY1A 4KGLA 1G7IA 4OFVA 4IRZL 3K8LA 4GH7B 1NKOA 3C09B 5HHVL 2R0LH 1RJYB 1T0PB 4MQXD 3UJJH 5ECJE 3T2NH 1YQVH 3ARSA 1S9WA 3BT2H 3ULUD 1B6UA 1C5BH 3BESR 5KSUB 1WZKA 3PWUA 4EEEA 1L6XA 1MRFH 4RGNB 5C0AA 2LU4A 1DEDA 4NRZB 1ACYL 3NTCL 2R56H 3AC0A 2BVUA 4PJ7E 3NA4A 2ZJSH 3SDCA 3CFEB 4LHUG 3IF1A 4CU6A 1WC7A 4L4TE 1YMMD 3TBWB 5ID1B 3L3JA 1S7WB 1NGYB 2VXTH 3MBEA 2V5RA 4X6DB 2OQJB 1OTUD 4HIHB 4JAMB 1YN7A 1T5XB 3FO9B 5HHOA 5L7XL 3ILQD 2PO6D 1P84K 1A7PH 1H8NA 4NN6C 3RWHA 4LVOC 1PY4A 2Z8WC 5D7IB 4CAGA 4PRHA 1UH4A 1YYLH 1A6TB 4LSQL 4DZBA 1J7VR 2YMXL 1LD9A 3P40A 5I1AA 8FABA 2CIIA 4A6YA 4QRTB 3K4ZA 1BQSA 1L7TL 5ANME 3ZTNL 1VGEL 3VXOB 4MB5A 3VD9A 4JLRA 3QG7L 5K9JL 1IARB 4L9LB 4HC1H 3GO1L 1BFOB 5BQ7B 3QXAA 1KCUL 1P7QA 5E8DL 4K9EH 5BV7L 3Q48A 2PW1B 2JTDA 4PJCE 1WCBA 5EU6D 4NJAL 1GGBH 3MRNB 4U2ZA 1E4WH 4NN5B 2KPNA 4HBCH 5DK0B 1QHPA 4WI4A 3P0VH 2ZOKB 4N0UA 3ARFB 1MFAL 4J3VA 3ULVL 5FYLL 4U3CA 2WWMD 3C9NA 4LVHB 2WIIB 4H8WH 1LWRA 3MOBH 3MGAA 4BA8A 5ABDE 2OZ4A 2VDMH 3E8UH 5C3LD 4YDKL 1C7TA 4NC1C 4PRIE 4XBPA 2R1WB 5T1DL 3HN3A 3ARPA 4MCYA 3JTSA 3RTQB 1J1XH 2BERA 4L8DA 4X0KA 3TO2A 5GGVL 1OPGH 3U36B 4QHMB 3S96B 4UOW1 4NRXB 4J1UA 1EGJL 2NY6C 2IFFH 4OZHA 1AGFA 3NACH 3ABZA 5C09D 1UZ6F 1WBYB 5F70A 2BOCB 5H35A 1KB5H 3W82A 4C83B 4OLWL 1P6FA 5IB4A 3IU4H 5I9QB 5KBNC 1VFBA 4YGVA 3KJ4C 4JFHE 2X4RB 2X4UB 1HCVA 3N9GL 4K3JH 3RZCB 4ELMF 1FCCA 4R96A 3WN5A 1WSST 2WLZA 3HE6D 3NN8A 1D5XB 1SEBB 5C07B 4LLVA 3MXVL 4QHUB 4HD9A 4GS7C 1IAKA 2AKRB 4FZ8L 4XH2B 5MP6H 1OGAA 1YNTB 1CDYA 1RUPH 1VEMA 4QXTB 1L7IH 1K8DA 3TBVA 3HRZA 4OSUH 2ZPKL 4MXVF 5FF6B 3RUGF 1E6JH 2ESVE 2FIKB 2OI9C 2Z35B 5FHBH 3MV9E 3R06A 2IQAB 5HVGB 4QT5B 3MYJB 4X80L 3FN0L 3T08A 1UFUA 2APXA 4B7IA 2EDDA 5CZKA 5KSBE 4DW2H 1ND0A 2W0PA 1WJ3A 2AV1B 1CFQA 1IFHH 5GS3A 3T3PF 1FFOA 3DX9A 3V6BR 4JY6A 5ICYA 2XPGB 3KXFA 1V8HA 2DQCH 3HZKB 4U1JA 5CEZH 1UB5B 3CMOH 5IHZA 1FZMB 2D7QA 3LIZH 4HAFA 5ESQA 4GMTH 3A6CL 1F90H 3MLTA 5EFIB 4NQTA 3P77A 4BJLA 3QB7C 2Q7YA 3UAJD 4XX1G 1CICA 1CGUA 1FZKB 1GGYA 3CZFA 4TRPL 1CT8B 4WUUE 3RGVC 2AEQH 3REWB 1IEHA 3MV8D 4U1LB 1MCFA 3UJIH 3DXAA 2V17L 4BSVB 2FNBA 1ZA6A 3GMNA 3RIAF 3X3GL 1CLYL 1QFPA 1FV1B 5TDPA 1EAPB 3QRGH 4XNZC 5DO2C 3WUWB 4MAYC 3HI5H 2KQNA 1U8PB 4PRAA 4JN1L 2P42B 4Z8FH 3KPOB 5EUOE 1UH3A 1BLNB 1MF2H 2CUMA 3BP4B 5TF1H 3D0VA 2Z92B 3GBNL 4I18B 1G7HA 5DMGD 1QR4A 5E7BA 4HPYL 1DLHA 4NCC1 3UTSD 4PJFA 3UYRL 2OL3A 4QXUH 5MI0B 3QWOB 3DIFB 4P2QD 1ZKAA 4Q2ZA 5IV2A 5JLZA 2A6JA 3HMWH 3MBXH 1BPVA 2X44D 2JJUA 1G6VK 4PY7B 4ZFOB 1WZ1H 3ARDC 5HGHB 5KSAB 3WJJA 3AFLA 4GRLD 1RZ8B 1BECA 3PXJA 3QUZA 2LVEA 2BY0A 1L9MA 5E5UB 2A77L 3DI3B 2RIKA 4FFWC 4PREA 3P4MB 1JGUH 2QQNH 5AZ2H 3SE3C 2E9WA 4NQEB 2E6JA 1CXIA 4TYUA 1VEOA 4N90D 1H5BB 1NAKL 3BISA 4UB0L 4ZXBB 2LU3A 4AG4H 5HBBA 4HJGA 2FGWL 4PJ8C 1VEPA 2B1AH 1SYSB 3H9YA 1HH9B 1BQHG 1GC1H 1VFOA 1T7ZA 1TJHH 3KHQA 3AS0A 4KJQD 3WNNA 3HPJB 3SKJL 4NQVA 1CTNA 1KIRB 2ZUQC 3ES6B 3K2UH 1KTRL 3EDJA 5JHDE 4D0CB 3H2WA 3D0LA 1FJ1A 2VLKD 2VWEC 3MUZ1 3VRJA 3TH2T 1J1PH 2GJ6A 2HT4D 2D2OA 3AMLA 2XZQL 1MY5A 2DQIH 3M45A 4LLWB 1QA9A 4QCIB 2QHLA 3HTLX 3ZHDA 1B2WL 3CFCL 2QQKL 4F15B 2P5EE 3IDGA 3D5OF 4KRPB 1XGUA 2E7LA 1I4FA 3MZTA 2WW8A 2XWTA 4TVPE 4KDWA 3X11A 1XGYL 1T1XA 5EG6C 4OJFH 1JPSL 4DCQB 1IILE 2EDWA 1A3RH 4U33A 2FX7L 2UUDH 4JDZA 2PW2A 3EO9L 5JORA 3PV6B 3MCLL 