1MCKA

Principles and pitfalls in designing site directed peptide ligands
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
216
structure length
216
Chain Sequence
PSALTQPPSASGSLGQSVTISCTGTSSDVGGYNYVSWYQQHAGKAPKVIIYEVNKRPSGVPDRFSGSKSGNTASLTVSGLQAEDEADYYCSSYEGSDNFVFGTGTKVTVLGQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IMMUNOGLOBULIN LAMBDA DIMER MCG (LIGHT CHAIN)
publication title Principles and pitfalls in designing site-directed peptide ligands.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immunoglobulin
total genus 39
structure length 216
sequence length 216
chains with identical sequence B
ec nomenclature
pdb deposition date 1993-02-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1mckA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1mckA02
3RWJA 1QEWB 5C07E 3ZKSD 1DBAL 5E9DD 5LBSL 2WQ8A 4F7PA 5DJCB 3JSSA 2FJGB 1TZHB 3NIGF 4WI8A 5DC4B 1IAKA 1ZS8B 2YKLH 5DC0A 1OAKH 1I9RL 1RJLB 1DZBA 1YN7A 4ENED 1VGKA 2YD5A 3P73A 3QI9C 3HG1B 4FFZL 1GPOH 3PWLA 2IFFH 3BIKB 3MA9L 5K9KB 4HH9A 3GSNL 1V3JA 4G7VL 4ODHL 1NAKL 3B6SA 1MFDH 1TJIL 3BXNA 4NN5C 4NKMB 1T03L 4OLXH 1G7PB 4QTHA 3S98A 4D9LH 1D5BB 4Z95H 3H0TA 4LMQI 3RWJB 2ADJA 3KHOA 5CCKL 4Y1AA 2NY3B 3RZCC 3O4LE 2CLZA 5EU7C 1UACH 4PP2A 2XKUA 1BQLL 1LO2L 2P8PA 4F7PB 5CJQL 4XH2A 4U6TA 5GISL 1G7HA 4G9DA 1J0ZA 3NCFB 3RTQB 1DBKH 2VLRD 1IAKB 1D5XB 3OKNB 1NGPL 3QFJD 1YN7B 2E8YA 4YXKL 1AFVH 1JPST 4LSSL 1VGKB 1IC5H 2OQJA 4G6AD 5HI4C 4LCIH 2QSTA 3FHAA 4Z77A 4N0FA 4LHJB 5SX4I 2EXWD 5GJTH 4JO2H 3VFPA 2GSIA 4WWID 3B6SB 4L3ED 3BXNB 1LWRA 3WE6A 3ZSTA 4QTHB 3H0TB 2ZWLT 3TBYB 2WUBL 4Y1AB 5B3JE 1QA9A 3KPRE 1AHWA 2CLZB 3QIUA 3HFMH 1UCBL 1IVLA 1P4BL 1KOAA 4G8GD 4HF5L 4XH2B 1G7HB 4G9DB 4QHLB 1J18A 1RZKC 2HMID 4K7FA 3CDYA 2EE3A 3IKKA 4GRMA 4RGOH 4O5LL 4P59H 4FQQA 4ZS6C 5CSZA 2DBLH 3ROOB 3OZ9L 4L8SA 3MV01 4N0FB 3BQUB 4KK9D 1KIRA 4BSVB 4G42A 5IQ9A 4FFVC 3RKDD 3WE6B 3CSBA 2CRZA 3FT4A 4R7NA 5KG9B 5D96C 4PYHA 1R5VA 1BX2A 4WEUD 3MJ9H 5IW1A 4UTAL 4Q6IA 1QA9B 2DL2A 3B9EA 1UVQA 1MI5A 3LEVH 3SHSA 1CL7I 4GMTH 4G9FE 4MQ7A 4U1NA 4K7FB 5GSRA 3ARWA 4GRMB 4X7FC 1D7FA 4S1DD 3NZHH 1LE5A 5ESQB 4CW1A 4APQD 4UV7H 4FQQB 5CSZB 2XWTA 1N59A 2C9AA 1K85A 3QQ3A 4IJ3C 4GKSA 2F54E 3HLAA 1EERB 2AXHA 2CSPA 4H26A 2W91A 2B1HL 3VD9A 3V6OC 4NC1E 4YBQD 1MFBH 3IJHA 5I66A 5HDQL 4OF7A 4ZNCD 1JGDB 3LB6C 3FT4B 4R7NB 5DJ2A 3PDDA 2JF1A 1R5VB 1BX2B 4Y4KD 4Q6IB 2BSSA 1Q9KB 5ICXB 4Y2OA 4PGDA 1XGQB 2FX9L 3ARYA 4DTGL 1FQ9C 4KKLC 3MLWL 5D7IE 1ZSDA 2H2PC 4MLIA 4MQ7B 4XC1H 3SDCC 5GSRB 3RGVA 3PGDA 3ARGA 3Q6GL 4ELME 1HYSC 4POZD 1LE5B 3TPKA 2NZ9D 3WXVH 4AM0A 5GZOD 5ACZA 3QEHA 1DBJL 2XWTB 3K8LA 1N59B 2CK0H 3QQ3B 4GKSB 3HLAB 2BNQD 3JTTA 1P5UA 1CFTA 3VFRA 1U42A 3GI8L 1IBGL 5DR5H 1K4CA 5IVZA 4M02A 3BZFA 2UUDH 4NUGL 3LS4L 3TZVC 2YWYA 2VDQL 1FL5B 5F89A 3DROA 4WFED 3P0YH 5LXGL 2M8XA 3NFPB 4IMLB 5HDBE 5ID1A 2J1KA 4NO5A 1KJ2H 3IDYC 4PGDB 4RZCA 5HI5D 4AL8H 2YRZA 1V3LA 5EZOH 2HVKA 1F6FB 3S37X 5AG8A 3BZ4A 3K4DA 3GUTA 3PGDB 3CUPB 3QDHA 4PRPB 1RUMH 3EW3B 1JPSL 3FOMB 5ACZB 3SJVE 2R39A 3MLXH 1E4JA 2GCYA 2WIIB 1JRHI 2UUDK 1WWCA 4X5LA 1H3WM 3BZFB 5D7JD 4OF0A 2Y72A 2NY7L 4G6FD 5LGKA 4UB0L 2J8UE 3LMJL 2NY2C 4GOSA 5E9DA 4P2QB 3CCHA 2KZWA 5EA0H 5B8CB 1Z5LA 4OQTL 4WI5A 3H9YA 4RZCB 1JYWA 1CICC 1ZE3C 4LVOB 2PW2B 5TE7H 3CX5K 4LAQH 1A47A 1X7QA 3BZ4B 4KI5D 2ADGA 2VDRH 2IBZY 2YPLD 5DK2A 2F5BL 3UZVB 3DX7A 2QTEA 2GCYB 2PYEE 3S36H 4XPAH 1N2RB 3OHXA 1MIEH 2HRLA 1OT1A 2WK2A 4P2RE 4TUOA 1CFSB 2X4TA 1OP9A 4X9BA 3G08A 3FQUA 1OHQA 1GSMA 2UZYB 4UIKL 3RDTA 4JM2D 2CR3A 3CCHB 4DKEH 4A6YH 5HYEA 4MLSA 4S1SL 3STLA 3IDNA 5HGAA 2VXTL 5FOBB 1DVFC 2IWGA 2VLRA 3BO8A 5FGSA 4UBDC 5FYJE 3MV8D 3MX0A 2DMCA 3N85L 3I2CL 3NA9L 2IQ9L 1JHTA 5TQ2H 2HLFD 1X7QB 2G5BB 1SM3H 3T4YB 4IRJA 4WDIA 1MLCA 1EPFA 1IT9L 3DX7B 3B43A 5FDYA 3ARBA 1JTOA 1UEMA 2R2CA 1A6ZB 4OF6A 3MUJA 3GSVB 4FMKA 2UWEA 5I19H 2CO6B 4TUOB 1BJMA 1RHFA 2X4TB 4J4PA 1BP3B 4LQFH 3BPCA 1NAML 2IALA 2E8ZA 3FQUB 3SE3A 3AS1A 1JI2A 5CD5C 2YUVA 1H5BC 1VFMA 5DJXA 2P5WD 2H45A 4JFZH 5JW5B 5EC2A 1T0PB 2JB5H 1Q8MA 3IDNB 3NIDE 4XNYL 1UM5H 3HNVH 4F9PC 3BO8B 3HG1E 5HYSA 5DLML 3QUXA 1TTGA 3AREC 2C7UB 5L8KB 2P5ED 4ELKB 2FX8L 4N1CA 3MBXL 1FGVL 1XGPA 4YQXH 4WDIB 4OFDA 1MLCB 3LKRA 2XWBA 3TA3C 2WM0A 3ZTNL 4P2OD 3ARBB 2NY6C 1P9MA 4KTEL 4RQQA 1I8KB 3WFEH 1EXUA 2GQHA 4Y16D 3GMQB 1G7MB 3HR5A 2ATPB 5FGCB 4L8CA 1FAIL 3JV5A 2B4CH 3MRHA 3N9GL 1Y6NR 3WNNA 3ULUD 3EBAA 3JWOL 5GGTL 1RQ5A 3QUXB 5CGYD 5E6IB 3W9EA 4R6UA 4NJ9L 1T5XA 2N4IA 3OX8B 2YPKA 4LASL 1A14H 2NLJA 4PJ8A 3RVVC 3ARUA 4GRWB 4F15B 4Z9KB 1RMFL 2V5SA 4Y1AE 1FIEA 3U4BH 4I13B 3TCLB 4WTWA 1EXUB 2I27N 4P23A 3UJTH 1KGCD 3B8SA 4S2SA 3HR5B 4NHUB 5GS2H 4L8CB 3UMTA 4X4XA 1DSFL 4HJGA 1E27A 3K1DA 5JHLL 4M1DL 4EI5A 3MLTA 5C0DA 2R56L 1CR9L 2ADFL 3TVMC 3WIIH 1R5WA 3U1SL 3NPZB 1A3LH 1RIHH 1YPZA 2VC2H 3L9RA 4HXAL 5GRUL 3W9EB 3FZUC 3QNXA 2BVOB 1VERA 1T5XB 2BXYA 3MZTA 4LCCC 5FDWA 4RRPA 2YPKB 4U1LB 5D2NB 3RY5A 4OJFL 4M8VA 1JFQL 4J1UA 1YEHL 2WINA 4PJ8B 5DD3L 3U30C 4DCQB 3I50H 4KK8D 4MCYA 1HDMB 5DI8A 1ED3A 2Q1EA 1PG7W 3TYFB 5CGMA 5EU3B 4M03A 5MENA 1T1YA 3QIBC 1A6UL 