1MCPL

Phosphocholine binding immunoglobulin fab mc/pc603. an x-ray diffraction study at 2.7 angstroms
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
220
structure length
220
Chain Sequence
DIVMTQSPSSLSVSAGERVTMSCKSSQSLLNSGNQKNFLAWYQQKPGQPPKLLIYGASTRESGVPDRFTGSGSGTDFTLTISSVQAEDLAVYYCQNDHSYPLTFGAGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Phosphocholine binding immunoglobulin Fab McPC603. An X-ray diffraction study at 2.7 A.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immunoglobulin
molecule keywords IGA-KAPPA MCPC603 FAB (LIGHT CHAIN)
total genus 40
structure length 220
sequence length 220
ec nomenclature
pdb deposition date 1984-07-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1mcpL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1mcpL01
4QT5A 5EO9A 1HCVA 3ARBA 1E4WH 2XKNB 3GSNB 4ELKB 3VD4A 3C6SA 2R56L 4LHJB 1JUFA 3IGAB 1OGAA 1L9NA 4TVPH 5AYQA 4FFVD 4Z7WF 4XCYA 5AG8A 3JWOH 4J8RB 4JM2B 1JPSL 5IEHA 1KLGB 3RWDA 3GEWB 1BF8A 1U92B 5C07D 5L0QC 4ZFOB 5IOPB 4P2RA 4IEFB 2X10A 2X4NA 1IGML 4W81A 3MREA 2ARJB 3BKCH 3A6OA 4LAJH 1MIEH 5TF1H 2BJMH 2OJEA 3VGAC 4PUBL 5CEZL 1DANT 2PNDA 4X5WA 4KJWC 5FYLH 4BK4A 2FIKB 4JRYE 1CIUA 3BH9B 3Q1SH 1TVHA 4LSPH 4H0HB 4KZDH 4D0DA 4NJ9H 2EDDA 2E9WA 3JBG7 1T0NA 2ADIA 5GS2H 3SE3A 2NTFA 1YN7A 2APTA 5H94A 3SDYL 4ODUB 2AKRB 4WCYH 4E0RB 5CZVL 2H6PB 1VCAA 5F21B 1YDPA 4BQ9A 4OFKA 1CWVA 2R8SL 1LK3L 4HUXA 4PP2B 2R2EB 4JKPH 4LDEB 4RFOL 5I75C 4OFYD 2PO6C 5J12C 2Z91A 5I0ZA 4LSPL 1MREL 1RUAH 4PJEB 3RVWC 4ZUSB 3QUZC 3VD5A 4LLYA 3NIGF 3ME0A 2ITDA 2VWEE 5MI0C 1A7RL 1TENA 2D9CA 1CCZA 3SO5A 4F7PA 1QBML 3B5TA 1INDH 4XCCL 2ADFL 3BP6B 1JNNH 5EZJB 1G7IB 1G1YA 4DQOH 1I1YA 1ZEAH 1YY8B 4OCXL 3SBWC 4KVCL 1CFSA 2CKBB 5DC4B 3SKJH 3O3DB 2P4AB 4Y5VA 3DV4B 2IANB 4D9LL 4MD4A 4UBDC 4Z7VF 1KFAH 3ARDC 4OBRA 2D0GA 1QRNB 1QSEA 4TSCL 3HR6A 3LN4A 1ZLUH 3WFEL 4A6YA 3DARA 4IS6A 5ALBL 3WSQL 5IIEA 3CGTA 3AREA 3ZTNL 5CJ8A 1K5NB 4XCFL 3RVVD 3EOBB 4Z78B 5E8OA 3VI4F 3QEUA 3LH2L 3DX9B 3ARFA 1U41A 4MXVF 4R2GD 3SBWA 1I3RB 2F74B 5DDHB 2XWBB 1KEML 2AXJA 2X4SB 3MO1A 3RAJH 4GAYB 4NZDA 4AENB 4JFZL 1C16A 5CD5D 4G8EB 4GFTB 1LMKA 2Y72A 4G8GA 5ETUA 1VKXA 2HLAB 3GK8H 4POZC 5EBMA 2AI0H 1MFNA 5CAYB 3N0PB 2P5WB 3FHAA 2YZ8A 5BOPA 3PQYA 4R26H 3MROA 4BFIB 1ZA6A 1EAPB 1P7QD 3EIFA 1FORL 5AZ2H 1IEBB 3MBEC 3LZFL 2YPLA 5ACLA 5CEYB 3HR5A 5E5MA 1ND0B 4N8PA 2Q3ZA 3MRJA 5GS1B 1YEJH 4JFFB 2WLYA 1T89C 2NW2B 2FATH 2Z35A 2WP3O 3VMNA 4IBLT 1WC7A 3QRGH 1XAUA 2PETA 2WINA 1U58A 4RAUB 5E1HB 3CAFA 1F3JB 5C07B 1A21A 1KGCD 4UTBL 1HZHL 3VXRD 3P73A 1IGFH 1MJ7H 2IH3A 1NSNL 4QXUL 5MEPB 3P4MB 5ANMB 5DD6B 3SDDD 4YHKL 1FGVH 1JF6A 2ICWJ 4R97C 3WJJC 4KJYB 3IDIA 5EO1B 5DEGB 1DL7L 3QFJD 1MJJB 1P6AB 4QOKD 3GJFA 2VQTA 2ZUVA 4P23A 1J1XL 3OJ2C 4M3JA 4NRZA 5EPMA 2HTKC 3N9GL 5EO0B 3HC3L 3MLWH 3BZFA 3BPNB 3PJSB 1RIHL 1UM6H 2HTLD 4HKJA 4HULB 2KZ1B 5I1IH 4TUJA 2MMXA 1U8PB 1OAXL 1LO3H 2IG2H 2CD0A 4AMKH 3C5SB 2CH8A 3LRSB 4LPCA 5C6WH 4PREB 1QBMH 3MRKB 1ACYH 4UIMB 1A4JA 1AO7D 1QSFA 1I8MA 2VQUA 1VENA 4JRXB 3SDXF 1G9NH 2CUIA 1XF5B 1A6ZA 2HWZH 3LB6D 1SYSA 4XAKE 1A9BB 5BVJA 2F54D 2LAAA 4CAGA 3ARUA 3RNQB 1NGZB 5JQ6L 5GGQL 5D1XA 2D03H 1Q9WB 4JRXE 4UINL 5GGTH 4YUEL 5F1NA 3B3IB 4LP5A 5DQDH 5CJQH 4EXKA 3ZKMD 3CH1B 2BHZA 3TJHD 1WFUA 4M7ZC 3HAEH 4OCMC 2BX5A 4Y0GA 4FFZH 4JGMA 1A14H 2AJVH 1OTUC 1SM3L 4WUKH 3W82A 1OAUL 1SEQL 1JGDB 2B5IC 3STLB 3BPOC 1N59A 4HLZH 1X5IA 1PX3A 3L3HA 1GGUA 1DQTA 1RJLB 3BP6A 4WI6A 3HI6H 5CEZH 4JQXC 4NSKB 1U8PA 3KPSA 6FABH 1WBYA 4OLEA 3DBXB 3UBXI 3ZYOA 1MHEB 3PP3H 3RPIB 2FEDC 4JHZA 1G0YR 2C4FT 4HF5H 4XMLH 4ZYKB 2IQAB 5I1KL 1FV1A 4ZAKC 3BISA 1AXSA 2EC9T 4QYOB 3FZUC 4IRJC 5EUOA 1D5BB 3GZKA 1M7IB 3NBNA 2R0WL 4KK5C 3VH8A 4XNQA 1QYGH 1DN2A 2VDPL 5IW1A 2BFVH 3AAZA 3IDYC 3OKEA 1A4KA 3FO1B 4ZOCA 4WW2B 3U36B 1IGIH 1NGZA 1CXEA 1WBYB 2WIIB 3MODL 4O58H 5GGRY 3CFDB 2NCMA 2VXTL 2OTWB 1NC2D 1SHMA 5KSVA 3MCKB 4HKZB 3CDYA 5T3ZL 3TBYA 5HJ3A 2YD1A 1K6QL 3T0EA 2Y25A 2P42B 4P5MA 4LLWB 1HWHB 1JGVH 1YECL 2G5BA 4LLDB 2QEJA 4WWKB 1IGJA 2OMNA 2D0FA 1HHJA 4ZUUA 2PCPA 4RQQB 5IJVA 4MA3A 3P4OA 5D7LD 3BP5A 3NA9H 5DZLA 1ADQH 5E1AB 5F3HA 5GJTL 3SCMA 5KG9B 1JNLL 4LU5L 3C87A 5DK0A 3HMXH 3UBXA 3VGBA 5D1XB 5CEXB 4GLRH 2BNQE 4TUOB 4Z7VA 3THML 5K9KB 4HWEH 2YSSA 2ICEA 2PYEE 5FYJH 1FFQA 4G8GB 3E6HA 4GS7C 1JN6B 4M6ML 2DF3A 2W0FB 1Z9MA 3PWNB 1NUGA 5IR1B 4PJDB 1A7BA 1OSPH 3BHBB 3T3PE 1EVTC 2AERT 5C09A 1TITA 3B5HA 3WFCH 3HUJB 4G7YH 2XYCA 1JHTA 4UIKH 4KV5E 3RGVC 4DEPB 3QXDA 5J6HB 3GJFH 1QD0A 2MHAA 4M43H 1D5IH 3VI3F 5A16B 3LKNA 1JRHL 6CGTA 4JCMA 4HWEL 4CBPA 5KZCD 4ZNEA 1QBLL 5IHBA 3RWEB 4MDIA 2FX8H 5AAMA 1V7MH 4QHNB 1WC7B 3BJ91 2CDGB 4Y5XA 2G5BB 1BEYL 1WT5A 3K2UH 2C3WA 1T20B 1ED3B 4MJID 1YMMA 4LOUC 4L9DA 3V5DA 5IROA 4XCCH 3LRHA 4KDWA 4NM4H 3HHRB 2XTJC 2JJSC 5KVMC 1MELA 4RMUA 3FFCA 2H45A 1JWMB 3RIAF 2Z8SA 1JPTH 4OGXL 3RL2B 4XVTH 2YS4A 4OZFB 5D1QD 2F8OA 4PG2A 1T1ZB 4PJEE 3WIHA 4EIGB 5B3JE 2HJFA 5DD6A 2APVA 2XY2A 1MIMH 1MUJB 2AXGA 2P44B 4OF5A 3EOTL 3SJVD 4FG6D 2GJJA 3HMWL 3QUXD 5HGDA 3TBYB 4EOWH 5FV1L 2BVPA 1QSFD 2YRPA 1A6WH 2XFXB 1Y6KR 1AFVL 1ITBB 