4GW1B 5B8CC 2MKWA 4G6FB 1OP3K 5D1QC 2V7HA 3AROA 5B3JF 4DJMA 4NM4H 2CXGA 2BNUB 3MODH 3WDHA 3FZUC 2AEPH 3G6DL 4PGJA 2X1WL 3EZJB 2EDFA 3QPQD 4LU5L 4HPOH 3RVXC 5HYQA 4PY8J 2R2EB 5HYSA 2B5IB 2F54E 3AUVA 1I75A 3NCFB 5IGXL 2R4RH 4G8GA 4JFEA 1RZIB 2YRZA 1TJGH 3BZFA 4HKJB 2WBJC 5DT1H 2DMBA 3I75B 3G6AB 3S4SA 5D1ZC 3QDJE 5BV7C 2G2RB 2CJUH 3LZFH 3FB7B 3BJLA 2Y25A 3PWJB 1CE6A 4FQQA 4DUXA 2A9NH 2LTQB 4XNXL 1A6WL 1G6RA 3EUUA 1BFVL 4YGAB 1T0NB 3AREC 1HHKA 2OTUA 3M17B 4Y2DB 1G9NL 1HCFX 4WW2B 3G9AB 5DFVC 3H9SA 3MACH 4UTAL 3H42L 4XX1E 3CVHH 2YD8A 4U1GC 3NAAH 4XVJL 2DMKA 5HPMA 4R7DA 5BO1L 5BVPL 3O6FA 3O9WC 1JF1B 4YDIH 2Q8AH 2VLRA 3QUMB 3RWJB 25C8L 3HHRB 4BZ1L 1UC6A 4NT6A 1F6FB 3BPLB 3UTTE 1GGCH 1H8OA 2NPLX 2DQGH 2VAAA 4HDIA 2D7TL 3RWGB 3EFFB 3HAEB 1A8JH 2QQLH 4QHLA 5T3XH 1NGPH 3SKNA 4C57C 2MSPA 2VIRA 4KJYA 1YEEH 1UKQA 1FVEB 1LK2A 4UDUA 5DJYB 2QL1A 2F74B 3PHSA 4IRJC 4XWOC 5I16A 1DBAL 3S37H 5CEXA 2DKSA 3KLAB 1F8TH 2J4WH 3F5WA 2Q86B 3KLHC 5SWSE 4WNQA 4JFOA 1MJ7H 4OT1H 4MD5B 2NY4C 3FFCA 5MEPB 3VG9C 2C4XA 5IMLA 1I7RA 5IMKA 1M7DA 3SGDI 1YZZA 3L3GB 2W9EL 2D7OA 4YBLC 5DD6A 3DGCR 4MNHB 5I19L 1GSMA 1I7TA 2GUOA 5GGTL 1QHOA 1T20B 2HVKB 4MGXA 4KDTC 3MRBA 1W8OA 1JZ5A 4OCYL 4QEGA 3P4NA 3U0PA 5SWZB 2IH3B 2EH8L 5JW4N 4XAWH 5I8OH 3SGKA 3S9DB 3MC0A 1DBML 4U05A 2V2TB 5DS8B 4Q74A 3RPIB 4Z78A 4FFYL 1A14L 1UGNA 2CGRL 3QHFL 5HYJA 4EOWL 3L5HA 5A2FA 1MCRA 3B8SA 3GMLB 2EIBA 4R9HA 4ZS7L 3BGAA 1XF1A 3TIDB 4PIRF 1UVQB 3D9AL 3MFGB 2E27H 1PG7W 3V52H 3CMGA 3EJZC 2A1WL 3QNZB 4OIIL 2XZAH 3ARGC 5MEQB 4N0CC 2QV2A 1I8IA 3TC9A 2Y06H 1HKFA 3OKDA 5HHNB 2V9RA 3I2CL 5AD0B 2NXYC 3D3VB 4O58H 4NQXB 4Q9CA 3P9LB 4HIJA 4M03A 4LAQL 3TJEL 4FZEH 4OLZH 1IT9L 3IRPX 2C3VA 4LIQE 1QQDB 1MRDH 1SYVB 4HGMA 2G60L 4HS3A 4U6TA 4TULL 1YY8A 3CX2A 4F33A 2JCCB 2X40A 5I8KH 1IAIM 4AT6A 2DJ4A 1YQ2A 3GI8H 1K3IA 3JV6B 3DGGB 5DHXB 5I1LA 1BREA 2ZUWA 5KVEL 1VKXB 1P9MC 1Z5LA 2M8XA 5HGAA 5HHPB 1YY9C 1QYGL 1OAXL 1R24A 3QQ9C 15C8L 3F7VB 3V6OE 3V0AC 1WT5C 4KTEL 3QXVA 3FRUB 1DBBH 4Y8AA 3FQTB 4H0IA 5T1MB 1VACA 2OR8A 1A7OH 3EFDL 1HHHB 4EI5C 1BGXH 4L4JA 1ZGLM 4DQOL 4IRSB 1Z9MA 5HI5D 2CLRA 3QUYC 2AAVA 4PB0H 1RJZB 2VDLL 2H32A 4MNQA 3E2HC 4PP1D 1HHGA 3RL2A 3SCMB 4EN3B 4WW1A 7FABL 2I60L 5J7CC 2YXFA 3E0GA 5D6CB 1T03L 5INCA 4KI5D 5KS9B 2XQYK 2OM5A 5EO9B 1PQZA 3FB5B 3T09A 2BOBB 4OCRL 5EBLA 1QFWI 4BSWB 4WV1A 3WD5L 1BQLL 3RRQA 4ZOAA 2CKBH 4JO3H 4O2FA 4N9OB 4OZFH 3PUCA 5E94A 4QY8B 4K3EL 4OZHF 5B4MC 2VLLA 4PJBF 4RNRB 4LPCA 2NY2B 1MI5B 1MIEL 2MCPH 1OAYL 3WFBH 5JMRA 2Y6SC 2C1OB 2J8UE 1E27A 3HNTL 5CJXC 2IQ9L 5JA9A 4IEFB 3F8UB 2ZUXA 5L2KB 3L7EA 1CLOH 1A0QL 2DQEH 4IDLA 3RTQC 5EOTA 4URTB 1KJMA 2P24A 1W0WA 3QEUB 4R2GB 5IW1B 5L8KB 1JPGB 2AABH 2EDKA 3GUTA 5EA0H 2P1YA 3NH7L 1DL7H 3DYOA 3L6FB 5GQBA 5EULV 3LS5L 4ISVA 4TVPL 4L3EE 3MXWL 5C0GB 5I76B 2C9AA 2J7LA 2C4FU 5D71H 3U79A 3V5KB 3VMOA 4NN7C 4X4XA 1U91A 2HYMA 4XPTL 1WTLA 3BD4A 3ILPB 2HG5B 1NLDH 1JHKL 1NGZB 3RY6C 1Z3GH 3STZA 1P5VA 4MJID 1XR9B 4D3CH 1L0QA 1DVFC 3C2SA 4I3SL 3WIHA 4LPWA 1OAKL 5DQ9B 1NAMH 2VSDA 2G75A 3DX6A 4RQQB 5MERB 4Z7VE 5C2UB 4PG2C 2D31B 5DI8A 3K74B 3B9AA 5D7SH 3X3FL 4CADB 2FL5A 4AMKL 1N7MH 4JO2H 3HI1B 3WFDL 3I6LD 3FN9A 2BVQA 3TLRA 5E4IA 3RWIA 1CFTA 1R5VB 5B39A 1FNEA 2X4TB 4JG0H 1YEFH 3DV4B 2D9CA 3VFPA 3HMXA 3GRWA 4A2MA 3RVTC 3QDGD 4HCRH 5E24E 1YECH 