1MCPL

Phosphocholine binding immunoglobulin fab mc/pc603. an x-ray diffraction study at 2.7 angstroms
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
220
structure length
220
Chain Sequence
DIVMTQSPSSLSVSAGERVTMSCKSSQSLLNSGNQKNFLAWYQQKPGQPPKLLIYGASTRESGVPDRFTGSGSGTDFTLTISSVQAEDLAVYYCQNDHSYPLTFGAGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IGA-KAPPA MCPC603 FAB (LIGHT CHAIN)
publication title Phosphocholine binding immunoglobulin Fab McPC603. An X-ray diffraction study at 2.7 A.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immunoglobulin
total genus 40
structure length 220
sequence length 220
ec nomenclature
pdb deposition date 1984-07-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1mcpL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1mcpL01
5E6YA 5CEZE 4RQQA 1A3LL 4WFHD 4FXKA 4G42A 2MQ0A 3FRUA 2XWBA 3VG9B 2HJKB 3CGTA 2IFGA 4XMLH 1ORQA 3UYOD 4P4KC 1U92B 3V4PL 5DQ9B 4D9LL 3C6LC 1MNUH 4Z7WB 15C8H 5DJ8B 4LSPL 2V9QA 4G43A 4QXUH 1LEKB 3CVHB 1MI5B 1FIEA 4F8QA 4OCSH 1LO4L 3KVQA 4D0CA 3VI4E 4UT7H 3N1QC 3MRRB 5C86A 3KYOA 4MB4A 4KY1H 4OZ4B 4P9HC 5HDBE 2R2HB 1M05A 3PWPA 1CDUA 3TO4D 4KI5C 5ACZB 1R5IA 1IEAA 3QSKB 3WFHA 2DYPD 3EOAB 2IALB 1JWUA 4DCQA 1U8HB 1AI1H 2NX5E 2QQKL 4IRJD 4WHYG 1ZHLA 2C4FT 3WUWB 4K9EC 3EFDH 4L3CA 4HUXB 4PGZA 3SCMC 1WZ1L 4NUGL 1BAFL 1DBBH 2WBJB 3TBSA 1EFXA 1NBQA 2C7UB 3T4AB 3PE9A 3S4SG 4OZGF 3N9GL 1LWRA 3FQRB 4R7NB 1EEYB 3LEYH 3CMOL 4H0HB 3GSWB 3KS0J 4ODTH 5IMMA 2NYYC 2BNQA 4UNUA 2OJEA 4HK3J 1KCLA 1KLUB 3GSNH 4LP5A 3VD5A 4JO4H 4NHUA 1AIFB 2OTWB 2Q86A 4W4NA 5GPRA 2H3NA 3KPRE 1AKJB 4NP4H 2D0HA 5CJQL 4QKXB 4Q97A 4BM7A 4X6CF 4JPIB 4RWYH 4ZFOL 3FB5B 2ED7A 5BW7C 3MV9D 5GGVH 3DHMA 5DSCB 4WWKA 5I15H 4E5XB 4OZHE 5FYKD 4OZIE 3PL6B 5ISZA 5EBWB 4OQTL 4E41A 2QHRL 5D7IE 2O5ZH 5LVEA 2VERN 4OUUB 4YHML 5DDHA 2XQYG 3DGCR 3DO3A 3CVIL 2BNRB 2XTJB 3PDDA 2HWZH 4PREA 4UQ3A 4FQCL 1I1FA 1J9CT 4P23B 3A67H 4RX4D 5FUZL 2Z35B 2FGWL 4D9RD 1TLKA 3ECBB 1G7PA 2CXGA 3BKJL 3QNYB 4DVRL 1DLHA 3QCTH 4P99A 5E2VH 3RAJL 4UU9A 1WGOA 3P73A 4I4WA 3VFUB 4WFFD 4ELME 5J89A 4LEOB 2P5WA 4ORZC 5CUSH 4EN3A 5EU6B 5KSBB 2B2XH 3FB6A 3UTQA 3TA3D 3KHQA 4LPUA 4PRIA 1RHHA 3ARBA 3LQMA 2CLRA 3OAYH 2IBZX 5FYLL 3HLAB 5TGBA 4Y89A 1LO0H 1V3KA 2FJGA 5BOPA 2R29H 2YPLA 1RFDL 4XCYA 1ES0B 4KMLB 1P9MA 1HHHA 2B4CH 4WW2B 1RK1B 3FB7A 5GQBA 5I8EA 1TVHB 1RI8A 3NZ8B 5TF1H 2NY3C 3TT1H 4Z0BL 4N5ED 3BZDA 4KQ4L 1JUFB 3JXAA 5C0IB 2UYLA 1CGVA 1I8IB 1S7WA 2JTDA 3C60A 4PJXE 5IK3B 3VXUD 2NQCA 43C9B 4G6FB 3V7AG 1A0QH 4HJJL 5F7DB 1KBGH 3P77B 3QXDA 5IBUB 5B8CC 4L4JA 3C5ZD 1UACL 4QGYA 2GK2A 3M17B 1QHPA 5F88B 4EUPG 5D8JH 1ULVA 3MREA 2DOCA 3HR5A 4I9WD 5K9KA 1T5XB 3Q6FA 3SDXF 4NYLB 5GSVA 4LIQH 4PJDF 4U1LA 1FFPA 1OP5K 3U46B 1WF5A 4PBWD 5I1GH 3EGSB 4O51B 1N4XH 1OD9A 2HLAB 3H7BA 1UJTA 4TUOA 5DD1H 5HHOA 1BFOB 5F9OL 5IMKB 5ESVA 1IAKB 4HKZA 4IDJH 4JFZH 5JW4R 5F9AC 1S5HA 1VEPA 5D5MF 3UXFA 2JCCF 3KPQB 4DGIH 1P84K 4F57H 2H32B 1J8HE 4G80A 1IARB 1QSEB 4GRWF 3B2VL 4Y1AA 3V52H 3DV4B 1D9KA 3OJ2C 4JREC 2UWEA 3X11B 1H8SA 5C2BH 1BLNA 4X6EA 2AJVL 3FHQA 1F11B 4JRXE 2X89A 4KZEL 1CG9B 4PJ9A 5LKNA 1JRHH 5F7HA 2YRPA 4OCYH 4HXAL 3HI5H 3I6KB 4FS0A 5IBLD 3O6FB 4PD4J 2AJSL 2UZXB 2OS7A 5FO8B 4RBPH 2ADJB 4OB5L 3JSSA 4G9FD 5F9JA 3GHBL 1LILA 3HZKA 1NCCL 3FN0L 2GHWB 3ZDYE 2EC8A 1RU9H 4WEBL 4IHOB 1KYOJ 1TZHA 2AXFB 5IVOA 3I6LE 1CK0H 2YEZB 3BPOB 4P5TA 1RZGA 4MLSA 4FQ2H 5FYLE 1YQ2A 4DKEL 4XXDB 2ZCHH 2CO6B 2G60L 5FYJL 1A6TB 1A9EB 5ADOH 4HGWA 4QT5B 5DFVD 1A22B 2IANB 1SBBA 4KK5C 4XP4L 4XWGL 2IPTH 1N6VA 3GK8L 3GKZA 5DO2D 1H3WM 1WIUA 4YWGL 5T3ZH 4NN6B 2V7HB 3WIHH 1S3KH 4NO5B 4M61B 4XNUH 3V5HA 2GKIA 1FLRL 5IBTL 2FEEI 5CJ5A 5DTFB 4X99B 4BKLA 4NNPL 5I17B 2Z91A 