2Q7NA 3JTSA 1S7VA 3R1GH 4WUUE 2VO5A 4PJ8D 2H9GB 1KXVC 3BKYL 4RFEA 1RULH 1LE9B 2VLJD 4U6HB 4LGRB 4R4FL 1L7TH 3DV6A 3IXAA 1D9KB 5L8KB 2J8OA 4YFLI 1F6LL 4CVZB 3QQ4B 1U93A 4LNRA 4QRRB 1BX2B 1OAKL 4AEHH 4QHMA 3EUUA 4QWWC 3O9WB 4AL8L 4QRPD 4XI5C 3ULSA 1YYLL 5C6PB 4ZO6A 3P4NA 4YH6A 4KUCD 1KCSH 4PRID 2FSEA 4JRYB 2DQTH 1MI5D 4U6YA 1KB5A 3UTPE 3BGFB 1NDGB 3MLSH 3P2TA 3WUWB 3DSFH 3L3GB 5KSAC 3D9AH 4NO2A 4GQPH 2VDKH 1G7JA 4OIIH 3T2NL 4L29A 5JHLL 15C8H 1P9MC 3F6LA 3FRPA 2H8PA 2OTUA 1FFOB 2DM2A 5DJCB 2GFBB 3EYQD 2H41A 2XWTA 4MNGE 1KB9K 2R2HA 1FZKB 4BZ2H 4JLRB 4RISL 5T1KD 3ARTA 5C09E 1Q9WA 4FQLL 4HS8L 4M03A 3SKNB 1MCOL 3G9VA 4HIHB 1GAFH 1BD2B 2EEDA 2X4TA 4LCUA 2B7DT 1OM3L 2AK1H 1BQHA 4LCWA 4YDIL 1KPUB 1Z9SA 3I9GL 1BJMA 2XZQH 3VD3A 3NCJH 3LQZB 1CI5A 3SN6N 2BXZA 5JHDA 2UY7A 3K46A 2YWYA 2J7LA 3IDUA 4P3DA 2V2WA 1ERNA 2Q86B 2ZSWB 4PRHD 3T77B 2IBBA 4XRCA 5T5NF 4ODWB 4HV8B 4OCLC 1R0AH 5L9DH 1JWMA 1MF2H 3AM8A 3M1BB 5D1ZA 3QDMD 4F15C 4M00A 4F7TB 5SX4I 3MRBA 5F7FA 1YMME 5EBLA 3PWPD 3T0ED 2DTML 1FO0B 5IQ7L 1F4YL 1KFAL 3GRWL 2UWEF 4FQ2H 4MJ5B 4QGYA 2QSTA 3WE6A 1C1EL 3O6MH 5JW5B 3MLRL 4LGPB 5D7LA 1MQKL 4KU1A 4X6BB 4PP2A 3SE9L 4P59L 1CGSL 2W9LA 2F54E 1GJIA 4MAUH 2FWOB 5C0CE 3GSOA 1ZE3C 3KVQA 4KK6C 1JF1A 3V0VB 2RHEA 2HJLA 3WXWL 4YHNB 3HUJA 5GGUB 2H2PC 3IJSB 4HPYL 4HJJH 4LCUB 4X4ME 3PQYD 35C8H 3EOAA 3RKPA 4MXWL 3KYKH 5KBNC 3QIWB 1CD0A 4LL9A 2P49B 5L2KE 2IPTH 1YEKL 3DRTB 4J6RH 1NC2A 4ZODA 1ZT7A 3QXDB 4OLXL 1GZPA 4X4YA 2Z8VC 3VFUA 4L3EB 2NR6D 3MJ9L 4K3HA 3E6HB 3QUZB 2Y5TB 1YA5A 2XICA 4MNGB 4UV7H 1F4HA 2A74A 3MCLL 3V5HB 4LAQL 1WTGT 3RWFA 3F7VA 4L4TA 1QP1A 1KJ3L 5IQ9B 4UT6H 1CL7I 4I8DA 4RIRB 5K9OB 1HKFA 4EI5A 4CJ1A 5L88H 3HZMB 3OKMB 1KTLB 5T3XL 3WIFB 2UZYB 15C8L 3MNZB 2CLZA 3GBNH 1AI1L 1G7PA 1ZT1A 1A5FL 2PYFB 3MJ9H 3ILPB 4IOSD 1P84J 3O4LB 3GMLB 1S8DA 3GGWB 2FBJH 3MRLA 2EDQA 4QXTA 1X5HA 5GRZA 5KSBA 3S88L 1RURL 3RA7H 1WV7T 3TIEA 3OKOA 3KNBB 5DRZA 5GXBB 1QEWB 3RU8L 2JF1A 2XZCH 3RJDA 1U2HA 3OKNB 1TJIL 3SO3C 5FF6A 5I6XB 1BQSA 2CGRH 1MCWM 3EGSA 4MQTB 1RZGA 4U6XB 3SGDI 4AH2B 4LVOC 5IHLB 2GCYA 2ZOKB 5FO8A 1M7DB 2C4FU 1KCLA 4MA8L 4O02H 2K7PA 1NDMB 2YD4A 2VH5L 5I1JH 4QTHB 1HINL 3AXLB 4BSVA 4N68A 4X0KB 1KUMA 1CD8A 3LDBB 5T3ZH 3UJIL 2F19L 3S5LA 1S9VB 4DFIA 1RJYB 5DJZA 4ZNEE 2PTVA 1KENH 4GXVL 1ED3A 1F5WA 1T03H 3BDYH 1I9IH 1S7UA 4XC1H 4M61B 3V7AG 2OM5A 4JR9H 2VWEC 1MFDL 2DKUA 3SQOL 1FPTL 1R3JB 2J2ZA 2YA0A 4U49A 4MVBC 3Q48A 2DMBA 1JTPA 3HN3A 1SBBA 3QHTC 5TDNA 4LARH 3NN8A 1NCCH 5HDBF 1UM4L 5C0AD 4HC1A 4HPOL 5JTWA 5FO7A 2HG5A 2J6EH 4PY8I 1FL3B 3V6FA 4PJHE 3IKCB 4Z7UF 2HKHH 5GGSB 4OKVA 3L5WA 4JAMB 4NFBA 4HIHA 1DQML 4WV1A 3HRZA 3GSVB 2WBJA 1I1RA 1NCNA 3CFKA 3BPLC 3LEYH 5GS0D 4JB9H 1F90L 2OMBA 4DOHE 1QQDA 1N5AB 1BIIA 2UZXB 4DZBB 1AE6H 5DTFB 3HI6L 4G6AD 3PIQB 4UNUA 4V1DA 1OAUH 3K8KA 3OJDA 2IMNA 1I75A 4OCYL 5ILTH 2BOCB 3L3DA 4L9LC 4JY6B 3ZTJG 1QG3A 5GZND 4Z6AT 3T65B 4GAGL 4NNYB 1IARB 1CVRA 1IM9A 3HG1E 2XQBH 1FVEB 4JO4L 5HD8C 2GK0B 2WV3A 4NM4L 3G5ZA 4TUJB 4YHIA 5IM7A 3GUTB 5FGRA 3GBML 1MAMH 1RK1A 3S35H 2ESVA 1E27A 4QRRD 2XA3A 1VHPA 4FZEL 3PJSA 4LLMA 3W11D 2V17H 5CEZD 1XMWA 1RZKH 3G6DL 4CW1A 4KRPD 1HILA 1XGUA 1XR9B 4PGCA 4I4WB 3LKSB 4HC1L 4JFPB 3TCXA 4UI2A 5D1QA 2CIKA 5FO7B 3WD5L 5F7HA 5I1EL 1YMHB 4WW1B 3OGCB 4GKSA 1R5WB 3HCVA 1OARL 4IRZH 5F71A 4QRPE 4P99A 5I1IL 3IF1A 2Q20A 1LO3L 2NZ9D 3L3IB 1RUPH 4LEOA 3HE7C 2BSED 3UTPD 4G80B 4NQUA 4X7FC 1YEIL 1RJZA 4NSKA 4P2QB 5I19L 3ES6A 5HI4C 1TTUA 1EHXA 4LLAA 1BVKA 4HUVB 1E28B 1IZKA 4OIBA 1FNFA 3V8CA 1DQDL 4I0PB 4HGKC 1B2WH 2BOBB 2LFGA 1KIQA 5EBGA 3MV7D 2V7NB 2VZSA 3BD4A 1AGBA 4Y2DB 4YHML 3OAYH 4NM8L 3CSPA 1H3PL 1ADQL 2YA1A 5DJ0B 3UJJH 3WIFA 3OHXA 1FDLH 3S36H 3CD4A 1PX4A 4KPHL 4U1MA 4Y8AA 1C7TA 1J7VR 4FP8H 4N1CA 4ZTPH 4C57C 4OT1L 2ZUXA 2Y06H 2Y36H 2VLLA 3TM6A 2P7TA 3MROB 4BFIA 4E41E 4LLVB 3TYFB 4YXKH 4MNGA 1UENA 2DMCA 1KIRB 2E27H 5EOTB 4JPWL 1EZVY 4CW1B 1G9NC 2Q7YB 5TDPA 5T3XE 2RR3A 1QOKA 3DMMA 4KI5C 3I02B 1FNGA 1NBZA 4LF3B 3QIBB 1CDHA 3VW3L 1MRDH 2DWDB 4HXBL 2ZCLL 1I7ZB 1WF5A 5AUMB 3MLWL 4GW5A 1J12A 4NCC1 3MXVL 2CRYA 4Q9QH 1RFDH 2FECI 2P8LB 1X5AA 1ZTXH 4OLYL 4OT1H 4I3GA 3BP5B 5H8DA 1Q94B 3MA9L 1Q9KA 3QIBC 1W0WB 4MX7B 3BPCB 3QEQA 4NHUB 4HF5L 3OXRB 4JZNB 2JK5A 2A6IB 1RUQH 4O4YH 5INDA 1M6OB 3K1KC 2MKWA 4NP4L 3U30C 1UFUA 5DZNA 3OG6B 2QADB 1OTTD 5HJ3B 4X6DA 4YXHL 4Z7UB 1S9VA 4LRIA 4UT9H 4XVSH 2N56A 4BQ6A 1UQSA 5ID0B 1WBZA 3OB0H 5JA9A 4G9FD 3TA3B 2A0LD 4WWKA 43CAB 4Y19E 4PTTB 1NBVH 4DCQA 3HC0A 4M5ZH 2CJUL 3ZDYF 1PVHA 1AP2A 3O6FA 1FN4B 1QLRB 5K93A 3U83A 1QVOB 2VDNL 1D5MB 4MS8C 2BK8A 4F7PB 3VJ6A 1FH5L 1A6UL 4DUWA 1A6TB 4FQCL 5ANME 1YEDA 3HTLX 4NZRH 2XXCB 3DMMB 5I8KL 2P8MB 3D0LB 5F6IB 1JL8A 1S7UB 1K3IA 1T7VA 2OZ4A 1B88A 1I8IA 1ES0B 1I7RB 2Q1EA 1H3VA 1ZHKA 2BVYA 3O11A 4OLZH 4AZ8A 1X6NA 4R7DB 5E6IA 1BFVL 1S9YA 1W72A 3RBGA 5C07E 3WNOA 3PF2A 2BVQB 4S1DD 3I50H 4B53A 4OZHE 5E8PA 4JO2H 5ADPH 1XF4B 4FOMA 5EIQA 1V5JA 5E08L 5FO9A 5HYEA 3GSXA 3F58H 4NQDA 2A9ML 3IXTB 4PY8J 2GK2A 5IHZA 4JFFE 1F4XL 4DAGL 3D69B 1RJYA 5DJZB 5FDWA 1JGLH 4Z0XB 3FMGH 3IDXL 3KPSB 5TDOA 1T20A 2BNRE 3O81A 1QNZL 1U3HC 