4I77H 5LG1A 1E4KA 3QEGL 1N4XL 4XTRC 2G5BB 5DMIL 3W0WD 5T3ZH 4FQJH 3KWWB 3D18A 3DLQR 2RQ8A 1DN0B 3QDMD 1R3JB 3C5ZB 2R0KH 2DQDH 5IOPB 3TWCH 5HGDA 1G9NC 3PWLA 2GCYB 4L5FH 5FYJU 3LHPL 3BKML 5T1LD 5EWIH 2FGZA 2NY1D 3L3IB 2NCMA 3VFSB 4CUCA 4PJFF 1NCNA 3HG1A 4QOKD 3KPTA 2ZWLT 1S7UB 3MRIB 4GJTB 2AV7A 4AEHH 3V0WL 3SDXB 1XAUA 4P4KC 3K7UA 1DDHB 1HXMA 4P2OD 1AR2A 2R4SH 4DGVH 1I1AC 3ZYOA 1YJDL 4ONGL 4WJ5B 3EYFB 4XP9H 3D39E 3G5VA 5DZOA 4NZTL 1T2JA 5GS1C 3QFJE 4KU1A 1TNNA 3OZ9L 4UDTB 5F6HI 3BYYA 4MCZA 2I9LA 4Y4KA 1VGKA 1YMMB 3DVGA 4Y4FC 1HSAB 4WFHE 4MX7A 3JTTB 3VH8G 2W60B 3NZ8A 3X12A 1XF4A 3OSKA 3GM8A 5MI0C 4HH9B 1AR1D 4QWWD 5HDQH 4BZ2L 5L2JB 1JBJA 1JIBA 3IFOB 1CU4L 1CS6A 1HXYA 5EUKA 1FP5A 1OWRM 3UPRB 1J1OL 4K8RH 5JDSB 2DTMH 4KQ3L 5DD3L 1HOCB 2NXZB 4JRXD 5HHXH 5IW6A 4AY0A 4Z5RB 4GRMB 1GPOL 1I9RL 1MVUB 2YOCA 4BFIB 2JK5A 3NCBB 2D7PA 1YYML 3CFJA 5I1EH 5CJQL 1NEUA 5CP3H 1DE4A 1OY3B 4EJ1C 2IADA 1FCGA 4HIXH 1INEL 2DIJA 3KPRB 1FYTD 1NC2A 4KK9D 1A2YB 4XCNB 5CMAB 4GG6E 4X4YB 2UYLA 5K9OA 3GSWB 4JPVH 1UCTA 5EU6B 4HX1B 3VWJC 2YRLA 1WAAE 1HEZB 2VDPH 5FV1L 4E9LA 4ODSL 1U36A 2C5DC 3RIAK 1FFPB 5FYJH 4DEPB 5EBMA 3GMRA 1LO2H 1WISA 5DWUH 5CINH 2ZSVA 5DJ2B 2F5AH 3OGOE 3BKYL 3MJ9H 2P5WE 3FAWA 3TM6A 4G7VL 4ETQB 5JW4R 1KG0A 4TSAH 4X5XB 3O11B 4X83A 5FOBA 2W0LA 3CFDB 5GSRA 4OCNC 5TH2A 5C0AD 4JFPB 4M43H 1DANU 3F7YB 4TN9A 4YFLI 1AO7E 5IM7A 1OAZL 3SDCD 1Z2KA 1FAKT 1EO8L 1SY6L 2FEEL 2WNGA 1U8MB 1PG7X 4AEIL 2JE8A 1HH6A 4LCWA 3MBED 4OI9A 4F8QA 4W6WB 4JM4L 1BIIB 1ZGLB 4FFZH 3DVNA 2BNQE 1IEAA 1AXSA 4XBEL 5E6IB 1NMCB 1ZWIA 3IB4A 3UTQB 3QA3B 4PRHD 2VZVA 4MVBC 2NX5D 1Q0YL 5D7LE 5CZVH 1CFNB 3O3BB 5D93C 4P23B 5LBSH 5J57B 4ONHB 3ECBB 4BK4A 4GKZA 1I1YB 1IM9A 4OLXH 3S36H 1GGIH 2NY5L 1UH2A 3A6BH 4Y5VA 3VD5A 5E8NA 3TBSB 5E9DB 3IJHB 3N85H 4Z7OF 3N0PB 3ARBC 1QVOA 4G42A 4N90E 3SGDH 1P7QD 5DK2B 5EO1B 1L0YA 2FX8H 2CDFB 3PDOB 4I0PC 4N9GB 1EO7A 4Y2DC 5DEFA 2R2BA 1KV3A 2ED7A 3W9DA 1J8HE 1IKNC 2VN4A 2V7NB 1AKJB 4CBPA 1P5UA 1CFSB 4OGAC 2VXUH 2DTSA 4UV4H 5IVXE 1ZLSL 4BH8A 3F12B 2BSSB 5J1SC 2PYEE 4HFWA 2BSRA 3VGFA 5ADOH 5EU4B 5IWLC 1TIUA 3O2DA 2FD6L 4N8VA 5DJ8A 5FO8B 1X3DA 4IMLB 3T3MF 1I3UA 4PJAB 4JHAL 3QI9C 5J11B 1HDMB 3NFSH 5HGGS 3DUUA 3DBXA 1UT9A 3AY4C 2DIAA 1MJ8L 4OF8A 1D6EA 1OCWH 1UWGL 3TF7C 3ZYZA 1RK1B 1R6VA 4MS8D 3SJVE 3KR3H 5LWYL 1I8LC 3AAZA 4NSKB 3MRDB 3MV8B 4U31A 3NZHL 2X4SB 3UJTH 1P7KB 3HS0A 5I8EA 5BRZE 1CLZH 1BEYH 2XTJC 4Y89A 1Y18A 2X7LB 2H41A 4EBQH 1D5ZB 4U6HB 3H7BA 4NFDA 4PGCB 3QXTA 5FA4B 4HQQH 5MENA 4MAYA 2NY3B 4LDEB 2BJMH 1XIWC 5IESH 1RAMA 1W0YT 1UACL 4M6NL 4M5ZL 4RZCB 3EO0A 4MJ5A 1AGEB 3KYKL 2J88L 1GGUA 1KIQA 1WZMA 3SOBH 1S78C 3IAPA 5DD5L 4GG8B 5DLMH 5ESAA 4LSRH 4O02L 2ZCKL 2L7UA 4F2MB 4V2CB 2R69L 5C0DB 3HZVA 2FBJL 3ARDA 3KPMA 4PRBB 5GRUH 4DOHB 4P5KB 3SE8H 3EOTL 4FXGB 3QNYA 2ADGB 4YPGB 5EIVA 1KF9B 3Q2CA 3DV6A 3NOIA 3KPSB 4D9LH 4RBPK 3TNNB 5HHQA 3BQUD 3SE3A 3QJHA 3QR2A 4Z7UA 4WHDA 4UIMA 4Y16C 4ODXB 4X9GA 5E1AA 1U8QB 3BP5A 4H25A 4PJGB 1QFWH 3IJSA 3WDIA 2MPAH 4OFDA 4ZSOB 1W0VB 2F8OA 3VDCA 3G08B 2HJLB 4PJ8A 1NFIB 2RBLA 4U6YA 5J12B 3V7AG 3TZVC 4AYFA 1A7NH 3G5XB 4KUCF 4AQOA 4FTVA 3RWEB 5I1JH 2ITDA 1MFNA 5JW4Q 4P3WA 4JANB 1Q1JH 1KJVA 3FKUS 4M6MH 1JFQL 1DQTA 1VADA 5I66B 1X4XA 4X8JB 2VH5H 3TYGL 2PR4L 3MLRH 1YJDC 1S7VB 5DQDH 4OF3A 2QBWA 4K71B 4X6CF 3DHJA 