1QR1A 4P23B 4RDQF 3ARDA 4KUCF 5F7LB 2AJXH 2OR7A 3K46A 4Y8AA 3V6BR 4OGXL 3DWTA 2DMBA 4X4XB 1N3NA 1CD8A 1E27B 4FTVD 2OP4L 3UAJD 4EI5B 3OJ2C 4LSVH 3OKKA 3UZEA 5LGJB 4MMZC 4YDIH 2ZSWB 1IKNA 1R5WB 1QOKA 3WFBH 1D5MB 5GSVB 2ZCLL 1YPZB 4FNLH 2A6IB 2DM7A 5GS1A 3U46B 3SQOL 3CC5A 4HPYL 3ULVE 2AGJH 5D7KE 5FDWB 3H42H 3SDYH 1T83A 5HHVL 4J1UB 4R4FL 1NH6A 1YMHA 2WZPD 4KRPB 4MCYB 5DI8B 3O6FA 1ED3B 5L2JA 4PY8I 1RZGB 4MD5B 3GBNH 1PYWA 5JZ7C 2HN7B 4BK5A 5MENB 2P46B 4JY4A 1XF4A 4MAUL 3QNZA 1BVKB 3P30H 4LPWA 1N3NB 5L88H 3T0EA 1KIPA 3OKKB 1F6AA 5CIPA 2OJEA 25C8H 1NFDB 1MLBA 5JR1L 2YPVL 4X6CA 1NBVL 4ZXBC 1IL1B 3BYTA 4P4KB 5I9QB 3EYQC 4LDOB 4OCRH 1FVCB 2FBOJ 4KJYA 1P7QA 4NWUL 4RMRA 5KSVB 1YC8A 3V0WH 3UPCA 3EO1A 4JVUA 5KVEH 1B88A 3T09A 2R0ZH 1UQSA 4AEFA 4OLUH 4N8PA 3T0EB 5SWSD 5BV7L 2OR9H 1MELA 1PG7H 2OJEB 1YC7A 2AXJA 3WDHA 4WTXA 5IFAH 2YEZB 3FO1B 2MPAL 3BEVB 1RURH 4G6KH 1KLGA 3IXTA 4EIZC 1X9QA 4RMTA 1T7VA 1G0YR 1AQKL 1ETZB 1P7QB 4MB5A 4WJ5B 4GG8B 4P2QE 4PTUB 3FQWB 3KYOA 3U6RA 4HJJH 5IG7A 3DETD 3OKDA 3FTGA 4TTGA 2BC4A 4KVCL 5KSAA 1P4LA 4FXGB 1UQSB 1YJDC 1U3ZA 3EHBC 4KH2A 1A7NH 5H35A 2EKSA 2H32A 2A6JA 4KTYA 1AHWC 3QIUC 3MTRA 4KJWD 3ZO0A 1CD1A 4I18B 3IDJA 1IEBB 1KLGB 4JJHA 4PJDF 2L7JA 1U58B 4RGNC 4M6MH 4PRBA 5K59E 4GMSL 4NZJA 5BXFB 3QI9B 1A7PH 3FMGH 3QCVH 1ZAGA 3H3BC 4M48H 1MHHA 5L0QC 4KK6D 5F1IA 4R7DA 3BW9A 4JFPB 1KNOA 2HT4D 1QR4A 5IT2H 3KYOB 3QDJA 2BY3A 3U6RB 1JCKA 4ORGA 1YEGL 3OKDB 4KQ3H 3TWCH 2P24A 1C5BL 3VWJA 5KSAB 3T65B 5C0ND 2Q86B 5H2BA 3QO0B 1UH4A 4BUGA 4N0YL 3KYKH 1T80A 4KROB 4KRLB 2P4AB 3DECA 1BGXH 4MA1B 1CXKA 2D9CA 5JPNB 2CDEA 2H32B 2A6JB 2XQBL 4OZFA 5CEZH 5HD8C 3GHBH 5E03A 5E1AA 3K2UH 3UJJH 1CD1B 1U8LA 4L8DB 3BISA 4X4ZA 3IDJB 1N8ZA 1IAIH 3GB7A 4ODTH 4MVBD 1CLZH 4XMKH 1NCDH 1ZLWH 3IFNL 4OLWH 4JFED 15C8H 4E42A 1A0QH 1VESA 4UQ3B 5F1IB 4MJ2A 1F4WH 3SDDD 4W81A 4ORGB 2AERT 1NFIB 2X41A 4GAGL 5EDXA 4R4NC 1GHFH 4PS4H 5DD6B 3VWJB 4CNIB 3VXMD 4PJ7F 4KZDL 5FCUH 4ZOEA 5ACMA 1P4IL 1TVHB 1QFWM 2OL3H 2AK4A 3VD3A 2CDEB 2VDKH 3OB0H 4OZFB 2B2XH 3IDGA 4Z8FL 4G5ZH 5JW4Q 4KHTH 1ZLWK 4HW6A 4E5XA 1N8ZB 4OF3A 4NKOB 3RGVC 3B9KA 1U8HB 2Q7YA 3Q3GA 5LGHL 4K8RH 4E42B 3VA6A 4JQVA 3D48R 5FGCE 5DRZA 2CRIA 3V95A 3K4AA 3NVQA 5BS0A 4M61A 5F1SA 4KKBD 3W5NA 4X6BA 2YRLA 3KYNB 2ZUYA 4JKWA 1EGJA 3VG0H 3MRFA 1LD9A 1X5IA 2Y36H 4HEME 4D0CB 5C0AD 1NCTA 3O0RH 1LILA 2Y9RT 1UYWH 3OB0K 1KBGL 4HBCH 5FHBL 1N5YL 3TFKD 2AK4B 1OW0C 1LO3L 3Q6FA 4GUPA 3VGAC 4GRWE 2AV7A 3QIWD 4GW5A 2Q8AL 5EU4B 5CZKA 2EH7H 2W65A 3RUGF 4GSDH 4FQCH 1JPFA 4LSQH 1JZ6A 1NMBL 4IOFC 3RVXD 4S1RH 3B9KB 2DD8L 3T8XA 2HRPL 1GZPB 3V6FB 3VFOB 5DD1H 4PUBL 5DHVA 5FIEA 2A9MH 3DO3A 5DRZB 4LSTL 4WCYL 3VRLE 1UJ3A 2ATKB 4PJAF 3WJLA 4M61B 5BS0B 1N7MH 4PV8A 4X6BB 3NIFE 4WV1A 2RFXA 2QADD 1UENA 3MRFB 3MLRH 3IDUA 1LD9B 3EZJB 4R9HA 1KEML 2D7TH 4LLDB 4KUCD 1R3KB 3Q6FB 1MFAL 3OXSA 4X6FA 4WI6A 4DGYL 4UT6H 1AI1H 4IDLA 2W65B 4JDVA 3JWDC 5HPOA 1JPFB 1BZ9B 2FHFA 4ENEC 2XXCB 1OCWH 4PJIB 1NSNL 4H0HB 4PJFF 2WUCH 4JPWH 1WFOA 1MIMH 2Q3AA 4CVXA 2J8OA 4L9DA 1QPXA 4XPFL 1KCUL 5FB8B 2B7DT 2DLFL 5EUOB 3LS5L 1UJ3B 4HAGA 4M93C 3T1FA 3ESVF 4OIIL 4R0LA 2UYLA 5ERWA 2XPGB 2ICES 4LLWB 5DWUL 1YPZE 4NP4H 5SWSA 1L7IL 4LSUH 3U7YL 5I75B 3VD4A 4MJIB 5JHDA 2I24N 4ERSH 3OXSB 3QRGH 3RVTD 3UYOD 1U3YA 1UFUA 3BDXA 3N1FC 4JDVB 1FRGH 4JJ5B 3KYMB 1OWRM 5MENE 1RV6X 3TT3H 4Y2DA 1I4FA 3LKOB 5AZ2L 3S3SA 3OKMB 4CVXB 5FUCE 3BUYB 2EXWC 2JJTC 3BP5A 3T1FB 3LD8B 4OLVL 1LQSR 3OKEB 4R0LB 2UYLB 5ERWB 2KUTA 1NANI 1BFSA 4F37K 3QRFM 2DS4A 3K3QA 2MHAA 4MNGA 1BFTA 3SE3C 3B5HA 1DQDL 2X4OB 5K9JL 3VXTA 5IBUB 2APTA 1RI8A 2DL9A 2VN7A 2Q6WA 3WO4B 4GRLD 4TVPH 1I9RH 5DJDA 2VERN 4GKZA 3QNYA 4RMQA 1IJ9A 5MERB 4JZJA 2FBJH 4Z7OF 2HMIC 1ADQL 2VJXA 5F21B 4NGHL 3ZSSA 4G7VH 2AEPH 5JDSA 1ZHNA 4M6NH 1T03H 1LEKB 4HJ0D 3VXOA 2GYSA 1BD2D 3MA7A 3OAYH 4KK9C 3WHXB 3EOBA 3T0EE 1UXSA 3BP5B 5CCKH 2X4RA 4XRCB 2X09A 4JZNB 4KDTA 3ARZA 3RKDC 2DICA 4OZGF 2NY0B 3QCUL 5CJQH 1NUDA 1HNGA 4OZ4A 4MNGB 2KQMA 1KN4L 1M7IB 2VRAA 1C8PA 1CD0A 3EOTL 3P77B 5HYQB 2F19L 5I1IH 2QSQA 5IGXH 3S35X 5L7XH 5DJDB 1H8OA 1Z0MA 1NGPH 4GKZB 3QNYB 4XNZB 4YXKH 3B2VL 1MJ7H 4LSSH 1BVLA 1WC7B 2R2BA 5CP7A 4X4MA 4S1DC 3X11A 5GS0L 1HI6A 1NFKA 4XAKD 4APQC 5DDHA 4LHQB 2IH1B 3S3PA 1U8PB 4IM8A 3OKLA 2GIYA 4K23H 3SE9L 3LZFH 2LTQC 4UQ2A 3OAYK 1BM3L 5AG9A 1YEEL 3VXOB 3PWUA 1CGVA 3IXAA 2V7HB 4PRNB 2NY4B 3HZYA 5HPMA 4YBQC 5ENWA 2Q3ZA 3VXMA 1UCBH 5IHUL 3V5DA 4LFHD 4HF5H 1JN6A 5ALCL 4PLJD 2MQ3A 2X4SA 4Y4KC 3PNWA 3QXWA 1WFNA 4O5LH 4IRSD 4YAQA 4J8RA 2OSLA 5I76A 1IM3B 1QFWI 3CAFA 1D3CA 1BVLB 2XZCL 3ZTJH 3MLSL 3O3BA 5HI3D 2GI7A 5HDOA 3OZ9H 4QYOA 3EO0A 3QPXL 5D5MA 3X11B 2NXZD 4POZC 4XMPH 2NZ9C 1HI6B 2VR5A 1W0YT 5BZDA 5GZOC 5HHMD 1QKZL 3D0VA 3OKLB 2E9JA 3MUY1 4KPHH 3PWUB 1T3FA 2EYTA 3HZYB 5HPMB 1JNJA 1NBYA 3RX7A 1GOGA 1HH9A 3FRPA 1SEQL 3CDGA 3SDAD 1RZIA 5EIQA 3MRPB 3B9DA 3QAZC 4QHKJ 4WFGE 2IQAB 1CFVL 2X4SB 2E7BA 3PNWB 2WSKA 2PO6B 4LSPL 4O02H 5HI5C 3EO9H 1J8KA 3HR6A 5AZEH 4C56D 5IBLD 4PRDB 5ICZA 3PL6D 2Z8SA 4V1DB 2HKHL 5T5FL 3V0VA 3VW3H 1VADB 4OLYL 1OM3L 1AJ7L 1XIWA 2BFVL 3QDJE 1FPTL 4FQ1L 5IB1A 2XFXA 3QDMB 