2RFXA 2HKFH 2EDRA 2B1HH 2VXSH 1HOCA 3S5LG 2LABA 3MRCA 5CJXC 3DMMC 2VDMH 1GGBH 2HN7B 3DXAB 1JP5A 3UYRH 4ZG1A 2Y07L 4PJ8B 5ICYA 3C6SB 2VE6B 2OTPA 3MRIB 4KHTL 4N9GB 1UCTA 4J8RA 4JM2A 2IBZX 4XP6L 3F8UB 4QHMB 1P4BL 4PJGB 1EJOH 4DW2H 4AIZB 5JORB 3DX7A 2P5ED 1T6WA 3RFZC 5SWZD 1N3NB 1U8OB 5EO9B 3VXRB 1OGTA 1PLGL 3MJ6A 5F72S 1N64L 2CDFB 4ELKA 2HWZL 3S37X 3QQ3A 4H26B 3FB7B 5EU5A 3U4BH 3D0VB 4I77H 3OF6D 5DUMH 3X12A 5T1DL 1CT8A 2N7BA 5C70A 5C3LD 3TBWB 1G7LB 2GKIA 3LD8C 4P49A 4FG6C 1OT2A 3EZ8A 2G2RA 2OYPA 3D25A 1JI1A 1F02I 3EFFB 1RK1B 3DX8B 4S2SB 3U1SL 2I27N 3V8OA 1KOAA 3H9HB 3G6JA 5D7IF 2C26A 4UB0L 1KLUA 4PJ8C 5BO1L 1F3DJ 5DJ0A 2F19H 5AWNL 3CFCH 1MI5E 4PJ5A 2QR0B 5TFSL 4GXVH 4ODVL 1I1YB 2E7CA 1Q0XH 3ABZA 4D3CH 3U6RB 4PLNC 5DRNA 5ERWA 1F3RB 2QV2A 4F57L 1T22A 4POYA 2YOCA 2ITDB 4WU5A 2BDNL 1U8QB 4CU8A 2G9HA 5JOPE 5E7FA 4ZQKA 4P5MB 5T5FH 5KSAD 1W0YT 4OLXH 3QXVA 2QSCH 3HZKB 4AT6B 1X5GA 1YDPB 5CCKL 2R1YA 1T2XA 3B2UD 1GPOH 5F3BA 4YHYC 5JDSB 3DRQA 4J6RL 3ULVH 5DD1L 5HYSB 5IESH 5LAXB 2YN3A 1CFVH 1MEXL 4GG6B 2VUOA 3LH2H 1UACL 2ORBH 5HHXL 4MMZC 2E6PA 2VXVH 3O2WH 3VDCA 1JJUA 5JPNA 2PXYB 2AJ3A 4Z77A 3O0RL 4W70A 3PV6B 3S98A 5ADOL 3DTXB 1KPRB 4I3SL 2W60A 2HT2C 1I9RH 2W0FA 3FB8A 3NACL 1H8SA 4YO0A 5AAWA 2XA8L 1QKZH 3BWUC 4OKDA 4MQ7A 2ZNXA 4JE4B 3UMTA 4ODSH 5HDQH 2QHLA 1YN6A 3O2VL 3BE1L 1NL0H 3E6FA 4M9OA 1MPAH 2JLLA 1DZBA 2V5TA 4OCRH 2VDLH 3TA3C 7FABH 3GMRB 1ZGLB 5EBWA 5KOVC 1AGCB 3L95B 5CBAB 4JPVL 3REVA 2R4SH 3LKNB 3HG1A 5HHXH 4I2XB 2YKLH 3H9ZA 4X4ZA 3TNMA 3C09C 1B6DA 1IC7H 1JHKH 1SVZA 4HJGA 4WHYG 4NC2B 1EAPA 3HE7A 3T0EC 1K4CA 2VL4A 1TZGL 1SJHB 2CKBH 4TVSa 4LVEA 4PJ9B 3UC0L 1I3GL 3PWNA 4A2MA 3ZE1F 5LCVL 1I3RA 1BP3B 1NEUA 4RSVA 5LWYL 2V2XA 4GAYA 1WBZB 4Z78A 3ILQC 2H2SC 1II4E 4LPXA 3TVMB 4DGVH 4ZSOA 1CQKA 5IK3A 3L5HA 1QSEB 2DRUA 4NHCH 3KLHC 3TPUA 1T1YB 3FFDB 2J88H 4PRIA 1A1NB 3AREB 1W0WA 1WCQA 1UZ8A 1CVSC 3P9MA 4YO0B 5DD5H 4OQTA 4NQDD 3T08A 4OCSH 1OVZA 4JM4H 4GKZB 1I7UB 2UVEA 5DVLA 4QOKA 3NZ8B 4HDIB 1ZEAL 4YPJA 3WLWC 3X11A 3L3KA 2F54A 4N5EC 3EFDH 5DFWH 5C6TL 1YYMH 5J6GB 4NC1C 4YHPB 3QQ4A 4LNRB 5LAXA 4QRRA 3RZCB 2AK4E 1E4KA 3MRNB 4YDKL 3WFHA 4UZGA 3BIKA 3DI3B 4MA1C 5E95B 2J5LC 3VXQB 4C4KT 4MSWB 4I0PC 4JFZH 1JBJA 3WS3A 3W39A 1HCFX 1QLRA 4LQFH 1PQZA 3W81A 3U48A 4L4VB 2BSSB 1MJUH 1NUFA 2O5YL 4JPKL 4WCYL 5JHDD 3QULB 4O2CB 2VABB 3MSPA 1NGPL 4EI5C 2FEEL 1J8HA 4U1KB 3LY6A 4MNQA 5I1HH 4BH7B 3LKRA 1C5CL 1DBMH 1ZWIB 5KS9A 5TE4L 1BAFH 2R1XB 4X7SH 5CKAA 4B0MM 4QRTA 2R2BA 2CDEA 4WFFE 1ZKAA 3SDCA 1TVHB 1MNUL 4NPYB 4JGUA 1LO0H 3SE3C 5DRWA 4J3UA 4K3DH 4YNYA 5GZOC 2AJVL 4MJ2A 4K23L 4HFWA 1Y6NR 2AEIT 3F7QA 4WFED 3PHQA 1QA9B 4UQ2A 1P7QB 1TZIB 4I9WE 4M93B 4XP1H 5FFLA 5H37G 3BJLA 3MJ7A 4QGTA 3NFSL 2DQTL 4FZ8H 2DQHL 1CLYL 3FFCD 1ZA3B 3BDXA 1S7QB 4EUPH 2FJHA 4AEHL 4N0RA 1JHLH 2FX7H 3QPXL 4GG6F 1RZKL 4LNVA 2B2XH 4ZFGL 3UTTD 1TFHA 4CMMB 3WLBA 2WUCH 2CDFA 4ZO8A 2EKJA 3CDFA 4OLVH 5DTFA 5C0CD 2AW2A 1N4XH 1XF5A 4XP6H 2R39A 5BV7L 3ZDXF 1XGRA 4YZFF 4FQCH 4PJGA 4ZSOE 2CUMA 4JM2F 4ELMF 5JORA 3C8DA 3BP4A 3NFNB 3WIIH 4QXWA 4Z18A 2XTJE 3VCLA 5FGBA 4ZUVA 3UZQA 1N5YH 1FVEA 4IRSD 2OP4H 4XMKH 2AGJL 5E99L 1AKJD 3CMOH 4PRIE 1RUMH 4IRJA 3QUMB 3DBXA 2NXYB 5FYLL 3RIAK 3W0WD 1W72H 5CZXC 4XPAL 4YHLL 3HLAA 1JTTA 3B8YA 3S34H 3G9AB 3RQ3A 3LIZH 5EIIA 4J3WA 3G6JF 1AY1H 3F58L 5IFAH 3U0PA 5FGCB 2X4RA 2VLKB 2WNGA 3U0TB 5DLMH 4CVXB 4N0YL 5CGYD 4HFUL 1CLCA 1T4KA 3CX5K 3MQIA 1WZKA 4WWKD 1OLZA 3MBEA 3WNLA 4DN4H 3B5GA 2ICWA 5F6HJ 3LDBC 5B4MD 2HYMA 4LSVL 5CINL 5C0BA 1RZ7L 1JYWA 1VB9A 1CTNA 1V7NH 1KC5L 2FHFA 3PQYB 2R29L 4P46A 3B2VH 2I9LB 3EO9L 5IVZB 1RZGB 4U6XA 4X4XA 2YUXA 5IW6B 5IR1A 1J5OL 3CDGA 4QF1B 5FB8B 2BHUA 4LVOB 1CXHA 3FTGA 1UJ3C 3FONA 1FC2D 3TT3L 1YEEL 4OZGA 4LPWA 1FYTA 3OJVC 5FYKU 2GQHA 4KJQD 1ZHNA 3FB5A 2IH1A 3HE7B 1L0QA 4I18B 4HK3J 3BH9A 4U05A 1X5YA 2QBWA 4C56A 3C5JA 4IOIA 1YZZA 4XBPA 3DIFA 1AC6A 1VFAB 4L8BB 1LO4L 5KSBF 4YX2L 5I8EA 1CQYA 4AH2A 4XWGH 4ZXBB 4QXGH 4PG9A 2P8PB 4DKFL 4XNZB 2OQJA 4KK9C 5ESAA 3PXHA 3IFNL 4F33A 3GMOA 1JGUH 2CKBA 4NUGH 3VMPA 2XN9E 3L3OB 1JHKL 2OL3A 2HVJB 5JPMA 1HQRA 5C0DA 2WQRA 3TWCL 3QWRA 1S8DB 5HHOD 3RIFF 1MRCH 5C0BB 3N1MC 1EX0A 2UWEB 2PF6A 4QRPA 2R0WH 1ADQA 1A6ZB 1QYGL 2ERJC 2C7UB 1N4XL 2ZUTA 3AU1A 3HS0A 4UMGA 3TN0C 5BS0E 2NY3B 2AJUL 2HMIC 5IBLC 2XQYG 5FM5M 1KN2L 2FD6L 3O4OB 5D71L 2R2CA 4MD0B 4HIIA 3S35L 1T1ZA 1F4WL 2C3VA 2DIBA 2GUOA 2IALA 4M5YH 1JNHB 3DUUB 2PW2B 3IJYA 3SDCD 3O0RH 3QUYB 4KKAC 4OM0H 4Y4FC 3GBMH 1CDYA 4NQVB 4FXLA 2GAZB 3B9KC 3KXFE 3J8F7 5IMLA 4LCYA 4NQSB 1T04B 4P2CG 4KKCC 3WJJA 2EDXA 4K55A 4P2QD 3W0WB 1MCDA 1MCCA 3JWNC 3V5KA 2EICA 4JG1H 3SDAA 3FCTB 4XXDB 1FLRH 5D5MB 1MCFA 4MDIB 4HUKB 4PLKC 3CMOL 3DURB 5E2UH 1ZLVK 3TP4A 3VRJA 2JB5L 4O2CA 3U9UA 4KKLC 4RZCA 4UDTB 5C0JB 4Y19D 1DE4B 3GSNL 3I6KA 1F58H 3T0WA 3HAEA 1YNKH 4PJCB 4FXGA 3AM8C 1H15A 2DQCL 2ZUYA 1BF2A 1V3MA 3F5WA 4G8IA 1J8HD 1CF8L 2WLZA 3AS0A 4YDLB 4HWUA 2F53E 1RU9H 3O41A 5DF0A 5GGVL 5EUOB 3SCMC 3V6OA 3D1MC 5IVXB 5I1AB 5F7UA 2BRRH 3OZ9L 4PJBA 2RB8A 4M7LT 2EZ0D 4KQ3H 3NZHH 3CVIH 1D5XB 4W68A 5F1IB 3GMOB 3GBNL 2OJEB 4NBYB 2QQQA 3DSNA 4NUJA 5DMIL 