2Q1EA 2AQ1A 1HQRB 4UU9A 2VDOL 3ZTJH 3VGEA 4OFYA 2P8LA 1EH9A 5F72S 4APQB 3G04A 2H8PA 5DHVB 3BWUC 3VH8B 3EYVB 4TUOA 1ZT1A 4RMTA 1AD0B 3SDYH 2MHAB 4LSVH 2HFEA 1A21A 3S37X 5GGSB 1AH1A 1LEGB 2WZPD 3VFWB 4WFFE 4ZOBA 3W9EB 1MFEL 4ACPA 4RRPA 4XAKD 5F6IB 5IJVA 4NKQB 4XCFL 1RULL 4BSJA 4HS6B 4NWTL 5DD1L 1IGTB 3FT2A 5B8CA 5C08B 2XA8L 3VG0H 1JK8A 2CLZB 3MUY1 3QUZD 1FH5L 1U9KA 4HWEH 4S1DC 3U7WH 4UV7H 2GFBB 3QUKB 1Z9OA 4LLMB 2MTPA 4NNYA 3LN5B 4ZPVA 1X5KA 1QKZH 5ILTL 1N59A 1S9YA 2VDNL 3NABH 4HV8A 5EN2B 5IEHA 5D1ZA 3ZSTA 4NKOB 5F7DB 3L3DA 5F96L 1KC5H 1MHPL 3OL2A 3V4UH 2NTSP 4F9LC 4JJHA 1LO5A 4F9PC 5I73B 1YEDA 3OKKA 2R29H 3O8XB 1LDPH 1RQ5A 5GGUA 1MCDA 2AJYH 5AZEL 3AREA 1T3FA 3ZDZF 3U1SL 3KPNB 3MRGA 2DQTH 3PWPE 1EO5A 3B3IB 3V8CA 4J8RB 4DK6A 4DAGL 2XWBB 2DM7A 2DLFH 4YLQT 1AE6L 3RVWC 5CZXC 4OZGE 1MFCL 2R2CA 4P5TB 4DK3A 1U3YA 2J5LC 2GJ6D 1XF5B 1T66D 3LKQB 4JFDB 3PABA 5FM5O 4GLRI 4J3UA 3PP4L 2Z91B 3RVVD 3WL9B 2IPTL 12E8H 3B5TA 3QCTL 1ORSA 2FZ3A 2X89A 1TPXC 4QRRA 1G7QA 1FRGL 1DJSA 1RU9H 3O4OC 4N1HB 1NCCH 1XEDA 2UVEA 5D9SA 4G5ZH 5E2TL 4PGEA 2B1HL 1EGJA 1UB6A 3LD8C 2WP3O 5H94A 1G7MB 4KZDH 1G7PB 1FNGB 5CWSB 3U9PL 35C8H 3L3HA 4IRJA 1WEJH 4NO2B 5FK9A 1DLFH 3WFCL 3P2TA 4MXQC 4ODUB 3CLEL 1CE1H 2WUCL 3KAAA 2IGFL 4WWKC 2NY5C 1XF3B 2CO7B 1BZQK 3B6SA 4G8GD 4KI5E 5H2BA 4MDJA 4NJ9H 4R4FL 5L9DH 4WFGD 1WIPA 3CSYB 5I1IL 3O3AA 5BZWB 5FDWB 1E28A 4LCUB 4HZLB 5I6XB 1HINL 4IOIB 1FVCA 2J12B 1KCRH 5MEOA 1KJ2L 2B4CL 3L9RB 1QD0A 1CDJA 1U8JA 3X13A 3EJYD 4JQIL 5KOMC 3WNOA 3PNWA 4NUJB 1XZ0A 1EDQA 1C1EL 2DI8A 4ELMB 4MQXC 1NUNB 4PV9A 4S2SA 2FBOJ 3W81A 2EIDA 3WUZA 3ULUC 2E9BA 3H9SD 1YNKH 1T1ZB 1VESA 1FBIH 4E41A 1R5IB 2WQRA 4MD4B 1TZIB 5IQ7H 5TDNA 3MREB 2QKIB 2O5XH 3S35L 3DRTB 3OR6B 5DMKA 2K7PA 3MA7B 4AJ0A 2D3VA 1HKLH 4HT1H 3O6FD 3U46A 5TQ2L 3BXNB 2IWGA 1FO0H 3S3JA 1OSZA 3ARGA 3GSOB 5E8EA 2IH1B 2N7AA 3BPOB 1NCDH 5CCKH 2DQHL 2I07B 1T1YA 4ERSL 4XNMA 4JZJC 4NQEE 3LCYA 3QXDB 4DGIL 3ILQC 2PO6C 3HZYB 1TZGH 3MJ8A 4FQCH 3KGRA 3WSQH 1MFBL 4F7TB 2L4OA 3UTPD 4QYOA 3D2UA 4GRWF 1QBML 1U93A 5BOPA 4KXZI 1EA9C 3FFCD 2LU7A 2OP4L 5DJAA 4AZ8A 1CGWA 5HVHC 2VXQL 2CDEB 1ZK9A 5EOQH 3MLXL 1P9MA 5C0IB 1N6UA 4O5LH 3AXLA 3QXUA 4YHNA 4RIRB 3MRCA 1WT5A 1NUDA 5J1AA 3FT4B 1IGJB 4PJEA 4I48A 1MPAL 3DX8B 3R0MA 5DVNA 4EI5A 4V2BA 4GW5B 4KPHL 2CKNA 2ERJB 3G6JA 5E2JA 3AM8C 3QUYA 5GS0H 2EZ0C 4DEPC 4NP4L 3TT1L 3VXUE 1JGEB 5BVJA 2FLBT 3P73A 3RL1A 3DJ9A 2DN7A 4L8CA 2CIKB 5KSVA 4PRPE 5HYJD 3UXFA 5F9OH 2WWMC 4HS8L 4N68A 1Q0XL 1AGBB 1BOGA 1P4LB 3S97C 3VXME 3ROOB 4G6MH 5J8OA 3QG6B 4DKEH 1QTYT 1BVKB 4RGMC 4NKIH 4N8PA 5CAYB 1VDGA 3Q1SL 1HHJB 1ED3A 3D6GA 5FECB 1ZSDA 5CJXA 3PIQB 2GAZB 2XKNB 3FQXA 1IBGL 1X4YA 2ZUUA 1MJUL 2B2XL 4I4WA 1KEGL 5FB8A 4NKMB 3H3PH 3DX7B 2EYTB 2GTWA 1B3JA 3IFLL 4M5YL 4V1DA 2VDKH 4KRLB 3REVA 4P9MH 4GAJH 4NZDA 5TFSH 3FRPA 4PJ7A 2VXVL 1PLGL 1CVSC 4F7MA 2XA3A 3VCLA 3WIIH 5JW5B 4WGWB 4L4TA 1ZVYA 4LVNB 1IGYB 3HE6C 1TENA 3MFFB 4MJIB 3G5YA 5F9JA 3TVMA 3WXVH 1U92A 3N1QC 4HXBL 4KUCD 3RY6A 3GEWB 3MNWB 5EOCL 2GJJA 4Q9BA 4PJXB 1LILA 3JZ7A 3NCEB 3SGEI 4U1SB 1DVFA 3QEHA 2BVPA 4LCYB 2NNAA 3QG7H 4ZUVA 1CDIA 1A3LH 4DKFH 1JPFA 1FYTE 3F6IA 3ZT6A 1KTLA 3BZ4B 1NGWA 4RX4D 5ANMA 2EKJA 1U8HA 3MOQA 5KVDH 1YN6B 4YXHH 3DURB 4OF5A 3BKJL 4PRNB 5IJKC 1QG3A 1EFXD 3GDBA 4OCWL 1U8NB 4OV5A 5TGBA 4F8TA 3GIZH 