5F9OH 4QHNA 5GS1C 2OYPA 1HH6B 3EFDL 3L7EA 4U7MA 1OAXH 3D0VB 3TO4D 2DIAA 5HDQH 1T83C 5TF1L 4AG4L 5IROA 2FO4A 1T3FB 2R4RH 4FQLL 3AS3A 5D7JC 1DUZA 4GXVL 1QD0A 3O6LL 4KY1L 4GG6A 2FX9H 5I1KL 5EU6D 2GT9A 3LHPL 2FEDD 1NCAL 4ODSL 4U1GC 2J6EH 4JREC 3VD5A 2XICA 1BMGA 3C5SA 3VDAA 3O45B 4LPTA 3X3FL 5C0EB 1T22B 3B83A 3CJJA 3WD5L 3WLWD 3V0VB 3T4AA 2V2WA 5IB1B 3IDXL 1XIWB 3GI8H 4KI5C 1IBGH 4ORZC 2XFXB 5JA8B 1PEZA 2VMFA 4RIRB 3TT1L 2IC2A 4N9OB 5DF0A 3L7EB 1FVEB 4QY8B 3G9VA 4YPGB 5I74C 4Q6YA 4W4OC 1BIHA 2EIDA 3QIBB 2AK4E 2JELL 3P2TA 4GG6B 5FV1L 1RZ7L 3RKPA 1FYTD 3RY6A 4JEGB 4KMTH 2FNBA 3FO2B 2CD0A 4JM2C 1FSKB 4PY8J 2QQKH 2AXGA 3LKQA 1I8LA 4AH2A 1WFUA 3FRUB 3LIZL 3C5SB 5ADPL 3W9DA 4TPRL 4UT9H 5EWIL 2OLDA 4EUPH 2VR4A 5D1ZD 3QDGB 3AC0A 4KDVA 2F8XC 3T3ME 5I1GL 3ZKND 4DN4L 4N5ED 2HLFC 4FQJL 1QHPA 2V2WB 3BDYL 1RZ8A 5BS0E 5TGBA 3F5WA 4X7SL 5TDNB 3THML 4MCZB 4FOMA 4DKFH 4UI2A 2YS4A 3ILPA 5KS9B 3T2NH 4M4PA 2NY7H 3GKZA 4LBEB 3KXFA 4UB0H 4FHBD 1CCZA 2DQFB 5F9JB 1TMCB 3RFZC 3HZVB 3UROR 1A5FL 2HFGL 4D0DB 5DD5H 4I5BA 4OQTH 2X7LA 5HYFA 2O61A 3QEQD 5I1LA 1NCBH 4H8WC 4G8EA 4HUWA 1CF8L 4JRXD 1BQHA 5EG6C 3U4EA 4WHCA 1OVZA 5FHAL 1RY7B 2W0FA 4NUJB 2I07B 1OD7A 2GK2A 2AXGB 3LKQB 3TYGL 1BJ8A 4W70A 4AH2B 3STZA 3P9MA 4PJIE 1YMMD 1HN1A 5E2TL 1D6EA 3HPJA 2F5BH 3BKML 3W81A 4WO4D 1F97A 1TIUA 5EUOE 1RZ8B 2PKDA 3I9GH 1UWEL 3F5WB 2GJZA 5JPMA 3LRGA 4HWBL 2CIIB 3LEYL 4JDTL 5HDLA 1YY9D 3HKFA 3I85A 3ILPB 2DLHA 4E41B 4MA7L 3BPNC 4P2OC 1OPGH 3QQNA 4MJIE 3OJDA 4DFHA 5J12B 4M9PA 4KJPD 5I1LB 4Y16C 2APBA 5GRWA 2F15A 1A4KA 1IRAY 1NDGA 3EOAB 1BQHB 3U4EB 3N85H 1W0VB 3NA9H 2D03L 4YXLL 2WLYA 1KYOK 3RNQA 3STZB 4M9OA 3ULUC 2FX7H 2O5XL 3M8OL 3HPJB 1IT9H 3ZE2E 1QSVA 5CGYC 1FZJA 3NA4A 1P6AB 3RVWD 4H88H 5JOPD 2QSCL 3H3PL 4MXVF 4RGMC 5E70A 3QUMB 2GJZB 1ZVYA 5IBUG 1YEDA 4PJCF 4XCFL 2H9GA 5F9WC 5C0FA 1NAMH 1G9EA 4TNVK 4OD3L 5DUBA 4AJ0A 1IZJA 1UM6L 2MWCA 2OR8A 3IFPB 5JHDE 4M5ZH 1U0QA 2KKQA 2HFFB 2VXUH 1WWAX 1LO4L 1YN6B 3U9PL 1NDGB 1CI5A 4IRSA 3DI3B 1Q72L 4NFBA 2J8HA 4RWHA 2ZUQC 3CLFL 3RNQB 3PF2A 1VPOH 5B39A 3DI2B 2WBJC 2UZIH 3HMXL 5JIPA 4MAYA 1EO8L 1WAAF 4WU5A 4WNQA 4KTEH 3SKOA 4NIKB 3GBLA 1NUGA 3OPZH 4JB9H 4PBXA 4HUMB 4DW2L 4KK8C 4MNGE 4KXZH 5JMRA 3G9AB 2H9GB 2E27L 2W07A 3WUWA 1F3JB 4NKIH 1U8IA 2AABL 2YC1A 1QSED 5DUBB 1T04B 3QQ4B 1HILA 2XQYG 4GW1A 3SDAA 3N9GH 5C0CD 3F7QA 1FZOA 1JE6A 4CRPA 5M95B 1RHHB 1I7TB 2WWKT 3VRIA 4PJEF 5CFHA 2Y7QA 5H37G 5I17B 5JO5A 1VA9A 5GGTH 2YWZA 5IWLC 3A67H 3IYLW 5TDOA 4DVRL 5CJ8A 3UAJC 4C56A 4ODWA 3VE0A 3OGCA 2ORBL 1SBSL 2IPUG 4MAYB 1JI1A 3MLVH 4HLZG 1FO0A 3GSQB 1OSZA 4WNQB 1UWGH 3TO4A 4O4YL 1RZKL 4R97B 1FCGA 2CRMA 4QRRD 2WWKO 1A6VL 4XVSH 3QZWB 3EDKA 3WUWB 4X7EC 2W0PA 2XNAA 3BWUC 3TBSB 4UOJA 2DYPA 3D25A 1HILB 1DSFH 4GW1B 5JHLH 1HXMA 2O5YH 5EU6A 4NQDA 1EDQA 1GIGL 1CR9H 1FZOB 1VENA 1XR9A 3RL2A 3VRIB 4MJ5A 4TN9A 3S88L 3CX2A 4PGZA 2Y7QB 5GRYA 3O3DA 4X4ME 4F7CA 2DDQL 1U8OA 5GRUH 5F93C 4OD1H 4ODWB 4XBPA 4N8CH 3VE0B 1DR9A 4OJFH 3ZE1E 2O5ZL 3ET9F 4EN3D 3MRNB 1NJ9A 3LDBC 5TPWL 3WDIA 5INDB 5SWQB 5K9OA 1OSZB 2AK1L 1B3JA 3TN0A 4ZOBA 2APWA 1A6UH 4MQXD 3S5LB 4AY0A 5HXMA 1KXVC 3VA2C 2XNAB 3RWEA 3KGRA 2DYPB 4X5WB 1J5OL 1JWUB 3D6GA 3QO1A 5F6HI 2E9BA 1FFRA 2EC9T 3QT2A 4IIQC 4MJ5B 4Y4HA 4V1DE 3ARFA 4F7CB 1U8OB 3T0WA 3QDME 3O2DL 4PJHF 3DBXA 4YXHL 4HPYH 4ZUWB 4GLRI 4XP1L 1CL7L 4W68A 1II4E 5DUML 4R4FH 1JHLL 3OF6D 1NJ9B 7CGTA 3FRPG 5K9OB 2FCBA 2V9TA 3QPQD 1EAJA 4Y0GA 1KTLA 2VL5B 2UY7A 4DUVA 1YNLL 4NRXA 2AQ2A 4ZMAT 2R2EB 4R8WH 2EH8L 3RWEB 2V2XA 3QEQA 3DETC 1UH2A 3MV7B 5T3ZL 1IMHC 5IEHB 4HWZA 4JRXA 4OGAD 1HHIA 4FQHB 4Y4HB 4R90L 2CKBH 2YPVH 4Z18A 1NBVH 2AI0L 3ARFB 1YMMA 1V7NL 1LDPL 3DBXB 3OR6B 2Q20A 2YK1L 1EH9A 3U2SA 3LKNB 2PTVA 4KJWC 1CTNA 4XZUB 4NWUH 1QBLL 3W39B 4Y4FD 5DRWA 4LNRA 5D1QD 1F4XH 1A2YB 4GG6E 3I6LD 4LVHC 1KTLB 2GW5A 3CZJA 1FORL 4KK6C 4NRXB 3S96A 4R3SA 2HT4C 4WI7A 5EBWA 3MRKA 4M93B 2IF7A 5IB4B 2A2QT 1Q0YL 3MJ9A 4LK4A 3QDGE 4U2YA 2J88H 5C0NC 1DJSA 1T89A 2FD6H 3RIFK 2MPAH 4MA8H 4K9EC 4M7ZC 4BFGA 5HHXH 4X98A 1FGNH 4W6YB 4CN4A 3DNKA 3U2SB 2VKWA 1UCTA 1AQKH 1J8HA 4MVBC 4AIZA 4JFYA 1CU4L 4LNRB 2HJKA 5ALBH 5CZVH 1JRHL 3ORJA 4HV8A 3AU1A 4LIQH 4I0PA 4NM8L 4Y7MA 1U93A 3S96B 4N8VB 3D18A 1U9KA 4P9ML 5EBWB 3S36X 3SDDC 4L3EB 4MXWH 4AEHL 5BVJA 3W2DL 4JPKH 3FAXA 2UVFA 3RPIB 2CDFB 4OZGA 5T3XD 4KHXH 4XNQA 4X98B 5AAMA 3M17A 3DRQA 1D5IH 1HKFA 2PTTB 4E41E 1J8HB 4GMSH 3KXFE 1K6QL 2C1OA 3MACH 2Z4QA 1KB5L 5GQBA 1L7TL 2X4UB 3LQAH 4WHYG 4X8JA 3PDOB 1EJOL 4AIZB 4DKDC 1U8KA 1WTLA 2HJKB 1X5LA 2H41A 3EYFA 1Q9LA 5I1EL 1QSEA 4P2YA 4HV8B 4PY7A 4I0PB 2X4PB 5CBAA 4WW2B 2C4FU 3MZGB 3D18B 4N0YH 5H94A 4KKBC 1MJ8L 5BRZD 1KJ2A 4HKXA 4DEPB 2ERJB 4LCYB 4L9LA 4D8PA 3OB8A 1FBIL 3O11A 4LARL 3PHSA 3V7MA 5CD3A 5ICYA 3U0PA 1I1FA 4XNQB 4NQEA 3TFKC 3G6AB 3M17B 3DRQB 3IFNH 3QIWC 4XVTH 2RJMA 4M1CD 5DUPH 2C1OB 4U6VL 1X4YA 4NJAL 2Z4QB 2I9TA 1V05A 4O58L 4X8JB 4Q9QH 4HIXH 3RVXC 1FHGA 1J86A 1U8MA 1NEUA 4QRRA 2HJLA 3V5KA 4GAGH 2J5LB 1Q9LB 4P46D 5CINL 5F1NA 3KG5A 3MGOA 5LAXA 4QRPB 4PY7B 4XNMB 5EO9A 5E8NB 4LLVA 4PJXF 5H94B 5IROC 4F7TB 4PD4K 3AY4A 1CYGA 1KJ2B 2QADC 3UJIH 