1ZA3A 1UM5H 3C6LA 4U1GB 5AD0A 4OCWL 3CZFA 5HPOA 2FR4B 4XNUH 1ZT4A 2IFGA 4JDVA 5E9DB 4LSSL 3FT3A 4L29B 4TOYH 4XXCC 2IPUG 3S4SA 4U2ZA 1DUZB 4H88H 4HEME 5FYKD 5KW9H 4ONGL 1PSKL 2XN9A 5GRUH 2AJXL 4P4RA 3RWGA 3PWJA 3CU7A 1FLTX 4EDXA 1RK0B 4XVUC 1X7QB 2IAMD 1WWCA 2GJ6B 4OUOA 5MHSD 4R4BB 3FAXA 1MRFH 2NZIA 2X5PA 2ARWA 4B5EA 2ZCKL 2E9JA 4RA3A 5FB8A 4YHNA 4OUUB 3N1QC 3KS0J 3QNYA 3CNKA 1M71A 2XZCL 3G08B 3F12B 1ZS8A 1TPXC 3K81A 3MA7B 4LASH 1CFBA 3FCTA 4GT7A 1TTGA 1KJVB 1OB1A 2VAJA 3MRMB 3BZ4A 5DMKB 1YEJL 1JWSB 1WWAX 5F96H 1MHEA 2FATL 1NCAL 2CLRB 3WFEH 3S3JA 4YC2B 4PGDA 4JY4B 3ZL4L 4IMKA 1XCQA 3LQAL 1MPAL 3BESR 3AUVA 4C56D 4K3JH 1T1WB 3BWAA 1WFOA 4NZRL 3UTTE 5HHMB 5IF0B 1F42A 2YPLD 4ALAH 3P0YL 1PYWA 4P4KA 5DLML 2EDHA 3MV9B 1N2RB 3RL1A 1DLHA 4G3YH 1YJDL 2VXUL 1KPUA 3BZ4B 4TYUA 1D5MA 1PZ5B 3BSZH 2GTWA 4R8WH 4MQSB 3VWJB 3U82B 2FGWH 4ZUWB 4PFEA 3QWRD 1OY3B 1OCWH 4YIQA 1LEIB 2VN7A 1ZVSA 5DEFA 1N6QH 5DA0B 1IAKA 1IAIL 1SYVB 3H6JA 5BV7C 4S1QH 4XVJH 4HUNB 3KYMB 3A6BL 4PJ7F 3I9GH 4PJBE 1BEYH 3K2UL 3ZE0F 4K2UH 4CMHB 4NQCB 2CO7B 3ZE0E 1XCTA 2VKWA 4MYWB 5EOCJ 4W4OA 4U2YA 5KVFL 5CZVH 1MCBA 2X1OA 1WISA 1YJDH 4RIRA 4GAJL 4X6DF 2IAMB 3H42L 2B5IB 2WWMD 5D2LF 2EYSB 1GYAA 2PO6D 3PHSA 1C1EH 5LKNA 2A74B 2NNAB 3MGAA 5E6IC 4DN3L 1M4KA 1TJGH 5FHAH 3T0DA 3I6GB 2GT9A 3KYAA 3V2AR 1U42A 3RVUD 5L8JB 5IT2L 3E6FB 3CLFH 3MCG1 5EN2B 5GS3A 1AGFB 1I1FB 5ALCH 4U33A 4PB0L 3CVIL 1BVLB 1N64H 5C0AE 3UBXG 5A40E 2J8UE 4I77L 3V4PH 2VXVL 2NX5B 4ELMB 1F11A 2PYEA 4NIKB 1Z3GH 2IPTL 3ARDD 4MA7L 4LCCB 1U8JA 4AJ0A 1P2CB 1A02N 3E1F1 3ZYZA 5L2JB 3P4MA 3SPVB 1TLKA 4HJJL 1HIMH 4YC2C 3H7LA 1CDIA 1H15B 2VERN 3TO4D 1KCUL 1W0VA 3AY4C 4PRDB 4KJYA 1KTKE 4OZFH 1EFXB 3IYLW 2AJXH 4NJAL 5FV2A 4H0IA 2EC9U 4GUPA 2N7AA 3VFOB 4OF7A 2HH0L 3QQ9C 1WTLA 2AEQH 5EOCL 4XCEA 3T4YA 3BGMB 1MVUB 1K2DA 5CMAA 3KLAB 3DVGB 5DWUL 1H0DA 4XNYH 4NN6B 2X70A 4N8VA 4F7EA 4PY7A 1IGTA 2NW3B 4XVTL 4Z95H 4L8DB 3PABB 4NQVA 4OSUL 1QO3B 4OZHA 3MODH 2O5XH 1G6VK 5KJRL 2XV6B 3MV11 3CFDA 3ILQD 4R97B 5J1AA 4ZFZA 3C9NB 4CVUA 1FNLA 4FQHA 4PGBA 1KTDA 4QOKB 4JY5L 5HHOE 1QR1B 1DEEA 3BOVA 3MPCA 2EXWD 5TQ0L 5JHDB 1IC1A 1M05B 3B6SB 4HIJB 5E00A 5EU6A 1LE5A 1PG7W 1TJHH 4NO0D 5IKCB 4LCIH 3OMZA 3T77A 4JFEE 1S78C 2IAMA 5I2IA 2VZTA 3ZDXE 4L1HA 3WFHB 1QFWM 4TNWK 3UBXB 1Q72L 4WUUA 3VI4E 4KAQL 4KK8C 3OBAA 3H3KA 2DLHA 3SDAC 3V6FB 2DN7A 1XGTA 3IFLH 1KCKA 3EDEA 1GH7A 1DBKL 1WWBX 1FFOA 4N0UA 4PJEF 5B3JF 3ZYIA 3F7YB 1NFKA 3LSOB 1JGDA 1TZHB 5I8CB 3CX2A 1R5VA 4PJBF 1FZKA 3IU3B 3ARGD 5GRJL 2HT3D 4D9QE 5FGSA 2A2QT 3UO1L 1XGQB 3REWA 5ABDE 4WV1C 4I48B 4CMHC 1HI6B 3O9WA 2CDEB 4V1DB 3G6JE 4LVNC 3S35X 5K33A 2W38A 4ZS7L 5GSVA 3T0XA 3QNXB 3GHEH 1MSPA 3PP4H 2HTLC 5LBSL 3PV6A 4Q6IB 3HC4L 1OTSD 3VDAA 5GZOD 4NQEB 4MB4A 3TEUA 1G9EA 4U6HA 3CFBA 3EKCA 1E6OL 2IADB 3PGFH 3D3VE 4AMKL 5FUOH 1DVFD 1WBXB 4K9EH 4R0LC 1IAOA 1QR4A 4J3VA 4G9DB 5I8OL 4QRSB 4O2FB 3P9WB 3QNYB 2Q76A 2OJZL 1CBVL 3N06B 4Z7NF 3DETC 4GRWB 3RVXD 2NY4D 3ULUF 1GIGH 5GHWH 2R9HD 1UVQB 5E5RB 1E6JH 1UKQA 5K9JH 1J18A 3ULVL 4YX2H 2H6PA 2J4WL 4DKFH 2G75A 1WAAA 1NMBL 4I0PA 3ZKMC 5FM5O 4MX7A 3D2UD 4WI4A 2Q8AL 2A6DA 4D0CA 1YC8A 2X4OB 4XH2B 1JVKA 1J0JA 2VITB 3FOMB 4WW2F 3JWOC 4P2QA 5DHVB 2V2TA 1MWAB 2VTFA 4DTGH 1OTUD 4U0QB 1HNFA 2PO6B 4XHJD 1QZ1A 5J12B 3RY5A 4MB3A 1TQBB 1GGCH 3G5YB 4P9ML 1KLFA 5E2JA 1RHHA 4PGEA 4JFEA 1YMHA 5DD3H 1FZMA 1Q9LB 2NY1B 3JWDC 3PDDA 4JDZB 4NKDB 4OV5B 4L3ED 5F88A 5EOTA 5IBTL 1RIVL 4X6EB 3MX0A 5D6CB 2FEDD 2EDTA 4KQ4L 3QG7H 2BZDA 4HXAL 3ARSA 3X3GH 3MACH 1JHTB 5L2KA 4HIEB 3R8BB 2OCFD 4OZ4A 1KN4H 5J9PB 3CXHJ 4NRYB 3FZUD 5I1KH 1D7FA 3VGAB 5E2TL 3MJGX 1BZQK 1FQ9C 3BAEH 3H9SB 5HDOA 1TNMA 4YPGB 4PG9B 4NKDA 3FO9B 4P5TB 5C86A 3NFSH 5EH1A 4UOW0 2IWGA 3QDGB 1HHGB 3T2QA 4JM2C 4DVRH 1ZLSH 4YHMH 2G60L 1K6QH 3OKKB 3DYOA 3IDJA 1CD1A 3L9RA 4X99A 4MQXD 3QI9D 4UUJA 3SKMA 1DBJH 1MHHB 4P3CL 3C5JB 4IOIB 4JHWL 2WBJC 5FYJE 5BZWB 1DSFL 3O8XD 3QHFL 2Y9RT 3UTTA 3FMGL 3IDXH 4NN7B 5D96C 3GI8H 3GSXB 1WLHA 3MLTA 4PJ7E 4LLUB 5KS9F 3VFVA 1U8LB 1S3KL 5JLZB 3VWKB 2C3VB 5GGQH 1S9XA 1OQOA 5IB1A 3O6ML 1YQVL 4YBQC 3LKQB 3UJTL 1F4YH 3NAAH 2A1WH 1XF2B 4LQFL 3EYUL 3RRQA 3S96A 2AJYL 3G6AA 1LD9B 2C1PA 1QFWH 1UT9A 5CZKA 2GK0A 3IS0X 3BDYL 4GBXD 1ZGLM 3RGVD 3BQUA 4PGBB 3VFMB 3D18A 1MFDH 2WZPD 1AGDA 4X9HA 3MRJB 3G5VB 3QCVL 1GVIA 3FRPG 4RA0C 1FL6A 4K8RC 4ZAKA 1HI6A 5MP6H 3ULVE 1S7RA 3MRRA 2RIKA 1A47A 1RZIB 5IJKC 2BVTA 1JGEB 2HMID 4CVXA 2NY3C 1G7JB 4TULL 3QUKB 3FO2B 3MV7E 2ERJB 1UB6A 5EUOF 1IKFH 4HBCH 2VZ1A 5SV3A 3QUXA 1KB5B 3S5LB 5EZIH 3S9DB 3LQMA 4M1CC 4QKXB 2P45B 1S7XB 4JB9L 2EH7H 3LV3B 3B9KD 5CIPH 1BM3H 1YEFH 2P46B 3KPPB 1L9MA 1BECA 4PYHA 4ZNCD 4K3EL 4XPFH 1G7QB 3TJEL 2LVCA 3VXMB 1A4JB 2OZ4L 1Z3GL 5DYOB 1UWXH 2C3GA 4JRXA 3VMOA 1CFQB 3QEQE 5D7SL 1IQWH 3OKDB 1KB5H 3BKML 2FBJL 1P5UA 3MOAH 5GSVB 1C08B 2RFXB 1WICA 5HYFA 4QXTB 3DX6B 4L3AA 2VSDA 4NZUL 5LGHL 1D6EB 2DM7A 5GGVY 4APQA 4Y4KB 4ZDHA 2VIRA 2I07A 4RCAA 5J7CC 2A77H 1XZ0B 4FABH 3SCMD 4OSUH 4K3JL 1MWAA 4MDJB 5I15H 2UYLA 2H1PH 3V4VL 4JDTL 1LILA 2ZSVB 4AEIH 4QWWD 2XA8H 3D2UA 4CU7A 5AZ2L 4P2OB 3U46B 1D5XA 5SX5H 3VG0H 4U4BA 4ZOAA 