1MCOL

Three-dimensional structure of a human immunoglobulin with a hinge deletion
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
216
structure length
216
Chain Sequence
b'PSALTQPPSASGSLGQSVTISCTGTSSDVGGYNYVSWYQQHAGKAPKVIIYEVNKRPSGVPDRFSGSKSGNTASLTVSGLQAEDEADYYCSSYEGSDNFVFGTGTKVTVLGQPKANPTVTLFPPSSEELQANKATEVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IGG1 MCG INTACT ANTIBODY (LIGHT CHAIN)
publication title Three-dimensional structure of a human immunoglobulin with a hinge deletion.
pubmed doi rcsb
molecule tags Immunoglobulin
total genus 21
structure length 216
sequence length 216
ec nomenclature
pdb deposition date 1993-02-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1mcoL01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1mcoL02
4W68A 3LVEA 4OLEA 4OFVA 5IHUL 1NC4A 2Z31D 3MRPA 4FFZH 4IIQA 4XNXH 5DK2A 4XNQB 5C07E 4OIIH 5EBGA 1HHHB 4G8FB 4LPCA 1SJEA 3OMZA 1T2QH 3WDJA 4OZIF 2OP4H 1DZBA 5A16A 3LKNA 4JKPL 3VDCA 2R4SH 2W9LA 4M6MH 1HHJA 3BEWA 1D6VL 2R2BA 5C7XH 3ARBD 5IMMB 1OD9A 2XWTA 3B3IA 4KKAC 3BPCA 3B9KC 3DUSA 3UTTE 3VH8B 3C60C 4I8DA 4LDEB 1MRDH 4M9OA 1T0NB 2W60B 2P42B 4P4RA 1CU4H 5J6GA 4HT1H 1N2RA 3BISA 3FQXA 1P6FA 4R8WL 3EZ8A 4YO0A 3L3GA 2BRQA 4XPBH 1CE1L 3AVEA 4GXUM 4LSRH 4KI1A 3O0RL 1FZOB 4M5ZL 3OKLA 1KACB 1WUNT 1U95B 4QWWD 4YC2B 5I8CA 2F15A 4P3WA 4YXHL 4X83A 4BH7B 3KR3H 1BJMA 4X6FB 3KPTA 3UBXI 5GS0D 4G6JL 3FONA 1GC1L 2NY7H 2XRAH 2P44B 3L5XL 4MDJA 4POUB 2XV6B 3QUMA 1IARB 4Y5YC 3SBWA 1SBSH 3PL6D 3EYOA 4IHOA 4X7TA 3RL1B 5I1DA 4Y4KB 5CMAA 5JNYA 1R0AL 2D3VA 4PJ7F 4Y5XB 5GS1A 3GMLA 3QFJE 2O5ZL 4PPTA 5CJQL 4PG2C 2QR0B 5F6HI 3T4YB 3DJ9A 2VLJA 4HZAA 5B3JE 4M61B 3JWDL 2J4WL 4OF0A 4IRJA 1W72L 4IDJL 5JXAH 3MRHA 1U8OB 5KSVA 2UV3A 4EI6B 3QIUB 1RJLB 4HGKC 3BJ91 3LZFH 4FQIL 4P5MA 5KSAD 5I18H 4NP4L 4KZDL 5CJXC 4MQXD 4C56A 4JG1H 1A4KA 1BEYL 3MRGA 1IL1A 1FGNL 1J7VR 3QNZA 1JHLH 4KJYB 1SMOA 1OB1A 4EZMA 4Q2ZA 4R7DB 3CC5B 4NM4H 4J1UB 4K7FA 4RMRA 4G7YL 1VPOL 2HRPL 2YA0A 5C0BB 4NRZA 5KVEH 3MLRH 3OKNB 4P46C 3SGJA 1TTGA 2EH7H 2J8UA 4PRIB 3D18A 5JOFA 1NMCB 1I1YA 5TE7L 1VKXB 4U1LA 3LSOA 4FQ2L 4M7LL 4X80L 1HDMB 1V5JA 4X5XB 5BZWA 2QQKH 1S7QA 2X89D 1KJ2H 1Q1JL 2HFEA 3TBSB 4GW1A 5BQ7A 3A67L 4RMWA 1I1AB 1NCDL 1XF4B 5TQ0H 4D0DA 5IFAL 4Y2DD 1RZKH 1ZVSB 4OCYH 3VXRE 1JI1A 2ZPKH 2V2WB 4WNQB 4PGEA 3NTCL 4HFWA 4G9FD 4LLVA 3LS4L 4HG4K 4N1EA 4J8RA 1JF1B 3V5DB 5BVPL 3U4BH 4WI8A 2XWJB 1HXYA 2GJ6A 2NW3A 1T21A 1UVQA 4L4VE 2H9GB 4MXQD 2R0LH 5FM4A 4L4TD 4R0LC 4HK3N 1KPRA 4Z7UF 4E0RA 1MY5A 5D2NB 1TCMA 1RURH 3GJFA 4NPYA 1BGXH 5FECB 3QNYB 1D5XA 4KRLB 4XP4H 3UO1L 2G9HA 1J0HA 3FB6B 4JREC 3MRCB 4L3AA 3VXMB 1KTLA 2E6JA 1CG9B 2ATPB 4I4WB 4N8CH 4F58H 4XPFH 4JQIH 4Z7VE 5I1IH 1F2QA 4XRCB 2EDHA 4M7ZC 1MAJA 1IC5L 3UTZB 4ELKA 3CK0H 5GHWL 5DJAA 4UBDC 5ADPH 1NANI 3O6KL 4KK6D 4KAQL 4XPGH 3W2DH 2EZ0D 3PWPE 3QUKA 4CU6A 4FZ8H 4PLJC 3AB0C 1B0WA 1JP5A 4BZYA 4LRNH 5HYJD 5D7KE 1QVOB 1IGFL 3GI9L 4WW2B 2B0SH 3KPOA 3N9GH 4RA3A 1OSZB 1NDMB 2BOCA 3U1SH 5FFLA 2CMRL 1RU9L 2JK5A 4L3CB 5IBTL 3TZVC 2FWOA 3HUJA 4CADA 3CXDL 3HE6A 4FHBD 4JRXA 4Y88A 2YKLL 2IMNA 2A77H 4ZSOE 4JN1L 4PJBE 2CDEB 1X5XA 3OKDB 5FM8A 2C4FT 3VGAB 1C16A 2A9MH 3DO3A 4JZOB 2F53D 2HN7A 1CQKA 4M7LT 1WK0A 3G5VB 2WLZA 1SYSA 3PQYE 2V2TB 4HIJB 5CGMA 3IDIA 4LVOB 1RMFH 5CLTA 3C2AH 2IH1B 1QBBA 1A9EB 4JB9H 2LVEA 4JFEE 3SKMA 5K9QI 4HS6A 4FMKA 2YWZA 4WU7B 1YMHA 2XYCA 3I3DA 1KIQB 5IFHL 2EYSB 5DJXA 2MKLC 4EDWL 2HJLA 4FQCL 5D7LA 2I07A 5FUOH 4X98A 3IB4A 3TO2B 4AZ8A 5EZOL 2CDFA 5CHNA 3GM0A 1JYVA 3NPSC 2VDKL 3SO3C 1FE8L 5CD5C 3TBTA 3MRBA 1FYTE 1I4FB 3PDGA 5ETUB 4ZUUA 4H25A 3S35L 2NMSA 2BMKB 1F8TH 4JQVC 3HR5B 4RWHA 3MXVL 4QOKD 4BZ2H 4PJ9A 2VITA 4XCYB 5FYJH 3KVQA 2I9TA 2IALA 3F7YB 4R90H 3V5HA 4WO4D 2X1QA 4G6KH 3QNXB 4CDGC 1BD2A 5CZVH 4S1QL 1PYWA 1UA6L 2GQHA 1EERB 5IHZA 3N1FC 1CFVH 4HPOL 5L2KB 1QFPA 2UZYB 4Q6IA 1P4IH 4UZGA 1HINH 3EHBC 4RQQB 3LRGA 2R29H 4WTZG 3MREB 1AGDB 2WBJB 1YC8A 1OAQL 1G7HB 1ZHLB 3EO0B 5TFSH 4DKAA 4AIZB 4HH8A 1ULVA 5FHAH 3ZL4L 3HMWL 3RVTD 4AY0A 5BRZB 3B2VH 2YXMA 4N8VA 4BQ6A 1BECA 2NXZD 3NZHH 2X4RA 4PR5A 4P4KC 4Z7WF 3IDYB 2YD1A 2DYPD 4GKNA 4GKSA 5FV1L 3ZLQC 4NNPH 4UUJB 5JHDD 3NFSH 3BO8A 3VG9C 1KELH 3EO1A 1NKRA 2YD5A 3HB3D 1YZZA 3FKUS 4U6XB 1MJ7H 2IF7A 4NOBA 1MLBA 4MNQD 1N5AA 2ICES 3D2UB 5JW4N 3IXAA 1I3RA 5JIPA 4U1MA 1BQHG 5KVDL 4MB3A 4NCC2 2HFGH 3OKYA 1MJUH 4GG6A 4PB9L 1J8KA 4XAWL 3HC3H 1S7TA 3D25A 5T5FL 1J5OL 2UUDH 3FQUB 4FFWD 5C0JB 4X5LA 1I7TB 2NY0B 1RUAL 4I77H 4PRHD 1CXFA 1JN6B 3SDCB 3VFSB 3MOBH 1MI5A 3G5ZB 4NQCA 3QG7H 3ZDYE 1RVFH 3LQAH 3VA2C 3E8UH 4OSUH 4OLUH 1QLRB 4UTBH 3DARA 2I27N 4HJ0C 1VEOA 1CFSA 4N0RA 4ZDHB 5DC4B 1DEEA 2ICWI 4LNRB 5C0DA 1ORSA 2OM5A 3O2DL 3NFPA 4S2SB 4XNUH 3TYFA 3VXOB 3U6RB 3WNOA 3VI4E 4XI5D 1FG2B 1FV1B 3VFTB 1PD6A 3VFWB 5K9JL 2V7NA 1D7FA 2EO9A 3RGHA 3KNBB 5GZOC 5I30L 3AREA 3IDJB 3NFNA 3NMEA 5ENWB 1NBYA 4LLWA 3I2CL 1FIGH 2FH6A 5FYKU 1J8HB 3OPZH 4MX7A 2VAAA 4K7PY 4YDLB 4L3EA 2R69H 3GK8H 2E7LA 3U2SB 2AXGA 4HMDA 5F44A 2RAMA 4PD4J 3UZEA 3RAJL 1T5WB 3EYUL 3H9SE 4YE4H 2EDRA 3C5JB 1HHHA 5DRNB 2AW2A 1CFTB 4UNUA 1QHPA 5FYJD 