4L9LB 1MEXH 1U41A 2GJ6D 3DSFL 4Y4KB 2R4SL 4OKVB 4GS7B 5C0RL 5AAWA 2NY5C 4OBSA 2H2SD 1I1FB 3UTOA 4NQEB 1PVHA 4U1HA 4PGJA 4PBWD 2EE9A 5LKNA 4ONHB 2XN9B 4HSQA 1FNEA 3AMLA 2I9TB 4DWHA 1EMTH 3ZL4L 2WIMA 3MO1B 1U8MB 2BHUA 4G8FA 3FQNA 3MV11 5IW3A 1CFNA 5TE6H 3V5KB 5F1NB 3M07A 3MGOB 2X9YA 3NZ8A 2BNQB 4FP8L 4F7MB 4YHNA 5GRVL 1R3JA 1PZ5A 3CGTA 2GEEA 5EO9B 4LLVB 2PYFB 1QLFB 3CFEA 4BQ6A 4TVSa 4OUUB 1JHKL 1WZ1H 2AKRB 4A6YA 1KBGH 1N5YH 3WFDH 3O9WD 2Q8AH 1FDLL 3FFDB 2ZG1A 1IFHH 3IFLL 3ZMRA 3HZKA 1U91A 4AMKL 5FUZH 3QZWG 4NT6B 3WUWG 4F8QA 4O2CB 4P57B 1IQDA 3PQYD 2Z9TA 3RVTC 1JNLL 1FNEB 1H3PL 3PP4L 4D9QE 1C16A 1TZIA 4WCYH 3BPOC 1AD0A 1OAUL 1GXEA 2YD1A 4KKCD 4I3SL 2OI9B 4Q74A 4LDEB 1G7JA 4WW1B 4U1KB 1PZ5B 3DOSA 4UT7H 1NC2D 3CFEB 4O2FA 4BFEA 4A6YB 1IKFH 1ZA3A 1KFAL 3GKWL 4G6FB 4I77H 5C8JA 5FYJL 4HAFA 5BCAA 3X17A 2PCPA 4DGYH 3MCLL 3AM8A 3UTSD 4OGYL 3WS3B 4Q0XH 3IJSA 1U91B 4EKXA 2R29L 1TCRA 4GRLC 3UTTD 3S5LG 3GK8H 3GHEL 4XCCL 1JZ2A 1YNKL 4WHDA 4OCXH 2ZKHH 4Y4FA 1X5YA 3V4UL 5D1QA 3FL7A 2XOTA 4XPFH 1TZIB 1KCUH 2ID5A 1AD0B 4NQDE 2YPLB 2IPKA 5KZCB 2IAND 4HJ0C 3Q1SL 4NZTH 4Z7UF 4HWUA 1WSST 4OZIB 1CXFA 2COQA 3SE8L 3U7YH 2I9LB 4O2FB 5C8JB 1ZA3B 1LK2B 4JO1H 3OAUL 4RSVA 4LHUA 4MGXA 1TVDA 4Y19A 5TFSH 4HXBL 2GY5A 5F72S 4B41A 2C3VA 4BELD 4U6XA 4NSKA 5IHZA 3H7BB 1TCRB 1FFNB 3VXUA 5I0ZA 1IGJA 1I85A 5HVHB 1Y6MR 5DRXA 2HG5A 3D39D 3MV8B 4F2MB 3L3OB 4ZFGL 4Z76B 1HQRB 1KELH 2D0GA 5DYOA 5EU5A 4BZ1H 2IPKB 3GRWH 3LKSA 2D7MA 4DGVH 4HWEH 1DQDH 2BP3A 5K9JH 1T0NB 1SYSA 2A0LD 4LCWD 1JYVA 4PJBA 4Y5XA 4YDJA 1MF2L 3AS2A 5GS0D 4LHUB 1QSFA 2L4OA 4B7IA 4Y19B 5J89A 3WFHA 4PLJC 3VWKA 4ZFOA 2P5WB 2C3VB 1MSPA 2F58L 4HUNB 4IRSC 1CIUA 3VXUB 2AEQH 2EIZA 4JR9L 5LQBL 4F58H 3NH7L 3BT2H 1PG7X 3BVNB 5DRXB 3CSGA 5HI3C 1T2JA 5I16B 1JMZA 2E9IA 1FL6B 1BOGA 2NXZC 3QHFH 3VJ6B 1D5ZA 5A2LH 5IB5A 4G7YH 5DYOB 2XTJD 5EU5B 5I71B 1GGUA 2DM4A 4XNUL 3LKSB 1PY4A 2DI8A 3X14A 3P4MA 1KN4H 3LAFA 4NNPH 1SYSB 4QTIH 1KSRA 3SDAC 2PN5A 5CKGA 4YJZL 1QSFB 4J3UA 2GSGA 4QKXB 4UINH 2EICA 4JZOB 3WFHB 4DKAA 4ZFOB 3VWKB 2QSVA 2K3TA 4YO0A 5EIIA 4QHMA 3TNNB 1OY3B 4PYGA 2Z92A 1BLNB 2DBJA 2BVYA 4N8VG 1QYGH 4GKNA 4HFUL 5IBLC 2ZUWA 3ESUF 4M7JH 3PL6C 3QUYA 3BGAA 5IVXB 3L3DB 2AEWA 1CG9B 1BOGB 4OF8A 2D7PA 3T0AA 4Z7VA 4P46A 3DJ9A 3IKCA 5IB5B 2G75A 4I1NB 4ONFH 3TO4C 5D2LA 5IHUH 5IB2A 3P4MB 3RWGA 5E8EA 4UZGA 5ISZD 1KUMA 4X6DF 4WI4A 5DEFB 4PRIA 1A64A 3FFCA 1J8HE 1N64L 4D3CL 3QUKA 2FEDC 1NCCL 5C7XH 3MLSH 4WRLA 3ULVL 1G0XA 4HK3N 1Z3GL 1XZ0A 4NN7B 5EIIB 1C12A 2ZUQB 4QHMB 1WEJL 4JO3L 4XB7A 2Z31D 4K2UL 2WBJB 3PWNB 3WHE0 5AD0A 1U92A 3WLWC 3HE6A 2BRRL 4JFDA 2BNUA 5IK3A 1UM4H 4K94L 5CUSH 4AZ8A 3IETA 2G75B 3FOLA 2W59A 1AQDB 5D2LB 1SEQH 1MUJB 5IB2B 5L2KD 3GMNA 1KCVH 5E8EB 3K7UA 3HPLB 1CFVH 1EFXA 3DUUB 2IAMA 5EOTB 1W0WA 4PRIB 4X9GA 1IAOB 4JM4L 3FFCB 2ZPKL 4EVNA 2D4FA 1LHZA 3D85D 5FYKD 5T5FH 1XZ0B 3T04D 4HUVB 3HI1B 1C12B 3QJFA 1OM3H 1AJ7H 1K3IA 4FQ1H 5D93B 1KC5L 4BJLA 4CU8A 3EFDH 5D1ZC 1XAUA 3SDXA 1R0AH 4QHUA 4QRPE 5T1MA 5AD0B 5TF1H 4AQ1B 3ZKNC 4N5EC 4AG4H 3JXAA 3HE6B 4J6RL 1HHHA 4JFDB 2BNUB 1U8NA 5DJAA 4GXVH 3E6FA 1JTTA 3FOLB 4KQ4L 4JG1L 4KY1H 1NC2A 3LHPH 3ULSA 1FN4B 3V4VL 1NCAH 3FQXB 1CGSL 2NX5A 1AKJA 4NQEE 1S7XB 2IAMB 1W0WB 4NO0D 2QV2A 3BE1L 2XN9E 1FYHB 2P7TA 5KTEL 2BCKA 2W9EL 5KSBA 3WD5H 1G9NL 1HHJA 3UPRA 1TQCB 3BP4A 1S9XA 1DP0A 3QJFB 12E8L 3IDXH 4HGWA 5F6HJ 3DMMA 3TH3T 4LSRL 4KJQD 2VXVL 4DZBA 4I3GA 3SDXB 4QHUB 4WO4C 5T1MB 1S5HB 1S9YA 2V7NB 4L8BA 3VGGA 2ZOKA 4WEBH 2VL4A 3NN8A 3O2VL 2IANA 1U8NB 1YY9C 1XH3A 1CDHA 2JELH 5DQ9A 3E6FB 3DYMA 5DQDH 3MRDA 4DOHB 1S5IL 3TLRA 1RZ7H 4FZEL 3VXNA 2XRAL 3GGWA 5FUOL 3ULSB 3OBAA 1OP5H 2NX5B 1AKJB 1U6AL 1ZXQA 3PWVA 1WT5A 4KJPC 4IIQB 4JN2A 4TPRH 3UTPE 4HUUA 2HFEA 1S7VB 4DQOL 2P7TB 1GC1H 2BCKB 3QWQB 2Z0BA 2UZXB 3UPRB 4NQCD 3BP4B 5ABDE 2VQTA 3HAEH 5DT1L 5EFIA 2V5MA 4L29B 1A9EB 2B5IB 2BOCA 3D39A 4FFWD 4OCYH 4P3CH 3DMMB 4X7SH 4K3EL 1EEYA 3THMH 4DZBB 5IR1B 4ZTPH 3B9AA 3JVGC 1J05A 1J0JA 3VFNA 3RVWC 5D70H 3MJ6A 4XWOD 4L8BB 2ZOKB 2G5RA 3PWPB 3NN8B 1DBBL 3JWDL 4IEFB 1XH3B 2H26A 2XZAL 4IDJL 4K3JL 5IVNA 2E6PA 1OP5K 1KPUA 1ZGLB 5IKCB 1M4KA 1SYVB 2DWDA 1CF8H 1RUQL 3L95B 3K0WA 5T33L 5ITBL 3JWOC 4XGZA 3VH8A 3PWVB 3QSKB 4GO6B 2XG5A 3S97C 1XR8A 3LVEA 4HUUB 4L4VD 1U8JA 2VZSA 2ZCKL 2W0KA 3GSRB 1KT2A 3AGVA 3ZKQD 1T2XA 1JV5B 2BOCB 5A2IH 3WNLA 4YK4B 2YHGA 2JKXA 4ELMF 5LVEA 3SGDI 4WY7L 4JANA 4NN6C 4PJ9D 4I48A 3MNVA 2H26B 4RAVA 1MWAA 3LEXB 1Y6KR 2BDNL 4PB9L 5KVGH 2DWDB 1BEYL 1M7DA 3HC4L 4LPVA 1QG3A 3ZKXB 43CAA 4BZ2L 3WIHH 1KCRL 3VH8B 3LCYA 1OD9A 3X13A 3GSWB 3STBA 5C0IA 4HHAA 2OL3B 1AP2B 5HDBF 1XR8B 1U8JB 1B0RA 3L1OL 4WFFE 3UDWC 4OCSL 4ZAKA 1BFOA 2HVJA 5EORH 3S8WA 1TITA 1SY6H 2WQRA 1HZHL 3IB4A 4M1GL 4Q9BA 3RWCA 1IGIH 4NQVA 4OD3H 1PLGH 1GJIA 1QFOA 3DX8A 5L9DL 3DRTB 4RAVB 4Y19E 3H9SA 4NC2B 5F1OB 2EDTA 4TSBH 1I1AA 2Z8WC 3CFJB 5FO8B 4N0CD 2LAAA 4P5MA 2QQLL 2DQHL 1HINL 4Z7QE 3VXUE 4YBLC 2J8UF 3CLEH 5I8EA 3CLFH 3P4OB 3X13B 3MRGA 5GHWL 4QOKA 3MXVL 5FYLD 5JIKA 2FJHA 1DBML 1J0KA 2Y25A 3HMXH 1JYXA 1KIUA 3WN5A 4HQQL 4PGBA 3CH1B 3MLYH 3AXLA 2FWOA 5DMKA 3L5JA 4YUEH 4ZUTB 3CVHH 