3IDMB 3K74B 1XR9A 5GRVL 4M48L 4UOJA 2OTUA 3B8YA 3EJZD 3TBVB 1LEGA 1Z6JT 4N8VA 4P48A 2C3VA 3DMMC 2FATH 4WGVB 4HKXB 5DD5L 4P49A 1OTTD 1N64H 4GMSH 2GSGB 1UM4L 1MLCB 3ARGA 4K7PX 3OKOA 4L3ED 1U2CA 1DDHA 5HHMB 1XGRB 1N5AA 5IQ7H 3H42H 1YEIL 1YMME 1FYHB 5GGQL 4Q58C 5E4EC 2Z8VC 5IB4A 2WAHA 3RGVD 3IDJB 4MX7A 4LVOC 4H20H 4YDJB 1OL0A 1RPQA 4BQ6A 3U0PA 3GSNA 2EH7H 5F7KC 4U7SA 4Z7UB 4M3JA 1CTOA 2YUVA 5GGRB 4JG0L 4WHYH 4HG4K 3QO0A 4N0UE 4KI5F 4OLXL 1YNLL 4ZTOL 3QXTA 4RSVA 1A14L 5FECB 4YHOH 3BGMA 5EFIB 1AQKL 4P59H 2EXYD 2XXMB 3CSGA 1A1MA 4R0LA 1L0QA 3TYFA 4PJ7F 3GBML 5EPMA 2ARJB 2ZUTA 1UCBH 4OF3A 4FOMA 3MOAL 2NY2C 4QHMA 1QRNE 2AGJH 2JLLA 2D7TL 1INDH 1HXMA 5C3LD 2OJZH 3F7VB 3WO4B 5E8NB 3P40A 1CD8A 4PUBH 2EDNA 3P9LB 3VXNA 2AV7B 2EIZA 4LVEA 4F7EB 5D2NC 5I73C 4OI7A 1FNFA 3L3GB 3W5NA 5D7JC 1E4WH 5JMRA 3SQOL 1N3NB 1SQ2N 3I3BA 4OFYD 4ZYKB 4QRRB 2JJTA 5E5UB 3T0EC 4AENA 5CJOL 1Q0YL 4CMHC 3B9DA 1MI5D 4TULL 4N0FB 5GS0H 2WNGA 4N90E 5EU5A 5IF0B 4ODSH 4F7CB 3AB0C 4EQ3A 1BX2A 1BOYA 3DX8A 5C0BB 3VDCA 1FNGB 3IS0X 2VLMD 4JE4B 1XF2A 1BP3B 4XCNA 1VKXA 5D6DC 3SKJL 9CGTA 1NGQL 2A73B 4JPVH 3KLSA 1WFTA 4I0CC 3O3BB 1J5OL 2V2XB 5SV4A 3DBXB 4JANA 2PW2B 1UH3A 2YUZA 4PTTB 4MDIA 3RY5A 1HEZA 2GI7A 5DUBB 2XZAL 4I2XA 4L4TB 4AEHL 3LN4A 2VH5L 2AK4B 3RHWF 4QOKB 4BYHA 4ZS6C 3TFKC 1XGTB 3IXTB 4D2NA 1N7ML 5DR5L 2WBJD 3DRTA 3A6OA 4FXLA 2AJUH 3TPUB 4NBZB 1CL7I 1A7RL 2COQA 2BSED 3LKNB 3PHOB 3QDJA 2LAGB 3BVNB 3EYQC 4XTRC 2PXYB 1B2WH 3PWJB 4KRPC 1C5CL 4O00A 1LHZA 2X4SA 4LHUG 5E95B 3CK0H 4WU5A 3VI3E 1FN4B 4M1CD 1NJ9A 4MJ5A 3G5VA 4Z77B 2N7AA 1FNHA 4M03A 4K2UL 4HBQA 1MSPA 2FWOA 1K6QL 1MCOH 3WLBA 1AY1L 1AKJD 1B0GA 1ZWIA 3QIWC 2XPGA 4E0RA 1UXWB 4X7EC 4OD3L 3OF6A 4J6RL 4FXGA 2H45A 2YBRA 1I1AA 3VI4F 4N8CL 3VXOB 5FK9A 5HDBF 3OPZH 1RJZB 3P11H 4ZODA 4LLMB 2CKNA 2MCG1 5GGSA 4BFGA 4NO3A 2F8OA 3FQUA 2R1XB 4NQCA 1MHCA 3ZE2E 1RUPH 5D1ZB 2X4UB 1VHPA 4UINH 3KPMA 1CDYA 2CKBL 4HV8A 3HHRB 2VDNL 3SE3C 3RY6A 3AGVA 2BNRD 2XTJD 1GGTA 2ESVE 3ULUH 1RUQL 1HH9A 1H5BB 4P23D 1FVCB 4LLQB 4JKKA 3RVWD 1I9RL 1T0NB 1QR1B 1NSNH 4IOFD 3RWFA 3PQYB 1G9EA 4PV8B 3K46A 4PV9A 3WLWC 1I7RA 7FABL 4JDZA 3E2HB 2K3TA 5FHBL 1XIWC 3SJVB 1MJ8L 2V7NA 5DJYA 3AM8A 4KTYA 4MQSB 4K3HA 5IG7B 2BOCA 5SWQB 3I3DA 3CXDL 4UDUA 1LDPH 3UBXA 3LHPL 4KK6C 1L0XA 2Y25A 5L2JB 1UC6A 1NGYB 5EU6D 2FO4A 3E6HB 1UVQA 1F02I 4OIIL 4Y16C 1IT9H 1JZ2A 2WZPD 3ILPB 1QA9A 1U8LB 4L8SC 4MXQC 4OFVA 5I71B 4BUHA 4NO2B 4GW1A 1RIVL 5EOQH 4DAGL 1AP2A 2ENYA 3HPLB 1XF5A 3L5HA 5FDWA 1FYTA 1X7QA 4L9LC 4ELKB 1K3ZA 1OVZA 3PWNA 3WIHA 2N4IA 4EIZC 3NCYS 3UPAA 1R0AL 3PNWB 1ZA3A 5GSRA 1G1YA 4MA7L 5KS9A 3GRWL 4J4PA 5D7IF 1IGFL 4Y2DB 3NIFE 1NUGA 4PR5B 2VUOA 3RWJB 3IKCB 5HVGB 25C8H 1JHTA 4MAUL 3V5DB 1QG3A 4X0KB 4G6FD 3CXHJ 1CLOH 3C09B 5HVWA 5J1TC 4CVXA 1KCSL 1S7VA 4FZEH 4X7FC 4RGNE 1S9WA 1IC1A 4M1GL 3VG0H 1RZ8B 1CFTB 1K85A 4XAKE 3B83A 4JPKH 5EZLA 3MCKB 2XWJB 3MLRL 2ITCA 3QEUA 2BVOA 1F8TH 4LSSH 2X05A 3CSYA 2DBJA 3C6SB 4NQVB 2XKNA 5AG9A 3D9AH 4NWTH 4ELMF 3RA7L 1CGSH 3V0VA 1JGDA 3RQ3A 1WTLA 3LS5L 4ODXA 4DUVA 5JPNB 3S34H 5IGXL 4ENED 1CDHA 3H9HA 1EAPB 2H1PH 3WKMH 4XMPL 3AS3A 3BKCL 1E28B 2WMPA 3LQAH 4O02H 4M9OA 3BPNB 2LU7A 2XY1A 4WJ5B 2PNDA 3O6MH 2A1WL 3HAEG 3RWDA 4G7VL 2VDRL 5D7LA 5E08H 4HK0B 4IJ3C 3MRMB 2XXCB 2HRPH 1YEDB 3FT2A 5CJ8A 1QSED 3FN3A 3ZHLA 1I3GH 5L2KA 1RJLB 4LDOB 3CLFH 3GO1L 4YBHA 2WV3A 5EUKA 1ORSB 2K1MA 1F4WL 3N1PC 2VLLB 3U36A 1KFAL 2NNAB 3D0LB 5TQ0H 1TJGH 3JVGC 1G7QB 4N1HB 1TQCB 1RURH 4NQED 2CRYA 4K3GA 1FFRA 4CAGA 1DSFH 3IU4H 4DN3H 1JZ5A 3QDGE 3O6FD 1XFPA 3LMJL 4NQSA 3NCCB 1ZT4B 5ESAB 1P7KA 3PGFH 3S37L 1QFUL 3ZMRA 5JIHA 3GSOA 2HRLA 2J5LB 2IAMA 5F6HJ 2CDFA 5C09B 4XBPB 1HI6B 2JKXA 5EU3A 2OR8A 3BIAX 3NPSB 3AMKA 5IHZA 5J1SC 4Y4FA 