1F42A 1FZJA 4X99B 5BW7A 4N5EC 1URLA 3QWOA 1PX3A 3QEGL 1JWUB 1R3IH 1CFBA 3EYFB 2D31B 4DFHA 3NCBB 2QSVA 1Z0NA 4P9HL 2A9NH 3IDXL 4JCLA 3VH8A 2XTJC 5C1MB 2VXUL 1HKFA 4H88L 4JFFE 4HCRA 2HRLA 3MYZA 3LRSB 1T0NA 2W60A 4WFGE 4RMVA 2AI0H 5KZCD 2AP2A 5E7FA 2X09A 5E94B 5ANME 4FZEH 1XF2B 1IBGH 2HLFD 5D1ZA 2Q7YB 1MHEA 5I1HL 1E4WL 3NABH 4OF5A 1DLHB 1S7UB 2FD6H 1HQRA 5FGSA 1FZOA 2YMXH 1FSKC 1U95A 4U7SA 4LU5L 3UPRB 4ACPA 2H41A 4B53A 1JZ3A 4BH7A 1F3DH 4QHUB 4JZJA 4X6FA 4Y16D 4EXPX 4XC1H 3SDAB 2FBJH 4CBPA 4NQXA 4YWGL 2WIMA 3DX7B 1GGCL 1NCAL 3VWKC 3KPQB 4MA7H 6FABL 2ZG1A 4PJGE 3RL1A 5KTEH 5E5RB 1I85C 3CZJA 4QRPE 4H1LH 3LIZH 4DQOH 2XA3A 5I8KH 1G7PB 3WUWB 4PUBL 4Y5XA 4R4NC 4F37K 5FGBC 4WI5A 4UI2A 2QR0A 4F7PA 4WIQA 2AEPL 5CEZE 3PE9A 1CXLA 1GOHA 2FSEA 4DN3H 4DVBB 1U8OA 2DQGL 1N26A 2HH0H 4EI6A 5KSBB 4LMQE 3QIUA 1RJLA 3QEQB 4ODXA 4YHOH 3A0OA 2HVKB 4YNYB 5CGYD 3TN0D 1F3DJ 3DLQR 1C08B 5IB5B 4KRMB 4K7PH 1F3RB 4LVNC 4KJYA 3D39E 3TIEA 1H3VA 4R7DA 4UQ3B 3F12B 5IUSA 1GSMA 3RJQB 1C5BL 2CKBA 4RFNC 2LAGB 1XGYH 2QBWA 3BDYH 3GM8A 4PRIA 2KKQA 2W0FA 2DBLL 4KMTH 1HDMA 1PDKA 3BYTA 2OXGA 3WFZA 4U0RB 1A47A 3U7YH 4P99A 3T0DA 3TBSA 3OX8B 4RAVB 4MAYD 5LVEA 1I1AA 1XF4A 4XZUA 1ZVSA 5IBUB 3NAAH 3UTSD 2DAVA 4OGZA 2V2WA 1U8KB 4WNQA 3T77B 3GZKA 3N1QC 4NO2B 3HN3A 4J3SA 3ULSA 1KCRH 4E41D 1JF1A 2VDRL 3V5DA 4M1DL 3H9HB 2QQLH 3WKNA 4JAMA 1ITCA 2UZXB 2H9GA 3BPLB 2I9LB 1QHOA 4HS8H 1OM3H 1QSED 1LE5B 3P77A 1BWWA 2HFFB 4FQJH 3V6OE 3RVVC 3TA3D 4U1NA 3L9RB 1IAIH 2YA1A 2AJYH 3ARFB 2G60L 4FOMA 3NCCB 4UDUB 2BSSB 5D2NA 4PRPD 4X4XB 3WXWL 3KPRB 3LV3B 1NMBL 1TZHB 4RFEB 1HN1A 5FECA 5EUKB 3QNYA 1JNLH 4I18C 1RIVH 3MRCA 4L5FL 3L3IB 2ATPA 1FPTH 1P9MC 3UX9B 1WT5A 2MSPA 4OZFB 1YEKL 3MLYH 4GBXC 1GGUA 2P24B 1KBGL 4XRCA 1MFAL 4YGVB 4WGWB 2GY7B 2BVUA 1J10A 1RZ8A 1JI2A 2QADC 5IEKB 2NTFB 4KKBC 3HI6H 3LKQA 5D72L 1AO7D 4OBRA 4OLXH 4X7SH 3IDMA 3RZCB 3IAQA 4LEXL 1S9XB 4JFDB 1OSZA 4L3CA 5CS7A 3TYGL 2B1HH 2HVJB 1GRWA 35C8H 4BQ9A 2DLHA 2QQNL 4U1HB 1XGQA 5KOVC 4KQ3H 3K4AA 5L88H 4MXVE 4KV5E 1BOGB 3OKDA 1J9CT 7FABH 2OL3B 2ZKHH 4JZOA 1KCUH 3BPOB 3G5VA 4NQEA 4ODTH 3ULVL 4P9HC 4HIJA 4Y4FC 1QPXA 4Q6YA 4OKDA 4O2CA 4ZFFA 4IRSC 4ELMF 2ITDB 5MP6L 2FGWL 1A9EA 1FZMB 1KEGH 2DDQH 1EO5A 4GRWF 4MB4A 5C0AE 1Q0YL 1VESA 4WU7A 1A7OH 1KIQA 2EYSA 4LPYA 3BRFA 4LCIL 1QFUL 4LIQH 2UVEA 4DWHA 1C1EL 4HJGB 3R8QA 2BVEA 1YQ2A 1NAMB 5F3HA 5TF0A 2BNUA 5MEOA 1P6AB 2D9QB 1TDQA 2YUWA 4JJ5A 1UEYA 4XMLL 2FX7L 2BMKA 4YDJB 5IVXB 1NGPH 3SPVB 3W0WB 1YMME 4YHLH 1ZT7B 2XKNB 1MJ8H 3RVUC 1TNMA 5LCVH 4QRRD 2XXMB 4F9PA 3L3JA 5KOMC 3WO4C 4LSSH 4KJQC 1IEAB 1ONQB 3F7YA 3IETB 4Z77B 5TPWL 3NOIA 2DQTL 4M02A 4RSVA 3F5WB 3RI5K 3SCMB 3C5ZD 3FO9B 4XCNB 2W1NA 1MFBL 4JR9L 3T0ED 2VXSH 2DL9A 5L2KA 4UV7H 1DUYB 4PJHE 4RQQA 5FCSH 1RUKH 1NFDE 2IPUK 3MREA 3MJ9A 1G7HA 4AIZA 4GKOA 2R0KH 1LNUB 1QLFB 3OG4B 1ZK9A 4LQ1A 3CH1A 3HRZB 4YHPB 4QTIH 3S34L 3VGBA 1XGRB 4X7FC 1ZGLM 4M1CC 4R3SB 2X1PA 4XWGH 1MFCH 1DN0B 3HNVH 3VFGL 3EFFB 2XA8H 1OT2A 2LU4A 4U6XA 1UADC 4TPRH 4WI9A 1IAOA 1KFAL 3D2UA 1ZOXA 4M7KH 2F5AH 3IFPB 1WAAA 1CLOH 2DB8A 2WV3A 5HD8C 4X6EB 1JHTB 1H15B 2EKSB 2OTUA 2JLLA 4LVHC 4XXDB 3G6DH 3DROA 3TC9A 1R24B 2AK1L 2WW8A 3JWOH 4TULH 3SOBL 5F1IA 1QTYT 3DECA 3UCRA 3D3VD 3FQTB 12E8H 3ARQA 1T03H 4K23L 3ZKNC 1T20B 4O5LL 5KS9E 5E6ZA 5C0JA 5SX5H 3KLHC 2NXYC 3DXAB 4LAQL 2XZZA 3VFSA 5T1KB 2HT4D 4UT7L 4A6YB 2QHRL 4FABL 3LPWA 5I1LB 2D2OA 1VGEH 3ZE2E 5CWSB 3VXTB 4XVTH 3MV9B 3B9EA 5C0CE 4FTVD 1BBJB 1Z9OA 1HHGB 5B8CC 3BVNB 4ZDHA 2VDLH 4LNRA 1FG9C 4P2OB 4Z7QE 1LK3H 2NR6C 3VXOA 2C4XA 4DZ8B 3U6RA 5C0GB 3LN4B 1ZLWH 1FG2A 1FV1A 3VFTA 1FAKT 2FX9L 2XFXB 3CFBB 4YXLH 4P23D 4F9LC 3PHQB 4XVUD 1F58L 3WLWC 2IG2L 2X4OA 3IDJA 5ENWA 2BZDA 1CDHA 4YHYB 3IVKB 3H2WA 3HE7D 5GGRY 5IT2H 3KLAB 4KRPC 4TQEL 4IS6B 1RIUH 2WWMC 2AXFB 4IMLB 1S5HB 3U2SA 4LSUH 2LV4A 1V3LA 4S1RL 4UIMB 2A1WL 1K4CB 5TGBB 1T5WA 1E4JA 3ZYJA 1K3IA 1YY9D 3C5JA 4NRXA 1HCVA 5DRNA 4PRBB 1CFTA 1YEGL 4UB0L 1KC5H 1RZFL 1JGUL 3QI9D 4X99A 1A5FH 1C5DB 4I0CC 4OJFH 4QHNB 3RPKA 3SE3C 1JWUA 1C7TA 4L4TE 2MQ3A 3OB8A 2GK0A 5E2WH 1UB5A 3EYFA 3RY6C 3X13B 2D31A 1Q94A 4MS8C 5T1LA 4KXZI 4IOSD 4XBEL 1EXUB 4KUCF 2GTWB 4KDTA 3CX5J 1SJVA 2AJZB 1RHHB 3O3AB 5TE4L 1OTSD 4MHHI 4NQDB 1CGTA 4G8GE 1A1OB 4YBQC 3O3BB 4MJ6B 3OKMB 2Q7YA 3TV3L 5F9DC 3K8MA 4I3RL 3MCLH 1ZT4B 5MENE 1RJZB 3MUHL 4Z95H 2IQAB 3UPRA 1UM5L 5C70A 2LTQC 2PW1A 2X4SB 4QHUA 3IFLH 3OXRB 3RIFK 2ADJB 1A2YB 2Y36L 1X6NA 3SDAA 2CJUL 5SWSE 2ATKB 3PGFL 1ZVYA 5HYJE 1YUHA 2C3GA 3DX7A 5DXWA 1BBDL 2HMID 3KPQA 1MCOL 3RIAF 3P11L 2QHLA 2H26A 3P0YL 4GRWH 5SX4I 1AGFA 3TBWB 4NQVB 4ZD3L 4MMZC 3C08H 4BA8A 5CILL 4XCCH 4UT9L 2J8UF 1AFVH 3CIQA 1VERA 4LLMA 4WWKD 5BXFB 2R1YA 1CDYA 4Z7VA 1N64H 4DVBA 2IMMA 4G7VH 5DTFB 2DQUL 4LCYB 2J2ZA 5KSBA 3WLBB 4OCSH 1HILB 2HVKA 4JFOB 4YNYA 5IB5A 3M17B 2BXYA 4JGJA 2EE3A 2YPLD 4F8TA 3PWPA 1AIFB 2EIZA 3QDJB 4UQ3A 4JANA 3F12A 4NWTH 4NHUB 4D0CB 3O4OB 1OF2B 43CAB 3KPMA 4NRYB 2ZOKA 4XCFH 3W5MA 1HHIA 3QO0B 3B4NA 3FQWB 4YUEH 3PGDB 1TQBB 2BFVL 4N0YH 1A6AA 4K8RL 3IU3B 2P7TB 4M6OH 2BDNH 1UWEL 2DWDB 3QT2A 1RPQA 1W8OA 1UT9A 3MRJB 1DSFH 1UXWB 3G6AB 5DFVD 2O93L 