1GZQA 4HMEA 4DW2H 4EN3C 4RFEB 3ILQD 4JLRA 2V9QA 2EDOA 3RWCB 2DM2A 4NQVB 2A77L 2JB6A 4JGUA 4PJBE 3DX8B 5MHSD 1HEZA 5DVLA 3T77A 1QSFE 3H9SB 4TSAH 4N90E 3INUH 4MQXC 1I1AB 3N1MC 4P5MB 4CGTA 4DVRH 1LE9A 5FO7A 5DMGD 3SY0A 4NHCL 4DVBA 3F7RA 4YE4L 5I8EB 2Y07L 2V2TA 3HUJA 5IVXE 1EHXA 1AGCA 1F4AA 3OKOA 1SBSH 1AXTL 2XA3A 2QHRL 1N5AA 5C07D 2DMKA 3AXLB 4IRZL 1RZKH 4PGEA 4YHLL 1U3HD 1KN2H 5SX4H 3CFKA 4JLRB 4E9LA 1FNLA 1YZZA 1HKLH 4JFHE 4JG0L 3PGFH 3QPQC 2JB6B 2P8MA 1MFCL 1HEZB 2QHLA 3OXRB 3TBVA 1BAFL 5BV7C 2GTZA 2JJSC 1A1OB 2DDQH 4NO0A 1LE9B 2VNCA 3SY0B 4UAOB 4DVBB 3IVKB 1HE7A 1MCPL 1JJUA 3IAQA 3HUJB 3PIQA 4OGAC 1ZGLM 2V2TB 1P7KB 4LF3B 4P5KA 1AGCB 4JN1H 2AJ3A 3NIDF 5JOEA 3AM8C 1QFWL 4QXGL 4Z7VE 4NNYA 2PXYB 1V8HA 3MMEB 1MHEB 4GBXD 5T1KD 2ZSVA 3O4LD 4HK0A 4PGEB 3JV6A 4ZO9A 5D2LE 3BKYL 2VZVA 3GZKA 2DKUA 4G6JL 3NFNA 4Y4FC 1IAIM 1ZT4B 2ZOLA 3KPQA 3QYCA 4HLJA 3NBNA 5D1QC 2X4NA 4OLZL 4PRIE 6FABL 2P8MB 3ES6A 2X1WL 3FFCE 2HJFB 3FN0H 1C1EL 3IF1B 3KPSB 1YDPA 4DN3L 1O0VA 2H6PA 3TBVB 3WSQH 4LKCA 4ODUA 3N50A 4YHZL 2JJWA 4C83B 5HYJB 2WANA 1G6RH 1IGYB 1CL7H 1G6VK 2A74A 3PIQB 5B38A 1CVRA 4L3CA 5DUMH 2AJ3B 3P4NB 5DURB 1KPVB 3GMMA 1OGTA 4JFDE 1T2QL 3MNZB 4NNYB 2X1PA 1OL0A 5KVFH 4CMMA 4HGKC 3SGKA 3KPRD 3JV6B 1CXEA 1BOYA 2Z91A 1YNLH 2ZOLB 1N4XL 2X4NB 5J1AA 3LRHA 5BW7A 5T3ZH 2APXA 1NC4A 5I18L 3HRPA 1FAKT 2WMPA 1I1YB 1YDPB 4CN6A 2PUQT 2K7PA 1WCBA 2D9QB 4LKCB 4UILL 2YMXH 4BZYA 2ICWB 2BY0A 1V7NH 3GO1H 1CBVH 1LDPH 3IDIB 1E6OL 1AE6H 3SDXE 1X5ZA 3S9DB 2A74B 4Y5XC 5B38B 5IQ7L 2BVPA 3MREA 5E4IA 1DE4A 1J1PL 1ZVHA 4QRTA 4GRLB 3GMMB 1OGTB 1TJGH 4WUUA 2A83A 3DO7B 3DURB 2WP3T 4AT6A 2FH8A 1IGTA 4CMMB 4KZEH 5AYUH 3BEWA 4JHWL 3F58H 3UO1L 4DOHE 3NFSL 4X99B 4ZSOA 5B21A 5BQ7A 2Z91B 1AXIB 5KVDL 4PJ9A 2NX5E 4G9FD 1M71A 4XXDA 5D72L 2IJ0C 1NC4B 2ZUXA 2OM5A 4OM1L 2P49B 2V17H 1R3LA 3LPGA 2F54D 4G80A 3BD3A 4YX2L 2R0WL 2WP3O 5FOJA 4ZDHB 1TZGL 3PE9A 2QKIB 4ODVL 3EIFA 3R1GL 3L3KB 5JQ6L 1KCLA 5I8KL 2BVPB 1ODAA 3MREB 5HYIA 3HNTH 1W72A 3FO0L 4H8WL 4QRTB 1ORQB 4RMSA 3PWPE 4WUUB 3DV6B 1CU4H 1DQQA 3PXJA 3UTZB 4M1CC 1QRNA 5BO1H 4W6XB 4HPOL 3ULVF 4ZSOB 2B1AH 4H25B 1H0DB 3V5HA 4NM8H 2MCG1 1NMCB 3TNMA 3GNMH 2XY1A 3D69A 1GAFH 3UBXA 1FL3B 3MXWL 4AEHH 3P0GB 4I0CC 4P46C 5T1LA 1CWVA 1Y18A 1FH5L 1P84J 3W2DH 1R3HA 5C0BA 5CEZE 3OG4B 2GAZA 5CGTA 1Z2KA 1PX3A 4G80B 4YDKL 5C0GB 1IGFL 2J6EA 3BMWA 4EQ3A 2VQ1B 5F88A 5FGRA 4XPTL 2ITDA 5I15H 1F3RB 3V79C 1YY8A 1JPGB 2X40A 4EOWL 1K6QH 4M7LT 2H2SC 4MZ2A 1AGEA 3MLUL 4DUXA 4X7TA 1KIQB 3EZ8A 4P3WA 1T0MB 4NZDA 2FLBT 3ULUL 1EVUA 5F7DA 3T2QA 1XT5A 4OZHA 2J3SA 5DFTA 3MBEA 1G7IB 1EJ6A 1I3RA 5CHNA 5T1LB 1SEBB 1NBQA 3QJHA 3AUVA 4YWGH 3KLDA 4HD9A 3SJVD 2D2OA 3EDEA 4WWKB 1S8DA 5INCB 4HLZH 5DVNA 4LARH 1ERNA 5FKPB 3QH3B 3O9WC 2DWEB 3QEUA 5F88B 1UZ8B 1GGCH 4EUPA 4X9IA 2NY1D 3MPCA 5C07A 4U6VH 4NJAH 3ROLA 4BQ9A 1IAMA 4MWFA 4O58H 5A16A 1AGEB 4PJ7B 1RUKH 5IB3A 3CU7A 3J8F7 5CINH 3VXRA 5F7DB 1JNNH 4S1QH 4CU6A 4TULL 5F7EL 3MBEB 5EOCH 1HHKB 3KPPB 3LV3B 4Y5YB 1FNSH 3KPMA 1I3RB 1H3XA 5CHNB 4KKCC 3NTCL 1CZ8L 3MGAA 5FCSH 1ES0A 3RAJL 3NACL 4U3HA 5F7KC 3DSFH 1IEHA 1S8DB 5EBLA 4X4YB 4ZYKB 2PYED 1FZKA 5ECJE 1IM9D 1MHPL 3QEUB 3C8KB 4P2RD 4U1MA 3QCTL 4EUPB 1GGIL 1X5JA 4GBXA 3S4SA 5T1KA 3ROLB 3HMWL 5HGBA 1Q94A 1LO0H 2I60H 1EGJL 3ZL4H 1BHGA 2VISB 4QXUL 1KJVA 1JK8B 2ESVB 1MCWW 1V7ML 3H9SE 1VB9A 4ZUSA 2G60L 5K59F 1WV7T 5GGQL 5FYJD 3VXRB 4BFIA 4U6YA 1IAII 1JHKH 4QOKE 2XXMB 4NO2B 4U6HA 5I73B 4NC0B 2YSSA 1ES0B 1FDLH 3KLAA 3UTQB 4M43H 2FR4A 2VWEE 4CMHC 4WU7B 2EDHA 4AMKH 4LPCA 4XX1G 1E6JH 3CFIC 1EA9C 5FA4A 3VGHA 1FYTB 3T2OA 1WT5C 1RUAL 4XX1E 1INDL 4U1MB 4ZQKA 1H3PH 4MX7A 3CVIL 1AGDA 2VLME 3S4SB 1Q94B 4WEMB 3KPRA 5CMAA 1MCLA 7FABH 3C60A 4POYA 4NZUL 1KJVB 5D1ZB 4F9LC 2AJUH 3EGSA 5GRVK 1A6AA 2DQTH 3VRJA 4I3SH 1SBBA 4ODXB 4L5FH 3HG1D 4LLUB 1Q9OA 1XF1A 2CMRH 2FECI 3BH8A 3QG6A 4QT5A 4A2MA 1OAYL 5JTWA 4OI7A 1OSPL 3HUJE 4M4RA 1OLLA 3GKWH 3SO5A 3ECBA 4RDQG 4U6HB 4G43B 2YSSB 3KLAB 3MCLH 4DFIA 5DFVD 3MRIA 3C6LA 3S35H 2A0LC 2F8VA 3MRBA 1A6WH 2R29H 2NY3D 4PBVC 2BHZA 1DDHB 3CPLA 3MODL 3HE7A 5GGVH 5FA4B 5GS0C 3Q5TA 1XGYH 1W8OA 3GHEH 4XCCH 3VFTB 4BSJA 2Y06H 1A1NB 2EDXA 4MX7B 3RTQD 4M7LL 5LWYH 2AVGA 1AGDB 3V4UH 1F3DJ 1TNMA 4ZO8A 5D1XB 3BPLB 5E08H 5CMAB 1IGML 3C60B 4YIQA 3KPSE 1ONQA 3EGSB 2UWEF 1A6AB 1FZMA 1ZT7A 3FT3A 4OGZA 2Y4SA 1NAMB 1F4YL 4YPJA 1TENA 1WGOA 2GFBB 2GUOA 3BH8B 1AGFA 5HYJE 2XTJC 4TVPE 4QT5B 2YD3A 4ZTOL 1DN0A 1XGTA 2Y6SD 5I8OL 2F54A 1CXLA 1F58L 1UZ6E 4HXBH 3HN3A 3MRIB 3C6LB 2SEBA 3RWDA 3MRBB 1R3IL 1FG2B 4Y1AD 2JIXA 1TNNA 4URTB 3HE7B 5T5NG 2BJMH 3TP4A 1KB9J 4ZFGH 2E7HA 3E3QC 4GRWF 5BVPL 1TPXC 1Z6JT 1CLYH 3FO9B 2AJSH 5D7IA 1SVZA 1FZMB 2W60A 1ZT7B 1VHPA 4AENA 2OZ4H 5EZJA 4J3TA 3KJ6H 5B38G 1JWMA 1OARL 1YQVH 3CFCL 2DLTA 5EZLA 4U3XA 3GBMH 3M1BA 5E4EC 3VRLF 1DN0B 3P0VL 2CIKB 1WF5A 3R8QA 5ID0B 1ZHBB 3HHRB 5JUEL 3L6FA 3NIFF 4F3FA 5GJSL 5I1CL 3CXDL 5F3BA 2JIXB 4JR9H 4P2CG 4X80H 4KAQL 2APVA 3BHBA 3QWRD 4LEOB 5JOFB 2YZ1A 5E94B 4UV4H 2AW2A 4WGVB 3WN5C 2CXGA 2Z31C 4N0RA 2F74B 4FMFA 4MD4A 3A6BH 3BGFC 1HYRC 2DQGL 4AENB 5FEBA 2NXYB 3WMSA 4Z0BL 5GGRB 3BESR 