3WO3B 4G8IB 3QDGB 1AGDA 2AI0L 3MLUH 4PJCA 4Q6IA 4F7EB 2AJZB 3GKZA 4C4KO 4JFYB 4PJ9C 4RA3A 5CGTA 2GTZB 1QBLL 2XN9A 3QDMB 2O5YH 1FSKB 5HI4D 5ICXB 5BJTB 1G9EA 4D8PB 2FO4A 3T1FA 3ET9F 4MD0A 2IBZY 3UAJC 2C4FT 4S1QL 4X6BB 3VGAB 2NY1B 3QCUL 4BUHA 1KJ3L 5BS0E 1BBJB 3AS3A 1QLEH 4ONOA 4OTXL 3UBXA 4Y19A 3WIFA 2E7MA 3NIDF 1FNLA 4P2OB 1N0XH 5D7JB 3MLZL 1KNOA 4PRIA 3DSFL 4PTTB 5FO9A 3KDMB 2MCG1 1W8NA 4B5EA 4P4KA 5B38A 5SWZE 1V7ML 1Q94B 3HCVB 3F7RA 4HLZG 3MGTB 3DVIA 1I1AA 4IJ3B 3EBAA 5DMGC 1NAMA 4YPJA 4KKBD 1JYVA 4TUKL 4LEOB 4XPGL 1II4E 4NKDB 5GS1A 3MUGA 5IKCA 5DJZA 5TE6H 3V9FA 1YNLH 4Y4FA 3BN9D 4Z7UF 3MSPA 4MJ4A 1ES0B 3FQUA 4DZ8B 4GRLC 1CIUA 4DGYL 4Z76A 4OLYL 5JIHA 1F4XL 3NA9H 4EUPB 5IVOA 5C9JA 1I8MB 4X9BA 2VQ1A 1NJ9B 1PZ5A 4G80B 2YD9A 4RISL 5LJYH 2XQBL 2LAAA 1V3KA 1W72H 1TZHB 1MCOH 3QAZC 3D3VE 4LLAA 4R8WL 4X80H 3RU8H 1XF2B 3E6FB 2ESVA 1FL5B 3WKMH 4WTZA 5FEBA 5GGTA 4XMPH 5FKAA 4ORZC 1TTUA 2A6DB 2Z0BA 3O6KH 2B4CC 5ESVB 2JCCE 1QSEB 5A2LH 1DUYA 2IJ0C 2ZSWA 4U7MA 1F02I 5KSBA 3Q6GL 3VWJA 1XR8A 2HRPL 3L7FB 4EVNB 3FAXA 4L4VE 1BVZA 4CDHA 5I30H 4H5SA 1ZOXA 4I2XE 1J87A 2HT4C 1MHEB 1XGTB 4MMXC 5AUMA 3HLAA 1E6OH 1G7IB 4H1LG 1RUKH 3HG1D 1VENA 4UMGA 4JKPH 1S9WB 4Z7QF 1H3PL 4OGYH 3PWUB 1ZLWH 5C0AB 4JO1L 3O6MH 2DLGA 1K8IA 5GRJH 4LHUA 4MA1C 4LRNH 3SDCB 3U6RA 3IF1B 4WUUA 1WC7B 4Y4KD 3GK8H 4GLRH 3L3JB 3MBEB 3WS6C 3V95A 5E8PB 3GBNH 4M1DH 5IMMA 4LKXA 3SO5A 5HHOB 3BKCH 1MCBA 3U4BH 3QPQC 3HB3D 4JG1L 3RWHB 5EUOA 3BSZH 4NBXB 1MI5E 1CQKA 4PRHB 4M7LL 4RDQG 4DTGL 3NIGE 3LMJH 3OKEA 4DZBB 1LD9B 3MZGB 1FORL 4F58H 3B5HA 5I1AB 4Q0XH 8FABB 4JFFA 1UCBH 2CIIB 4A6YB 3UPAA 1QPXA 5HYSG 4DFHA 4HUUA 4XBGA 1Q9OA 4BKLA 2CD0A 4JLRB 3ULVF 4XCEA 4K07A 4YHKH 1P7QB 1Y0LB 1NC2D 5D2NC 5EDXA 3M8OL 4HJ0D 5I1KL 4JQVC 1TCRA 2P8PB 5FYKD 4Z7WF 1F3JB 3ARBA 2XTLA 1WCBB 1JTPA 4R26L 2DKUA 3VFVA 4KJWD 4RMQA 1HIML 5DC0A 3MNZA 1YEJH 4LPTA 4I0PA 1JN6A 1I3GH 4HW6A 4LFHD 3MLSL 1DANT 5KZCB 2AXHA 2NZ9D 4FQIH 5FOJA 4N0UB 3OV6A 2BC4A 4EQ2A 3C9NB 1RJLA 3W2DH 5KVFL 5DJ6A 5EU5A 1TMCB 4DKDC 4CMHB 4ZQKA 1A6ZA 4OZIF 1GHFL 4OQTH 1JHLL 2C3GA 4XBPB 1KULA 4GT7A 1NKRA 3QI9A 4UUJA 2AEIT 3JTSB 4ZNEA 4Z95L 3AY4A 4L8DB 4LCIH 4X0KB 2HWZH 4XC1L 4XNYL 3TO2B 3GHEL 3OR7A 1KXQE 5A40E 1IGFL 4UINL 2PF6A 2DL2A 2P5EA 4LCWD 2VDQH 2Q3AA 1I8LA 5F6HJ 1QNZL 4OZHB 4M7JL 2NTFA 2QHRH 5H35B 2NY6D 1MH5A 1YEIL 4YXLL 5IB4B 1WFNA 3KHOA 2I5YL 4Y1AE 4NZRH 3BP6A 5DRNA 1VFBB 4YGVB 2EDEA 4JHWL 4R96B 3WN5B 1A1MA 3BRDA 5F9WC 3GFUA 3NN8B 1XIWA 1S5HA 4LLVB 1J88A 2APTA 1IM9D 1HZHH 2AK4A 1IAKB 3VFTA 1MSPA 2FDBP 1SMOA 1OGAB 3CDGA 5CIPA 1KELL 1CGXA 1K8DB 3TBVB 3HRZB 2YK1H 1WFUA 2W65A 2F54A 3IS1X 5IIEA 4JDTH 1K5NA 1RIHH 5IFAL 1LO4L 2FHBA 3R06B 3BD3A 1MFDL 1U3JA 4NC2B 1C12A 4LPUA 3ZL4L 3HI6L 5I1GH 5IB1A 2ED8A 4NNPH 5LGJA 4POZD 3LKPA 1ND0B 1JRHI 1OAQL 3QO0B 5CUSL 3H9HA 1CFQB 3BRGC 2EICA 3DX9B 4JY6B 5ICYB 2GYSA 5JOPE 4UT7L 3ZDXE 3KXFB 5JPNA 4Y16A 4U1JB 5CSGA 3UEZA 3IU3A 3UO1H 5IHZB 3T0DA 3FQWA 5ESQB 3MLTB 3UTZA 1KEML 1OHQA 4L3CB 2Q7YB 3TZVA 3BGMA 4NQDD 1OTSD 2JLLA 4NO0D 3TO4A 1CICB 3NCYP 4WHYG 2PUQT 3CZFB 1PEWA 1S7QA 4PJEF 3P30H 3KPRE 3QO1A 4IIQA 1PSKL 4YE4H 3UTTA 3DXAB 3TA3B 3G6JF 1ZA6B 3GMNB 5EZOH 5TDPB 3P11H 1D5IL 4PRAB 2JIXD 2IEPA 4OCXH 5FO7B 5J13C 3CU1A 3D0VB 4MAYD 4NFCA 3QIBD 4XP4H 1IKFL 1G7HB 1DLHB 1IM3A 4PJFB 3C5JB 2ADFH 