4LOUC 4TRPL 4PJBA 4FQPA 1M1SA 1P7QB 4UTAH 3OX8A 1E4KA 2CUMA 4RAVA 5GGVL 4WFED 4KTEH 5C3TA 1EIBA 5ESQB 3CSPA 1N0LA 1OTUD 5F6IB 1AY1L 1DVFB 1T1XB 1KJ3L 2EC8A 1U8KA 2C5DC 3T77A 2YD3A 3BZEB 4NO2A 4Q0XH 2OJZL 5DGRA 1PSKL 4NUGH 3HC4H 4FFZL 3OB0K 5DJDB 1D9KA 5D96C 5D7IB 3LHPL 2EDOA 2NY3D 3U4EB 1MHCB 5ITBH 1N6VA 2I9LA 1CL7H 4BFBD 1LE5A 1YEJH 3L9RA 1KB5H 4APQB 3T09A 2ICEB 3ROOB 3NCMA 2WANA 2BSSA 3PJSA 4YK4C 1IKNA 3B9KB 3KPRA 1QA9A 3WMSA 3C60B 1FVDB 5C7XL 3MJGX 5EUKA 2VQTA 1G6RH 1JTOA 5JHDE 5SWZE 3LKRB 2NQCA 3L3IA 4HKZA 1MRFH 3HUJF 4OZFA 5KW9H 2P24A 2F54E 4Z7NE 1CBVL 5T3ZL 2GI7A 2NX5E 1YY8B 4GFTB 3QIBD 3OAZK 2H2PC 2X4UB 4JFZH 1BQSA 3V0WH 4LBEA 4LLDB 5IEKA 4ORGB 5IBLC 2NTFA 1CVSC 3MUJA 4ZAKC 1H3UA 1EAJA 1RZGA 3HI1B 4Q97A 4DGVH 5DJZB 1WBYB 5LBSL 4TVPH 4UILH 3OHXB 4K9EH 3WEXB 3EYVB 5J3HD 1G7LB 1FNAA 1X7QB 1FORL 3IDGB 4X5WA 3RZCA 2A0LD 5E2VH 1S9XA 5HHMB 4JFDA 4Y5YB 3V79C 4TNWK 3SGEI 3U0TA 2HVJA 2Z31C 4GRLA 1IKFL 2ZUUA 5DA0B 1AI1L 4M7JL 4OIBA 1LE9A 3RDTD 3HNTL 4U6YB 1MCWW 1BOGA 4IRZL 5ERWB 2OL3A 2W0PA 4QRUB 4ZUVA 3PWUA 4OZHB 1G9NC 3UPCA 1OLLA 4HC1L 4KGJA 1IM9B 1G0DA 2DQIL 2P47B 4X9IA 3WE6B 2GKIA 4LMQI 2ITDA 1Z3GL 5CBAB 4RX4D 4U1SB 3EGSB 4RISH 1J1XL 4OQ1A 3LEYL 2VLLB 1MCEA 5I18L 1GZPB 4JE4B 4AMKH 3AY4C 4UNVA 1T2JA 4JG1L 4IOFD 4POYA 1MCWM 2Y25A 5JIHA 3GJEB 2FL5B 4WEUD 3TVMA 4HJGA 2XZQH 3C8HA 5F1NB 4P46B 4ZNEE 1BQLH 3GIVB 4JHWH 3SN6N 1A4JB 2YHGA 5M95B 2AEQH 3MV7B 3ALPA 1X5LA 4O51B 4JRYD 2EH7L 1KTDA 2HFTA 2AJXH 1EVTC 4QWWC 1T89C 4ODHL 4YDJA 3QUMH 5C9JB 2QSTA 2X44D 2XKNA 1YNKL 5GS0C 3LS5L 1YEFH 4P2QB 4ZODA 5FYJE 5T33H 4NNXB 4CAGA 3GEWB 5D1XD 3IETA 5DO2C 5FKPB 5TQ0L 1NCBL 3CVHL 3F5WA 3PL6C 1RZKL 3STLA 5AZEH 4HDIB 3GO1H 2X4NA 4I48B 5ALCL 3TWCH 2R0WL 3KYMB 1DUYA 4XPHH 1T1YB 3S4SG 1AQKL 5D1QB 3X17A 3BWUC 1GVIA 4R0LB 1X9QA 1QLFA 2K9UA 4GG6F 3HRZA 4ZFGL 5DSCB 5KSAC 5BS0B 1XGRA 3H9SA 1BFSA 1MCLA 4MQXC 4F57H 1P7KB 1CWVA 4HUUB 2L0DA 4OB5H 4PJ7E 4R3SA 3NIFF 3VW3H 5EU6B 3P9MB 4JREB 1ZHBB 2MHAB 1DN0A 1BGXL 2OBGA 4XMKH 3AMLA 5DQJA 4WI4A 5I76B 1WGOA 2EDBA 3IFPA 2F58H 4M7ZB 5FYKL 3CFJB 1JHTA 3QEUB 1H15A 2EKSA 3B2UC 4ERSL 2B20A 3MRKB 3E0GA 3VMOA 3QIWC 1R24A 2I60H 2VDML 4OGXL 2P45B 4TVPD 3EOTL 3VXUE 1NC4D 1NMAH 5GSRB 2XKUA 3AS1A 3FQTA 3QHTC 4R6UA 3MJ8A 3AB0B 4L1HA 3FT4B 4XPGL 4Y2DC 1QUNA 3P30L 1JGLH 3OJ2C 5T1KA 1PFCA 2V9QA 2PN5A 3TZVB 5I1LA 4U49A 1WTGT 4K71C 1IT9H 5HGGS 5CWSA 4BYHA 3OSKA 1KCSH 5JA9A 1CD8A 4OIAA 1BBJA 5GRUH 1HHGA 5FIEA 2R39A 5KJRH 4MXQC 1YNLH 3RWJB 5LGHH 1I1RA 4HS3B 4P2OA 3GJFH 1U42A 4DZ8A 3ARVA 2A9ML 2YD6A 4B41A 2V2XB 2DQHH 4CGTA 3LN4A 4TSBH 2MCG1 2XFXA 3CFBA 4D94A 4UOW0 5EO0B 4NHCL 1O7SA 3QDHA 1DQQA 4FA8A 3IVKA 2YK1H 3FN9A 1YPZF 4NDMB 3RBSA 3EOAA 3KLAA 1UZ8A 5HDQL 4LGPB 4IS6A 4TOYL 3RTQD 3T3PE 3SO3B 3C9NB 4IMLA 4MA8L 3ZZ1A 5L6YH 3EIFA 2VL5B 4KUCD 3ULUF 3UJTL 4UIMA 3UTSE 5TGBA 3WL9B 4GW5B 5HVWA 3QJFB 5F72S 4M4PA 4KK6C 4E41E 5I16B 1NLBL 4PRBA 4D3CL 4YDKL 1WFUA 3U9PH 2EZ0C 3CZFB 4XP9H 5E6ID 4W4OC 1F8TL 4HIIB 1C5DA 3V9FA 1BREA 4QHNA 5MEPB 2JJUA 1V7NH 1A8JH 4HX1B 5H37G 2PTUA 1QSEE 1DL7L 4EXKA 4ETYA 2E9WA 3X13A 3QCVL 2VLJD 4O00A 3KXFB 1WICA 3G9VA 5DHYA 4IRJD 1EXUA 2GTWA 5HTSA 1LO5B 1AD0B 1W72B 2AV7B 3UROR 3S5LG 1HIML 4RGNE 1RHHA 4LCCC 2P1YA 4C56D 1EDQA 4NQDA 1JCKA 1MRCH 1A1OA 4MJ6A 3OKMA 5EFIB 5HHXH 1ZANL 4XP5L 4RDQF 1WWCA 4P4KB 4PB0H 3MRRB 2DQJL 1ZT4A 2MCPH 1B2WL 1U8HB 2IQAA 3QDGD 1R6VA 2HJFB 1WV7T 5T3XH 1WC7B 2X4SA 1TVHB 3VG9B 2EEDA 5CD3B 3L5JA 3OXRA 2Y23A 2VH5H 3O6FB 2IPKB 1R5WB 2ADJA 3QA3B 1A2YA 3P73A 4GAYA 1AO7E 3V6OA 1P1ZB 3UJJH 25C8L 3S8WA 4RRPG 3H9YA 2F9BT 5IB2B 2R1XB 4U1IB 3MLUL 1KCLA 3AM8A 2BSTB 3TBWA 2MKWA 1AXTL 3JV6A 1HSAB 1RZJL 4WTWA 3ILQD 3QUXC 1A6WH 2XN9E 2VC2H 3Q5TA 5J12C 3BP4B 4MDIA 5HVFB 4LFHD 5IB4B 1RZKC 1MJUL 1UB6A 3H42H 3PV6B 4Y2OA 3FB7B 5F6HJ 3MA7B 3GMPA 4LCYA 2GJ6D 1UWXK 4PREB 2BXZA 2M8XA 4WO4C 3WLBA 2MFNA 4PV9B 2FECI 4U05A 3TJEH 4X6DB 4ALAH 3LQZB 4JFOA 1ADQL 3OJMB 5F96L 3LMJL 1BOYA 3EOBA 3M17A 4XWOD 3MOBL 3S37X 3LEXB 4D9QD 3EDKA 3MX0A 2LU7A 3LQAL 4H20L 3HS0B 1AIFA 4H8WH 1RFDL 2APXA 3QUYA 3WS3B 1CDGA 4OSUL 2ZOLA 4NHUA 4D0CA 4HJJH 43CAA 4O2EB 5DLML 4UTBL 4EUPG 1HHKB 3QO0A 3V6FB 3PGDA 3QG6B 4JM2C 4KUZH 1U8PB 2NXZC 3QPXL 3IU3A 2GY5A 5C3LD 4RMSA 5IFJB 2ADIB 3MRJA 3G6AA 2HT2D 1QFWM 3L6FA 3DBXB 2NY5L 2ZJSL 1LDPH 4L9LB 2ZCLH 4L8BB 2H32B 3QHFL 3HB3C 3OR6B 1YA5A 3RX7A 2FBOJ 3O3EB 5BO1H 5ESQA 3T1FB 1FO0L 4P3CH 1DDHB 2PYEB 1WISA 3BDXA 1DVFA 1T1XA 3MODH 1HWHB 4BSWB 2VB5A 3BZEA 1GCFA 3MBXH 4PJFE 3GK8L 4KI5C 5ADOL 1BQHB 4JKWA 3RP1A 2VLME 2NW2B 1QNZH 3T0EE 2GJZA 5DJDA 3MOAL 5D7IA 1KENH 5I6XB 3HE6D 3W11D 2MPAH 4JRXD 1NANH 3ZT6A 3D9AL 1N4XH 4FFWC 3IFOB 1BJ1H 2N56A 2R2EB 5JPNA 2OJEA 2QSCH 5HPMB 3O2WL 4APQA 3Q1SL 3GBML 1C8PA 2ICEA 4FQQA 3JUYA 2YPVH 3B9KA 2XTJB 3V8OA 4U31A 4CU8A 1JTPA 5FF6B 4NN6C 4RFOL 1YMMA 2PO6A 4M1GH 2DKMA 1ES0B 4F37F 4KHXH 2JCCB 4AG4L 1FDLL 1PLGH 2CO6B 4CL7A 1SY6A 4OFYA 1X5JA 4TNVK 1X5KA 1YYLH 5D7LD 5C0IA 1EAPB 1NGYB 4ODWA 3CFEA 4J3OC 4LLDA 4XGZB 3OXSB 5F9AC 5T3XD 1FSKB 5HYFA 4X4YB 1P84K 4PJHA 5DJZA 2YMXL 5HYQA 3OHXA 3WEXA 1U6AH 3BKJL 1G7LA 1X7QA 3ZSTA 