5C0GB 1UGNA 2IAND 4Z0XA 4F58L 1YYMH 1GHFL 1H3PH 4C57C 5DEFA 4HJ0C 2R8SH 4KRNA 2JJSA 5TE7H 3THML 1F90L 2DQHH 4WNQB 2GSIA 4XWOD 1NCDL 4P46C 5IM7A 2F54A 3GSQB 3ZKMD 3SDAA 1GH7A 4LSRH 2DMCA 2C4XA 3DVGA 5CKGA 4IOIB 4PJ5A 5KJRH 4WY7H 1ZA6B 2JJVA 4JR9H 2CR6A 3VWJC 4PRHB 5C07B 3UYPA 1D5IH 4U1HB 1YEHL 2MCPH 3EOBB 3O41A 3RTQA 3VXMB 3VXSB 2NXYB 4EI5B 3TYGL 2KKQA 2NZIA 1RVFL 4Q9CA 1ZEAL 3QIUA 1LD9A 2H26A 3LPFA 5HHMD 5KSAD 4K55A 4PJGA 4H5SA 4I18C 2BVTA 3OKYA 3RZCC 4HH8A 3LKQB 1ERNA 4MD5A 5DUPH 5I1JH 4NT6A 2A9NL 3IETA 1RV6X 1MCPL 2EIDA 3PF2A 4R7DA 4CDHA 4H26A 1AD9A 5FB8B 4XB7A 4XPBH 5T1MB 4F9PA 4RGNC 1JK8A 1NEZA 2VKWA 1OAUL 4XNMB 2G75A 3MRKA 4JVWA 1L7IL 3QUYC 1QLFA 1JV5B 3OL2A 3U1SL 3W82A 3UPRB 3I02B 2DQTL 2VLJE 1DL7L 2A6KB 4TUJB 1WCBB 4X6DB 5MENE 3K2MC 3RL2A 3CU1A 5D93C 3DARA 2J88H 3JWOC 3ALPA 3ALXA 2WIMA 3MJ8A 4M7JL 3S5LA 1JMXA 2DBLL 4WW1A 3SO3B 3VRIA 2OZ4A 3QQ4A 5BRZB 5HVFB 1PAMA 3UJTL 4OJFL 3MV8B 4IS6B 5EWIL 1H3XA 3VFPB 1CFVL 5D2LA 3WEXA 1X3DA 2F53E 3QEQB 1SJEB 4M62H 4Z7VE 3I6GA 3VFTA 2VDPH 3E0GA 4M02A 3D25B 4U2YA 4YHNB 4ISVA 2GCYB 1GOHA 1IGTA 4Y5XB 1JP5A 4YHIB 3TZVC 4UTAH 1X6LA 2F9BT 2HJFB 3DX7A 5EOTA 4JFXB 3W0WE 1A4JA 1WIPA 2FJFB 4NQUA 4OCNC 4TYUA 5HYSB 4PP1D 4QRRD 3CFBA 3QBTB 4KUZH 3WFEH 3FZUC 4GXUN 2GYSA 1UH4A 3L3KB 4LVHC 4HAFA 4YDVA 1EO8L 4MD4A 3GB7B 5C0BD 1A7PH 1EUUA 4HQQH 2OL3B 1JHLL 1A1OB 3BQUB 4NHCL 2BSTA 1GGUA 3KWWB 4PB0H 5GRJH 5CD3B 4TUKL 4RRPG 3MLXL 4YFLI 1KUMA 5FM8A 3PGCA 1FGNL 3TH2T 4HWNA 5MERA 5DJ0A 3ELAT 1A7OH 2EDLA 1BQHA 2W0FB 2DQUL 2DM7A 3IJSB 4ODUA 4YO0A 4Y5YA 1BZQK 3LKRB 3NCJL 1EZVX 2VIRB 4N0YH 2F19L 3RJDA 1HOCA 4L4TD 1SM3L 3LD8B 2APXA 5JXAL 1PQZB 2AK4D 4QOKD 1U58B 3RDTA 1T04B 1ND0B 2UZYB 3KLAB 1ZLVH 3CH1B 2E7HA 3QQ3A 3DRQB 4JDTL 3O3DB 3T65A 1QBML 4YQXL 3OHXB 5HD8D 5DHVB 2PXYD 1S7TB 4CKVX 2D03L 1OM3L 3D18A 4FQHB 1IGJB 1SY6L 3MPCA 4AM0B 3WS3B 4I0PC 1YJDL 1OAZL 4IMLA 3O2DH 3EO0B 2CMRL 4PG9A 3HN3A 1D6EB 5D96B 3S4SB 3TIEA 1MFBH 1MY5A 5EO0A 1KCVH 2Z31A 4UV7H 1JGUH 2X1OA 5JMOC 2DIAA 4LCWB 4OLWL 3RWIA 1GJIA 2OTWA 3FT4A 2NY5L 1P1ZB 3OXSB 1WBYA 5HTSA 1A6PA 1FFOA 3V0WL 5CWSA 3WIIL 5J3HD 1PX4A 3IDNA 1NKRA 5D1ZD 1A5FL 4OF6A 1KJ3H 1G0XA 4FP8H 2VC2H 4YPJA 5DI8A 4JZJC 1MF2H 3L6FB 2F58L 4JHWH 5C0CE 4C54A 2AEIT 1WZKA 3IF1A 5LGHH 3TVMC 4M6OH 4BH7A 3QDMA 1FE8L 1YEKL 3MRQB 4DKAA 4Z76B 4OZGA 1WT5C 3U2SA 1PX3A 3QQNA 3SGDH 4CNIA 2B0SH 2P8MB 3FQWA 3ZE0F 2AJYH 1JGEA 1XCQA 2IG2L 1DLFH 3PQYD 3IB4A 1SMOA 4OLUH 5CLTA 3QEHA 4S1QH 3SJVD 2XKSA 3S98A 4XZUA 1UA6L 3KYNA 4KJWD 1F58H 3TJEH 1C5BH 3HAEH 4NIKB 5I1LA 2Z0BA 2EDHA 5IMLB 4MJ2A 5A2LH 3OZ9L 3F7QA 1IAMA 5K9JL 1T1YA 1D6VL 3MQIA 2FB4H 3MLUL 2AEQL 4XX1E 5C0ND 3VI3F 4NC1E 2ZUQC 3EHBC 1DQLH 5E1HB 2QLVB 2A74B 2HVKA 3DVIA 4YIQA 4WUUA 1X5JA 2GW5A 4CADB 4E42A 3B43A 1ZLWH 2B7DT 2CLVA 3W39B 4K9EH 3DXAE 2MNUA 4U1MB 3Q5OA 5BV7B 1BJ1H 3HMXL 4ZQKB 4LF3B 3DGGA 1GZPA 5GISH 1KB5H 1U8MB 5C0AE 1IAIH 1GAFL 1RJYB 1BZ7A 2OM5A 4G8EB 3P3YA 3ZE2F 4Y2DD 3H6JA 5JXEA 1G9ML 3D3VA 2EDQA 4YAQA 1T7ZA 5SX4I 4KVCH 3NABH 4JO1H 3SDDB 2ERJB 3HG1B 4XP6L 4U05A 3G9AB 3EYFA 3DO7B 1RY7B 4JM2B 1XZ0B 2VISA 3WS6C 1QQDA 5L9DH 3JV5A 3FONB 3F12A 3TP4A 2ICCA 1XCTA 5DK2B 2W0KA 3X3GL 2BVQB 1EHNA 3O8XA 3QEGL 2MHAA 1JYVA 3AAZB 5LWYH 3BE1H 1DBJL 4UT9L 3T0WA 4U2ZA 2EYSB 4OGZA 3RUGB 1C8PA 2VSCA 2IF7A 3TCLB 1JF1B 2DF3A 4QYOB 3A6BH 3S3PA 3AMLA 2EE2A 3D69A 4EUPB 4EBQL 5FF6B 1GZQA 4PY7B 1VADB 5I1DB 3VWKB 3SKUD 1NFDB 5EIIA 4I3SH 4X80L 1MRDH 4HULB 1EEUA 4I1NB 3HNVH 5AG8A 4R9HA 3PXHA 3S9DB 3F7YB 4LHUA 1M6OB 3FJTA 1IEBB 3DURB 3FQTB 2Q8BL 2WWKO 4JHBA 2YD4A 1AR1C 2PCPA 5I8OL 5CEZH 2A6JA 3P0YH 3U6RB 2F8XC 1NFIA 3SDXA 3VRJB 3QHZH 5FM4A 5I75B 2X1WL 5GS1B 5DT1H 3MO1B 4PJDA 3GSUB 3QPXH 1U8NA 4NQEA 4P2YA 5IIEA 