3ZDYF 1CXFA 3C8KB 2OL3B 4RMVA 4TQEL 1EV2E 1KN4L 4C58B 4Q2ZB 5IV2B 5JLZB 4OV6F 4PG9A 2BVEA 4JFZL 4BQ8A 4PP1C 2A6JB 1JPTH 1ZS8A 4ESKA 2YD6A 4H88H 3S6CA 4KI5C 3SKMA 5C6PB 1Q9LA 4UT9L 3QUZB 3SGEH 1AXIB 1LE5A 2EH8H 3ARDD 4PREB 4YHOL 4K2UL 1NLBL 1J5OH 4QRPE 2XG4A 1A9BA 1UA6H 1H8SA 4FFWD 2AJSL 3BEVA 3QHFH 2DQUL 1AHWC 3SDAD 4U4BA 4PJ7F 5I1CH 4NHUA 3QWRD 4G6JH 2ARWA 5HI3C 1JWSA 4MHHG 1BQHA 3F65A 4F9LA 4ZD3L 4F9PA 1N8ZA 4PJ8D 5F7WC 3KPLA 2GKIA 3RKPA 1IC4H 1L6ZA 1JGDA 1H0DA 2H1PH 4QTHA 4FTVD 3D0LB 1FJ1B 2ZNWA 2DWDA 4FQLH 1ZEAH 1LEIA 1EIBA 3VRJB 5F7FA 2CMRH 4LAQH 2GJ6B 5E9DE 3B43A 2V6HA 2HFTA 1QFUL 4XNUL 1QA9B 4GMSL 1GAFL 1MCCA 2XRAL 3IDNA 4TULH 4WEUD 3S98A 4ZUSA 3IDGB 5IVZA 1TCMA 1XGUB 3JSSA 1JGLH 2XWTB 1UXWA 4OFYD 3F6LA 3X11B 4CN4A 3LS4L 4RWYH 5ADPL 1T1XB 2YPVH 1SY6A 2PYFA 2AQ2A 4PJCF 1ZLVH 1FHGA 2PW2B 4JDZB 5D70H 3BO8A 8CGTA 2YPLD 3IKCB 2I25N 2YHGA 1DP0A 2YA2A 5C92A 1LP9E 1NEZG 3KPQA 3C87A 5JUEL 4L8SC 5CJBA 5HYQB 3WXWH 5HYSB 4MSWA 3FO0L 4G8GB 3L1OL 4JFEB 4R97B 2AERT 2FB4L 3PGDA 3BZFB 3RVXD 1KGCD 1CL7I 1KCVH 3S4SB 2HT2C 1NSNH 1OT2A 1CXEA 4LP4A 4TSBL 1IAII 5DVMA 4FQQB 5D1ZD 1ONQA 2Y23A 4KVCL 3QZWA 4N0FA 3DYMA 1G6RB 4TTDC 4ZTPH 2NY1C 3BIKA 1HHKB 3JWOH 2OTUB 3SN6N 4YQXH 1YEHH 3QUMH 4P3CL 4U1KA 1TQCB 1CZ8H 3ARED 3LB6D 5E00A 3H9SB 3LPWA 3QUXA 4P2OC 5GRVL 1I9JL 2J8UA 3HAEH 1NMAH 1UWEH 5HPMB 4R7DB 3GBML 1RZKH 3ULVD 5ETUA 1BJ1H 3O6FB 5FYLD 1U8KB 3TBTA 3ARYA 4JKMA 2VLRB 1NBVL 3PHQA 3SKOA 2GQHA 4NT6B 2ICWI 4XP1L 1MCKA 5T5FL 3STBA 2VAAB 3GSRA 3T4YB 4QO1A 3KPSE 4QWWC 2X89D 3K3QA 5TE7L 4QHLB 3VDBA 4L3EA 5KOVC 1X7QA 3SKNB 2ZG3A 4JZJA 2VIRB 2XFXA 3DI2B 4KJYB 4YFDB 1LK2B 4UDUB 2F58L 3JWDL 5I16B 5CEXB 1WTGT 3TYFA 4MWFA 4WNQB 5KSBF 4G8EB 4ZTOH 4JFOB 4ZSOE 3V4PL 4IRJD 3FFCB 4K94C 1T2XA 5IMLB 1I7RB 1RURL 1RUQH 5IMKB 4KK9C 2VRAA 1X5HA 5DD6B 1N6QL 3V2AR 2XWJA 4OD1L 1NMBH 2QEJA 3EOYG 2VSCA 1NGQL 1I7TB 3SQOH 2GUOB 4Z7NE 1HHIA 1RK0B 1RUAL 5J06A 1A1OA 3MRBB 3U0TA 4LGSB 3P4NB 2HN7A 2NY7H 2UWEE 3INUH 2WSKA 4JDVA 4Z78B 5HYJB 5A16A 4LFHG 4UIKL 1J05A 2M1KA 5EO0A 3WE6A 1T4KA 3HFMH 2F53E 3RVUD 3LQAL 4NGHH 4KY1L 4E41D 3CCHA 5EUOF 3DO3A 3V0WH 1GZPA 5DZLA 3U48A 5T3XD 4Q9RH 5C08E 3F62A 1I8IB 4Q6YA 3VXRE 4MQ7A 4DN3L 5HYIA 4JY5L 1IGIH 2A38A 3ROLA 3OKDB 4U1NA 3H3KA 3ARGD 5DD0H 2IAMA 3TNMA 1RZJH 3ULSA 3Q6FA 4N0CD 2RJMA 4FOMA 3TBYA 1NQBA 1OARH 3OG4B 5DHYA 5JPMA 2C3VB 4M4RA 1JP5A 1KBGH 2BMKB 2NXYD 2WIMA 5JOFB 2F15A 3D39A 4HS3B 5C09A 1YY8B 5JXAL 3QFJA 4OGXH 2C1PA 4F33B 4DVRH 5JZ7C 4AT6B 1C7SA 4ZOEA 2JELL 3RX5A 5TPWH 2E3VA 3D2UD 3V6FA 4TSCH 1IEBA 5I1LB 1NBZA 5HGAB 4B7LA 3HE6A 4XPBH 4YHLL 4OD3L 2ICWA 1YPZA 3BWAA 1CDUA 4F37F 3DUSA 2CDGA 4U1IA 1VACB 3STLA 1IGCL 4RFOH 4OKVA 2JB5L 4NYLA 4EXPX 2WM0A 3NBNA 2CLRB 4ZS6D 5CJ8A 4BUGA 1TJIH 1OF2A 2H32B 3IFNL 4MNQB 3SEPA 3RL2B 1HHGB 4WW1B 4JFDE 1M1SA 2HTLD 3DNKA 3O2WH 2EYRA 2WK2A 4N0YH 5INCB 2DDQL 2J1KA 1GYAA 1XFPA 1AJ7L 4J3OC 1PQZB 3BX7C 5EBLB 4GG6A 5IJKA 4WV1B 2Y7QA 1JUFA 1MHCA 1RZ7H 4O2FB 5E94B 3I9GL 3QISA 2FX9H 5C0FA 5D5ME 1WAAA 2VLLB 4PJ9A 2BVOA 1JRHH 3FHQA 4KTDL 4GQ9H 3SE4C 3WFEL 1J0ZA 1IQDA 5HJ3A 1E27B 3VDAA 3ZKXB 3QYCA 4PV8A 3L7EB 4YO0A 1U6AL 4MS8C 5KTEH 5EOTB 1KJMB 2P24B 2DYPA 1W0WB 2JJWA 1Q72L 2P5WA 1C16A 3KYNA 3GUTB 1K85A 4JN2A 2Y5EA 1K4DA 1ADQL 1X6NA 4ISVB 2PKDA 4LASH 5ALCL 5FHAH 1AO7A 1F45A 4WFEE 