3V4UH 4PJEE 5H94A 1X5IA 1VFBB 1E0OB 4P9ML 4QRTA 1U93B 4PJ9D 2YD8A 4Y5YA 3VWKB 4WI3A 2FBJL 4P5TA 3DGCR 1UZ6E 1IGCH 1DTUA 4WGVB 5KTEL 1GHFL 1T7WA 3S37L 1BD2D 4DQOL 3MROB 2B4CL 3Q5YA 4FTVE 4QRUA 3PXJA 4YHIB 4BQCA 4HCRH 1GGIL 1C12B 2X70B 1IM9A 4LLYB 3WE6A 3K4ZA 4DN3L 3DV6B 3ULUH 1A1NB 1FNEB 3L3HA 4U1SA 5CJXA 2Z93A 4FMFA 1EGJL 3PGCB 2VLLA 5EIIB 4AQOA 4LVNB 4ZFZB 1AE6L 2WUCL 3DUUB 4LIQE 4K7PL 4N1HB 1ZGLB 4DTGH 1BM3L 1FRGL 3I6GA 5L9DH 4RFNB 1WFTA 1PQZB 4P57A 5DEGB 4PJXB 3BGMB 3GIVA 1NLDL 1A4JA 3BN3B 3MV7A 1ZT1B 4UIKL 2ZCKH 43C9B 2JELL 5GSVB 4HEPG 4MQTB 2X7LB 1J18A 3WIFB 4WUUE 3GMMB 5EUOB 4QXWA 5C0CA 1VFUA 3KYAA 2NY1D 5C9JA 3ULVE 1WIOA 4Y16C 3N0PB 4NJAH 1MCFA 1MWAL 4HD9A 3I9GH 4HWEH 4ZYKB 1J0YA 5JA8B 3B9AA 3SKOB 5DURD 3CMGA 5EU7E 1QBAA 1EHNA 1RZJC 5FKPA 2RR3A 3L7EB 3C8DA 5I71B 4HDIA 3IDUA 4OV6F 4I48A 4WY7L 1DQJA 5BMFH 4OF8A 1MHPH 4GMSL 1NQBA 5HI5D 1MF2H 1F90H 1MI5D 1KCRL 3EW3B 3KYMA 4NQCD 1G6VK 2AJUL 1UENA 1G9ML 2QQLL 3W9EA 5D1QA 1FFQA 1GGBL 1W0WA 1TVBB 2IQ9H 2VLKE 2Y72A 4Z0BL 4HS8L 4X4ZA 5CJOL 5DSCA 2HWZH 5ESAB 1OM3L 2D4FA 5HHPB 3LQAC 1T0MB 3F7PC 4ZTPH 1OAUH 3TN0C 3UC0L 2P5WD 1L7TH 1P7KA 2CKBH 4K94L 4I18B 2XT1B 5EU6A 5CSBA 2MHAA 3L3KB 4GG8B 2Q3ZA 5E2TH 2RHEA 1BZ7B 1J1OL 2B39A 3LPGA 3PQYB 1J1PH 3ARED 3V52L 4LSPL 4GBXB 3VD5A 3WHE0 1OPGH 4PYGA 3QQNA 5I76A 5D7SH 5TDPB 3FO0L 4FXLA 1JVKA 4NSKB 3MLYL 4OI7A 3MRMB 3G6JB 2QADB 3DHJA 5AUMA 5CJBA 2X4TB 3PV7A 4L3ED 3UXFA 4KZEL 1MQKH 4D8PB 3O4LD 4FXKB 5E99H 1T1ZB 4YH6A 4OZ4B 2X5PA 1LO3H 5GSRA 3T0VA 5JXED 3EFDL 1FL5A 1MAML 3S88H 5C6TH 4MAYC 5FXCH 4G8GA 3FT4A 5JW4R 5A2FA 5GJTH 2FX8L 4EIZC 5T1MB 3NIGE 1KPUB 4OLXL 1ZEAH 1BMGA 2GSIB 1TZIB 3TZVA 5MENA 1U91A 4JM4H 3GKZA 5EA0L 4GQPH 3U36A 4L8DB 3QDME 2C3HA 2DQEL 3CLEH 5I15H 2YPLE 1IAMA 5GQBA 4KQ3L 5JQ6H 3RWJA 3HNSH 1IZKA 4HS3A 2ICWJ 3BJLA 1KCUL 1WWAX 3ULUD 1CIDA 2V2XA 2W65A 4IRSB 4S11A 4NC1C 1K8DB 1T0PB 3AS2A 2AQ3A 3HZYA 1CTNA 5D1ZD 4OCMC 5EO0A 2KL6A 3UDWA 1L7IH 3PWLB 5C6PB 4RMTA 1NGXB 3TT1L 4XBGA 1A14L 1SJHB 1YNTB 1JUFB 4NDMA 4X8XA 3VXSD 5I74C 3O81A 4QXTA 2YOCA 4U3CA 3C9NA 1XFPA 2APVA 2VL5A 5F7LB 5C86A 2APBA 3UJIH 4GW5A 5CUSH 1OW0A 5I16A 4ZOBA 2CDGB 2D03H 1QPPA 1GZQA 4MD5A 4HIIA 1SHMA 3VCLA 3WO4B 4PJCE 1AR1C 3UTQA 3W39B 5A2KH 2CLVB 1SYVB 1UKQA 4HX1A 4MJ5B 1EUUA 4N1CA 3KXFA 2FEEL 3ETBF 1KN2L 4HUMB 3WXVH 1W72A 3QIUD 4IMKA 5DQDH 4OI8A 5J56B 1BFTA 2UWEE 4PGCA 1FNSL 3EJZD 4PFEA 5GISL 2Q6WA 2EKJA 5D6DC 4XHJD 1UWGL 3I3BA 4NM8H 1M7IB 3FRPG 1OQOA 5EFIA 3BI9X 4G8EB 4Y4HB 3MRRA 2DD8L 4N68A 1K4DA 1U8HA 2YR3A 3MLVH 4QTIL 2V17H 4Z7VF 2HJFA 3CVIH 4PRID 5ISZA 1OGAB 3O6FA 2ZUVA 5GZND 2DQDH 1D6EB 2N4IA 2VWEE 3QA3A 4WCYH 4HBQA 3HNVL 4OCWH 2GFBB 4AM0B 1TLKA 4LGSB 4O4YH 5IB2A 4KY1L 2R1XA 1XR9A 1I1AD 3QP3A 3P4MA 4LVHB 3SGDH 2BSTA 1N7MH 3MC0A 1HSAA 2O5XL 4JDVB 1GAFH 3F58H 4PJ8A 1Z6JT 5SWZA 2Y06H 4ZS7L 1INDH 1LP9B 5IB4A 3PV6A 4GMTH 1FFRA 2F54A 2DN7A 2J1KA 4OQTL 2NX5A 1U3YA 2NXYB 4PJBF 4PREA 1JPSH 4ONFH 1S78D 2PW2A 4X9HA 3ET9F 1FH5L 3LQZA 3MJ9H 3WD5L 1G9MC 3T0EC 3QO1A 5I75C 1FFPB 4N0UE 4FG6D 5EZJA 3LEXA 3RWDA 3P9LB 1ZLUK 1E6JL 3HS0A 1VGEL 3WS3A 5B8CB 1KN4L 3HZVB 4O2EA 1HHKA 2DM4A 5C09E 3V6FA 3MGTB 2ARJQ 4K94C 3RWIB 2RIKA 2UUDK 1NCCL 1RIHH 4WV1A 4YDVB 5J8OA 1J86A 5DJ8B 5DJ0B 5IFJA 5J1AA 5H2BB 5TDOB 1XR8B 4K3EH 1J12A 1CD0A 1PZ5B 4L9LA 1D5IL 3NZ8B 4L8BA 2OQJB 2H32A 4L8SC 3OR6A 4PJ5E 4PJIB 4KRPB 3B8YA 1DDHA 2PYEA 2UVFA 3DMMD 2GT9A 3TJHD 1AGBB 2A83B 1XH3B 1BQUA 3LKPB 3BKCH 1MIEH 1RIUL 2JJTC 2IAMB 3VU2A 1P53A 1BQHA 4NWUL 4AEEA 2NW2A 1W0VA 4MCZB 3R0MA 1U8MB 2DQFB 4FFYH 4YIQB 5E0QA 2ZUWA 4NKIH 2BHZA 3LEVL 1X4XA 4CNIB 3HA0A 2FZ3B 5DD3L 2XI9A 3IFOA 1KYOK 5D2LE 4KJWD 4I5BA 4G43B 8CGTA 5HPMA 1BP3B 5EOQL 4Z7OE 3BKYL 2AJSL 3OF6A 1SM3L 1IGTB 3RUGB 2HT4C 4NQED 3PDOB 1MEXL 1MCIA 1FVEB 1MCQA 1LO4H 1KF9B 1FL6A 4AYFA 5FF6A 5DD1H 1OSPL 5FUZL 1ES0A 1N3NA 2F5BL 2RFXB 2JCCA 3WNKA 4BH8B 4ZQKB 1S9KC 4NKOB 3MACL 5E8PB 3S7GA 1Z9LA 5HHOB 3SGKC 2G2RB 3ME0A 3W9DB 1I9RH 1NGYA 3RGVA 5J0BA 3BDBA 1WJ3A 1ZWIA 4P23C 5IMLB 3KHOA 4XVUC 3D39B 1M05B 1L4IA 4PRDB 2LTQB 4OCRL 4Z95L 3HE7C 5AG9A 4M6NL 1UKSA 5KANG 1AD9A 1VFBA 1Z5LB 1MSPA 2YUZA 5D70L 1U93A 4ZOAA 1CN4A 4JO4L 4GAFB 1I85A 1XCTB 4NKDA 3WHXB 5DMGD 4BUGA 2L4OA 4XHQA 3DI3B 4MSWB 5HVGB 3WFEH 1HZHH 1YY9C 15C8H 1JBJA 2X41A 3K46A 4CVWA 4ODVL 4B7LA 4OLVH 3QI9C 3L7FB 1OOAA 4RGOH 1AFVL 4YHIA 5L2KD 3V7AG 1C12A 3C09C 4MXWH 4LLYA 2CRIA 4Y19E 4LK4A 1A1NA 2CRMA 1OARH 2YPKA 3JTTA 3ESVF 5TJWK 5E1AB 3PGCA 2DJ4A 5HI3D 3VXUA 5EIIA 4PJAB 2UY6A 4ZFZA 1U3ZA 1A3LL 4ONHA 4Q9RH 1FFOB 1NAKH 3DUUA 1ZGLA 3MRQB 1OTSC 5C08B 1K6QL 4ZPTA 3QXWA 1KT2B 2ESVB 4MJIB 3NA9L 1PQZA 1V3MA 3BGMA 4O9HL 3T2NH 5LGJB 5I1EL 1WBZB 1ZT1A 1O7VA 3D2UD 43C9A 4N0YL 5GSVA 2EXWD 2X7LA 5ACMA 3WIFA 3GMMA 5DHXB 5EUOA 1A7NH 4PGBB 2F8XC 3UTTD 1ZMYA 5CCKL 1J87A 5F7DB 4OKVB 3F62A 3WIIH 4ZYKA 4M62L 4QGTA 3O3UN 3FFDB 3NACH 3SKOA 1NCWH 2F8OA 3ROLB 5I8OL 2WSKA 2VXVL 2HMIC 2OR9H 1MLCB 2IGFL 4KFZC 2VLJE 2NY0D 3JWOC 2BNRA 3HZMB 4JFHE 5J11C 4HGWB 4Q0XL 5D96B 4NUGL 3HC4L 5I19L 2MWCA 1EZVY 4WWKC 3IDNB 1H5BC 4KTDL 1C7SA 1CICD 2IBZX 4J6RL 4N9GB 5DS8B 4C56E 3BW9A 1TVBA 