3AXLA 1OTSD 4PGBB 4YBLC 3CX5J 4QRUA 5E00B 4U3HA 4XC3H 4OCLC 2ZUUA 5C09D 3W5MA 4JKPH 5FHAH 2WUBL 3F5WB 1EGJH 5DK0A 3IDIA 1L9MA 2JCCA 5EZOH 4B53A 2IQ9H 4PGEA 3SGEI 3F6LA 4LLVA 1UYWL 2V2TA 4Z5RA 1NAMB 2F5BH 1QPPA 2EE9A 1F4AA 4XI5C 3WIFA 3A6CH 1OD7A 5KSVA 5D9SB 3O6LL 1EHLH 4ODHL 5CS7A 3SE8L 2H2PD 4HUUB 1S7UA 2VJXA 5E2UL 4TN9A 4AIOA 3RWCB 4O2CB 4OM1L 3CDGB 1ZLUH 4ZNEE 3RNKA 4PRHD 1FRGH 1K9TA 1OAXL 5C07D 5HHXH 3MODH 3TLRA 2G9HA 4XPHL 2DICA 3NA9L 5GGSY 3VXMD 4QXGL 3VXSD 4EI5D 2NXYD 2AK1H 5J9PA 2MMXA 3STLA 5JHDA 3GJFA 3SOBH 5JIKA 4F2MB 4XPGH 3VXRB 4HT1H 5DMIH 1T1XB 1NGWA 2ZSVA 4WVRA 4XNQA 5F1OB 3V6FB 2EZ0C 1OSZA 1JPGA 1VFAA 1UJ3A 2V17L 4Y5VC 5F1KC 4XVUD 1U95B 1P7QB 1JGLL 5KSAA 4HC1H 1OPGH 4XVTL 3HPJB 3O2DA 1QYGL 1T3FA 1IGIL 1WTGT 1U8KA 3NTCL 1CGTA 1JNNH 5EUOE 2AQ3A 4DEPB 3OKDB 4MCYB 2OMNA 3GHEL 3ARDA 1QO3A 4K23L 3BZ4A 1E4KC 3U79A 2EDOA 4JRYE 5I76A 1Q72L 3UTPD 5IVXB 2R0KL 4HWEL 3RNQB 4P5KB 1MHPL 4K3JH 3UYRL 2BCKB 1EJ6A 2G5RA 5FOBA 4GW4A 2VXVH 3BW9A 4UOW0 2ZJSL 2Y7QB 1S9YB 1NDGB 5JO5A 3C08L 1Z9SA 3KXFE 5BRZD 3UTZB 1A7NL 2BSSA 4XPAH 5DJ6A 3MV8D 3DVNA 1A64A 3V2AR 4H88L 3ZTJG 4P4KA 3QEQD 3C6LA 1I8MB 2ARJA 1I1CA 5H94B 3PWVA 1OGAA 4MA3A 1ZLSL 4LBEA 3V4PH 2EKSA 4YHYB 1NCAL 4X6CB 4W6XB 1OW0C 5J1AA 3S6CA 4Q9RL 3EDKA 3MLZH 2GITA 3E6FA 2HAZA 2R56H 4JQXC 4CW1B 1T1ZB 1FO0B 2BOBA 1QSVA 2VLKE 3WFZA 4JO2L 1IGMH 1P4LA 3U9PH 3C8HA 4R96A 1RUKL 3NAAH 4YHKL 4D0DB 2Y07H 4MDJB 3MBEB 5DHXB 1G9NC 5DJ2A 5DA0B 4Z9KB 3GM8A 4KVNL 4K7PH 1LK3L 1QSFA 3HNTL 4OD2A 3BQUD 4KKBD 4HXBH 1U8IA 3UO1L 4HCRH 3IFPA 3HR6A 5C0FB 2P4AB 2E9WA 5ID0A 1AO7E 1R6VA 2QQKH 3RKDC 3SCMA 1KJVA 5CGYD 1S7RA 1U3HC 4WO4C 1KB5A 1XAUA 3KJ4B 1R3HA 5F7FA 3VH8A 1Q0XL 1WZ1H 4NUGH 4XAWL 3CFKB 3MNVA 2JF1A 3B8SA 4DTGL 5MEPA 4WEUD 1WJ3A 4G8IA 2DLEA 1HH6A 2ZOLA 3VFWA 4KMQA 3GSXA 3PV6A 3CMOH 1WWCA 2HFFA 4M8QB 5C08A 1FVDB 4QRPA 3HI6L 1INQB 3BP7A 4RA3A 3UAJC 4AH2A 2DM3A 3L9RB 3RVXD 4KQ3L 1IRAY 5C3TA 4OV6F 2AK4A 5DVOA 2C26A 5E94A 1QVOA 5BW7A 4N5UA 1HQ4B 4RWHA 4K71C 1WFOA 2AEWA 2O61B 4LCCB 43CAB 2IGFL 3L3IB 1ODAA 5IP4A 1E4XI 4YDLB 2D4FA 3QZWG 1TVBA 4PRPE 5CD5C 1MRFH 3LRHA 4HUWA 3RWEA 2YZ1A 1N0XH 4GAYB 1P53A 4FQJL 3OR7A 1H3GA 5EOCJ 4UBDD 2QR0B 2DMKA 4OQTH 2QHRH 4EEEA 3S96B 4LCWD 1EUTA 1I3RA 3O9WC 4XBEH 3MV7A 4YHMH 5IV2B 3TNNB 3BD5A 3UTTB 3CVIH 4JFPA 1Q9LB 4N0CC 3RPIB 3HE7B 2V5MA 3REWB 1HHGB 5I8CA 3DPBA 1NGXA 5IROC 3QQ9C 1OOAA 4OLEA 1W0YT 3AU1A 4H1LG 4PJBE 5FUZH 4MA8H 1X5FA 5L8KB 3JWNC 1RAMA 5LGJB 3FO2B 1RJZA 4M7KL 3GMPA 3KPOA 1CXFA 4DVRH 4NCC1 1ZSDB 2DN7A 2VO5A 5BO1L 3VFVA 4BH8A 2DKSA 3RL1B 3OKMB 3K4DA 1UWGL 5F3HB 1OF2B 3QG6A 5T1LB 1R3IH 3NGBC 2X41A 3MNWB 4GRMA 1FV1B 4MMZC 3KLHD 3O0RH 4NQDE 2J6EH 4MNGE 4RISH 1UCTA 3G6AB 3B3IA 5D5MB 1PD6A 2A6IB 3MNZB 3KG5A 1EGJA 2HLFD 5FYLH 3IXAB 3K1DA 2NY0B 3QWOB 3QIBB 3UZEA 1MRCL 1X6NA 4JO3H 3IFLH 3ISWA 3L95B 4PB9L 5ITBH 1HHIB 2I24N 5FUCE 3VD3A 2LE9A 5IW1B 5CBAA 3NN8B 2W9EH 5IR1B 1U93A 4Z0BH 3SKOA 3BGFC 4KQ4H 4LFHG 4EDXB 3MRIB 2HTLC 4GS7C 4QXWA 5TDPB 3G6DL 2B1HL 3ZYOA 4ZSOE 5DD0L 4HJJH 5F7EH 2APFA 3BO8B 5J06A 1PKQA 4KRMB 2OX5A 3SDDD 2JELL 1R3LA 3JTSB 1MCIA 3HG1D 1MQKL 1UQSB 4MS8D 4XNZC 4Y2DA 4JM2D 1J12A 4XRCB 5D7KE 5C0JB 3MYJB 5EC2B 2YK1L 1RMFL 1A2YB 1T21B 3H0TB 4ZS7L 4ONHB 2GFBA 3LKPB 4EXKA 3W2DL 1PY9A 1RIHL 4G6JL 5DVKA 1T0MB 4HC1A 1BVLA 1MCNA 4D9QE 3O3EB 3WL9B 4ODWA 4U1SB 1Q94B 1IQDA 2VOTA 4FQLL 5FA3A 1WITA 3ARWA 4NO0B 4HIHB 4JFFB 4ZTPL 3HI1A 4HMEA 4U31A 5TH2A 3C5SA 5CZVL 4S0TD 2OSLA 3B2VH 1G84A 3VWKD 4LPWA 5I9QC 1BD2A 5F7NC 4TSCL 4XXCC 5C9JB 5D7IA 4NZTH 1G7LB 3PP3K 5CZKA 4D94A 2AJVH 5K9QI 4NRYA 4X5WB 5E8EB 4WU7A 4YHLL 5FKAA 5C8JA 3BZEA 4DGYH 4FTVA 4Z7NE 3GJFK 1A3RL 4LMQI 4RFNB 5I1IL 3OGCA 3MRFA 2Y72A 1UEMA 5B4MD 1FZMA 2FECI 