4KZEL 4XMKH 1R3HA 4U6XA 1V3LA 2HKFL 4X4XB 3NGBB 4FNLH 4LLYA 1NBQA 1U91B 2NR6D 4L4TD 3ZYJA 2C3XA 3E3QE 3STZB 2KBGA 1UYWH 1MAMH 3UTSA 3LOWA 3TVMD 4UOJA 4AL8L 4ELME 4P2QA 2FEDD 1DBJL 5F97E 4Z18A 4PY8I 5L88H 3SO3B 2G75B 3DX6B 4GRLA 5DVOA 5HYFA 2CR6A 1WZLA 2HAZA 1GZQA 4JVPA 2OK0L 1B6DA 5FAAA 1TVHA 1HQ4A 3MR9A 3CUPA 4OLEA 2D03H 3O4LB 2FL5B 4JGMA 4KMTL 2FECL 4OD2A 1NUFA 5CD5C 5CGMA 3IETA 2WLYA 1DZBA 3BQUC 4K3DH 2ITCB 3V4VL 3LH2L 5JHLL 4MXWL 3RWIB 5B39B 1D6VH 1IMHC 1BD2B 3MOAL 4KAQL 4X4ME 3VFPB 5DUML 3GHBL 3GSQA 3LPFA 3QFDA 4PFEA 3GIVA 1ZLSH 1HYRC 4W4NA 4MAUH 43C9A 5DGQA 5TJWK 1VSCA 2Y07H 1CGTA 3D18B 5D96B 1OAUH 3ULUH 4PS4L 2R15A 1KJ2A 1S8DA 4XPAH 2VAJA 5IVXA 5HGDB 2VE6A 3PWLB 2CO6B 2KUTA 2PYEA 3CXHJ 4UNTA 5DUPL 5GJSH 2DQJL 3CK0L 3P9MA 3LEXA 3D85D 1FL6A 3HG1B 2VLKA 2OMBA 2QJDA 1CG9A 4Y7MA 3A67L 1ZHKA 1IC7H 4LBEA 5CFHA 1SMAA 2AV7B 3T0VA 3PL6B 3C60B 5DR5L 4PYHA 5LWYH 4Z6AT 1HXMB 3DROB 4M7KH 2HFGH 1X5GA 2GITB 3OAZK 2EKSA 4KVNL 1NCUA 1M7XA 2MFNA 1U3HD 4NUGH 2DLHA 3G5VB 4P4KD 5FUCE 2JJVA 3SJVA 4QNPE 4QRSA 5EC2A 4MCZB 2I9LB 3QQ4A 4OUOA 4Y4KB 4OZ4A 3T65A 1VGKB 3DVGB 3LQZA 4MX7B 4BH7B 3NZ8B 3X12B 1XF4B 5A1AA 4JHZA 4NRYA 4RA0C 5BRZA 1S7XA 3L5XH 3RWCA 3VRLE 2IG2L 2OX5A 4Y4FD 3JWDC 1TETL 3EOBA 3WS6A 3MLYL 3WS3B 4E0RA 2J88H 3WJJC 1HXYB 4Z0BH 4QTIH 5C6TH 1XGPA 1MIMH 1KENH 3OPZH 4JFHD 1I1FA 5D2LA 4NN6B 1MWAL 5CEYA 5IW6B 4XXCC 4LVOB 1DQDH 1OSPH 1QR1A 5TQ0L 2JK5B 5M94B 3CFJB 2UZIL 2WBKA 1DE4B 2IADB 3AB0B 4NCC2 1BHGA 5KSUA 3MA9L 4JPWL 1NC2B 3UMTA 3VXSE 5D7KE 1RZGA 2ESVD 3V5HA 2UYLB 5K9OB 4GKOA 4KHTH 4PD4K 2ARJQ 3MV9D 3MCKB 4HFUL 4OB5L 3B2VH 3LY6A 1CL7H 1A02N 5GGQL 2EDNA 4GRWB 2ATKA 4XCCH 1MOEA 4I3RL 3V7MA 3H8NA 5ID1A 1IAIH 3TJHD 5TE4H 5EBMB 3GMRB 4F57H 1RZFL 1FGVH 5C2BL 3LQAC 4CNIA 1PYWA 1KCKA 3P0GB 1CGYA 4FQ1L 2HA1A 1ORQA 3CH1A 5I1HH 3PHOA 4PJXE 2IMMA 4Y8DC 4NNXA 1GH7A 1KG0B 4LQFL 1OP3H 3RVVC 5FOBB 2E7LC 1IL1A 5GSRB 5CILL 5J6GA 5TH2B 3TH4T 2X9XA 4X7EC 3KYMA 1F4WH 5IF0A 4BQ6A 1IQWL 3OKMA 4ZODA 2G9HB 5IM7B 5BQ7A 4LKCB 3EYSL 3LAFA 4K8RD 1T21A 4N5EC 1V3MA 5EZIH 4K7PL 5D1XD 5K33A 5DYOA 4LCWB 1XT5A 4NZJA 3SQBA 3C6LC 3S5LG 1J12A 3HR6A 4JCLA 5JR1H 1JNLL 3TT3H 3DVNB 5CBEA 1IEAB 1MFEH 2NY6B 4D0DA 3IGAA 1AXSB 4S11A 3GSNL 1ZWIB 1AGCA 1LHZA 1S5IH 2BDNL 2CK0H 4XCFH 4YHPB 5DJXB 4HKZB 3CFKA 4JRWA 4ENEC 3U4EA 3B9VA 3KJ4B 2FR4A 4GKZB 2H45A 4RGOH 4NQSB 5E8NB 4NOBA 2J8UF 2V2XA 3BW9B 2K7QA 1W2KT 1U95A 5CEZE 2AJVL 2W9DL 5F7EH 4HWBL 2R8SL 4G42B 1QVOB 2R2HA 3BN3B 4YIQA 3K8KA 5IHUH 2R1WA 1FAIH 1ZAGA 2P8MB 3EJYC 3T0BA 2JB6A 4S1RH 1PKQB 3VW3H 5DEFB 4HG4J 2AGJL 4AEFA 2R2BB 3B9KA 1TQCC 3W9DB 2ZCHL 4O2CA 4I0PD 4P59L 4XPHH 2FATL 2BFVH 3OKOA 5FFLA 4BH8B 3BIBX 1P4IL 4HFWB 2BSRB 4HEPG 1NCAL 4G3YL 4WO4D 2EXWD 4JZOB 1JCKA 5IBLD 4EQ3A 5A3ID 4ODBD 1BJ1J 4N8VB 3PWPA 1ZANL 2X4UA 3LN4B 3RUGA 3DUUB 3DBXB 5IFHL 2FHFA 1YC7A 5JHDD 1ODAA 1TDQA 4U3HA 1KPVA 1N5YL 4OZGA 1SM3L 4QHUA 4E42A 1DBKL 1D6EB 1CK0H 1MJJB 3U2SA 1N64L 3AAZB 1CVRA 5FUOH 2KDGA 2FIKA 2ORBH 4D9QE 4XWGL 2P5ED 1ZLUH 2IQAA 3HS0B 5I8EB 4NHCL 3RGVB 3MYJA 4TVPD 1MREL 5E2TH 1VPOH 2B1HH 1Y18B 3MLVH 4WUKL 4QXWA 2HP4A 2OTWA 4WGVB 3CSPA 3H7BB 2AV1A 3T0EE 4XNZB 1MY7A 5MENB 4MAYB 4G7YH 4CW1A 4XVTH 5I71C 2ZCLL 4TNWF 3HR5A 3EO0B 4MJ5B 2A9ML 3TFKD 1XIWD 1WQVT 2EDOA 1KUMA 1KIQB 3BE1L 1N6VA 4WEBL 5FYKL 2GHWB 5ESAB 