4PRNA 1SJXA 3S96B 4E5XB 5BV7H 1IAII 4GAGH 1T0MA 3CJJA 4XX1G 5E5MB 4YK4B 4EOWH 1KB5L 4OD1H 2OSLB 5ITFA 3O2DA 4GG8A 1BZ7A 1P9MA 4LSQL 1G7IA 2BNQB 3QFJD 2F19L 4GBXA 4PTTB 5TDPA 2WP3O 1OLZA 3S98A 4NSKA 3MSPA 3FFCB 5KW9L 3WNNA 3BXNB 3KJ4C 4XVJL 3BIKB 3G6JA 1ZVHA 2X4TA 2YSSB 1SQ2N 1AH1A 4FXKA 1FC1A 3SE4A 3V0WL 5DFVC 3T65A 4OZ4A 4JO1L 5D8JL 3HAEG 1ND0A 4G6AD 4C54A 4PJGF 2ZWLT 4D0BA 3LB6C 4O2FB 4RWYH 4WUKH 3QRFM 4EN3A 1NCNA 5LAXB 1BWMA 3Q6FB 3QEHB 3QISA 1OTUC 5T1MA 3UZQA 2GIYA 2GSIA 2EDLA 2GJ6E 2Z31B 2DM7A 1CFQB 1TZIA 3QPQD 4OT1L 2ZCHH 1CZ8L 4YEFA 2G75A 4L8DA 3V4PH 1KIRB 2NY6D 4KQ4H 5T1LD 3VFPB 4OLYH 2NY3C 3TIDB 5FYKE 3T04D 4NZTL 3WUWG 4YPGB 2FATL 1WZ1H 4LF3B 1H9VA 3OJDB 3CFCL 2YXFA 5EBMB 5FYLL 3A6BH 3CDYA 3KYNB 5LG1A 4IRSA 4CMHC 4JKLA 5DZLA 1QLEL 5LWYL 3E6FA 4OZFH 4LPTA 1UJ3A 5DR5L 3PWLA 1RZIB 3ZKSD 3GSRB 3WN5B 1EV2E 2ENYA 4KXZH 3MRDA 1SJHA 1TQCC 1ZLVK 3EUUA 1JUFA 3PWVB 4GLRH 4IM8A 1AXSB 1OAKH 3VWJA 5ACZB 4DZBB 3H9ZA 3QIBC 5AD0B 3VFMB 3GSOB 1JWSB 3GFUA 3HG1B 5FV2A 1AKJB 3SDAD 4MJ4A 4HULB 1CXHA 1E4XL 1JNNH 3QCUL 3U0WL 1A22B 2QLVB 2R56L 1NUNB 2CDGA 1EHLL 4PRAB 1IGYA 3I75A 3GBNH 4RIRB 2KPNA 5J3HC 2JF1A 5KSUB 1G84A 1JHKH 3HUJE 5FO8A 4X6CB 1NAML 1SYVA 3Q6GH 2A0LC 4MJ5A 5KVFL 1YEFL 3EO9L 3PL6B 1EJOH 3MOQA 2OL3H 5INDA 4Z18A 2ED8A 1S7WA 2F74B 4KTYA 5F9OL 5B3NA 3RDTC 4XC3H 4HBCH 1II4E 4HWBL 4PJDE 1IQDB 5SX4H 5EOTB 1NGWB 2A73B 4F2MA 1NBVH 3V6ZB 2FRGP 1FLRH 4NQSB 5IQ9B 3EJYD 3PWPD 3B5HA 4FQXA 5F7KC 3BD4A 4CVXB 3WS6C 4G8EA 4Y4HA 5D7KD 5KSAB 2MQ0A 5GGTL 2O26U 4LSVH 5EORH 1BJ8A 3MA9L 1SMAA 2L7JA 5T3XE 4J3TA 1OGAA 3SE9H 4S1DC 2B5IC 3PABB 1D6EA 3GMOB 1DBAL 3K2UH 5CINL 4V1DB 4XPAH 1PKQB 1NEZG 4M93C 3O6LL 4YAQB 3LKOA 1TETL 4JLRB 5EU4A 1Q9KB 5ACLA 4OGYH 3QIWB 5FO9B 5CSZA 3KJ6L 5HI4C 2PTVA 1T3FA 4HHAB 4JFED 2EIEA 1EHXA 3X3GH 3O9WC 1BD2E 1NMAL 4Y2DB 1D9KD 3EJJX 5D1XC 5D71H 1IC7H 5CJ8A 4MXVF 2K7QA 4KV5F 2IPTH 4MNHA 3BH8B 1DJSA 4KPHL 3MLXH 2NZIA 3FTGB 3WSQH 1UG9A 1T83A 3SJVB 4G9FB 2C3WA 4K71B 1M7XA 2VAJA 3GSVB 5FUCC 1BVKA 2ZUQC 3GSWB 2C26A 2BRRL 3KPRD 5B8CA 4ONOA 1KGCD 3CMOH 1MUJB 1FJ1B 4HWZA 3WV0A 1LO0L 3S4SB 5KJRL 4L9DA 5D93B 2NZ9D 4A6YL 5JMOC 3RWIA 3VA6A 4YDVA 5K59E 5HPOA 3INUH 2FIRT 3O3DB 1G0YR 5DJ8A 5SX5K 3MZTA 5DHVB 2Q8BH 2VDQH 3VI3E 5TDOA 2CLRA 3GMNB 1PY4A 2VDOH 2EXYD 1PZ5A 2GITB 3VFNB 3NZ8A 5C92A 4HLJA 2OQJA 5IW6B 3RKDD 4NO3B 1CVRA 4PJIA 4YXKL 4JG0H 1JPFB 3O2VH 5JR1H 2R23A 4GG6E 4G6ML 1AGBA 5DT1H 3NCYP 5F1SA 2Z35B 3LKPA 4YHMH 1MOEA 2IAMA 3RZCD 1F4YH 1S3KH 3PWNB 2W9EH 3NCJH 5L6YL 1DLFL 4JFDD 5C71A 4MCZA 1EEZB 1KJVA 3GSUB 1U8MA 2DQFA 3PNWB 4IIQC 2BVQA 5E4EC 1MREL 1BZQK 4YIQA 2V6HA 3WNPA 4GRLD 1MI5E 4MA1B 4NQCE 5ICZB 4Q74A 5EU5B 2R0ZL 5IMKB 4PP1D 4XPTL 1VEPA 5GPRA 4PJHF 3GHBL 1QBLH 3RY6A 1IGTA 4LARL 1NFDF 1V7NL 2DRUA 3PDOA 1FVEA 1B4JH 4JY5H 4WUUA 5F7WC 1DQDH 2X42A 3JTSB 4G6FB 4IOIB 1NL0L 1RJYB 3KPPB 1ACZA 1NDGA 4XAKE 4X9BA 4HH9B 1ZA6A 5DJ2A 2F53B 4ZQKA 1F5WA 2VZ3A 5E8PA 3SDXB 1WBXB 4P49A 5HHOA 5HJ3B 2YEZA 2G2RA 1TZGH 5DEFB 3SKJH 3W9DA 4AH2B 4DGIH 3TVMD 5F9JB 5IMLA 5D7JB 2JB5H 3I3EA 4PB0L 4U6VL 3MLZH 1DFBH 1FP5A 4OLWH 5E7BA 1YEIL 2YZ8A 5DMKB 1Z9SA 3DRTA 3GI8H 5AZ2L 4BFIA 1Z5LA 2VH5L 2GAZB 3RTQC 4OUOA 1H8OA 2QV2A 1X5FA 2DBJA 4X9FA 4HF5H 1XCTA 1CDJA 5KS9F 5IHBA 3P4LA 4MSWA 4NCDA 4F7EB 3QUXB 3IF1B 1CT8A 1CGWA 1FNFA 3MR9B 1S7VB 4QOKB 1MCJA 5I1JH 1S7XB 4N8PA 4DUXA 5J12B 4AT6B 3NVQA 5E6IC 4R4FH 2GSGB 1U92B 4OV5B 4I9WD 3ZE2F 5GS1C 3QAZC 2ADGB 5T1DL 5E8EB 1PGRB 1U8JA 4QXUH 4UQ2B 4WO4B 4K3JL 1MY7A 4QTHB 3K8LA 4IRJC 1MCPH 2HG5B 4KJPD 2QTEA 4Z7QF 5CP3A 5E1AA 4JO3H 1MIML 2W91A 1QOKA 1FFOA 1ERNA 5IROC 4W70A 3H9SD 3S3SA 1TJGH 2ARJB 3K8KA 5HHQB 1E6OL 5C08A 2HTKC 4R4BB 5IVZB 3S5LB 4H8WL 1KT2A 1YJDH 3BSZL 2ESVA 1I9JL 4M3KB 4MJIA 3M1BB 1QBMH 4JM2B 5LGJA 2NXZB 4G3YH 3GIZH 1N59B 3U30C 3A6CL 1WBZA 4DKEL 2G5RA 2YD9A 5DC9B 3QDMA 4U1JB 2I26N 1WSST 4PGBA 2Y5EA 4KWUA 1XCQB 4M8VA 3BP6B 4OCXH 5F7DA 2DIBA 4OKVA 2CK0L 4XNMB 3NA4A 4PS4L 4MNQB 5IW1B 2VL4A 4KGLA 5HGHB 5FM5O 3KLSA 3ROLA 2EC9U 3BQUB 4NOFA 4JPWH 1HH6A 1NBZB 1MLCA 2IFFL 4NQUA 1ACYH 1NFKA 3HZMA 3VFVA 1F4AA 3ILQC 4OZGA 2R4RH 3MBXL 4HGWA 1JNHA 5T1KD 3MLWL 1IGJA 5E6YA 4HSQA 5I73C 2E7HA 3UBXG 3IDNA 3G08A 3JBG7 1CL7I 5DS8A 4HXAL 3S96A 1UKTA 4PRHB 2Y6SD 4M00A 5HGBB 4DAGH 4E5XA 1NBQA 3BH9A 1LGVA 3L3DA 3CH8A 2QSCL 4NN6B 4N0FA 4XWOC 1JV5B 4O58H 2OSLA 3BGFC 1DE4B 5C0BE 3QWRA 5F7MC 1ZLSL 2WP3T 5IJKC 4HUXB 2BP3A 1Y18A 4PRIE 1EEYB 3MCG1 1G7MB 3IS1X 1F02I 1CK0L 2BNQA 2W92A 4PTTA 1U8NB 2DI7A 5KBNC 4EUPB 4PY8I 3FFCA 3BXNA 1FFNA 5DMYA 3BIKA 3S36X 1J0IA 2YSSA 2PYFB 3GB7B 4MD4B 2Q76A 2HT2C 1QSZA 5IOPA 2UWEA 4V2BA 1R3HA 1RUML 1B3JA 5TF1H 4TUKH 4OZIB 3MLTB 2XPGA 4Z8FH 1LWRA 1RK1B 3TNMA 5FB8B 5AWNH 4K55A 5LAXA 1FNLA 2XZCL 4CVUA 3GNMH 3ZTJG 1FN4B 2CD0A 4OD3H 3ALWA 1CDUA 2VXQL 3X3FH 1TJHL 2EO1A 1DQMH 4PIRF 4LRIC 4LEOB 1KIRA 3KPLB 4OM1L 5B38A 3VFPA 3TIDA 1UH2A 1Q0XH 1OTTD 1T7ZA 3AU1B 3HE6C 3W11C 5D2NE 4YPGA 4LF3A 4S1SH 1X5HA 3OJDA 4Q58C 1TJIH 2V5SA 2Q8AL 3KYNA 3V4VL 3VXME 1XGTA 1V7ML 4NQDD 3THML 2AK4B 1SY6H 4WFFE 3LD8C 4YHZL 5CZXD 3QSKB 2C3VA 4LHUD 5BOPA 3GSRA 3RRQA 3VD3A 