4FFYL 3ULVD 5D7KD 4G8IA 3MUHL 1JGLH 4NQTA 1NMAL 4KTDL 3L6FB 5IF0B 1TTFA 4WUUE 1RULL 5C0CB 1YPZF 5FKAA 3V4PH 5IMLA 4LKXB 2IPTH 4LLQA 4JAMA 4PJGA 4XVJH 1YJDH 4ZSOE 1JWSA 5KJRH 3BHBB 3PHQA 1X5GA 1CK0H 4I4WB 4CDHA 5D7LB 4PP1D 1J1XH 1YNTA 2IGFL 4MD4B 2OTPA 4XBEL 3SCMA 3KPLB 1K8IA 2X89A 3QUZA 4XCEB 1D6VL 1B2WL 4IHOB 2L7UA 1N64H 2VE6B 1S7SA 2PYEA 5D9SB 3D3VB 1DQLL 3ULVH 2CKBA 4M6AA 1Z3GH 1OAZH 2VXQH 3CK0H 1Z9MA 4Y89A 1M1SA 1QRNE 4JO3H 4LLQB 4M62L 4JAMB 4JO4L 4R26H 4ESKA 5DTFA 1UG9A 4NCDA 2C26A 4PJGB 5JNYA 2MCPL 1T1WA 1RUPH 2LVCA 4TUJB 5CWSB 5I6XC 4EDXB 3FB6B 3PHQB 1DLHB 5KAQF 3ARGD 1ITBB 4XP6L 5J57B 4KJQC 4JFFA 2C3HA 4EN3B 1I7ZA 1FFOB 2VITB 4FQIL 2MSPA 5C0BE 3VFVB 5FF6A 4K3DL 1K8IB 3QUZB 2H3NB 1MVUA 1HSBB 2V5RA 4YHML 2FJFA 1T4KA 1OAQH 3SO3B 1I7RA 2AJVL 1S9KC 3WUZA 4PJ5A 2ZPKH 1QEWA 1E4WL 1LK3L 4P2QD 2OTWA 4X6CF 4ZUUB 1PGRB 5DJCA 4NO3B 3HS0B 2XZZA 5D7SH 1TZHA 2JCCA 4FXLA 4N0UB 4LAJH 1ZS8A 1RJLA 3TC9A 4FFWC 4LLAA 4J6RH 3D87B 1A3RH 1UT9A 1G0DA 3QQ9D 4KQ4H 4UTBL 3SGKC 4JG1H 1WZMA 4YFDB 1NGWB 3FCTB 5FF6B 1RFDH 1KJ3H 2Q8BL 4S10A 2EDYA 3L5XH 4XWOC 3O6MH 5C0JA 1BBJA 1MVUB 5H8DA 4EUPG 4HBQA 4HX1A 2FJFB 5DZOA 5MEOA 1G7PA 1D5BA 4IMKA 3U7WL 4BKLA 4PJ5B 5KTEH 1X3DA 4R2GB 3I75B 3UPAA 2OTWB 1MPAL 12E8H 5JW3H 2HH0L 2ESVE 5D71L 2ZJSH 4LSRH 3Q48A 2VXVH 4PLOB 3RTQA 3TO2A 5F6IC 2JCCB 1UXWA 3VXRE 3GSXB 3QWOB 5E8PA 1D5XA 3OKNA 4RFNB 2O93L 3ZT6A 4XP9H 3WCYA 1Z9LA 3CSYA 3MLZL 1ZLVH 4P5TA 4UDUA 5A43C 2CLVB 2XZQL 1QNZL 4RWYL 3O8XB 4FZEH 2E6JA 5GRJH 1KULA 5C0JB 1HQ4B 1BBJB 1RK0A 4PJ9C 4HX1B 1U8QB 3S4SG 5MEOB 1I8MA 2VR9A 1FNGB 3FQTB 4BKLB 3GI9H 3TBYA 1IC7L 2W9DH 1TJHL 1EEUA 4JQIL 3RDTD 4QWWD 4L4TB 4J3SA 1MQKL 5DT1H 3TBTA 1B4JL 4OFIA 5TE4H 3PGCA 3UBXI 1A3QA 3CXHJ 3GJFB 1URLA 4OIBA 3PV6A 4QHLA 3TO2B 4XCYA 4JY5L 3OMZA 1UXWB 2ED9A 1AGBB 5HSFA 1TQBB 5E8PB 2EDNA 5D6CB 4XPHL 1AXSA 1ZWIB 1YEFL 3CSYB 4M00A 4P5TB 4K7PL 1REIA 2FB4L 4UDUB 2GY7B 3JWDH 3ROOA 5DJ0B 4IRJD 1WZLA 3WKMH 3B8YA 2XZAH 4K3JH 1MJUL 3BQUA 3V52H 3FAWA 2VDNH 3E2HC 1C08B 3ARBD 4BSVA 5ITBH 1RK0B 1VFBA 1YEIL 3BKCL 3ULUF 3PWJB 4J4PD 1I8MB 5KG9A 4WI2A 4N0CC 2W1NA 3QUML 3MFFA 3Q2CA 1LNUA 2DF3A 2H1PH 5TH2A 4U2ZA 3TBTB 3EYVA 3SEPA 3PGCB 4R96B 1PKOA 2AQ3A 2N1KA 3QWRA 1XGUB 5C3TA 3PV6B 1B6UA 4XCYB 4IOSD 3QUXD 2BZDA 1AXSB 5ESQA 3RA7H 3C08H 3RJQB 1C7SA 4OF5A 3GIZL 3ILQC 3GMRA 1T6VN 2BDNH 2CGRH 1BEYH 2EDBA 1VFBB 1D9KB 5EC1A 3NAAL 1CXIA 1EEZB 4JQXA 4DGIL 1JGDA 5ILTL 1TTUA 3MFFB 1T6WA 2VDMH 5I1HL 1LNUB 5DMGC 1Q9KA 5ICXA 4PJCB 1XGQA 3RY4A 5TH2B 2EDQA 3EYVB 4HS8H 1DQJB 5HHQA 1EZVX 4W4NA 4RISL 3WJJA 1MRDL 1L0QA 5T1DL 2GTWA 2BXZA 3C8HA 4M1GH 3L3HB 4CVUA 3O4OC 5C9KA 3T3MF 4Z7OE 2GHWB 2DQUH 2I5YL 3RWFA 5EUKB 1U3HC 5L9DH 2Z8VC 4PJ8D 4C54A 2X42A 3GMRB 3U36A 2QQNL 1CN4A 4TNWF 4U0RC 2YBRB 1HINH 3BP7A 5EC1B 1FL5A 3I84A 1QHOA 4JHAL 3QB7C 4P23D 5M94B 1WQVT 1FP5A 3EJYD 3NFPA 4IMLA 1F2QA 1S9VB 1DANT 4EI5D 2RCSL 1GOFA 5HHQB 2HP4A 3ZDXE 5FO9B 5C6WH 2V5YA 1A8JH 2GTWB 3CUPA 5MI0C 4PRPA 4ODBD 2J4WH 4GBXC 3FOMA 3DV4B 5CJXA 3NMEA 5MP6L 3RWFB 4MDIB 2DQEL 3S3JA 4JFOB 2WIIA 4YHKH 3DGGB 2YD4A 3MJ8B 4KRPD 3U36B 3NPSB 1RZJL 3QHTC 5HVFB 4LVEA 1O5DT 3C8DA 1K9TA 3IAGC 3BP7B 4NHCH 5MEND 4YE4H 1S7UB 2Y07H 1IQWL 1FO0L 3O2WH 3ARDD 4P2QA 5B8CA 2VXSL 5D7LE 4IRZH 3SGJA 4LP4A 3ISWA 1MREL 4KI1A 2PW2A 3A6CL 4YHLH 5A40E 3U9UA 5CJOH 2KDGA 5JMOC 4JG0H 4TUKH 3UC0L 4S0SD 2OK0H 3ZE2F 4P99A 5HJ3A 4P4KD 2FYYA 4OI8A 4NOFA 3GRWA 1RD6A 4HIJB 3MYZA 1MFEH 2XYCA 4GAJL 2B39A 1BAFH 3D3VE 1N2RA 3O6FD 4M7KH 2BSED 2XI9A 1CFSA 2XG4A 1L0YA 5DFWH 5E1HB 1EAPB 4PJGE 3C87A 4ZFZA 2YA2A 4OAWA 3BN9D 1GPOL 4NFDA 3GEWB 4KXZI 4HFWB 4CU7A 1QFWH 3FB7B 3ZYJA 5FOBA 5IOPB 1BWMA 1G84A 3T0ED 3BJ91 1JPTL 3CU1A 4Z95L 4YR6A 2VDLH 5JW4R 3U9UB 4PRHB 2G5BA 3D2UB 4BFBD 2GITA 4G6JH 5CKAA 3T4YA 5HJ3B 4OLZH 2FYYB 3K80A 1C1EH 3B2UD 1DBKL 4DN3H 1A6ZA 2A73A 1P7QD 2PTUA 4YC2C 3GSVA 4GQ9L 5EZIH 1CDBA 4XMLH 5DEGB 1OP3H 2JJVA 1AFVL 3C9NB 4UNVA 4ZFZB 4OAWB 2AAVA 1F45A 4N0UE 4NQUA 2FIKA 3RHWF 1PQZB 5JW5A 1FE8L 4WIQA 4JO2L 5GJTL 1T2QH 1ZLSH 4JFFE 5C08A 4NC1C 2HFTA 4YR6B 2C7UA 4HZAA 4ELKA 4M6OL 1CXHA 5DJYA 2GITB 2IADA 3HFML 2EYRA 2VLJB 4ZS7H 1NEZB 3H7LA 4PJ5E 2FSEA 5C09A 5JW4N 2A73B 1MCNA 1OP3K 1I8KA 3W0WA 3K74B 4P59L 1OGAB 4O2EB 3GMQA 2H8PB 1G7MA 2JCCE 4X7DC 2ATPA 5I30H 1I3GL 4IS6A 5KSAD 2FIKB 4CL7A 4LCWB 3QEGL 4KROD 2VOTA 2J2ZA 5C08B 1ZA6A 3TGXA 5IJKA 4RA3A 1YA5A 1R24A 3NFSH 5E6IA 4XC3L 3DVNB 4LIQE 4LLMB 3MJ9L 4YHOL 5DJYB 2X2YA 4QCIB 4WFGD 3OX8A 3ZE1F 1MCDA 2IADB 2EYRB 4U05A 1DFBL 2DQIL 2CRYA 4OTXL 3LEVL 4GMTL 2FSEB 2BVEA 5ANMA 5C09B 4L4TE 3TCLA 3W0WB 2DQJH 2X9XA 3QDJD 3SOBL 1T5WA 1MY7A 4RAUB 3DIFA 3V7AG 3TJEL 5KW9H 1A6TB 4NHUA 4QRUB 3VWJD 1VFAB 4IS6B 3VG9B 3ZT7A 3V7AE 4N9GB 3CZFA 3SE4A 4H8WH 1EIBA 2CUMA 1CLOH 5D5MF 1ZA6B 4KUZH 3QXAA 2VDPH 4HMDA 1NGYA 1R24B 2NY1C 1ACZA 2WWMD 2BVOA 2QQQA 1TPXB 4LPYA 4U1LA 5D2NA 1QBML 4DCQA 2VUOA 1HDMA 3DVGA 3TYFA 4OFYD 1FH5H 2NCMA 5EU3A 4XC1L 5ANMB 5J4MA 3U0TA 1KTKE 3JZ7A 3WXVL 1T7ZA 4YDKH 2KL6A 1T5WB 3DIFB 4XPTH 2CK0L 1NCWL 5ISZB 4EOWH 5DR5L 5E6YA 3CZFB 3DARA 4I2XA 1AY1H 2BSRB 5LGJA 2ZSWA 3MLUH 1D5MA 3OR7B 