4JFEA 4Q2ZA 1CT8A 2ATPB 5TDOB 5INDB 4OB5H 2BNQE 3QXWA 5KVFL 2I5YL 3HAEB 1JL8A 3DHJA 1NCCH 4ZOEA 3L7EA 2Q76A 3P9MA 4WEBH 3DUHA 3L3HA 1C12B 1BZ9A 3REVB 4YEFA 3P4MB 4DKEH 1AXTL 5HYJA 3O45B 1DEEA 3T08A 5IT2L 2HJLB 4PJ7B 1J0YA 4XP4H 4PD4K 1ZGLM 1RZFL 1ED3B 3GK8H 4E41E 4MCZB 4YWGH 3ZTJH 4L8BA 4HDIA 2QJDA 3FT3B 4X7TB 3QFJA 4CU8A 1ZMYA 4XPTL 4HCRA 3TNMB 3TBTA 4YDKL 2DS4A 3RZCD 1FLRH 1W2KT 5IBTH 4GUPB 5BVJB 1CFSA 4NNPH 4P57B 3ROOB 5CCKL 3DMMA 8FABA 1MCHA 5HHVL 4Y19A 4HWBA 4M48H 5GRUL 3DX6A 4N68A 5MI0C 1NQBA 2BHUA 4FQQB 4RMSA 1X4XA 3GI9L 1Y6KR 1LK2B 2FJHA 3ETBF 3HTLX 3BH8B 2MFNA 4L1DA 1YEIH 4MJIA 1UXSA 2J7LA 3U0TA 4RMUA 2BC4B 5E7BA 2P5WE 2XN9A 1T22B 4XBGA 5F3BB 1FSKB 3OMZA 4XMLL 2FYYB 1J11A 1IFHL 3VXRD 1MNUL 4HKJB 3ZSSA 5HDQL 3H2WA 3KPLA 1FFNB 1QFPA 3PIQB 4JG0H 2NR6C 4QXUL 1E27A 2HMID 4ZXBB 1XH3A 3OKLA 2VDLH 4NPYB 3VD4A 4KXZI 4OCSL 1P7QD 4LKXA 3HC0B 4UNTA 4ZTOH 5E6IB 4KKLD 4UT7L 1CXLA 2JB5H 5C0EA 3K3QA 4KY1L 2YPLE 2QKIB 3GMQB 3QA3B 2VDMH 2DJ4A 4WI6A 2Q1EA 3GBMH 4KROC 5DD3H 4KTEL 1A9BA 3AS1A 2NMSA 1DVFC 1OLLA 3RX5A 2DLIA 2X4PA 4WHCA 5DRWA 1AI1L 4WV1C 5ELIA 5TF0A 2VYRE 3JWDC 4F9LC 4JCMA 4U0RC 4XCCH 1BF8A 5D2NA 1T80A 1WCBA 4P4RB 4HH9B 2Y1VA 5D7JA 4GXVH 1FZOB 1XR8A 3IAQA 4P3CL 3MA7A 1WZMA 5IB3B 3T0EA 3T3PE 3MLTA 3V5KB 3LEYL 3TC9A 1SYSB 5BRZA 5BXFB 3OX8A 3AY4C 5DJDB 5L8JB 2J6EA 3GSNL 4MJ6A 4GKOA 5IVZA 2ADIB 5EBLB 2PW1A 2RB8A 4TULH 3VXTA 5D6DA 2VQUA 5C6WH 4MQ7A 4RWYL 2ICEA 4H1LH 3UC0H 4LLYB 4P2RA 3RPKA 2NW2A 1XGQA 3MBED 1PFCA 2J1KA 1FDLH 4KWUA 3SKJH 2EDEA 2X7LB 1KNOB 4GH7B 2Y23A 1OHQA 3S3JA 1IC5L 1J5OH 1B0WA 3GNML 2NX5B 3WN5C 5EUOF 2ED9A 1FZJA 4X4XB 1F97A 5B8CB 2DQCH 2O5ZL 2UWEE 2XZAH 3IS1X 1EPFA 3M07A 3PXJA 3UTSB 3BPCA 4L3AA 5JPMB 1X5ZA 5E2TL 3EOTH 1I75A 3MR9A 4MAYC 4GKNB 3KPPA 3IDGB 4Y4KC 5DR5H 1SVCP 2IEPA 4OF8A 1NCBH 4CVUA 3NFNA 1KTRL 3S7GA 2Y6SD 3R4DA 3CFDA 5F1IA 2WQRA 3WYRA 1HSBA 2O5XH 4G6AC 1GGBL 2X70B 1I1YA 3QCTL 2EDXA 1QD0A 3P4OB 1X4YA 2QEJA 4F7PA 4QY8A 3PWLA 4BQ9A 3ZDXE 3KPRB 2IH1A 3QIWA 1F5WA 4GRLB 4OKVA 3Q1SL 1K6QH 1AY1H 2BNUB 3OR6A 2RJMA 4CVZB 1LO5B 3BIKA 3FO9A 3JV4B 1PEWA 4I48A 1DBKH 3BP6A 4OZHB 4ZPVB 4OZIB 2SEBB 4G8FB 1BREA 3L5WA 4HMCA 2HN7B 1LO0L 2FHFA 2EE3A 4GG6E 3T77A 4ZUVA 3HCVA 2E7LC 2B8OT 1FL6B 3BPLC 3SE3A 3PDOA 1G6RH 3WCYA 2HT3D 3GUTA 3BMVA 2WP3T 3NH7H 3K80A 2CKBH 2B4CL 3UTTD 1J05B 1X5IA 3HE7D 1K4DB 1T4KB 5TF1L 3TT1L 3MLSH 4JQVC 3EZ8A 5EN2B 1MVUB 3CPLA 4OFDA 4XX1G 4X83A 1Y18A 3H9SA 4BSWB 4PLNC 3U4EA 4KGLA 1XIWA 1I4FB 1YUHA 7FABH 5H2BB 4J8RA 4JZOA 1OCWL 1MJ8H 4EOWL 3WNLA 4MSWA 4BQBA 2EO1A 3FO0H 2GT9A 1DUYB 2D7PA 3RWGA 5T1LD 1KPRA 2NY4B 4N9GB 1AGBB 1ZT7B 1C08A 4Y16A 2LVEA 1YEGL 1HILB 4ETQB 4DQOH 1LEIB 4YGVA 2IH3A 2Y06H 4L8SA 1TZIB 3VXQB 4PJCB 1JN6A 4PJAB 4JY6B 5I1GL 1N4XL 1CDCA 1N6UA 5D1QC 4KJQD 2NY0D 5DD1L 3TM6A 2I9TA 3QIBD 2B5IB 4IDJL 3I2CL 1F6AB 1KPVA 5DS8B 4F57L 1QZ1A 1R0AH 2ICWB 4JAMA 1JWMA 2Q7YA 3GRWH 2R4RH 5CZXC 4JN2B 5CEXB 3LPWA 1T66D 3FFCE 5F1SA 3F65A 4PJXB 1FORH 2W60A 1OP3H 3IJHB 3MRGB 4R4NC 4HIJB 1UB5A 4J1UB 1PKOA 1S8DA 2NY1B 1AFVL 4NRXB 5HHQA 3T04D 1JRHL 5HJ3A 3TBWA 4PBXA 5CHNB 1S9XB 1KCSH 1IC7L 4RFEB 3AFLA 3T2QA 4PRDA 4M1GH 2VXUH 3KNBA 4K8RC 1W0WA 3WV0A 5BS0A 1YY8A 4WFHE 3K8LA 2YXMA 4QXTB 4ZFOB 3B9KC 4U4BA 4AIZA 3PWUA 1CLZL 1RU9L 3RA7H 1J18A 1P2CB 1ZAGA 5M94B 4M7LH 4ZPTA 3BWAA 4YHPA 1H0DB 3D2UB 5IGXH 3ZYJA 3CXHK 2ZCHL 1HE7A 1CYGA 4HIEB 4XMPH 2RR3A 3BKCH 5ADOL 1JZ7A 2IPTL 4RNRA 4NO0D 1J8HB 3H7LA 4JFFD 4X8JB 3BESR 2VDRH 4RMWA 1WBZB 1DQQB 5T3ZL 3HB3C 1K5NB 3WIHL 2MSPA 4I2XE 4KHTH 1RZ7H 4JRXB 2C1PB 3GO1H 4Y7MA 1KULA 3JVGA 1YMHA 3RU8L 1MH5B 1MCBA 1OB1A 4ONOA 4RZCA 1I8KB 1F4WH 3MLYL 1TCRB 1NAKH 4HG4J 1ZHNA 2FATL 3QDJE 5B38A 2D31A 3FOMB 1N64L 1UB6A 4DVBA 2OBGA 