3WN5A 2AEWA 3PWVA 1Y0LB 3WIHL 1Q72L 1MVUA 4MA3B 5ACZA 3GSNH 5AD0A 3MBEA 4DTGL 5LKNA 5J7CC 5L9DL 1JWSA 1IQWL 5IV2B 3HG1A 1J0KA 1AKJA 2Z92B 2A6JB 5K9OB 4J3WA 1M7DB 4PRAA 1A6VH 5LQBH 5DI8A 3T8XB 3BE1H 4N90D 1U8LA 5KSUA 3IGAB 4X7DC 2PCPB 2FLBT 4JPKL 2RJMA 5C09A 4NJAL 3R8BB 2H2SD 5F7NC 3I9GL 2P8MB 3CLFL 5FCUH 1UWXH 5CP7A 3DSFL 2F74A 1QD0A 4U1KB 5DK3A 1CFNB 2Z8SA 5GJSH 4YLQT 1WIUA 3H3PH 3LDBC 5BMFL 1EFXB 4PJ5A 1IQDA 5JHLL 2ZG3A 5EOTA 1F90L 1NGWA 1NFIB 3V6ZA 5IR1A 4NQSA 3RY4A 1HH9B 4Q6IC 4D9LH 3QUYD 2O5YH 1XF1A 4CVXA 2LAAA 3TN0B 1DBBL 2BJML 1G7QB 4ONGH 4Z7NF 5HVHC 4H8WC 1H8SA 1PAMA 1AHWC 1PG7H 2Q1EA 4KVNH 1CS6A 5F88B 1ZTXL 1I8MB 3LH2L 3ZMRA 3MLSH 3E1F1 3PABA 3GMOA 3IU4H 1NSNL 4MVBD 3BAEL 3BZFA 4V1DA 1UYWH 1PKQA 4KU1A 1J1PL 5GGQL 4IBLT 2D7TL 4JLRA 4CKVX 5DC0A 3AXLB 3WFDH 4XT1C 1U3HC 2E6QA 1VFMA 5K9QG 3QIWA 1DVFD 3I85A 1FO0B 2NY1C 3RIAK 1GPOH 5L8JB 5HY9B 4FQLH 3SHSA 5EOCH 1DBJL 1LO3L 2RCSL 4Z7UB 5HBBA 4Y2DA 1JRHH 1FAIL 2I24N 5ALBH 5L2KE 4FP8L 4MJ2A 2P5EB 4JDTH 1D5MB 3S36H 3BH8A 1UACL 4GH7B 3FTGA 3SJVA 2HKHH 4TTDD 5AYQA 2OTPA 4LPVA 4APQD 1CQYA 1IGMH 3RNQB 4FNLL 2VDPH 5HI5C 4KKAD 5BRZE 3B9KD 2EDQA 4KHTH 1H3GA 5I1GL 2FLRT 3T2OA 1MUJA 1FJ1A 3RWFB 1YMMD 2PO6D 3CLEL 2R8SH 1ED3A 3S4SA 5A1AA 2OR7A 4GXVL 1P4BH 4OFYD 4PRPB 3O3DA 3OAUH 5IM7B 5DHVA 4UNTA 5EOCJ 1D5ZB 3GMNA 1BFVL 1WAAE 1BIIB 4CN4A 3I02B 4LCWB 1K9TA 1A21A 3P0VH 1QYGL 4NO3A 3Q0HA 5I74B 3AREC 1JPFA 3D6GA 1DUZA 3WFBH 1QRNB 5ID1B 4Y19A 1D5BB 2OLDA 2Z35A 5JO5B 2JCCF 3KAAA 3GJFK 5IHUH 2VLRB 3PWNA 4OF7A 5HHMD 5A3ID 3E3QC 5FDWA 2CSPA 4JPVH 1EEZA 3GSUA 1ZAGA 4P5TD 3PNWA 5JXEC 5L8KB 4HAFA 5J89A 2VKWA 5ICZA 3HLAA 3QZWG 4EI5C 3IJHB 2D03L 3GRWL 4XH2B 2EH8L 4NZRL 5IMKA 3ARGA 3SE8L 5DQ9B 4JKPH 3Q3GB 2B2XH 5HYIA 1T22A 1I3GL 5BW7C 4H1LB 3ARPA 1BX2A 1P84J 1OAZH 5DRXB 1E27B 1IM9D 1MCCA 1WVZA 3T0BA 4U4BA 4HC1A 4PG9B 4HH9A 4P5KA 4Z0XB 3QR2A 5EN2B 3WXVL 3U7WL 2F53A 5DQDL 2YD7A 3PF2A 2IFGA 4G42A 4FRWA 3SDXA 4OCLC 3ZHKA 1WBXA 4NCC1 3O6MH 5HJ3A 5F89B 1JGDA 1A3RL 3ULUC 5E70A 1CE1H 2AEIT 5F9JA 5D1ZC 5D7JA 2DJUA 1J8HE 1XZ0B 2FIKB 3EKCA 3O0RH 4M5ZH 1NGZB 4HK0B 1BFOB 1KIUA 1HXMB 1A9BA 2GTZB 3DYMA 5LGKA 3MLVL 2V17L 3NN8A 4G6JH 3UZVB 1GC1H 5C0CD 1QACA 3LKSA 3TO4B 4JZJC 2GAZA 3L5XH 4Z9KB 3O8XA 4WCYL 2QSQA 3CCHA 4XMPL 3GSQB 5J4MA 3IXTA 1I3UA 3QH3B 3MUGB 1XIWA 3C2SA 1MWAB 2YA2A 4F7EA 3QUXA 3KLDA 3MR9A 4QOKA 1N7ML 1VACB 2O5ZH 3MV01 3CVHA 4QRRB 5DEZA 4JFPB 1S9YB 5CJQH 2GSGA 3F58L 1U92A 4Y5XC 4M8QA 2ADGA 3JWDH 5J9PB 2J4WH 1W72H 2XACC 4OFKA 2AJVL 4IDJH 4Z7WB 2BC4B 4F7CB 4WO4A 4H0HB 5D1QD 4C83A 1RZ7L 1H3XA 3OGCB 2HG5A 2GCYA 4FQIH 3T0EB 1N5YL 1IAKB 5ESVB 4DKFL 5I75B 4NP4H 3RU8L 3MJ9L 1BEYH 1W8NA 3S35X 4QRSB 3EJZC 3FB8A 3X12B 4UT6L 2ARJA 5HHQA 4M5YH 3S5LA 4R4BA 5IVZA 5C0FA 1F45A 4XHJC 3M1BA 3G04B 1DQLL 4G7YH 3QQ9D 4JM2A 3CU7A 1IMHC 1N59A 1UH3A 5B39A 4M6AA 1ZHNA 5TE7H 4U1JA 4R26H 3ALXA 4M7LH 5EZLA 3T3PF 4H0GA 4X80H 5JIIA 1NMCC 1XCQA 5MEQA 3BP6A 4MYWB 5GZNC 1LD9A 4K3EL 3A67H 4XNMA 4NO5B 4MNQA 5IW1A 5HGHA 1NCDH 5IK3B 5IFAH 5IWLA 3HMXL 1H3TA 3BQUA 1VGKA 2CUIA 1I1AC 4G8GD 5DFWH 1F3JA 3ZKMD 4RRPA 3NTCH 1D3CA 3LS4H 4JGMA 3ZHLA 3K4DA 3D3VB 3ORJA 5BVPH 5KSBE 1BZ9B 3TZVD 5MEND 3QEQE 1IC4H 4W6WB 5ID0B 2Z0BA 4UDTA 5CEYB 3O45B 4DN4L 1S78C 2WIIA 5SWSD 4R2GD 1P5VA 4RAUB 4LGRB 1CLZL 3REVA 2JB6B 1RSFA 1Q9OB 1F11A 4FG6C 3D0VB 1LO4L 1XF5A 4EVNB 4JPIB 3UO1H 3FZUC 2ZUXA 1EEYA 4L1DA 1G7MA 2KQNA 1NJ9A 4M3JA 2E8ZA 1U8NA 3TPUB 2NY4C 2AV1A 4CW1A 4EUPA 4W6YB 1Y6MR 2H32H 4ZUSB 4HZLA 5KG9B 5F7HA 4KDWA 1IC5H 3MRLA 5DYOB 4P23B 2PYFA 4MD4A 5CD5D 4CMMB 3WNLA 3O6KH 1N6QL 4PJDA 5D9SB 1CDCA 3AS0A 4OZIA 3MLTA 3HE7B 3M8OL 1RK1A 1CD9B 1RUPL 2SEBB 5FB8A 5DWUL 5FKAA 4NQTA 5JMRA 3DMMC 1FN4A 5E8DL 1IGFH 1JZ5A 3VFRB 3TJHC 4CVZB 1UM4L 4LVEA 2CMRH 1RU9H 5HHVL 1B4RA 5IBTH 3V5KB 3JVGC 5E00A 2ORBL 1OL0A 3CXDH 4KROC 3KPLA 1MCNA 4KVCL 2YS4A 3KXFD 4DOHB 1X5YA 4JN1H 1HZHL 3K7UA 3QI9B 3EDEA 4JVUA 3KPRE 1KGCE 4KJWC 2GEEA 1OP3H 3EHBD 3C09B 3EYQD 5FGCB 5C0ND 2J8HA 5IMOB 2AK4A 3WKML 3I6LE 4LVOC 1JE6A 3D85B 3IKCA 5JW5B 4U3XA 1OARL 4HKXA 3MCKB 5IFHH 4FQCH 1Y0LA 4O02H 4LKXB 1P2CB 5EZOH 5C8JA 5ISZD 2D7QA 2EE6A 3O6FD 3B6SB 1FE8H 5E5UB 4C58B 4LPXA 2A6IA 3S35H 1A6TB 2PF6A 4JFDE 3T8XA 1OHQA 4P2YA 3MXVH 5FK9A 5FOJA 4WHYG 1WZLA 4PJFF 2J6EL 3IGAA 2PCPA 1F6AB 2Y9RT 4PJ8D 5GRWA 5SWZD 3MQIA 4K3GA 5DMJB 4NNYA 2P8MA 3NACL 2A38A 3RL2B 2DLFL 2F54D 3KDMB 4ZXBA 5DMGC 1K8IB 2NX5D 3GKWL 4U1KA 4Z78A 5J11B 4S1QH 5GIRA 4C55A 3GMRB 1UA6H 5INCB 3MGAA 2Q86A 1ZLUH 3CDGB 1EFXA 5I1KL 4WWKB 1H5BB 2BVPB 1INEH 1NFIA 3L5HA 5C0RL 3CSYB 5IESL 2M1KA 5BVJB 1ADQA 1OAQH 1S9WB 3VFOB 1HH9A 4JQXC 1EO7A 4HJ0D 3UYPA 3ZL4H 3BN9D 1MH5A 1FBIL 3TN0A 3HC0B 2CXGA 5DUMH 4QHMB 4MMXC 3MZGB 1UEMA 2CGRL 3VG0L 4QXGL 3PWJA 3ILPA 1RI8A 3KPSB 3K0WA 5IVXE 1KCVL 3MRFB 3W0WE 1MFDL 1Q9WB 4I0PC 3SY0B 4UOJA 4B5EA 1SEBB 3KJ4B 3AXLA 5HDBE 5KVDH 2J7LA 2R1WB 3IT8D 3MV8B 4PJEF 5GS2H 2EXWC 4UU9B 3PG2A 4BZ1L 3TF7C 1FO0A 4XP6L 4Y5VC 3DVIA 4HV8B 1T5XA 5D6CB 1UZ6F 4PB9H 4XAWH 2IH3B 4BSVA 1J5OH 4Z7UA 5T5FH 1QR4A 4YDIL 4I9WE 1RUAH 4FQHB 4PBXA 4HPYL 2FO1A 2P5EA 1D5MA 4N5ED 4BQBA 5F1KC 5C9KA 