5GSVA 1EX0A 2AK4D 4DZ8B 5F96H 3QXAB 2A6IA 1NGYB 4N68A 1NLBH 3C5ZA 3P0YL 3U46A 3ULUH 5IESL 5E2WL 1KJ2L 3BFOA 4FQ2H 3CMGA 1SHMA 2PNDA 3RVUD 5EZOL 3B9KD 4KK5D 3DVGB 1KCKA 2F53A 4FG6D 1RZGA 1T66D 4MD5A 4U7SA 4GG6F 4F33B 4FXKA 5GGRY 2HN7A 3U0TB 3C09C 1EHLL 3Q0HA 3P9WB 4PJCE 4NBZB 4OIAA 5BS0D 2D4DA 5TQ0H 3L3IB 2DLIA 4HIEB 3MLXL 1H8SA 1BVKA 1Q9WB 4HCRA 1A7OH 3U0WH 3DLQR 1KACB 3HAEA 1MRFH 1K5NB 4I2XB 4TQEH 4LRNH 1NFDA 3V6ZB 3UYPA 5MEQB 2ZCHH 2MQ0A 5ETUA 3C5ZB 1IL1A 4PLKD 4X5XB 4P4KA 5EA0L 1E28A 5F7EH 1FVCA 1WAAE 1RZFL 5KSVA 3NTCH 1CZ8H 1HWHB 4LAQL 2F53B 5KN5B 2G2RB 1LP9B 4FXKB 1V3MA 4I0KA 1NL0H 1H3GA 1IEAB 4I9WE 4U1SB 3QCTH 1H15B 1UGNA 4XPAL 1GGIH 5DFVC 5F7MC 3HMWH 2NY3C 3HAEB 1EGJH 4MJID 4QXUH 4FQXA 1EHAA 2YEZA 1V7MH 3FO1A 3BEVA 4Y5VA 5ETUB 3RTQC 2G60H 4DKEL 4YDLB 4A6YL 5E00B 4D9RE 1E28B 3IS1X 4U1JA 1O7SA 1ETZA 5GXBB 4EI6A 4WJ5A 4CAGA 4GG8A 3BAEH 4PTUA 1GGTA 3FQWA 5TQ2L 5BMFH 3C2AL 1WWBX 1SM3L 2WBKA 4ZFFA 2RIKA 3MNWB 2Y6SC 5J13B 4FXGA 4J3WA 1VACB 2RB8A 3AS0A 4PRPE 3U4AA 1ACYL 4CDGC 1FC2D 4WFHE 5I19L 4LEXH 1XMWA 5EO1A 1LO5B 1J0YA 1KEGL 4LQFL 1VCAA 4FQXB 4NZUH 5JHDD 3HNSH 5IFHH 1CE1H 1SY6A 1EHNA 3UCRA 4I18A 4NYLA 4NDMB 4Y5VB 1IEBA 3DPBA 5I2IA 4ZPVB 5IIEA 2VZUA 5C3LD 4JFQA 3P40A 1X5KA 1U58A 3NGBB 4U1JB 4EZMA 3ALXA 1UM5L 5BXFA 3QI9A 2F5AH 4EI6B 4Y2DD 4RBPH 1INEL 5I1JL 1F90H 4JFPA 4OD2A 1QQDB 4XPBL 3UX9B 3P4LA 2DTMH 4ZFFB 2CH8A 2P1YA 4YQXL 3X3GL 1NCUA 4JKLA 3T65A 2Q86A 2C3XA 3QO0A 1PY9A 2NY0D 4PRHE 3BJLA 3MRCB 4ETQB 4UOW0 3GMOB 2VLKA 5JPNA 4YBHA 4CKVX 4WENB 5EO1B 1IGMH 4L4VB 4JKPH 4L8DA 3CVHA 4NYLB 4TOYL 2MOVA 1S7QB 3RIAF 5I2IB 4H5SB 3ZKMD 5IIEB 4JFQB 2ARJA 2B4CL 4RBPK 4XAWH 4NBXB 4UQ3A 4ZTOH 3CMOH 4YNYA 1OQXA 4OD2B 1VEPA 4FABL 5A2KH 1F58H 1RU9H 4L8SC 3L3JB 1NFIA 4NN5B 1A14L 2NY4D 3ULVC 5DD6A 5KSUA 1ZHKB 4CNIA 3T2PA 1P5VA 2IBGA 3IS0X 1NEZG 4JQXC 4NM4L 5CD5D 3RZCB 4F7EB 1MCCA 4PFEA 1TVHA 3U4BL 4GLRH 2VLJE 3DX6B 2VLKB 4Q6IC 3VXSB 5BVPH 2R1YB 4NRYB 4JCMA 1JZ3A 3FQRA 4K94C 3CVHB 5ITFB 1F8TH 5EH1A 2D31A 4NKOA 2ARJB 1U8HA 1OGAE 3NCJL 4PP1C 4OFYA 2AJYL 5T3XL 5EBGA 3WIIL 4ZFOL 1A3LL 1CDUA 1RIHL 4YNYB 3U83A 2VC2L 3P0VH 5D4QA 1ZEAL 3KYNA 5I1CH 5C08E 2CXKA 2OMBA 2HWZH 5KSUB 1KTRL 3GMLB 4D0CA 2DRUA 4BH8A 4PREB 2XV6B 4LNVA 1BWWA 1VFOA 4MNQB 2PO6D 2HT3D 5EU4A 3FQRB 4K9EH 4KGJA 1VKXB 4LOUD 4UIMB 5C09E 4UNUA 3TV3H 3G5XB 3ZDYE 4V1DD 4XP4H 5EIVA 3W0WE 2D31B 3ARGC 1WZKA 4LSVL 4Z0BH 1GZPA 3V6FA 3VFOA 3QDMD 1AIFA 3RBGA 1MNUH 4YDIL 1PFCA 3HTLX 2IG2H 1DTUA 1CT8B 4FNLL 3FN3A 3MV9A 1N6QH 2ATKA 3QXDA 2AGJL 4BSWB 1C5DA 3H42L 1A7QH 4ZNEA 2A9NH 2ED7A 3SDYL 4Q9RH 1G9NC 4LLYA 5AYQA 2LQRA 1G6RA 5D96B 4U7KA 1QVOB 4BH8B 1KV3A 3GBNL 5DGRA 3EYOA 4LLDA 5SWZB 3H3KA 1R3KA 4UUJB 4M8QA 3WFCH 4ZOAA 3BN3B 3SDCA 1MHCB 4LVOC 5ANME 3P30L 1BZ9A 4XBEH 5JXAH 1TETH 1XIWD 4PJIA 1D6VH 3QQ9C 5DJZB 1AIFB 4IJ3B 1JUFB 4X7CC 2BK8A 4J3OC 3MV9B 1ZHLA 3O3EA 5FB8A 9CGTA 5EUOA 3QXDB 1T1ZA 5B22A 1C5DB 2EO9A 3LSOB 3TPUA 3TZVA 2XPGA 4OCRL 4LLWA 2ZUTA 1CD9B 4LLYB 1BPVA 3VFUB 2VZ3A 4M62H 3K1KC 4JO4H 1G6RB 4X9HA 4DAGH 2Y23A 1ZKAA 4MJIA 3EYOB 1A7RL 2DIBA 1DEEA 2CUIA 5D2NE 4ZD3H 5KVEL 4AIOA 3MUZ1 2XY2A 5AUMA 1RJYA 3ME0A 4XP6H 4M8QB 1OT2A 1AO7B 2YD8A 3SDCB 2R0ZL 3QDGD 5AWNH 4JJ5A 3TJHD 3GSOA 3HC3H 3KYMA 3NOIA 5MI0B 4BYHA 1WJ3A 1ZGLP 2YUZA 3F65A 3O4LB 4MB4A 3REVA 3LKOA 2F9BT 4LRIA 3ALPA 1SJVA 3OKMA 2AJVH 4YHPB 4BQ8A 2Z35A 1ZHLB 1RURL 3BUYA 3O3EB 3GSUB 1E4WH 1T1ZB 2QR0A 3OKEA 4I2XE 3TZVB 1LK3H 2R9HD 3TPUB 4OFKA 3DVIA 3QFDB 3S6CA 4R4BA 5D6DA 2X4OA 3EDJA 3RDTC 4QWWC 3IDYB 1DEEB 2GJJA 1CICA 5AUMB 1RJYB 2VH5H 5MERA 2F53E 2NY5H 3HA0A 5HY9A 1LP9E 2DN7A 3GSOB 2Q8BH 5DSCB 4PLNC 3REVB 5CSGA 4IRJC 4JKMA 5C2BL 4G6AC 1LEKA 3HAEG 1MCHA 3U7WH 4E41D 2Z35B 3WHXA 1XF3B 3KXFD 3ARBC 1DBAH 2VABB 4XRCA 2QR0B 4JZNA 5LBSH 2N7AA 4M6ML 3IGAB 4GAFB 5HGGS 1NFDE 1A7PL 4J4PC 3DXAB 2NY2B 3QCVL 1M7IA 4R4BB 3P77A 1O7VA 5HYQA 4EBQL 4XCNB 5IT2L 2V9RA 1A4JB 1DVFA 1CICB 3TWCL 2HA1A 1IE5A 2Q76B 1WC7A 4JRYB 5IJKC 4FFZH 5HY9B 4RWYH 3QUXC 3KYKL 3MA9H 1FLRL 3SPVB 3GSNH 2IH1A 4ODHH 1BGXL 1NAKH 1U8PA 1TJIH 2B0SL 4L4JA 2P48B 5CEZL 3GHBL 3UJJL 3K2UL 4F15C 2AP2A 2V7HA 4ODTL 4PRNA 1CLZL 1TJHH 1P9MC 3T1WA 1Z9OA 3G5VA 1LO2H 15C8L 1B4JH 1BQLH 1EZVY 3VI3E 2HAZA 1H5BA 5GISH 1KPRB 3WNMA 5DZLA 1PBYA 1F4WL 3O3UN 1ZMYA 4XPHH 1IM3A 1YEFH 1DVFB 1GHFL 3G04A 4PS4L 4KMQA 4K7PH 3ZE0E 2FB4H 5E8DL 5FCUL 1CFBA 1MJUH 1I1CA 2VDKL 1YEIH 3TA3A 1GGBL 4XHQA 3F8UB 2R69L 4PJ8C 4G5ZL 2HLAA 5FYJU 2FECL 4H0IA 5F71A 3R06A 2WUBH 3KHQA 2N7BA 3DHJA 2G9HA 3GMPB 4ELMB 3G5VB 3TEUA 1P4BH 2KH2B 4K8RL 3RBSA 3MRPA 4P23C 4WVRA 1H5BB 2IQAA 2VZOA 3EJYC 4X8XA 2PO6A 1JIBA 1SMOA 1QACA 2C3GA 2LU4A 4EI5C 1MWAL 4JDZA 1KTDA 3G04B 3VG0L 1F42A 4PRDA 2X10A 3AREB 4V1DA 1BBDL 2Y36L 1VADA 3GIZH 5F70A 3O0RL 4MAYD 3BP6A 1UYWL 3QDMA 1UB6B 1HH6A 4HS3A 3TA3B 1G9MC 2HLAB 2NY6B 3BWAA 4KRPC 4DK6A 5EU7E 3R06B 4UTAH 2VLKE 3VXSE 5I1HH 4OV5A 4D9QD 2G9HB 4M3KB 4ZPTA 5E95B 2ED8A 1MRCL 5DD1L 3NCBB 1L6ZA 3ARDC 4JE4B 2KBGA 1FV1B 2A9ML 4RISH 5T1DH 5FUCC 3W11D 1N7ML 3O45A 3TVMA 2NW3B 3VXQB 5C0EA 4JDZB 1KTDB 1T22A 2I5YH 5DQJB 3CDFA 2NY1B 3MLRL 1IKNC 4UMGA 1VGEL 