3U0PB 1RVFH 3LAFA 3P11L 5HGGS 1JF5A 1BQLH 4JVUA 1NKRA 1RZFH 1Z0NA 2VJXA 2OR9L 3LIZL 5EU7E 1DBBL 3EYFA 2FL5A 3NCYP 1IGFL 2B8OT 5DJDA 2X9YA 3V0VA 5DT1L 5MHSE 3HZKA 4AT6A 3OV6A 3QIWD 2CKBL 3CUPA 5HHVH 1WIPA 2X4PA 1WT5C 1J8KA 3NPZB 1YEIH 1FRGL 2G9HB 3QWQB 1LDPH 4U1JA 5BRZB 4U3XA 2GSGB 4KTEH 3NCEB 3PWPA 1ZAGA 5GSRA 4LBEB 3ALWA 1FCCA 2XACC 4DKDC 4EUPB 2NXYC 3IDGB 5K9QI 1AKJA 5HDLA 3O2DA 4F2MB 3VXOA 5FHAL 1U91B 1GC1L 2B0SH 3TT1L 4KUZL 3QAZC 3UTSB 5I76A 5JMRA 4MWFB 1ZHLA 2ESVB 1XZ0A 1JYVA 1XCQB 2LV4A 2UZIL 3ES6B 4M7KL 1P84K 3GM8A 4UV4L 3BD3A 1EIBA 4OQTL 4RGOH 2Q87A 3MCLH 3MLXL 2DQDL 1EGJL 1IGCL 5FKAA 4KZEH 3BKJL 4LP4A 4BUHA 3D3VD 1UCBH 4J3TA 5F44A 1OAQL 3OKDA 3WO4C 3OGCA 3RAJL 4GH7B 1C5BL 1IBGL 4Q2ZA 1G84A 1S9WA 2RJMA 2EDOA 4JHBA 5I17A 1VKXB 2BRQA 3UCRA 1BWMA 2C3HA 3EHBD 2QSVA 3KDMB 4ODTH 5DK0B 4BSWA 5CEXA 1QRND 4PJXA 3NTCH 4KK6D 3SDYH 3JV4B 2A6JB 1T21A 5DO2C 5KW9L 1MQKH 4GBXA 5EN2A 5IGXH 3O3DA 5EA0L 5IJVB 4K94C 3JUYA 3BZDA 4D9LH 4H88L 3RTQB 1N6UA 1KXQE 3NPSC 3ARGA 1ZVHA 3U0WL 1UXSA 3BQUB 4NPYA 4XBGA 3VXOB 3ZYJA 1X44A 1U8KA 3TYGL 4YEEA 2BCKB 4F9LA 1GOHA 4YEFA 3QFDB 1CIDA 1X4ZA 2EYSA 3CK0H 3MOAL 4PP1C 4X6CB 5C0CA 2HRLA 2IFFH 4GRLB 1HQ4B 3P9LA 4KRNA 2FX9H 3EYOB 4JQVA 1XFPA 2VABA 4M5YL 4WENB 4U1JB 5BRZA 3MOBL 4F8TA 1QACA 5CS7A 4U1NB 1J1OL 5T1MB 3WFDL 2G5RA 1D9KD 3L5WB 4JAMA 4EBQL 5J8OA 4TVPL 1FG2B 2OR9H 1UGNA 3QJHB 5HPMA 5BQ7A 3KPNA 5C0EA 1GAFL 1S9XB 1J05B 3OJMB 4PG2C 1RVFL 3D6GA 1KJ2A 3WS6C 5ESVA 1MCOH 2BMKA 3LEXB 1KT2A 1MVFA 3MXWH 4H1LH 1HQ4A 1IRAY 4EOWL 1JE6A 2W92A 1BZ7A 4P4RB 3WFBL 4ODVH 1U3YA 3T1FA 3O4OC 4ENED 2HKFL 2D9QB 4EVNB 2GJ6A 5DT1H 3R0NA 5DR5L 5DRXA 1SEBB 2DIJA 2VLRB 1QFWI 3PDGA 3TVMC 3RWDB 4XBGB 4XTRC 1FNSH 4CDGC 3CJJA 4IIQB 4OZIB 2IF7A 4XCYB 2BRRL 5ICZA 4U6YB 4P2YA 1C08A 4GJTB 1M7XA 1OLLA 3QEQB 2E8YA 4OB5L 1G7HA 2DD8L 4PJFB 3BO8B 4LMQE 4PJ9C 3MXVH 1U92A 4LSRH 3NFNA 1KPVA 2I5YL 2K3TA 2VLJB 1EK3A 3I3BA 3RX8A 3STZA 2BY2A 1ONQA 1D5IL 1FZOB 1NCUA 5DUPH 3TBWA 2L0DA 1K4CB 3FL7A 5DJ2B 3BP7A 4PB9L 4RMTA 3VXMA 1PKQA 1V7NL 3OR6A 5E00B 5EU6B 4CMMA 4TUKL 2IPKB 4I18C 4G5ZH 5D2LA 3V0WL 3AMLA 1P7QA 2ADGA 1A3LL 3HRPA 4G43A 5JOFB 4H8WL 1U91A 2DQJL 4UQ2B 4NFCA 5C0JA 4RBPK 5ITBL 2Q8AH 5C08E 4PJFF 3EYVB 4WU5B 4FQ1L 3BX7C 5F9OH 3CVHB 1RD6A 2RCSL 4ISVA 4OM0L 3ZT6A 3TBSB 4YWGL 4YXLL 1FNHA 4MDJA 1V3JA 2CIIA 2QTEA 3SDAD 4WNQA 3RI5K 3T09A 3P30L 2GSGA 2UUDK 5D6DC 4G9FE 1R6VA 4JFDE 1AQKL 5IB5B 3LMJH 2ZNWA 5HYSA 4GO6B 5I8KH 3I2CH 4G43B 4Q0XL 4XMPL 3TZVA 2ZPKL 4JFXB 4XNQB 3ARGC 5IMKB 1E0OB 4O58L 3FTGB 4ODWA 4TTDD 5D1ZB 2AJSH 4RAVA 1T7ZA 1VFMA 4JVWA 4XB7A 4K94L 5DD0H 4BZYA 1U8QA 2ICEB 5L9DL 1NFIB 5C3TA 2R2EA 3LS4H 1K4DA 3LN9A 2E7BA 2IMMA 1KJMB 4X6BA 3IKKA 2X40A 1RMFL 3TJEH 1UXWA 4RX4A 4QCIB 4E0RA 3WN5C 1Y18A 5GJTH 1Y0LB 4HDIA 4RQQA 4A6YH 4JFHE 1AR1D 4KTYA 1AY1L 5SWSB 5TGBA 2Y6SD 3LVEA 1KTRL 4FMFA 4KWUA 1FNEB 5IWLA 2MPAH 4KHTH 1W72L 4U3HA 3HFMH 1AD9A 3MOQA 4XX1E 1OP3H 5EWIH 3QO0A 4W6WB 3RWCA 4OD2A 1RI8A 2AS5M 4Z7UA 2NTSP 3U4EB 4OUUA 4WUKL 1ULVA 1B3JA 4MD0A 1NC2B 3DGGA 4NO5B 4UOW1 2HAZA 1W2KT 1G6RA 2NLJB 2GI7A 3QG6B 5F6HI 5TJWK 1KJ2H 3WNKA 3EOAB 1BOGA 1H8NA 5HPMB 4K7FA 4Z8FH 1K8DB 1WZLA 4NNXA 3CFJA 5EU3A 1AIFA 2J8UA 2I5YH 1PKQE 2AJZB 2BMKB 5C9KA 1FVDA 3UTZA 1WIOA 2NXZB 2Z8RA 5EZLA 2A1WL 3O6LH 3F5WB 1NFIA 1HK6A 2DD8H 5IFHL 1L7IH 5F88B 4XPHH 2VDQL 4HEPG 1U3ZA 4EN3C 1A6TA 2H8PB 2OTUB 4MQ7B 2P8PA 2NYYC 5F8RC 2XRAH 3O45B 3ELAT 1DN0B 4Y4HD 1VFAA 1L0XA 4Q9RH 3DURA 4X80H 5EG6C 5TGBB 1S5HB 1NGQL 3CPLA 3Q6FA 4EN3B 2BSRA 1S7TB 4HWBH 1Z5LB 4PV9A 1QO3A 2KQNA 5DQ9A 1U8KB 3C60B 4PRNB 4JZJC 4D8PA 4XP9L 1M7DA 2KZWA 5EO0A 4MA1B 1PW3A 3T2PA 3KPRE 4I5BB 2Y7QA 1HKLL 4P9HL 5I1HL 5GRWA 4JO3H 1WK0A 3JTSB 4HSQA 3FKUS 1DBML 1KNOB 4U1LA 1CGXA 4K07A 3RGHA 2GTZB 4EBQH 1QFOA 3L1OL 1A0QL 4PLJD 3GIZL 4CKVX 3Q5YA 1NC4A 1UEYA 1PKQB 2VZVA 1QSFE 1PY9A 5IJKA 4FQXB 1ITCA 4XNMB 4KGLA 1WEJH 5IB1B 5H35B 4FXKA 4PV8A 1MCKA 3FT2A 3SDDA 3IETA 5KVEL 3VXPA 1LNUA 1MCHA 4UTBH 1XIWC 2YXMA 3WS3B 2CSPA 3MNVA 5JNYB 4OD3H 5KAQF 3RWCB 3TO4A 1EH9A 2IPUK 3QFJA 1CLZL 4EIZC 2W59A 1RZJC 3NCMA 4V1DE 2XPGB 1F6FB 1BVLA 3MZGB 3EYVA 2FLRT 2R4SL 5ICZB 2H3NB 3TFKD 1RUKL 3EO0A 4XC1L 1I8KB 3QIUB 2X05A 2F9BT 3LRSA 3C6LB 1XH3B 1J11A 3ECBA 5FGBC 5D7JB 5IMMA 4S1DC 4JFYB 4CN6A 3WIHL 1U3HB 1PG7X 3O41B 5DJAA 1I85A 5F7MC 5E2WL 4HFWB 1EJ6A 1I1CA 2AQ1A 5DJ8B 4U1HA 4DZBA 5KSVB 3DRQB 1KNOA 3BQUC 4LHUA 3QH3B 1QLEL 2GTZA 3X14A 2GEEA 1YJDC 4HW6A 1BIIB 1HHIB 1HXYB 2AGJH 5E99H 4OD1H 4RFNB 4M1CD 2O5ZL 5ENWB 1L4IA 3MXWL 1G0XA 4MAYD 5HHOB 4M48L 3TH3T 4KDTC 2PXYC 1QUNA 4M7KH 1MY7A 5MENB 4NDMA 1QBBA 1HEZB 4UU9B 5DC9B 1GCFA 5IF0A 5IMOA 2YPLB 5T1LD 3GNMH 4PRPA 5CJ5A 4LHUG 2NY5H 3V6ZA 2YC1B 3LS5H 3T0EE 3VA2C 3CVHA 4ISVB 1KELH 5GISH 1MFBL 5ADOH 2Q8BL 1CFNB 4LSQL 1VEMA 4GG8A 1A7QH 4KKBC 4X7CC 5A1AA 4JKWA 2DQUH 1ORQA 3BZEB 5HHQB 5DGQA 1UH4A 1LEKB 4RWYH 3SGJC 3AU1B 3HS0B 3KPOB 3GHBH 4OF8A 3SGKC 1ZMYA 4NKMB 5EU6E 2AJZA 4Z7NE 2R0ZH 3ALPA 5DK3A 3VH8G 5BMFH 1DANU 5C1MB 4J1UB 2VKXA 1UWEH 1ZSDA 1J9CT 3SPVA 2J8UB 2V2XB 4XZUA 2VLJE 2BDNH 3JV6A 3GSVA 3QB7C 2ZG1A 4XBPB 3VG0L 4WY7L 4BZ1L 5D70L 