2NY0C 1UC6A 4PJIF 3BESR 5IB3B 2IPUG 3VMPA 3QULB 5AAMA 3OF6D 3RNQA 3QUZD 1LHZA 2NY3B 4M43L 5TQ2L 4PGDB 3N1MC 3N85L 1CICC 2KDGA 4XNQA 1A7RL 3O2DH 4K07A 2UYLB 4G8FA 1JGEB 2BCKB 1WZ1L 4CMHB 4JHAL 4JDZB 4PRPA 4TUOB 1VENA 5K9JH 5IM7A 2DQCL 1JPGB 3BP7B 5DD5L 1D5ZA 3RGVD 1UCBL 5TE6L 5IMMA 3H0TB 4LCWA 1TQCB 1KYOJ 1KG0B 1KLFA 3I2CH 3SDDB 1QRNA 3ULVF 5ID1A 3QIBB 1D5BA 3ARSA 4NJ9L 3QRGL 2J5LC 3FJTA 3JZ7A 1VDGA 2VLRA 4YDLC 1GOFA 1V3KA 1U8IB 1VSCA 3RAJH 3EYUH 3PHOB 4HK3J 3DXAE 4G6AC 1JNNL 4LASL 4OLZL 4S0TD 4IJ3B 4NZJA 3HAEB 3IJHA 4TSAL 4XH2A 4R4ND 5DQ9A 4ELMB 2WWKO 3Q3GA 3MV9E 3QEGH 4GRWB 4BJLA 3S3PA 4HFUH 3WFHB 5FM5M 5HGAB 1F97A 4P9HH 3IDXH 5HDLA 1E27A 2VNCA 2VXUH 1MPAL 2NY6C 2M2DA 3RDTB 3K80A 4H88H 1H3WM 2C1PB 1KIPB 4PG9A 4Z0XA 4Y4KA 5EN2A 3H3BC 2YC1B 3OKEB 3IFNL 3VXUD 1K5NB 4KDTC 5D6DA 2OZ4L 4YFLI 1EGJA 3R06B 2IANB 3WJLA 1NBVL 3T4YA 5GGRB 2J88L 5I1HH 1L6ZA 4M61A 1LEGB 3V0VB 5FA4B 5FYJU 1NGZA 4HK0A 1HXMA 4LU5H 5EORL 2FJGB 2HA1A 2B5IB 2ERJC 2QL1A 1R3LB 3MLPA 5D5MB 4MQ7B 4N5UA 2WMPA 2DLIA 3TO4A 4M93B 3F7VB 4YWGH 5C2UB 1NGQH 3K2UL 3CC5A 1GGCH 5GS2D 1NCAH 3GSQA 5E56A 3TM6A 6FABH 3SGDI 3QH3A 4J1UA 5MERB 4JRYB 2Y7QB 1MWAA 1EHAA 5C0BA 3NIGF 5EC1B 5KAQG 3OKNA 5GRXG 4PUBH 3FRUB 5DMIL 3O9WB 2BNRD 1VKXA 4JFPA 5CGTA 2NY2D 1S9YA 4HWNA 4OFPA 2XOTA 2AEPH 3QXVA 5D1XB 4X5XA 1Q9LB 4YHNB 2BC4A 1KEMH 4ENED 2FB4H 2X4PB 3U82B 4LHQB 3OGCA 5D71L 4AEIL 3ZO0A 4NQDE 1IAKA 2E7CA 5ESVA 2ZUQB 1NCTA 2C3XA 3I6KB 4GQ9H 3N50A 3TEUA 4C59B 1IJ9A 3MGOB 1KB5B 5BV7C 1C5BH 2VERN 3G04A 4G5ZH 4OZGF 2XWJA 5HSFA 2ZP0T 3UAJD 4JO2L 3FRPA 4DVRL 1G6RB 1HYSC 3AGVA 2DBLH 1CLYL 1WLHA 4MCYB 4I3SL 2OMBA 2CH8A 1BLNB 3Q48A 4Y8AA 4N90E 5IHLB 4MHHG 4OUUB 5FGRA 1P69B 4RGND 3FB6A 4HQQL 3VXMA 1U8QB 3STZB 4EN3D 1M4KA 4I2XB 1CG9A 4I4WA 1NEZB 2JJTA 5DJ6B 1F00I 4PJCF 5EWIL 4GS7B 3ZYOA 1Y6NR 3BZ4B 5IQ7L 2VDRH 3D3VA 1NC4B 2W9EL 3P3YA 1BZ9A 4IIQB 4KK8C 4M1DH 5E4EB 3UTZA 3H7BB 5DK2B 1D9KC 3OG6B 3PP4H 4Q9QL 3QCTL 1YYML 2UWEF 4OF6A 2VZTA 3LKNB 2E9JA 3QDJE 6CGTA 2G60H 4RAUA 2R2BB 1QVOA 2K3TA 3PIQB 4MAUL 3WXWH 4WW2A 1NMBH 2EC9T 1NDMA 1BVLB 3DGGB 4N9OB 1TPXB 1DQDL 3DUSB 5BOZG 1ZLVH 2VTFA 4L5FH 2Y4SA 1KUMA 2XN9D 4J4PA 1HNFA 1VA9A 3TPUA 4A2LA 1A7QL 3QBTB 1YEKH 3SGKA 2BSRB 2HYMA 4UINH 4P4RB 1KBGH 2CDEA 3VXPB 3QHZL 1MFAH 2XZAL 2CIKB 4QO1A 4ZUSA 3FQXB 2WM0A 2WUBL 3MUY1 4MD0B 5KG9A 3EOYG 5DYOA 4P23A 3VWJD 2V2TA 3SQOL 1HEZB 4CMMA 5CEZL 2EXYC 2IH1A 3T3ME 3RKDC 3MLZL 4OLWL 4U33A 2E3VA 3RVWD 3RTQB 4H26B 3VD9A 3RVUD 4OFIA 5JLZB 5D7IE 3VFRA 4CVZA 2KZWA 4ESKA 3TO2A 3RZCC 3TYGH 3DSNA 3V5KA 1Z0MA 2QQNH 4WI2A 1HKLL 4X7TB 4GRLC 1VEMA 1I4FA 5E6IB 5JNYB 5ETUA 4Y8DC 4I3GA 4JFQB 1J0JA 1T4KB 5GGSB 2UZIH 5I1JL 5GS1B 3QAZB 4PP1C 3ULVH 3HR5A 1X6LA 5IGXL 1YEEL 4XCYA 4IRJB 4F7MB 2GYSA 4M48H 4QXUL 3V7MA 5EO1B 3D85A 4FQXD 1KXTB 4ZO8A 5JW5A 2FJFB 1JMXA 1C5CH 1Z2KA 4Y4HD 3MCKA 4C57C 5A43C 3QNXA 1MCRA 2VLMD 3EDFA 2GUOB 5E2UL 3MRGB 4LKXA 1P2CA 5AEAA 1C1EH 3HCVB 1OGAD 4Y1AB 1TJGL 1OB1B 5JXAL 3B6SA 1ZXQA 1AGDA 2WBJA 1L9MA 1ZHLA 3EO0A 3TVMC 4NRZB 4XMLH 3QDGB 2J8UB 2FX7H 5HHME 3MXWH 5BRZA 4U1LB 3LSOB 2B7DT 2ED9A 4NYLB 4WEBL 4R96B 1F6AA 3OQ3B 5BZWB 4U1GC 4UUJA 2HFEB 3Q2CA 4GW1B 1NUGA 3HI5L 5TPWH 3RL2A 3KWWB 2DQTH 3I50L 4YQXL 4Z6AT 1LVEA 3KDMA 4MWFB 4LQFL 1K8IA 5D2LF 2XIDA 5JUEL 3SDYL 3KLHD 2NXYD 1MFBH 5E03A 4MZ2A 2FCBA 3UYRL 1TTFA 1X3DA 4JR9H 4OZHE 4PGEB 4Z7OF 4OQTA 4NZUH 4FQ1L 3RPIB 2NCMA 3FN0H 1B0GB 1H5BA 2BVPA 2PXYB 3CSYA 5CP3H 5BVJA 3F6IA 2E27L 3C6LC 2X9XA 1WTLA 4I1NB 1BVZA 2OS7A 3RWHB 2HTLD 4DAGL 2NR6D 3FQUA 4KJPC 4WI7A 5E9DB 1I7TA 3BGFB 4P59L 5GRVK 1JN6A 3SDCA 3G5ZA 4O58L 1V05A 3MV7E 1DBMH 3HR6A 1DANU 3KYKL 3KPSA 3BMWA 1KFAH 1QLRA 1KTLB 3SY0A 1WCQA 2AGJL 1SEBA 4KK9D 4KRPD 3RA7L 3MV8A 2C7UB 4S2SA 4P2QE 3TGXA 4F15C 1KSRA 4UU9A 1X5ZA 1SVZA 1U41A 2IJ0C 2AK1H 5DZOA 3SOBH 4HV8A 2IAMD 5D6CA 5DFTA 3IJSB 3VFWA 1LO2H 1NC2B 4K23H 5LXGH 3KNBA 1F4WL 4O5LH 4Z8FL 4LPWA 5C2BL 4FQHA 3QUKB 4LAQH 3PXHA 3T2PA 3L1OL 3GNML 5AYUL 4OD3L 3IJYB 2E7BA 2YN5A 3BMVA 1J8HA 3OZ9H 2QHRH 4UT7H 4FABH 4TVSa 5IB3A 3QULA 5L8LB 3R1GL 1I9EA 4HIXL 2JKXA 3P9WB 1EO8L 4NGHL 1TVDA 3ABZA 3RY5A 4WUUD 5BS0E 2B1AL 4JRXB 4PGDA 5IJVB 3ULVD 3ARDD 1LEKB 3P4NB 5JW3L 3UBXB 3ZDZE 4K2UH 2Y6SC 2UYLA 5EU6E 4W6XB 1C16B 1JGEA 1HE7A 3MNVB 3LQMA 4JDZA 4YBQD 4LHUG 3LCYA 2FX9H 5HHOD 3LD8B 3BP7A 4YFEA 4OTXL 5IG7B 2Y07L 1F58H 2D7MA 2IG2H 4NN5C 4HS6B 1U58B 2A74B 4GO6B 1G9NL 2CR6A 4GLRI 1FGVL 3E6HB 5DJXB 4TQEH 3SDDA 3FMGH 3LRSA 5D7LB 4YHYC 2I07B 4X98B 8FABB 1WFNA 4NN7B 2LE9A 4LCUB 1QKZH 4B50A 5E94A 3GSNL 2D0HA 2VLKD 1XF2A 2A1WH 4MZ3A 1NUFA 3TBTB 3K74B 2WWKT 1DLHA 1S7UA 3H7LA 4H25B 1UM6H 3V6BR 1YEGH 4UB0H 3HAEA 1RZFH 1JGUH 2W9DL 1EEQA 3D0LB 2GK2A 1GGTA 4ELMA 3QXDB 1NKOA 5B22A 4AEHH 3WFHA 2APFA 2DL2A 3B83A 5GGVY 5I1CL 5HGAA 4XP1L 5I0ZA 5GS0L 3RDTA 2FJHB 3LDBB 4JVWA 2C1PA 4LLQB 1OTTC 1KXQE 3NH7H 2B8OT 1CR9L 1FNGB 2YC1A 3OKEA 5IHZB 1UJTA 2DLGA 1K5NA 2M26A 3EZJB 4YX2H 1G7PA 3WUWA 4Q6IB 1KB9K 2IANA 4CUCA 4F33B 3TV3H 1JGVL 1A0QL 4I3RH 3V0VA 2MMXA 5FA4A 4MJID 1KTRL 5CZXC 5HVHB 1AC6A 1AHWB 5T5NF 5DRZB 1UM5H 2FJGA 3RHWK 2I25N 3MPCA 4PR5B 4ZOEA 