2APBA 1RPQA 1U8IB 2F54D 4PR5A 1NGXA 3HZVB 3ARDB 3KPMB 1TVDA 2R0LL 2F19L 3UJJL 3T2NL 1FZKA 1YQVL 3QNYB 3BT2L 5C9KA 3DV6B 5LXGH 3HKFA 1C5BL 3QDJD 3T0AA 1MRFL 5HHQB 3VFUA 1U58A 2EE9A 5IBTH 3BPCA 3QJHB 4Z7UB 4UIMB 4DUVA 2ZJSL 1C1EH 1O0VA 3HPLA 1B0GA 3VE0A 3TGXA 5E1AB 4JPIB 1AHWA 4H25B 3IJSB 4Y16D 4YXKH 3O3UN 2VXTL 2IALA 2DJUA 3QIWC 4PJ8B 1P84J 1U8LA 4U6YB 4M1CD 1M7IA 2HLFD 1YPZF 4YX2H 1A7PL 1BAFH 1CGSH 5F7KC 2ITDB 1MAJA 5DHVH 2ZUQB 3TO4D 1A7RH 4OLUH 1YYLL 4PJIE 5SV4A 3GNMH 1KJVB 4ZAKD 3IDXH 4NCDA 1VADB 5DDHA 4PLNC 3GZKA 3U83A 1AXTH 3WLBA 4DWHA 4EZMA 3UTTD 4PJDE 4UU9B 3QHZH 1KFAH 5GJTH 1EJ6A 4ZDHA 4HC1L 1FL3A 2P8LB 1OW0A 3G04B 3V0VA 2H8PB 4K9EL 2RHEA 4GG6F 4TUOB 1ZT1B 4J3SA 2HFEB 4I0KA 3RY4A 3RWFB 4NO5A 3ZE2E 1GOGA 1U42A 1IZJA 1WAAF 1GGBL 5JW3H 1UWXH 1E4WL 5C70A 3HRPA 4XNQA 5SWSD 4HBCL 5IJVB 2HMID 5E4EC 3H0TA 2BVTA 3FT2B 4M62H 5B8CB 2R9HD 1D3CA 3P0VL 5D1QB 1JK8B 5CGYD 5F8RC 1JZ4A 4M8VA 4OZFG 4XRCA 2VABA 4WI9A 4WHTA 4H8WL 2WANA 4WV1C 3MOBL 4TOYH 1QRNE 3VMPA 5KW9H 4NNYB 4NQCB 2VDML 3E8UL 5KVGH 4J6RH 1JZ8A 1N59B 1S9YB 5EU3A 4HV8B 5HI4C 5HHME 5IEHB 1IRAY 5D1ZB 5EORH 3VXUA 3W0WA 5BV7B 3L3DB 4MLSA 1J1XL 4ODWA 4JO4H 4OZHE 4GSDH 3ZKXC 1A1NA 3BVNB 1LO5B 1OPGL 4AENA 4PRPA 1YEDB 4JVWA 1LNUA 3OKKB 4OUUB 4PBXA 2VZ3A 5IROC 5GGUB 5T1LA 1V7NH 2EC9T 3D25A 3VWKC 2IFFL 3AREB 1T3FB 2KZWA 3VXMA 3MRGB 3ZMRA 5CKGA 4YDVA 1A7QH 1LE9A 1KB5L 4P2RE 1LO0H 4CL7A 1TTFA 1F11A 2B2XH 3PV7A 2VN7A 3IU4L 3I6KA 4F37K 2VUOA 3HC0A 3R4DA 4K3JL 4U1GB 2IMNA 1EVUA 3MRKA 2R2EA 5CZXD 2NY0D 4KKBC 3PABB 4YAQA 1JI1A 5MP6L 3BN9C 1L7IL 3PWVA 3HNSH 4OSUL 4ZFFA 1ORSB 2FZ3B 4G9FE 4QRRB 1JZ7A 1G7QB 2CXKA 3FB7A 1CR9H 5CSBA 3RDTD 3CJJA 1J11A 5DVKA 4CU8A 5D9SB 4H0HB 1BVLB 4PGEB 1UB6B 1C5DA 3KXFE 5H94B 4DW2L 2IF7A 4JRXA 3L3HB 4IRJB 1IFHL 3GKWH 5FK9B 5IVXF 4O9HH 4M00A 5FXCH 3EDFA 5ALBH 3EOAA 2DQCL 3S88H 2H3NA 2P43B 2NY4B 5CEZL 3CMOL 3VG9B 3LIZL 3B6SB 5JA8B 4GMTL 4MDJB 1JZ6A 1F90L 1FYTA 3WNPA 1JF1A 1QEWA 3AGVA 4YBLB 3PG2A 2DF3A 4PJ5D 4PJHA 1E28B 3DXAE 1RFDH 1FVCB 4P4RA 5MEOB 1K3ZA 4KROD 1U8JB 1T04A 3X13B 2AEQL 5JIPA 4X8XA 3LSOA 5FGRA 3PNWB 1XZ0B 3UJIL 4F3FA 1A7BA 4S1QH 4PV9B 4S2SB 3QRGL 3U0WH 3HI5L 3QCUH 4PJFE 3L5IA 3QPXH 2FYYA 1FFNB 3PJSA 1KJ3H 1F6AA 3QUXD 4E41B 4Z8FL 2ED9A 5TDNB 4HZAA 1MF2L 5TF1L 1RHHA 2WQ8A 3LV3A 1CF8H 5DMKB 2GIYA 4KJPD 1MAKA 5D2LF 3KLSA 4JFQA 5DUBA 3BZEB 4QXUL 5BS0A 1OSZB 3ARGB 4Y4KC 5E8EB 3ZKND 4XP6H 3LKOA 3HMWL 3MBXL 1JNHA 4Y5YC 4X7FC 1T1YB 4XNMB 1WZ1L 1MCSA 1CFVH 2XYCA 2NXYB 4XPGH 1LO3L 4L3ED 3MJ8B 2ZUYA 3HB3C 1R3KA 1JGUL 3OJ2C 2QQNL 1JE6A 1TVBA 2I27N 5AZ2L 3V8OA 1FLRH 2HRLA 1BF8A 3RIFF 3CVIH 4QYOB 1J10A 3D2UB 4DGYH 1U93B 3M07A 2R0WH 2NX5A 4AG4L 1EMTH 4TUJA 3JVGC 1D5MB 2A83A 2BNRE 5DJAB 2V5TA 3AB0C 3M1BA 2B1AL 5B22A 1AC0A 3AXLB 2WMPA 2XICA 4YHNB 4HJ0C 3MRCB 1GC1L 3CXDH 5J1AB 1TJHL 1HE7A 2VITA 4PJEB 4I48B 1BZ7A 2FH6A 4LCCC 4KJWC 4ODTH 4YWGH 2EDJA 4FQXA 4X6EA 4EI5B 3K2UL 5HHNA 3G6JB 3ZHKA 4GXVH 2EDYA 4GKSA 5GIRA 3QUYB 4NQXA 2NZ9C 3E2HB 5BVJB 2VQUA 3BEWA 2ICEB 3P73B 2DQIL 4MA8H 1SYVA 4L8CB 2EZ0D 4NM8H 3C6SA 1BOGB 3PQYE 1TFHA 4HKXA 3WHXA 4OJFL 3DGGA 5GGSY 2Z8VC 4L4VA 1IE5A 3TH3T 1A3RL 1PBYA 1UJ3C 4Z0XB 4IMKC 4I2XA 2ADJA 1KLUA 1ED3B 1ZSDB 3JWNC 3HUJE 3SE4A 2G5RA 3FQXB 1EAJA 4I4WB 5FB8B 4HUKB 3NIFF 1H15A 2IAMD 4HGWA 4JFEE 4NM4L 3P4LA 5J56B