1NFDB 1WFNA 3EOBA 5FYKH 1MI5A 4PJ5E 2ITCB 2FJFA 4IOFD 5IG7A 3EBAA 2IAND 4NC1E 2B2XL 4NOBA 3QIWC 2O61B 4P4KD 4KTDH 3P9MB 2VLRE 4BM7A 5IFJA 4WFGE 1ZHLB 3ZSTA 1UM5L 1VGKA 3OQ3B 5MEOB 4Y4FA 3PUCA 2R4RL 4JRYD 1I7ZA 1ZLUK 5A3IC 4JKPL 2D31B 4I0CC 4HHAB 5IVXA 1MHPL 5BVJB 3DWTA 4WI2A 1SMOA 4XNMA 1IT9L 3NA4A 2ARJQ 4X6FA 4X7SL 4RMVA 3TNNB 3BUTA 4WGWB 4RFOH 3HI5H 3OXSB 4PRHA 1J8HB 3IFOB 4JQXA 4G42A 5CILH 4CN4A 5JNYA 2YPVH 1FN4A 3OF6A 5E2WH 1KIUA 3BW9B 4AEIL 3G04B 4FQXA 2AQ2A 3A6BH 1U8JB 3MV9E 5EU4A 5FXCH 4TNVF 4JQIL 3BEVB 1DQJA 3SJVB 4JG1L 5DUBA 5I18L 4TTGA 3FJTA 1LO2L 3ZDYE 4HKXB 5CIPB 3VU2A 4F3FB 3QUMH 1P7KA 4ZFFB 4X6CE 3IJHB 4NQDE 1DBBH 2UVFA 4GUPB 4X5LA 3VFNA 4N8CH 2VLRD 3CPLB 2AXHA 4X7EC 2BOBA 3MUHL 2ZUQB 5E4EC 1AI1H 3OAZK 5ADPL 1A7PL 3K2MC 3SE8H 3I3EA 4JFFA 3W9DB 5DO2D 5D7KD 1XGRB 5E7BA 3TGXA 1EFXA 1U2CA 1RJCA 5B39A 2VAAA 5GGVH 2QLVB 4LGSB 4XBEL 4K7PL 2ADJA 12E8L 1S9YB 5F1OB 3V5HA 4F3FA 1E4XH 3KHQA 1NGWA 1RU9L 5KSUB 3KYOB 2JE8A 43C9A 4NHCL 4AQOA 2QADC 4OFPA 4N5ED 4DVBB 1ROWA 4P48A 3QO1A 4NRXA 4X98B 3ARXA 3F6IA 1U8HA 3UYRL 1G7QA 1UA6H 2C9AA 1F6AB 3EOTH 3WLBB 1CICD 3I75B 1FIGH 3NGBB 4RAHA 2DYPA 2HVJA 4RX4D 4U1IA 4Z5RA 5D7JA 5CHNA 1OOAA 1JZ8A 4Q6IA 4TQEL 1UWGL 3QSKB 1FFPB 4YFDB 2RQ8A 3HI1A 1QNZH 2LU7A 4EI5D 3TBVB 1CLOL 3LEVH 4UNVA 1E4XI 2RCSH 4Z76B 1SEBA 2XRAL 5KG9A 4FFYH 3UTSE 2AXFA 1XR8A 1JV5B 3O3AA 4HK0A 4ONOA 4RNRB 5D7LB 5TE7L 4HUVA 2G2RB 2WSKA 2N4IA 4MGXA 5DRXB 4RRPG 4MCYA 4Q9BA 2DYPB 2QQKL 1IAKB 5IVXE 2YN5A 3BW9A 4YQXL 2DLTA 3V4VH 5B8CA 3MRFA 3LS4L 4H0GA 2MQ3A 5LGHH 5DJ6A 5BXFB 4HMCA 4PLOB 3M07A 4G7YL 1FVCB 3ZKNC 3C8KB 2NY6B 2FL5B 3AGVA 3T3PF 5IROC 5AZEH 4ZUSA 1FAIL 2AABH 3E3QC 2XG5A 1MJ8L 5H37H 5B3NA 4LPYA 1AH1A 1KCVL 2QQLH 4OFYA 1WCBB 2ZUSA 2OL3L 1UB5B 2F53A 4X4MA 3DUSA 3IU4L 1EBAA 2B4CC 4PJ9D 3FQTA 5HGBA 3S97C 4UAOC 1FGNH 1T1WA 4GRLD 3BDBA 3EJZD 4Y4KC 1XGQA 3REWB 5DJ6B 4JHAL 2Y23A 1CGYA 1T6VN 4NM8H 3KPMB 4UU9A 1Z9LA 3PHOA 3OHXB 1MCSA 1GOGA 2C5DC 1KEGL 3QFJE 3BZEA 2QQNL 5SV4A 3DVGA 4PRPB 2VRAA 5HYJD 2Z0BA 3QFDA 3IXTA 4GKNB 4WIQA 5JO5A 2F5BL 5CBEA 4GW1A 2XI9A 4GG6A 4CDHA 2PR4H 4XRCB 5ISZB 4XP4L 4J7RA 3ARED 2AEPL 4RWHA 5HI3C 3MRPB 4HLJA 4PGJA 4G8FA 1NAKL 5HGBB 1CK0L 1LO2H 2A6JA 2PTTB 5CZXD 1FP5A 3A67H 4ZPTB 2DLIA 3MLPA 5FUOL 4U7SA 3L5XH 3RDTB 3H0TB 5J9PA 2XZZA 4LIQL 5HSFA 4CRPA 1TQCC 3S37L 3EJJX 1NGPH 1FYTD 1E6OH 3MNZA 3VXME 3HC4H 5JDJA 4GW5B 3QWOB 1CDBA 4PIRF 2DJSA 2PR4L 3FB6B 2XN9B 1AGEB 4G6KL 5E5UB 4L9LB 4XPHL 2BVOA 5GS0L 5H2BB 2ZWLT 2XG4A 3SOBL 1UM4H 5HVHC 4WFHD 5HYQA 2DB8A 4X8XA 2VDRH 2WUBL 3WXVL 4N0YH 2DLFL 1BREA 4HS6A 5TPWH 4PJXE 3L5XL 2PW1A 1R3KA 4R0LB 3MZTA 4MXQC 3CLFL 1YEHL 1E6JL 5C0ND 5SWSA 1OAXH 1GSMA 2PO6A 4XP1L 1MAKA 2YHGA 5DC0A 3ULVF 1F00I 3TT3H 5E8EB 4XP9H 4ZAKB 3L6FA 5EA0H 2K9UA 1YQ2A 4KY1L 4U6VL 3RGVA 1JMXA 5L7XH 3M8OH 4ERSH 1B90A 4D9QD 3AB0B 1AE6L 1NDMA 4V2BA 4HZAA 3BEVA 4FQQB 3VFWB 3DUSB 2Z31C 4P23B 4MAYB 3AFLA 4Q97A 5D6CA 4LEXH 1DE4A 1OQXA 3JWDH 1WGOA 1WSST 2P48B 1WUNT 2WBJB 1I8IB 1FYTE 2R0ZL 2D03L 4AEFA 1BFVH 4TN9A 2FX7L 4G8IB 4OLYH 1BFTA 4HUWB 4H20L 3MLYL 3UPRB 3L3KB 1ZT1B 1PQZB 1WAAE 3GKWL 1DJSA 3EDKA 4HT1H 1A7NL 1PZ5A 4HH9B 5IHZB 2VR9A 3PWPE 4NYLA 2EYRB 3BEWB 4MNQE 5EBLB 3ZDZF 1MHHA 2VLJA 3RZCA 4FQJH 4Q0XH 3VI3E 2E8ZA 4LSUL 4I5BA 2Y4SA 3DX6A 5K59E 3ROOA 1RIUL 4KRPC 4JFFD 1T1XA 3TBVA 4Y1AE 3QDGE 1HINH 25C8L 2EIZB 4WI8A 2Q6WB 3SDCC 2QQNH 2BOCA 3L3DB 5E8EA 4BUGA 4BFGA 2R1WB 1INQB 4J3XA 4ODTL 3Q6FB 4EN3A 4JHAH 2A9NL 1Z2KA 1FBIH 1DBAL 4Q9CA 1H5BC 1S5IL 2NY1C 3MUJA 5JUEL 1QLEH 3KPPA 1FGVL 4ONHB 1VFBA 1R24B 1YEKH 1EERB 4H1LA 3KLDA 1NFDF 1MFAH 1A9EB 4MLSA 5D72H 3LV3A 4ORZC 3UC0H 2F58H 2EEBA 4RGND 3TIDA 4KROD 1FL5B 3MJ8A 5DGRA 5I2IB 2VQ1A 4M6AA 1KELL 1FBIL 4XCFH 4R96B 2OSLB 3K3QA 3QXAA 4PJAA 4NBXB 3GMNA 5SWZA 2X41A 4H25B 3MV9A 4I2XA 4WHYH 1QPXA 2E6JA 3BH8A 4TNWF 3W9EA 5JXED 5IQ9A 1T5XB 3PP3K 4FQHB 5CBEB 4QHLB 4Z77B 1DLFH 1G9ML 3O2DL 2VDOL 3O6KH 1MFCL 1P53A 4R26L 1GHFH 5ITFA 3DHMA 5BOZG 1TVDA 4OIAA 1QBAA 2OTWA 1KCUH 1B4RA 5I9QB 1LE9A 1UXWB 5A2JH 5JXAH 5GQBA 4LBEA 3L3JA 3GFUA 4HGWA 1A7RH 1OD9A 4IRJB 1BJ8A 1IM3B 4PY7B 1FSKB 4H8WH 2VYRE 2I26N 3QIUC 3NIDF 4Q6IC 4OLWH 1ETZA 4W4NA 4HJ0D 4YDKH 4UQ3A 5CJBA 5GSRB 2ZP0T 3C8KA 1OAYH 3MBEB 4KZEL 4XAWH 5FYKL 1SY6L 3D3VB 3KYKL 2GCYB 2ZOKA 3BVNA 1KV3A 2OI9B 1HXYA 1C12A 4QHUB 4NQEE 5EIIB 2HVKB 3ARDA 4KTDL 5CWSB 1TJGL 5I1EH 1OTTC 4OZGE 1LO5A 3RHWF 3BUYB 3PGDB 3BPOB 4HC1H 1CD1B 3L9RB 3HNVH 4ONGH 4B7LA 4Z0BH 3NH7H 4IDLA 3MV7A 2VLKA 1CFTA 1MWAL 4XPGH 1Z5LA 1C5DA 2X9WA 2P8LA 3DROB 4M7ZB 5KN5A 4C56E 3AS1A 3IAPA 4FQJL 3RTQA 1TIUA 3BKCL 3AS3A 1CLOH 2BJML 3QIBA 1T1YA 3FFDA 4LASL 3SQOH 1VADA 4X8JA 4QRUA 1OPGL 2C1OB 2X1XR 3KPQB 4OZFG 3E8UH 3EFFA 4PRDA 3QWOA 5D2LB 4A2LA 1NBYB 4WEMB 4QHKI 1I3VA 1DUYA 4LPUA 2ZZUT 1IC5L 1PFCA 1G7MB 2DQGL 1S7SB 5IB3A 5LGJA 3H3PH 5TDPB 3GIVB 1PEZA 5AYUH 5HI5C 2VXUH 4KKBD 3Q3GB 1YEFL 2YEZB 3NIFE 5ESQA 3X3FH 4OI8A 4JFEB 5D1ZD 5IB2A 2Y07H 4X8JB 5GISL 5JIIA 1Q9OA 2VDML 4I2XE 1EO5A 1R5IA 2EE6A 1N0XH 2NXZC 5CUSH 4TULH 3UP1A 3L5IA 1HOCB 3QEHA 2RGSA 1ZLSL 2HN7A 3DXAA 4RWYL 3T1FB 1XH3A 5TDOB 3REVB 1DCLA 