3PP3H 2J8UB 3BP6B 2ZUVA 1CGUA 5FECA 5CAYB 2B1HH 4RIRA 1ULVA 32C2B 4JPIB 4P4KC 4H1LH 1FVEA 4QY8A 4YPGA 5I9QC 4HS3B 2NNAB 3DTXA 3KLHD 4UT6L 3RZWA 3I3EA 3EUUA 4JHAH 3BWAB 1RK1B 1ZOXA 3O6FC 2QEJA 3RIAK 3JWNC 5CLTA 3QIBA 1CDIA 1I8IB 5IFJB 4OV5B 2DYPD 4MNQE 1OCWL 4ZPTB 2QL1A 4NQDD 4DTGH 3BN9C 2RCSH 3MLWH 3FO2A 4X0KB 4IBLT 3Q6GH 3FRUA 1IM9B 3TVMB 3T0EC 1BQUA 3KS0J 3QDGA 4P2RB 1DBJH 3PP3K 2EDRA 2DQEH 4NP4L 4XBGB 3L7FB 1EUUA 4HC1A 2BRQA 4LCCB 5FECB 5CZXD 2R1XA 5TDNA 3T3PF 4MCZA 4NUGH 3TN0D 5FYKL 3U30B 1PSKL 1CIDA 3FONA 3LS4H 5KS9A 2VDQH 4LBEA 3DTXB 4AQOA 3B2UC 1FO0H 5IVOA 2DQFA 5F9JA 1FRGL 3FN9A 3HZVA 3WO3B 5LXGH 5SWZE 4D0DA 4QXWA 3TT3L 3BOVA 3DX9B 4DK3A 4NCC1 3A6CH 4J3XA 3UXFA 4NUJA 3N1QC 2I07A 4Y4HD 1P84K 1A6PA 3ARFD 3L5WA 3UC0H 1JPSH 4GXUN 2R0LL 2CO7B 4ZXBA 1SVCP 3MV9E 2LAGB 4ZUVA 3E8UL 4GAJH 3V6OE 4I18C 4TVPL 4ZNEE 5HHOB 2R1XB 1NGZB 1HIML 2CIIA 2OZ4A 1P7HL 3ABZA 3FONB 3B3IB 2XKSA 4E41A 5TDPB 5GGUB 1TXKA 2FBJL 4NKQB 2YN5A 5E2VL 4HUKB 3LMJH 4KDWA 4HKZB 4PD4J 3PJSA 3RNKB 4HIHA 4PR5B 5J9PA 1A7BA 2AEPL 3S7GA 3JBG7 1AO7E 4M6NL 3BGMA 1JPTH 4Z7QF 3EOAA 5KSAC 3IDMB 1W0VA 1GRWA 3MOAL 4KROC 2VB5A 1G7QA 3L5WB 2FH6A 2JK5A 4MA1C 5SV4A 5T3ZE 1GGYA 4ZXBB 4ZUVB 1ZK9A 1RJZA 5I1IL 1QPPA 4JY6A 1DL7L 3QUMA 4GQ9H 3KPOA 5IGXL 5L7XL 1EO5A 1QTYT 1MJ7L 2WAHA 3P73B 4PJBF 4UIKH 3PWLB 3PJSB 3IFPA 1VFUA 4HIHB 4HH9B 1FE8H 4S1SH 2IMNA 5J9PB 2HFFA 2VXTH 4K23L 3LZFL 1YN6A 3BGMB 3VWJC 4OI9A 3U7AA 1YYLL 3I2CH 2IQ9H 2XTLA 2ADJB 4M6OH 5IVXF 2ENSA 5LG1A 3L5HA 1G7QB 2DI7A 3SGEH 5JXED 4PP2B 2JK5B 5JORA 2P8PB 5EN2A 1J8HD 3SBWA 2WWMC 4OCWL 1RJZB 1F2XK 1BECA 4JY6B 4C58B 3KPOB 1UC6A 3IJYA 3LPWA 4KGLA 3DXAE 1IGCL 5F97E 1F3JA 2OQJB 1FCCA 1T04A 1I3GH 3QQ4A 4XI5D 4I0PD 4Z77B 4XMPL 2HTKD 2BNRA 3QEGH 3VFPB 2GSIB 1RHHA 1I7TA 4XNYH 4JRYE 4N5UA 5I17A 1I3VA 5DLMH 4KPHL 1CE6A 1BFVL 4XC3H 4YHOH 2FX8H 2Q87A 1AHWB 3MBXH 1FGVH 3QIUB 1OTSD 4OSUL 3ARXA 5I1DA 5JORB 1DFBH 4Z7VF 2DQIH 4OTXH 3GSQA 5EN2B 3ZTNH 5JIHA 5D2LF 1S78D 2E3VA 4G3YL 3TIEA 4RGNB 1MCSA 4O02L 3EO9L 3RVUC 3IJYB 5AZEL 3SOBH 3B9KC 4KK5C 3QZWA 5L0QB 2VQUA 4FG6C 1NDMA 1F3DH 1W72L 4RX4A 3TJEH 1T66C 2IFGA 3TBSA 3VW3L 1WIPA 4QRPD 2EKJA 4JQVC 4L8SB 1FAIH 4X6EA 1YEKL 5F9OL 3CH8A 1KIRB 2BNRB 4G42B 5IQ9B 1OAXL 5I1AA 1IC4L 3JWOH 3Q5YA 1CDCA 2DAVA 1CE6B 3G5ZA 2R4RL 1TVBA 5IW1B 4NJ9H 1UVQB 4LASH 1QBMH 4NQED 5I1DB 1JZ5A 3MRNA 3MLPA 3LN9A 1MI5B 5INDA 5SWQA 1DQML 2XN9D 1RMFH 4PLKC 2J6EL 4U1NB 5FYLL 3MCG1 4NNXA 5F9DC 3TIEB 3BRDA 3B5TA 3TH4T 4DJMA 2EEAA 4CW1B 2ZG3A 2ICCA 3AB0C 5M7QA 1QLEL 2W0LA 2X4QA 1AR2A 3S5LA 1NDMB 1NCWH 4H26B 4X5WA 5DK3A 1A9BA 1JWUA 3D5OF 4X6EB 4M1DH 1UJ3C 3WJLC 2R56H 2ADFH 3IJHB 5I1AB 5I66B 1SJEA 3U1SH 5F3HA 4KRNA 4WV1C 1Q1JL 4HXAH 3G5ZB 3SDXF 5DJ2B 1TVBB 1OW0A 4XXCA 4ZUWA 2BSSB 5I75C 5IESH 3LQZA 1MCWM 5E2WH 3SGDH 1JFQH 5DD3H 1YEHH 3VU2A 4WUKL 4KMTL 3UTPD 2KZ1B 1ZSDB 2QQKL 4NNXB 4YHIA 3RGVB 1KB9K 3ARGB 1EHLH 1H3UA 4UT9L 4AM0B 2VL5A 3QEHB 4P48A 3TESA 2X4QB 1JZ4A 2R2EA 4QF1A 4LRIC 4OGXH 3JTTB 4BK4A 1CFTB 3VFRB 3RPKA 1A9BB 1K4CB 3MV7A 5IVZB 4HG4J 5IEHA 5KSBF 2OP4H 3LD8C 2J7LA 2C4XA 4DKFL 4R0LC 4FQHA 3T2NL 1SJEB 5F89B 3DROB 5F3HB 5HGHA 2BOBA 2ZCLH 2A38A 5D6DC 4RA0C 1X5HA 3SQOH 5DD5L 5ID1B 3OR6A 4NO5B 4GAYA 3WO4C 3LQZB 3VGAB 3LKNA 5HHVH 1NCBL 4GW4A 1RZFH 4XZUA 2HVKB 3W39A 1VEOA 1N0LA 3BRFA 4YHIB 3GUTB 3QULA 1A2YA 2ZNXA 5KZCD 1B0WA 5FK9A 3V2AR 4Y2DC 4MAUH 3G6JA 4FS0A 4QF1B 4LSDA 5FA3A 5EO0A 5IB4A 3I9GL 5F44A 1CS6A 1FIGL 3MQIA 5F7FA 4HZLA 2D7NA 1FC1A 5ELIA 5JR1H 2NY0C 5HGHB 3WKNA 3BZEA 1OPGL 2BOBB 5E9DB 1G7LA 3SN6N 1Z5LB 4GAYB 2ADIA 5J3HD 4GW4B 4PGCA 1N26A 4XNZC 1PW3A 1NCNA 4JZJC 3ZKMC 3QFJA 2I26N 3C2AH 3QULB 4WFFD 2VSCA 1QFUL 4Z7WA 2ADGB 2FX7L 4X83A 1SQ2N 2YD9A 5FK9B 2W38A 5DK2B 2X70A 3G6JB 2DOCA 4N8VA 5FA3B 2JJTA 4Z7NF 2KPNA 4H88L 3SKMA 2O26U 5EO0B 4L3EA 3OHXB 3QXVA 1ACYH 5J0BA 2NY4C 4HZLB 1IILE 5BV7H 4KDTC 5IMOA 1KEGH 3QHZL 4TTDD 2X5PA 3N1PC 3G08B 3OTTA 3RPIA 2CDFA 4LHUD 3BZEB 4CJ1A 4Y19D 3RDTB 1G7LB 5HHOE 3WNOA 1Y0LA 4AEIL 5JXEA 3CSPA 4G8GA 4M5ZL 3STLB 5KS9E 2ADIB 2PTTA 2VXUL 3VXUD 3EYSL 5HGAB 5L8JB 3LN5A 2VLRB 4PGCB 1P69B 2X4UA 4XTRD 1INEH 5I1JH 3PDOA 3KYAA 2FEEI 1JHTB 5GGSA 3QFJB 3BX7C 5CBEA 5JDJA 4XPBH 4Z7WB 1K8DA 1VPOL 2VUYA 4IRJB 3X3GH 4KVCH 5K9QG 1B6DA 2UZIL 2X4PA 2X70B 4WW2A 3SKMB 5ESAA 4Y88A 3FT2A 3ZHKA 3OPZL 2UWEB 4JB9L 5GS2D 1WVZA 4BQBA 3TCXA 4LCYA 5C86A 5IMOB 2DKMA 3BPCB 2IALB 3HZMA 5DRNA 4NKIL 1LDSA 1QSFD 4ZG1A 4TOYH 1NGQL 4N90D 3VWKD 5DJXB 3PHOA 5DXWA 1Y0LB 3GJFH 5E7FA 3G6AA 4G8GB 5EC2B 1E4XI 2PO6C 2HT3C 4NRZA 3LN5B 2FL5A 4LOUC 1ZANL 5HYSB 2RHEA 3A67L 4KMLB 2A1WL 4FABH 5GGSB 4APQA 5CBEB 5BJTA 3KJ4C 1YEGH 1K8DB 1XF2A 1XGPB 1C5BH 4QRPA 2CLRA 4XNMA 3LKRB 3MLVL 2XWBB 5E8NA 4QHKI 4NM4H 2MMXA 1H8NA 4F7TA 1UWGL 1UJTA 4RQQB 3EYUL 5ESAB 4JFHD 3WDJA 3FT2B 5HBBA 2YXFA 5FAAA 1CLCA 1N6UA 2XQBH 4XVSL 4NKDA 3HZMB 4Y4KA 5DRNB 3GJFK 2YXMA 4OKVA 3BUTA 4MNHA 3PHOB 2O5YL 3MRHB 2M2DA 4ONHA 3NCJH 1Z0NA 3E0GA 2AJYH 2XN9A 4NRZB 5T3XH 3VFSA 1JYNA 4QEGA 3T08A 3K81A 3U82B 2FL5B 2WBJD 3OL2A 4OKDA 4YEFA 3QUYD 3MO1A 1ZEAH 4APQB 5BJTB 4OD1L 1XIWC 4N8CL 1XF2B 2LTQB 2NLJB