3QEQA 2OK0L 1S7RB 1R3LA 3B5GA 1PG7L 1QG3A 1C08A 1YJDC 3QDMD 5D5MA 4MQ7A 4LOUD 2FECL 3HFML 2Y36H 2CJUH 3EO1B 3PGFH 1H3PL 2ADFL 1BBDH 1JF6A 1MLBB 1MCOH 1N5AB 3R4DA 3P11H 3V6OC 1U3HB 1SEQL 3IXAB 4JRYA 2Y7QA 5MERA 3P0YH 5EC1A 3MO1B 4HXBL 1F13A 2NY1B 4U1MB 4ZD3H 2C1OB 1ZS8B 3FRUA 5CILH 4UT9H 3KXFE 2A6KB 2D9CA 3O9WA 3TFKC 1QFWL 3CXHK 1TFHA 4FXGB 3NBNA 5DURB 2H2SC 4WFHD 1F4XL 1S7TB 1WEJL 2DQUH 1MFEL 1BAFL 2YRZA 5E08L 2CLZB 4EQ3A 2HKHL 3ZTNL 1CGSL 4KC3B 1SVCP 3QWRD 4JFYB 2EYRB 3H9HA 4XNXL 3QUYC 5ISZE 2X40A 4M03A 2BFVH 4OIIL 5C0DB 1ORSB 1FL3B 4K8RH 4NFBA 2BNQD 2JIXB 1O5DT 2P5WB 3VRIB 1TQBC 2HFFA 2H2PD 1T2QL 2OP4L 4MCYA 3ARFA 4DUWA 3OAUL 2R4SL 4M6ML 5F97E 4TRPH 1W2KT 4UDUA 1BLNA 4X4XA 3LV3A 4MNGB 3VMNA 5GGVH 1TZHA 4RFEA 3AREB 1QO3B 2DLEA 4OUUA 4MVBC 2COQA 4LLWB 1AY1H 1U8QA 1N8ZB 3STZA 1MRDL 4I2XA 2WNGA 1NEZA 3WFBL 3WCYA 4L3EB 5F6IC 1CU4L 2OJZH 3O4LB 4HT1L 1PSKH 3BZ4A 4YGVA 2AXGB 1REIA 3OBAA 3HTLX 3H7BA 3LHPH 4EI5B 4JPVL 4X6DE 4XPBL 4X7CC 3BUYB 2JJSC 3OAYK 3ZE1E 2E5EA 4LSRL 4PJDF 1FZJB 2XQYG 3NIDE 3QWOB 2VYRE 2HT3D 3KR3L 2B2XL 4TTDC 3PIQA 4APQC 4X4ME 1BVLA 1YPZB 2NY7L 2XRAL 5H8DA 3DGGA 1OAZL 1AC0A 2BSED 3PP3K 1CE6B 1SBSL 4R97C 4U1HA 2PO6C 5DHVH 1DP0A 2XWBB 2VSDA 5EZIH 3VXPA 2BSRA 4OGAD 3BUTA 1EVUA 1CBVH 5T3ZH 2CIKA 4MD0A 4PY8J 3O6ML 3DURB 5D1ZB 1MHEB 2PYEE 1HEZA 3MBED 3MRIB 4NFDA 3HG1D 1XGPB 3ARBC 1AKJD 1HQRB 1FZMA 1W0YT 5LBSH 3VXSB 3PHSA 3LZFL 1FORH 4JZJB 3MUZ1 4H26A 3RTQA 4QT5B 5JLZA 1YN7B 5C09D 3JV0A 4NQXB 4NC2B 1JHLL 2AXHA 5A3IC 3LN5B 1IKFH 5DO2D 1NAMA 4UAOC 5EH1A 3UPAA 3CDFA 4P2RB 4NM4L 1AI1H 4DKDC 2XY1A 2DMCA 1CIUA 4P5TC 4M7JH 4ZFOL 3HNTH 5KVEL 5L2JB 5E6IA 3MLRL 4U6HB 4IRZH 2XTJE 4JFQA 2D0GA 1T4KA 5GGSA 5IVXA 3SPVA 3W0WA 3QZWB 2VISB 1ZT7A 3UEZA 4WI6A 4PJ5D 4F7PB 4HC1H 3MFGB 2DQIH 2JCCE 3DVNB 4HWBA 4XXCA 2FSEB 1VFAB 4F7MA 1Z3GH 2QQKL 1KJ2L 5DVMA 2VR5A 5EO1A 4QKXB 1IEAA 1ONQA 1J1XH 2FJFA 2VE6B 4Z77A 2R9HD 5DUBB 3LEYH 3SCMA 4ODXB 5IROA 3FO9A 4OCYL 4XCNA 3TT3H 5K59F 3BZDA 3MRNB 2GUOA 2ZPKL 5GGTA 2AQ1A 5CEXB 3VI3F 3HCVA 1B0RB 1UQSB 1ZHKB 4Y1AA 3TIEB 4M5YL 4K8RD 4X0KB 4GT7A 3U4BL 2CKBB 4V1DD 1PZUB 1LNUA 1S8DB 3QDGA 2R0LL 7CGTA 3JV5A 3B2UD 4ODHH 4YHPA 3ELAT 3F7RA 1TENA 2W0FB 1YNKH 3QIWD 4R26L 3LS5H 4NYLA 4R96A 3G5YB 2VZOA 3CUPB 1RURL 5DZNA 1I8IB 2I5YH 2ICWB 3TCLB 3P40A 3DO7B 3EFFA 2AQ2A 3KWWA 1NCBH 3CVHH 4XZUB 4XP4L 1K85A 4MWFA 1CDBA 3ZHDA 1T04B 2DJSA 5ALCH 4N8CL 4F58L 2R0WH 2LQRA 4X6EA 4XPFL 4JQIL 3RPIA 3SJVD 3ULSB 5I1IL 5H37H 1B0GA 4XXDA 2PXYA 1LQSR 1TMCB 1AQKH 4NUJB 3CK0L 4JAMB 1IC4L 2DICA 2BOBB 4NKQB 5ADPL 4QGYA 3RWHA 5D1QC 4ZFGH 1T20A 3P77B 3W2DL 4KKCD 5E9DA 4U1NB 4FZ8L 3E2HC 3DXAA 4LRNL 4PJXE 2BY0A 1OP5H 2WINB 5IJKA 2DTMH 1DBKH 4A6YA 2B0SL 2FYYB 3N9GL 3U1SL 1RV6X 5I8EB 5JORB 3VXTA 3HHRB 2NY4B 3MV9A 5EUOE 5T3ZD 5K33A 3CFIC 2VMFA 4LHJB 3QQ9C 5FYKH 4E42B 2A77L 3BVNA 1A7PH 4JFXB 2C7UA 4ERSH 1E28B 4Y19D 1F6LL 1QSFB 1RZ8B 5C0GA 2VDMH 4OGXH 3EOTH 2CR3A 3IJSA 1NC2A 1RMFL 1GIGH 3FAXA 2BNRE 3C2AL 3PHQA 2Y5TB 3D69B 2FO4B 3ARXA 4JB9L 4AIOA 3LKQB 3DMMB 3P30H 5I17B 1JNJA 3IDMB 3ZKMC 1GGYA 1BF2A 3ARGD 3IJYA 4LRIA 4KROB 5FUOL 3NPSB 2AXFA 3VXNB 1S5HA 3WFCH 1K4CA 1XGQB 5IJVA 5EBWB 4G6FD 1LEKA 3P4NA 3UBXA 2N7AA 2ZSWB 3MNVA 3KGRA 4NQEB 2HAZA 4R2GC 4BZ2L 5AG8A 4ZFFB 4LKCB 4O2CB 4RMUA 5FYJL 4NHCH 5IG7A 4EUPH 2Z9TA 1U58A 4JFHD 2A74A 4R90L 3G6JE 4TSCH 5D7JD 3UDWC 4ZOCA 1ZGLP 4XNZC 3E6HA 4G6KL 4RA0C 5HDQH 3D5OF 5CZVL 1BHGA 1UH4A 4O02L 4TOYH 2AJZA 8FABA 4LCUA 3O3AA 4MA8H 1I7RB 1CFVL 4U0QB 1A02N 1P4IL 5F3BB 1HINL 5F3HB 3UJTH 2BNUB 2R29L 3KG5A 3O3BA 3O8XD 4LDLB 5MEOB 4JJ5B 5TFSL 1CXKA 4LAJH 5I0DA 1QFHA 2JTDA 4W4NA 1NLBH 2DWEB 1FCGA 5FHAL 4D3CH 1XIWD 1GC1C 4YDKH 1OW0C 5FA3B 3FAWA 3B2VL 3VDAA 1RJZA 3QUXD 3NZHL 3K81A 3D0LA 4AIXA 3HPLB 3QXDA 3ARUA 3L3JB 1DL7H 5HYEA 4NNPL 3NFSL 3QCVH 3BRDA 3V95A 1KELL 2ATKA 2PTTB 2FJHA 1MJ7L 2CO7B 4LLQA 5JOPE 1HIMH 1FNGA 1PG7W 3AMKA 1HQ4B 4NQVA 3JWDC 3DUHA 4IMKC 3FHAA 3EYQC 1INEL 5C0NC 3WDHA 5F93C 2HFGL 1DCLA 4F33A 2P43B 2AERT 5BXFA 1I9IH 3AFLA 4BKLB 1ZANH 4XP5H 5A2LH 2DQJH 4DFIA 3HC3L 5DTFA 1U2CA 4JM2D 1B2WH 3CH1B 1AHWA 4D2NA 5DRZA 3FT3B 4I77L 1HILA 1S7RA 2VQ1B 5DUML 4HMCA 5C07B 3U48A 2VZUA 2XQYK 4WU5B 3FOMB 5CIPB 5FYKD 3QG7L 1RVFL 3O6FC 4I0PB 25C8H 3QDJA 3E8UL 4WHCA 1IAOB 4OLUL 3AUVA 1OF2A 4NRYA 1U3HA 3MLUH 2YRPA 3FQWA 1OQXA 3BQUD 2FHFA 3MO1A 1FLTX 3RVTC 1AXTH 4Y5VB 1RZJH 2C1OA 2OTUB 1ZS8A 4XNUL 4B0MM 3UTTB 3DROB 5DJYB 3WBDA 4KI5D 2A6KA 2P7TA 5F1IB 2D7OA 2DWDA 1IFHH 4FXGA 1IZJA 1UXWA 1JRHI 4PJ8C 3T08A 3MFFB 4K7PX 1P7QA 1FYHB 4GRMB 5L0QC 5EC2B 1JK8B 1OAXH 1ADQH 2CLZA 5F96H 3LMJH 4KK5D 1FIGL 1OAYH 3OPZL 4H20H 1RFDH 2R69L 3QFDB 2N7BA 4JGUA 1CICB 5MHSD 4EDXB 4JFYA 2EYRA 5DLMH 4IEFB 2D0FA 4YBLC 4YE4L 3U4EA 1OGAE 3RFZC 3BN9C 1MHCA 1FL3A 2JIXA 3QPXH 2P5WA 3VRIA 1IEBB 5F8QC 4OD2B 4WV1C 4MQSB 3ROOA 2NY5H 2ZJSH 3MMEB 1UFUA 1R3IL 4MNGA 3C60A 1FVDA 3QHFH 1QO3A 3DV4B 2X4OB 3OL2A 3QFJB 1LEIB 4L9LC 4WW2F 2A9NL 1FO0H 4XB8A 3VJ6B 2JJVA 2E9IA 1ODAA 1N8ZA 3LKRA 2J5LB 1LP9E 5IIEB 4J3UA 3P4OB 2AI0L 1DEDA 3O4LA 5ADOH 1YY8A 4KMLB 2X4UA 4FZEL 5JXEA 4XI5C 4GAJH 3MOAH 1IBGL 4TN9A 4LP4A