1A3RL 2ZOLA 3EFDL 5E8PB 4Y16D 3ZHDA 3ZDZE 5DMGC 1YEGL 3MFFA 5LXGH 2WWMC 3NZHL 4AQ1B 3KXFA 3D39D 4R4NC 4XPTH 5DFTA 5LJYH 3GDBA 4F7EB 3IDIB 4RGOL 4K3EH 5C0EB 2C7UA 1MQ8A 3VFRB 2BNRA 2VDOH 4HS3B 4LSDA 4FS0A 2OZ4H 1CR9L 2OLDA 4IOFC 4K9EC 2BSSA 3VXMD 4GG6E 2EYRA 3PWLB 4LCCC 5CP7B 3LEXA 4HAGA 2HLFD 3G04A 1XF3A 2W9DL 3CX5J 4MZ2A 4QTIL 3MRDB 3X14B 1DQJB 1BZ7B 1J10A 4PJ7A 3TPKA 4MLIA 2E3VA 1FG2A 4RGNB 3ETBF 2EXYC 1DR9A 5DMYA 1IEAB 5C71A 1OGAD 5F7YC 3TNNA 4KJWD 1A7OL 5E2VH 4M61A 1Q0XL 5JZ7C 3GSNH 5L0QB 1V3KA 3OKYA 3VE0B 2NX5E 4LKXB 1OHQA 3KJ6L 5DD3L 2DQFA 4WHDA 4OGXH 5C0AB 2NQCA 4N0FA 1IAMA 3WNNA 2DQEL 2C1OA 1BD2A 1G7PB 1TVBB 5I1DA 2KUTA 4XWGL 3NZ8A 3OX8B 5DHYA 2EDJA 4QNPE 5I71B 5I66A 3EO0B 4UUJB 4JO2L 2DQJH 3QQ9D 4GOSA 2OI9C 3WKMH 4G6FD 3ROOB 4I48A 2YD8A 3D25B 1N8ZB 1T5WA 1GC1H 3KG5A 3VE0A 3PGCB 3O3EA 3RVWD 2BSTA 3LQAH 3BPNC 4YBHA 1QKZL 4F8QA 1MCNA 4BFBD 4OJFH 5HGHA 4GMSL 1CF8H 2X4UB 4S0TD 3V6OC 5I8OH 5DS8A 4PJBB 2NPLX 5DDHA 1RULL 2DI8A 1SJXA 4GLRI 5J4MA 1EV2E 1U8MA 3OAUH 5MERA 4EQ3A 5KTEH 3S96B 1IQWL 1BLNB 4K71B 5DEZA 2EXWC 1CGVA 2CMRL 3QO1B 4D94A 4WJ5B 4ZPVA 4GG8B 4KUCF 5CP3H 3U2SA 3JTTA 4X5XB 4UBDD 2NX5D 4M5ZL 3Q6GH 5GGUA 3DXAE 2QKIA 1S78D 2VC2H 4ACPA 2RBLA 3O6LL 3MLUH 2F5BH 3GI9H 4DVRL 4NRXB 4X98A 5F7WC 4FTVD 3TN0B 3HZYA 4DTGL 4Y1AD 3RVVC 4JGJA 1P4BH 2BNRB 4OLUH 1NGXB 1BQLL 2J12B 3V52L 8FABA 4LIQE 4KK8D 3FOMA 4HCRH 3P11H 5DQJA 5F9WB 4OLZL 1RIUH 4M9PA 5FAAA 3G6AB 4ODXA 3RTQD 4LSUH 1QFPA 2MFNA 3WN5A 3W0WA 1UYWH 1M71B 4WTZG 5DK2A 4IMKC 3CH1A 1BVKB 3C2AL 4UB0H 2DTSA 5MP6L 2EO1A 3GSWA 3QI9A 5AWNH 3ROLB 4O9HL 1IGYA 4LFHD 1H5BB 3H9SD 3RZWA 3DOSA 2DKSA 3KLHD 1EEZB 1KYOJ 1FVCA 3MBED 2DLFH 5CSGA 4AIOA 3N1FC 1XGYH 3HZMA 1AIFB 4HG4K 1U0QA 1CR9H 2GJ6E 1JPFA 2HFEA 4G6JH 4QT5B 2CLZB 3KJ4B 5ESQB 3PWUA 3ORJA 2NLJA 2YRZA 4AM0A 4JPIA 4G8FB 5F3HB 4KC3B 4P5TA 4NO3A 5IEKA 3DETD 2NY4C 2YD5A 3E2HB 4ZUUB 5FUCE 5L7XL 1OWWA 1FYHB 4EUPA 4Q7DA 4PRPD 1NJ9B 5FM8A 5HYJB 5E1AA 3SCMB 1MJ8H 1UZ8B 3EJZC 4RGMB 4NQCD 2FCBA 4F37F 4PPTA 2EDFA 4Y4KA 1NCDL 5GGTA 3NCFB 1NLDH 2D4DA 2XQYK 2ZPKH 4GRMA 1C5CH 4OFIA 2P5EE 1F4WH 3MFGB 1QFWL 3HNTH 2F74A 4EKXA 4U1KA 2ATKA 5E8NA 3U9UB 5TQ0H 1ZGLP 1FNGB 4LFHG 4E41B 3VXUD 1I8LA 4GW4A 4KVNL 4FZ8L 2D7TL 4WHTB 1S7TA 1RIVH 5J06A 1A6UH 1AP2B 4HXAH 3PWLA 5CP7A 3C60A 1XGPA 4OI9A 5IBTH 3O45A 1KG0B 3HNSH 1GGCL 1S7RB 3NH7L 4R2GC 5J13C 3KPOA 4IJ3C 2VN4A 3W0WE 1FL6B 1TMCB 1U8IB 3KXFD 3PNWA 3U9PL 1G7IA 4Z0BL 3EYSL 1JGUL 1FG9C 2CK0L 1VESA 4GKZA 3VFNB 2Y5EA 1R3KB 4R0LA 4CADA 4POZD 1VDGA 4YFEA 3FOLA 4Y88A 2DM4A 4I3SH 3RX7A 4XCEB 2IBGA 5F7LB 1S5HA 2YD6A 2YBRB 4PR5B 5EB9A 1EDQA 2XNAA 4QRPB 1FRGH 3QAZB 3RDTC 2WUBH 3QDJE 1NUDA 1KULA 4JFDD 4JN2A 1MVUA 5CMAB 1HZHH 1FGNL 5DS8B 4XNZC 2WBJD 3VCLB 5J57B 2VISA 1MRDL 5GGRA 5GHWL 1NEZG 3QH3A 1RUPL 5F1NB 3GMMB 4BH8A 3PGCA 3FN9A 1DTUA 1RSFA 2Z31D 1UQSB 5ID0A 2EKSB 4JANA 2V5MA 1DLFL 1G9MH 2E9IA 2KPNA 3MLXH 3WUWA 3N85H 4U1HB 3QXWA 2O5XL 1P1ZB 1KENL 3O8XB 5M7QA 1T2QL 4XP4H 2BCKA 1XT5A 5DJAB 5A2LH 2GITA 1M05A 3B6SA 1NL0L 3INUL 4S0SD 1X5LA 4N0UE 3MJ7B 1NDGA 1AD0B 1AGCA 1JNJA 2DWEA 2R69L 4N0UB 3ARFC 4XGZB 2YPKB 3PHQB 3S36L 3UZVB 4AYFA 3IS1X 3SDDC 1TZHA 2J5LB 5I8CA 1JZ7A 4P57B 1UJ3A 3QQ3B 4H26A 2XKNA 1QRKA 4RFEB 1KIQB 2H3NA 3MLZH 1OAYL 3SDDB 1JK8B 4S1SL 4Y16A 4F7MB 2Z8WC 4DOHB 2HKHL 4JJ5A 2EDNA 3I84A 4XCNA 3VFGH 3WMSA 3CVHH 2FB4H 5B38A 1IE5A 4OGYL 4Y5VC 4BKLA 3NIDE 1EBPA 2VMFA 4IHOA 5ILTL 4S1RH 3IF1B 4LRIC 4OFDA 2FO1A 1A9BA 4R6UA 4FA8A 1UKSA 5EOCH 3RVTD 4NZTL 5I73C 3D85A 3P0GB 3DGCR 5ERWB 3QDJB 2B4CL 5MEPA 1JZ4A 3TBSA 4MHHI 4P59H 2EH7L 4KUZH 5FK9B 4FHBD 4ZUWA 3PGFL 3HAEB 3QISA 2NY1D 1VEOA 1IKFL 1LEKA 4ZPTA 2D7MA 4WNQB 1KACB 4QHNA 3T3ME 1QRNA 3QI9B 4LLQA 3U7WL 3IAQA 3P4LA 3BWAB 4XBEH 4MWFA 3H9HA 5FGCE 1U3JA 1DN0A 1IMHC 1BWWA 4RGNC 2I60H 3HLAB 4AIXA 4L8SA 5EPMB 5BW7C 1YYML 3JV0A 2O61A 2YWZA 2ZUUA 3CXDH 4U7KA 3QDJA 3L7EA 4K3GA 3OKLB 5FK9A 1MREH 2VZ3A 1W0VB 3HPJB 1FZOA 2Q76B 5ENWA 2AV1B 3RWIB 4APQC 5JOEA 4M7JL 3TN0D 3X13A 5JW4M 5EBMB 3FRUA 3LN5B 4K23H 2AV7B 1FV1B 3DVFA 5IFHH 5CSZA 5F89A 1HSBA 3OR6B 5E8NB 1KXTB 5FOBB 5JW4N 4KKAD 1Q72H 4Y4FD 4PD4J 3WUZA 1MAJA 5KVFH 2R15A 1RHHB 1WIUA 2WM0A 3TA3A 5E6YA 1GZQB 4FQLH 4HS8H 4LSRL 1S9WB 1AGEA 1F58L 5ESAB 2X7LB 2VL5B 5C2BL 1R3HA 2WUCL 3FQRB 2YUZA 3WHE1 3AC0A 5SWZE 3ZL4H 3O6FB 3L3OA 1IJ9A 4XWOD 2D4FA 3VRIA 5BO1H 5K9OA 5HYJE 1X6LA 4OF6A 2YD7A 2L7UA 3Q0HA 2R23B 2DBJA 5IV2A 2V5YA 5D96B 4KK5D 4YDVA 3QG6A 1OSZA 2NY5C 5ALCL 1R5VB 3BUYA 1C5DB 5CLWA 3DIFB 3OZ9H 5TPWL 4QEGA 5C0RH 5IB4B 1T7XA 4KKNA 3FO9A 2NXYD 4R7DA 5LG1A 1MFAL 2BC4A 2EDBA 3K4ZA 3OKEB 5CJOH 4L3EE 3QUML 5EFIB 1VACB 4GSDH 3RUGA 2BNQA 3O9WD 3S8WA 5C2BH 3TBTA 5K59F 2Z4QA 3SJVA 1MCPL 1I3UA 2VR4A 1XIWA 5I1AA 2O93L 2PXYA 3TT1H 3AVEA 4YJZL 4FFWD 3UJIH 5I74C 2V9RA 2CLVB 3OTTA 4ZYKA 2AEQL 4ZOEA 1ES0A 1KJ2B 5F89B 4BFEA 3OR7A 5JOPD 2KDGA 1BD2D 5FECA 3F62A 4L4VE 3C5SA 5GRUL 5MEQB 3KJ4C 3BKMH 4S1RL 4WVRA 1UACH 2ORBL 2F54B 5BMFL 3FN3A 3RUGB 4XNUL 4EJ1C 1OPGH 3MMEA 2BVUA 2A83B 35C8L 4ESKA 4ZTOH 5D4QA 1I85C 3RWIA 4X0KA 5F9AC 5C08D 3PWJB 4HS3A 4HT1L 2AJYH 4MJ5A 4P9HH 4XVUD 