1KELH 3LMJH 5DD6B 3AB0B 4HJGA 3V95A 3EYSH 1DQTA 2H8PB 4PLKD 3BP4A 5KANI 4H20L 1P69B 1AGDA 2ADFL 5CSBA 3ILQD 3L3JB 2A77L 1XGUA 3HZYB 4MZ2A 4WFED 4R2GC 4GKZA 4DZ8A 2EXWC 4Y4HC 4FQIH 3O81A 4NSKB 1ACZA 5JZ7D 4UIMB 4F58H 4RAUB 2BSRB 1GHFH 3S8WA 1HWGB 4JPWL 4P46A 4GG8A 1OTUC 4LEXH 5FGCB 3RVUC 1H15B 4NQCE 3THMH 5ENWA 1F90H 2A2QT 3MV9E 1TTGA 2X4NB 5H8DA 3TO2B 3UTOA 2WWMD 4Z6AT 3VWJA 5BZDB 4X98B 1S78C 3RWHA 1CS6A 1UCBL 4XPFH 4JCLA 2P45B 3SKMB 4X5LA 4OZFG 4LCYB 1KXVC 3EYVB 2KUTA 2AGJL 5FGRA 1BFVH 1BBJA 3WFCH 3ULVC 1INDL 1YMMB 4I18A 3RZCA 4ZFZB 3BEWA 1JRHI 4QHLA 4RBPK 1ZEAH 2IQAA 1SJXA 2DQJL 4Z7NF 3NVQA 4H25A 4D9RE 1ZT1B 1CICC 1D5BB 1G0DA 3UX9B 2A9NH 1E4WL 1MCPH 3KHOA 1R3KA 3MJGX 3PABB 3IFOB 3QUYA 4OFKA 4G8GA 1AQDB 4N0UB 4XHJC 5T1KA 1OAUH 4WFFE 3MCLH 1RZJC 3UBXI 4U1KA 4ZXBD 3M1BA 4C56B 1L7IH 1YC7A 2IBZY 5GS0L 1BIIA 4Q9BA 4YLQT 5FO7A 5E6ID 5LAXA 3UJJL 4JY4B 2CLZB 2OR7A 1EA9C 1DL7H 2NCMA 5T3ZE 3RI5K 1FYTE 2PN5A 1ZVSB 1J8KA 3EIFA 1G6RA 1FL3B 5DWUL 5I2IA 3MGTB 1S7SB 5KS9E 2OMBA 3CC5B 4M7JH 3PUCA 1QRNB 2DBLH 3QWQB 1LP9B 1ZHKB 3IYLW 5HI3D 3UJTH 3BP5B 4OJFH 1IJ9A 5EWIH 3GMMB 1CFVH 4OTXH 1JNHB 3TO4C 5F8RC 1U3YA 3MMEA 4P2OB 3TZVA 4Y8DC 5MHSD 3VFRB 5IHUH 1CD0A 3VFMA 3WHE0 5GZOD 4MA1B 3MFFA 2YUXA 2VRAA 5CINH 3F7PC 1M71A 4HUVA 3QDGA 5GRZA 1HN1A 4IRJC 1F3DJ 4W4OC 4G6MH 2IFFH 1B2WL 1KENH 3BEVA 3CK0L 3RIAK 4GLRH 2VQ1B 5KSUB 2DQFA 3CCHB 4Z95L 4AK1A 4L9LB 3HMWH 2F74B 1MCOL 1TENA 1JHLH 2Q8AL 3D85A 5EG6C 1TFHA 4FQXB 5KOMC 2FD6H 2GJZA 1QFWL 2VL5B 1NBYA 2GJ6A 5D7LE 2PO6B 1FGNH 5DZNA 3P11L 2NX5D 5JNYB 1AGCB 3P2TA 4FQ1H 4AG4H 4EIGB 5CGMA 2P7TB 3QG7H 3TT3L 3JTTB 1RUPL 3UJIL 4UINL 4CJ1A 4OSUL 4X6BA 2EYRA 2VABB 3WDJA 2OCFD 3GSVA 3CIQA 2F19H 3UTSD 4LRNL 4M4PA 1SM3H 4L1HA 4YDIH 1T6WA 1D5XB 3ULUL 5JR1L 3QNXA 3C2AL 3G5ZB 4RMRA 5CBEA 4J3SA 3SPVA 1JPTL 3K1KC 5ILTL 3D0VB 1SYVA 5DGRA 3SE4C 2ZOKB 5GRXG 1NSNL 3DTXB 5IEHA 2G5BB 1U8QB 4PJFF 5IB2A 4IMKC 2RFXA 7CGTA 4PJEF 4I0PA 1OM3H 1QACA 1SY6H 2XQYK 3BAEH 1YN6B 2J12B 2Y4SA 3KPRD 3S36X 4PJIF 4G9FE 1LDPL 1QLRA 4G5ZH 2HT2D 1XF3A 4GRLD 4UILL 2JJUA 1XMWA 2CMRH 2X2YA 2FR4A 3VA6A 1H3UA 1IT9L 1CCZA 5IB5A 5IJVB 5K93A 2NY5H 1ETZA 1S7XB 4WWID 5J6HA 4MNHB 5EOQL 2F54E 3VFGL 1A8JH 4JZJA 3CZFB 3V0WH 3WIIH 4KDVA 1DQJB 2MKLC 2P49B 4PJ5E 1A5FH 1XGPA 1ZTXL 2HFEA 2ESVB 3TVMA 4BSVB 2Z4QA 1TITA 1MFAH 1MFNA 1WBXB 3T1FA 3D39B 5BVPL 1WT5A 2R1WB 3TA3C 3QZWB 5FO9A 3K81A 5I0DA 3F6IA 1FE8H 4K7PY 4R26H 1J0IA 1N59A 3ARFB 1HQRA 3U9UB 4NKMA 25C8L 3BH9A 3BWUC 4PJGE 1WFUA 1RIUL 1KIRA 2HT4D 1T5WB 2W38A 1JYNA 3R8QA 1IAOA 2FX9L 3BFOA 3FB8A 3HE6B 3MRBA 1UT9A 4JB9L 4JPKL 3O3AB 5DRNB 4N5EC 2V5RA 4GAGL 4JFHD 4HPYH 3VGGA 2NY4D 3OZ9H 4YUEL 5K9JH 1F8TL 4H1LB 4LSSL 5ANME 3MLUH 2LTQB 1HHKA 1NBZB 5DUMH 3D9AL 4NWTL 5GGUB 3WFDL 4YHZH 4HX1B 5JORA 2XG4A 1SJHB 1SEQH 4HK3N 5DK3A 1XF4A 1CI5A 4H8WC 1RZKL 3NIDF 3C5ZC 5IW6B 1QPXA 1VFBB 3RRQA 3QRGL 2H1PL 3WKML 3LQAL 3P30H 3HMXH 5LGKA 4GFTB 1VACA 5E08L 1CD1A 2VR5A 4GG6F 5CGTA 3ULUE 2HRPL 4S1DD 3MXVL 2JE8A 4APQB 3Q6GH 3WNKA 1G9MH 3S35X 2QADB 2UVEA 1TNNA 2P24B 4P2CG 3RBGA 1KIPB 2D2OA 2GAZB 5HVHB 3X13B 2NY1D 4X6FB 3WS6A 5TQ0L 1MVFA 3KPSB 3MV11 1CFNB 1ZGLB 4U6XB 1Z0NA 3DV6A 1DSFL 3IU4L 3I85A 4DN3L 5B22A 4X4ME 3VE0B 3SY0B 3ZZ1A 1NC4A 4KC3B 5AUMB 4BFIB 3PGFL 4NQXA 3LSOB 1ZHBB 3X3GH 2FHBA 3QEGH 4O2FA 5IJKC 4ZDHA 3QUKB 1F4HA 2XA8L 3QJFA 1GC1L 4O2EA 1DBJH 4UT9H 4RFOL 1X5AA 5GXBB 4Z7WE 1UWXH 5SWZA 5IBLC 3ULSA 3FL7A 1KN2H 3D2UD 4OZFH 3F58H 1MI5E 3LDBC 3LKSB 2CKBB 4O4YH 3JUZA 2HG5A 5F7WC 4MLIA 4NZJA 1YYML 2AEPH 3LN9A 1KEGL 1T89C 4JKLA 1J8HD 3MUZ1 4X80H 2FHCA 3MRLB 4QRSB 5TE7L 1QLEH 5HPMB 1HWHB 2M26A 1X5HA 4LSRL 5J6GA 4JRXD 1AD0B 3H9YA 4EI6B 1T1WB 1FJ1A 3MOBL 4PG2C 3ULVF 32C2A 4JFFA 2Q8BH 