1YMMB 1HYSD 3KPTA 4Z7QE 5D7JD 1IC7L 1LEGA 3HE6C 4JPVH 3IRPX 4W6XB 3EYSH 4PJCF 5DVOA 3WEXA 4F57H 5C8JA 4X7TA 5JR1L 2H1PL 1P7KB 4ZFFA 1JNHA 5E9DD 3V6BR 5FUZH 2AAVA 5DJ2A 4Z7OE 4LAQH 2CRIA 2I24N 3UROR 2IPKA 4C59B 5F1IA 4G5ZL 1VEPA 2DQIL 2JJVA 2APFA 3NCBB 1FFNA 4YLQT 3MRKA 5DMGD 2OR7A 1MH5B 3FB7A 4OD3L 2QQKH 1CL7H 2CXKA 3SQBA 1BZ9B 4IJ3B 3STZB 5C09B 1BQHG 3RKDD 5JUEH 1ONQB 1T89A 2P43B 3KYOA 4OGZA 4YXKL 5JMOC 1QPPA 3L6FB 2ZJSL 1BOGB 3WYRA 4JFYA 2HFFB 2FNBA 3OGOE 5INCB 2E7LC 4LCCA 3RHWK 4LU5H 4DAGH 4XCNB 3GB7A 3BI9X 3QUXC 1JGEA 3DROA 4JY6A 2UZIH 4Y16B 4D8PB 4F7MA 3UX9B 3C60D 3EO1A 4NWUH 3CFEA 1WZMA 5C7XL 1OF2A 5D71H 4DKEH 1JFQH 1LEGB 2YPKA 1RY7B 4HMDA 4K7PX 3L3IA 3SGDH 1TTFA 4M8QB 4BYHA 1RFDL 3MV8E 5DHYB 2A77L 3FO1A 4F9PA 5I19H 3BT2H 4LSSH 4YE4L 3ULUD 3D85B 4O9HH 4WW1A 3TVMD 1X5FA 1PEWA 5F3BB 1YPZF 3HA0A 1JNNL 4LVHC 3FHQA 5IUSA 1J88A 1NANH 2Z93B 1IFHH 3GSOB 4K9EL 2FH6A 3MCKA 4WUUB 3C5ZC 4YIQB 1XR9A 5E6ZA 1TCMA 1DSFH 3IFPA 3U4BL 2YA2A 1OP5K 3LCYA 3CXHK 4GKSB 1UH3A 4Y2OA 4X6FB 1AXSB 4HMEA 1I1AB 4YBLB 3SY0A 4KXZH 4OB5H 4HIJA 3MUY1 1N2RA 4N1HB 5IM7B 3RVUC 5C8JB 1QSZA 5DD0L 5T33H 4ODXB 3G5XB 4X99B 1GGYA 1YEGH 1Q0YH 4MCYB 5DFVD 4F7TA 3MV8B 2VITA 1HKLH 1FNAA 4P2OA 3U46A 3QR2A 2EO9A 4D3CL 4JY4A 1UWGH 3QO0B 4WRLA 3RY6A 1O5DT 3EO1B 1HHHB 5E2UL 5EFIA 3O3BA 5FO8B 2EDWA 3F7YA 2AVGA 4P3DB 3TO4C 5SWSD 2VXTH 4HLZG 3VFSB 1Q9KB 5T33L 4MJ4A 2BNQD 3IDNA 4YUEH 3DUHA 1OW0C 5DQDL 4KVNH 1Q0YL 4OKVB 1GRWA 5H2BA 3U7YH 2D7TH 1L7IL 4R96A 3HUJE 5I1GH 1BJ1J 1X5ZA 2F53D 5E24E 4K7FB 5EZLB 3G6DH 3OAZH 1FZJA 3P30H 2ZKHL 1A6VH 4G8GE 3VFTA 1F11B 1KCVH 1NBZB 2PYEB 2YEZA 4LEXL 4NN5B 1K8DA 4JY5H 3WDIA 4TTDC 4PJDA 3JWDL 4F33B 2BNQB 1NGYA 4R90L 3RJQB 5HVHB 4MVBD 4MD4B 5D2NA 1OP5H 1NANI 4X9GA 4JJHA 4KDVA 4OQTH 2H2PD 5FYJU 2JK5B 5B39B 3H8NA 5DQ9B 4C56B 4AY0A 5M94B 1LD9A 3MGOA 4O2EB 2NNAA 5T1LB 4YAQB 4Z7WA 3WFBH 1KTDB 4HKBB 4OGAC 1DBKH 1TQCB 1JUFB 2VLKD 1KEGH 5TE6H 3IT8D 3GSRB 3TCLA 2CDGA 5GS0C 2MQCA 3HI5L 5FHBL 1FNSL 4OZHB 4A6YL 2LAGB 4OZGB 1I1AA 4TRPL 1RZKC 3SY0B 3VFVB 3MMEB 3BEWA 5BJTA 5EUKB 4HUWA 4TPRH 1X4XA 4LPTA 1BBJB 2JIXD 4QO1A 3HB3C 3RUGE 3PGDA 3UJTH 3OKOB 5DRZB 5SWQB 2FX8L 5DZOA 1X5XA 5DJXA 2FX9L 2LU3A 2ZG3A 1OL0A 4U3CA 1P9MA 2DIAA 4WEBH 5LXGL 4PB0H 1CICB 1CN4A 5J56B 3B83A 1N5YL 3S37H 4W6YB 4HCRA 1EEQA 3U30B 2V5RA 2ZSVA 1D3CA 1XR8B 4HK0B 5BJTB 4D0BA 4IRSA 4Y19B 3HR5B 3C5ZA 4MHHG 5E5MB 4OCSL 4FXGB 1XGUB 3LKOB 4FQPA 1GOFA 4PJHF 4Z7UE 1VGKB 1KBGH 5C92A 1H3TA 2HJKB 4FFZL 1WITA 3HNVL 2ICWI 4NOFA 1FSKC 12E8H 1LO4H 4U1SA 3SKMB 3FN0H 4QXGL 3GSUA 5D70H 5IVOA 5CJQL 5F9OL 4MMXC 3V5KB 3RWFB 4UNTA 3T4YB 1EVUA 4QHLA 3IU3A 1MAML 4ZDHB 1CT8B 4TSBL 3M17A 2NZ9C 2VQ1B 4LKCA 8CGTA 3C09B 4FQ1H 2HFFA 1NMBH 3LSOA 2CK2A 4URTB 1ZV5A 1C5BH 1IBGH 3CVHL 5SWZB 3GB7B 2J4WH 3UTOA 4L4VD 4LARL 5FYLE 1EHLH 2R9HC 4CN1A 3MRGA 2PW2A 1EEZA 4MXWH 1MLBA 1LO0L 2NY2C 5AEAA 1LHZA 1KT2B 1O0VA 4M4PA 4XP5L 2DI9A 4DZ8A 1VFBB 3H0TA 3SKNA 1G7HB 4PJFA 3HRZB 4AIZA 5I1LA 3OPZL 1TPXB 1Q1JL 4P9MH 1BQHB 4J4PA 3DYMA 4UDUA 4ONHA 2CRMA 2B39A 4PLJC 5F1KC 2VLLB 2SEBA 2YK1L 5ID1B 2VDPH 4OJFL 4LCIL 4XHJC 5L88L 2CQVA 1KB9J 1NAMB 3VA6A 4J3SA 3QCUL 4JDTH 1ORSB 5FKAB 5F70A 4D9RE 5CLTA 2A6DB 3I6GA 4D0CB 3SO3B 2MKLC 5HHQA 1CFNA 4M7JH 3CZFB 2FR4A 2P24B 1CLYH 4L3CB 5L6YH 3M1BA 1A64A 1H3PH 2CR3A 2IANA 2XY1A 1P1ZA 3O8XA 4QRSA 1UXSB 5C08A 2YMXL 3ZHKA 3BMWA 5CD3B 1CE6A 1UVQA 5CWSA 1PAMA 3MLUL 1T5XA 4P2QE 4G9FA 2GW5A 2LTQC 4KH2A 3K80A 2WAHA 3QHZH 5EOQH 3FB8B 3QPQD 4HUMB 3VJ6B 4U1GC 3QIBD 3WDJA 3JV4A 1EA9C 4P5KB 2M26A 4OZIF 4KMLB 3ARFD 3QRGL 1S5IH 3ZKQD 1FYTB 3SGEH 4GW4B 4PTUB 5EC1A 4MA8H 4S11A 2EH8L 3U9PH 4NKQB 2BY1A 5AYUL 5B8CC 5JQ6H 1J1PH 3RL1B 3MV9D 1E4XL 4JFQA 2FRGP 3NABH 3L3HB 3GMLA 4ETYA 1F3JA 5EOQL 3BRFA 1RQ5A 3SE8L 2JJTA 3FO0L 1WJ3A 4ZXBD 1B9ZA 2HRPH 4JZNA 1T3FA 3FT4A 4FQQA 4MS8D 2XZAH 4M48H 4KVCH 4MAYC 3IDJB 3HG1B 5D7SH 3H2WA 2ZG2A 1Y18B 1B0GB 2PXYD 2J8UF 3MREB 5KAQG 1ZHBA 2VNCA 1NPUA 3BPLB 1IZJA 3EYUH 4U1IB 1VPOL 4Z5RB 5I1CL 3O3BB 4KXZI 1NGYB 3CSBA 2NY5L 3ARBC 3O2DH 1ZS8B 1UZ6F 4K3DL 1ZANH 4G6KH 2BVOB 5I30L 3QEHB 5D93B 3NVQA 3KNBA 5SX4H 1T2QH 4JO3L 1DUYB 5CSZB 3SHSA 2W9EH 2HFGL 4M62L 3A0OA 4BJLA 3N85L 4YR6B 2FLBT 1URLA 1AC0A 4J23A 5DEFB 2NY6D 4EDWH 4PJHB 1KJ2L 1MHPH 2P5EA 3RDTA 4HBCL 1IEAA 1HHKA 2Z31A 4XAWL 4APQD 1V05A 1CDUA 4WTXA 5LGJB 1FZMB 1QRNE 3ZE1E 1PYWB 1HXMB 3P4OB 4KZDL 2IFFL 4PJDF 3OWEA 2WINB 5K9KA 2IANE 5DVKA 1PY4A 5ICXB 5ISZE 1K9TA 3UPAA 3I85A 3VFWA 1D5ZB 3CSYB 3MRPA 4AL8H 3BXNA 4G3YL 3U6RA 3MGOB 4O2EA 4Z7QF 3WNMA 4HKXA 1LK2A 3VG9B 1CFSB 4XNYL 1MWAH 2KH2B 4HZLB 5E2TH 5DA4A 3IJHA 5I6XC 2GIYA 2XKSA 3MBXH 3RPKA 2CIIB 3L7FA 1N6VA 3BGMA 3IU4H 4WI3A 3VGDA 2X70B 4N8VB 3BMVA 3DX8A 4NZUH 5HDQL 3QULA 2AJSL 4AG4L 3X3FL 1MHCB 2B4CH 1HYRC 1A7NH 3KHOA 5A16A 1A6AA 5L2JA 4OD1L 2OBGA 1Q9OB 2KL6A 2O5ZH 1MLBB 1NUNB 1X7QA 5A3ID 3QNZB 4WEBL 3O9WC 5DRNB 3MRNA 5D8JH 1BLNA 5LWYH 2P5EB 3VG9C 2A0LC 3O4LE 1S7QA 2BSTB 5LQBH 1MLCA 3CSGA 3DJ9A 3OR7B 5HHNB 1KYOK 1FDLL 2VLRA 1T5WB 1TZIA 2AK1L 3BIKB 3GI9L 4OFVA 3A6CH 1A6PA 5FKPA 2A9NH 2AXFB 3L3JB 3FO2A 5T3ZD 4MJIA 3DO7A 3P3YA 3OL2A