5DFVC 3O4OB 5IEKB 5C0CA 1G7HB 4PGCB 1D5IL 4FFZH 5I8OH 1WCQA 2DM4A 3N50A 4W70A 4QRQB 4BQCA 2FX8H 4W68A 5J11B 4L8CB 5DO2C 4EVNB 5D4QA 5AWNH 1LE9A 2D7MA 4FG6C 1AE6L 3MJ7B 4KV5F 1M7IB 4LKCA 1D5ZA 2XA3A 2DQIL 5D1XB 2G2RA 5C71A 5DUPL 4AQ1B 5I1JL 1GGCH 3I6LD 3EJZC 2QV2A 2BERA 5FYLD 1B0RB 1Y6MR 2WUBH 4XPBL 4R97C 1OTTC 5E7FA 1A7BA 2H6PA 4CU7A 2HVJB 1EDQA 2VE6A 1U91A 5JA8B 1KF9B 3RGVC 3QWRA 5J13C 4QTHA 4K7FA 4R4BA 4QCIB 4NKDB 1MUJB 4FMFA 2PETA 4ODHH 1CFQA 4UUJB 3W9DA 4P9MH 4DW2L 5E2UH 3CX5K 2V6HA 4HWZB 5ERWA 1QEWB 4OM1H 3EKCA 1HKFA 4S2SA 2QQNH 2AQ2A 3QDME 1ACYL 5E9DB 3C8KB 4NRZA 2W91A 4OZGE 1FC1A 3KDMB 2CIIA 5MP6H 2EXYC 3NA9H 4XVJH 5CJBA 5JW3L 3B9AA 1YMMD 1MHEA 4M62L 2YC1B 1NMCC 4RGMC 5ACMA 3MRNA 2VDPL 2PYEA 4YXLH 5I1AB 4KK8D 4JDVA 1CVRA 3FTGA 3BI9X 4Y5VA 3B6SA 3O11B 2E7CA 4JFQB 1FPTH 4LLDB 2V17H 3Q48A 3HS0B 4HZLA 1JGLH 1I7UA 4XVTH 1OT1A 1MLBB 1IGIH 1JNLL 4BA8A 4LSDA 4C56D 3DIFA 1E4KA 2ZZUT 4WUUE 3MRJA 3ARTA 1S9KC 2VLJB 3LB6D 3FFDA 2CRIA 1A7PL 3MRCB 3B9VA 4HQQL 3VG9C 5EU6E 5MENB 3P4NA 2EDRA 5B3JE 1G7IB 1C7TA 4PB0L 2UZIL 5GRJL 2R0KH 4PGDB 5EU4A 4MD0B 4HWEH 4K3EH 1MHPH 4WFGE 4YNYA 3UYRH 3WDHA 2XNAB 4NFCA 3T8XB 3QPQD 2GEEA 1QRND 4F7MA 2ZJSH 3D3VE 2CJUH 3VXPB 1E6OH 1YECL 2F53B 1MWAH 4H88H 3R06A 4Z7VB 3VJ6B 4N0YL 1NDMA 2NY6B 2VDQH 1EAJA 3EFFA 1OW0A 4FFVD 4HS3A 4P2OD 5FGSA 5DRZA 3I75B 3OKKB 1ZLSH 1NCAH 4Q6IB 3W0WB 5HY9A 4JQXA 5JLZB 2BVPB 4R3SA 5HYQA 1GGIL 3SKNA 2VLRA 3LKOB 1AHWB 4NN5B 3NFPB 3AREB 4ZOCA 5FYJD 5E70A 3QUZB 4N90D 4OT1H 1A6AA 5HGAA 4YHKH 1RUKH 4LDEB 2WBJC 3PJSA 3O2DL 4HFWB 4ZFFA 2YN5A 4KVNH 4X4YA 4I5BB 1MFBL 4HZAA 5KN5B 3O3UN 2V2WB 4FQXD 3UO1H 1JGUL 3IAGC 1U3HA 4WO4A 2C3GA 5E8OA 1NC2B 1K4CA 5GJSL 1BGXH 2FX7H 3M45A 1NCNA 2PO6D 3JV6A 5DRXB 5HGHA 4M1CC 1ZANL 3G5XB 4NKOB 4NC2B 2XY2A 5L8LB 5B21A 5CMAA 5LXGH 2I60L 4Z7QF 1KEML 4XAWH 1KJ3L 4GW5A 4WCYH 4DTGH 3QUXB 2VC2L 1MF2L 4KZDL 2EC9T 4JHWL 1MFDL 3E3QC 1QSEE 3MJ9H 4M6OL 1VFUA 3DX9A 2DQGH 4GKSB 5E5MA 4ZNEA 3T1WA 4L29B 1F00I 1F6FB 1R24B 4AJ0A 1S9VA 1N6QL 1WFNA 5F9WB 2B0SL 3BXNB 5I1HH 1DN0A 2YXFA 5C0RL 2AJYL 2YWZA 4F15B 4PJDE 1DLFL 4NM8L 4FABH 4AY0A 4NQEE 1YNKH 3DOSA 3U83A 4OLUL 1WWBX 1C16B 2XTJC 2FGZA 4F3FA 2Q6WA 3TJEL 4N8VG 2IGFH 3IGAB 1UFUA 4P5MA 4P9HL 1HNGA 2VAAB 4P23C 1A4KA 2JIXB 4ORGB 3H3PL 1VFMA 4JFOA 4PRNA 3RVWC 4NBYB 1YDPA 2JCCE 3V6OC 4FQJH 2V5TA 3O9WA 3IFNL 4IOFC 5CIPH 4YBQD 5FKPA 5ABDE 4GRWE 4CMMB 5EUOA 2RIKA 5IROA 1T83C 5A2FA 2AS5M 3C5JB 1P4BH 1CE1L 2Y5TB 3BISA 4K9EL 4JFDA 4IEFB 1KLGA 1W72A 2IANE 4KKAD 3MFGB 4JG1H 3ES6B 3MROA 2W65B 5FUOL 1KB5L 5MEOB 2F5AL 1IAIL 3ARRA 3D39D 1CBVL 2X4OA 1BFTA 4Z78B 2J8UF 2R2EB 3G5YA 1N26A 1JYWA 4M7KH 3QAZB 1ZLVK 1YNTA 1F3JA 2GK0A 4KK9D 4C58B 4KVCL 5BO1H 1G7MA 1PEZA 2P5EB 3ARFD 3MUGA 4JO1L 5JHDE 1UWGH 1EVUA 3PV7A 2XWTB 2YD7A 2NLJA 4IIQB 4WW2C 1K8DB 3UP1A 3HE6D 4MVBD 3WE6B 1FVEB 2AVGA 5AZ2L 1A6WL 5HHME 2AKRA 5BQ7A 3RP1A 1FC2D 2EDKA 4FA8A 4U1IA 2OP4H 5SWSA 4D0BA 2BK8A 2VLKA 3KYAA 4KAQH 2CDGB 2W1NA 5JW4Q 4XVSH 1WAAE 3G6JF 1ZS8B 3PGDA 2HYMA 3DXAB 5IMOB 4PB9H 2RCSH 2N1KA 2FZ3B 3A6BL 1U8PB 3CDFA 5DJZB 1JVKA 5C0AB 1U2HA 4U1NA 4I3SL 1KC5L 1I7ZB 4MWFB 4PJCA 1AO7A 3QXAB 1MRDL 5H37H 1DN2A 3TBYB 3OJDA 4XGZA 1Q9OA 4BZYA 2B1HH 4UDTA 4APQD 4AQOA 5ID1A 5DD0H 4U6YB 1YEEH 2VR9A 2XI9A 4ENEC 3VGHA 3MRDB 2QADD 4QHNA 4MNQD 5F97E 2JELH 3LEXB 5DMKB 1OGAE 4OAWA 5F6IB 1MQKH 4J3UA 3SGDI 3KPSD 4ZOAA 5CEZL 2R23A 1CL7H 1YYLH 4XAKD 5BJTB 3P0YL 1A1NA 4IRSB 2YK1H 4PJGF 3IU3B 4ZS7H 3K4ZA 4KI5E 5FCUL 4LFHD 5DT1L 3QH3A 2JJWA 2IPKA 3QPXL 4JZNA 4POZD 1R3JB 3BD4A 1YA5A 1HXYB 4XC3L 3IVKA 5GIRA 1KTLA 1YQVH 1QSFE 4JKPL 1W0VA 1EGJL 1MY7A 3O6FC 4X5XA 4ZTPH 1ZLWK 5DHYB 4XXCA 3V4VL 5EZOL 2IQ9L 3OKEB 4HIIA 1HHJB 5EBGA 5L7XH 1K2DA 2AXHA 2FBJH 4L4VA 5FA4A 3A6CL 4LHJB 4M6NH 1GIGH 3CFEA 4J3WA 1EXUB 1EHLL 1TETH 2BJML 4OCMC 3TN0B 3BPOC 1GL4B 1A3RH 5I1IH 1IAII 3SGJC 1MWAA 4JJ5B 4YPGB 1J1OH 3TIDB 4DUXA 1X5KA 1IM9A 3VFOA 4AT6B 1FRGL 5HHXL 2LFGA 4OBRA 4U3CA 5KVFH 4HS6B 4AIXA 1KTDB 4UV4L 4CGTA 5FXCH 5INCA 5ALBL 2GQHA 2AK4E 2I07B 4RA0C 4QOKE 4XWOC 3QFDA 4S1SH 4NN6C 3SOBL 3C2SA 3K8KA 3ZKMC 4NWUL 3X14A 4XPGL 4HT1L 5D1XD 4LLUA 1MJJA 3OJVC 3FOLB 2FL5B 2VN4A 1OT2A 2FCBA 4NQDA 2NTFB 1Y6NR 5FCSH 1FAIH 4HC1L 1OPGL 1FQ9C 2W0PA 4NJ9L 2CIKB 1N2RB 3ZE1F 3GMLB 5KSAC 5CP3H 5DYOB 4PJ8B 3MV7E 4Z7WF 3O2WL 3L3OB 4ZAKB 4RGOH 4EQ2A 3MXWL 1KJMA 3RHWK 3ZKXB 2BMKB 1R5VB 5HHVH 2YSSA 1MPAL 5I16B 2AABH 4K3JL 4RIRA 1RK0A 4EZMA 5J12B 1IGYA 3GI9H 2BFVH 4TRPH 1M7DA 3PHSA 5E9DD 1YN7A 5ETUA 1GVIA 3G04A 3MJ9A 3QJHB 4XPAL 3EUUA 4K8RH 3VFNB 4ZSOA 5L0QB 4HKBB 1IL1B 1CQYA 5BZDA 1MHHB 1R5WA 1W8NA 2ATKA 1N8ZA 1IFHH 5FIEA 1A6ZB 4QF1B 1HDMB 5HDQH 5DJCB 1FNEB 2P8PA 2AV1B 3ARSA 3MLZL 1SEBA 3BDBA 3R1GL 5LG1A 4ZFZA 3PQYE 4OZFB 1L7TH 2R56L 1PZ5A 5JHLL 3STZB 2OQJB 3GIVA 5DMGD 5T5FH 3DUSA 3MACH 2JB6A 3WO4C 1IGML 3U9PL 2VDOL 3NAAL 2Y07L 4QHUA 5CIPA 4QRTA 2VLJD 1Y0LB 4BFBD 1DVFA 4K7PL 4JRYB 3GJEA 5MEND 4KTEH 2I9LA 4WV1A 3ESVF 4HXBL 1M7XA 4LARH 4HCRL 4F9LA 4PP1C 5F89A 4U6HA 3MV01 5HHNB 4TSBL 2ZUXA 2IADA 5AD0A 3KXFB 3Q5TA 1TQBB 3P0GB 1JWSA 4HWBL 3MGOA 2F53D 1PKQE 2AAVA 3HUJB 5EORH 1JCKA 5I1CH 4M93B 4PTUA 4P3CH 2NY6D 3ZT6A 4HIXH 4LLWB 1QBLL 4Q0XH 4Q9QL 1I7TB 3AY4A 3HZMB 3W0WD 4LAQH 3DSNA 2DRUA 1UENA 3NCEB 1U8JA 2ADGA 3CUPA 2W0LA 4MZ3A 4PRBA 3LV3A 3D5OF 4XCEB 1Q9WA 1NLDH 5CP7A 4F7TB 2WINA 1FCGA 1ROWA 4R4FL 1MCEA 2FSEA 3ARED 1OAYH 3QUZD 1F13A 3NCBB 4GSDH 3GIZL 4A2LA 1TDQA 5EO9A 3WBDA 3T4YA 4FN0A 4OQ1A 3LQZA 5C0DB 1MRFL 4D8PB 3WN5A 1DQML 2A83A 4UIKH 1N0XL 4GS7B 2GTZA 5HD8C 5ICXB 4NNYA 5JOFB 1IC5H 1X4ZA 3GNMH 1BD2E 2PXYC 1NC2D 3GMOA 3HNSL 5EZJA 4XBEL 1SMAA 5DJAA 4V1DA 3G08B 4MAYA 5H35A 2ZSWB 4Y4KA 5B3JF 3ULVH 5E2TH 1MJ7L 4FTVE 4NM4H 4ZUSB 3L7FB 4BFEA 2N56A 5EO1A 1GOFA 3QUXD 2YHGA 4JFEE 3SDCB 4MA8L 5BZWB 4LASH 2PO6A 4FNLL 4P2QA 3D48R 3ME0A 1M4KA 1BQSA 2CPCA 3DI3B 2WIIB 1GGBH 2CH8A 1IM3B 1J0JA 5IB1A 1FBIL 3OWEA 1ITCA 4WW2F 1AGEB 3CFJA 1NL0L 3BUYA 3EO1B 2X1XR 1K3IA 5J3HC 5DEZA 1DE4A 5D1ZC 3C87A 1R3IL 2DTSA 2H9GB 3J7HA 3O0RL 3Q1SH 1WICA 2J6EL 4RISL 5HYJE 4PRPB 1UEYA 2E6QA 5A2IH 4OV5B 3Q2CA 4LNVA 3KAAA 1H5BC 2JIXD 3W81A 4CRPA 2E7LA 4XH2B 2X9WA 5IWLC 3ZKND 2A6DA 4QHKI 4KUCD 3QFJE 2GTWA 3MRPB 4HMDA 4OGYH 4OIAA 4L8DA 2X10A 3E2HC 5EC1A 4JQVA 4URTB 4JO3L 1D5MB 3IFLL 4KJWC 3EAKA 5ITBL 1PYWA 4Y19E 1WEJH 2W9EL 1MCWM 1UM6L 1NEZG 1RUML 2ZG3A 4PJBB 5C0NC 1S7QB 4RAVB 2IBBA 2P8LA 3FN9A 5B3NA 1L4IA 4MJIE 4X8XA 3TWCL 2DWEA 1GOGA 2ICWI 5F7EL 3V6ZB 2FIKA 5KG9A 4DZBB 1MCQA 2XN9E 4PJFA 4DN4H 5I71C 1OCWH 2P5ED 1HINH 1NPUA 2ZUVA 4PJEA 4EOWH 5GS2H 1WBXA 2ZG1A 4KMTH 4Z8FH 1Z5LB 4G6KH 4GJTB 1F4YL 4MNGB 3S5LG 4OCRH 2JK5A 5GGTH 2EDWA 3VXME 2HFTA 3VXSE 1OGTB 4PJIA 1YEGH 5F70A 3KYMA 3FQXB 4Y2DC 4YXHH 1IZKA 2IMMA 3QULB 5D1QA 3GMRB 5CEYB 1DQDL 2CO7B 1TIUA 4HLZG 5EIQA 4XC1H 2OXGA 3C09C 1T2QL 2GUOA 5CP3A 4RMQA 2E27L 3I2CH 3DXAD 3K2UL 4DJMA 4GBXB 2OI9B 3BJ91 1MCFA 1JTPA 1J1PH 1L9NA 4U1JA 2C3XA 2KPNA 5C0AD 4NZTL 4RQQB 2D4DA 4Z7OE 4FXKB 4G42B 5D2NE 3S36H 3QB7C 3FRUB 2XWBB 1AFVH 4G3YH 4DGYL 5KTEL 3BZFA 1ORQB 1Z0MA 5GRYA 1ITBB 2VXSL 1IC7H 4X7CC 3T0EE 1QKZL 1QTYT 4WDIA 3B9KA 1REIA 4MQTB 4G43B 5BRZE 3BPNC 5I74B 3MV8E 5CSZA 2WM0A 1BQHG 5TDNA 2VITA 4XB8A 4D0CB 1U41A 4C59B 1OAQL 4IRSD 1CLZH 3KYOB 4MNQA 1M05B 3PWPB 4UT6L 1HSAA 4V2BA 2V5YA 1R5IB 1IEAB 4TQEH 3WFHB 1WLHA 5I1EH 3QI9D 4P2RE 3QO1A 4WI8A 1IEHA 4W81A 3VA2C 1JWUB 2E7BA 1NBVL 1TQCC 4X7DC 4EXPX 4DCQB 2VZUA 5E8PA 5A16A 1V3MA 1ZHLB 5DEGA 4NNXA 3L1OL 5T33L 4L3CB 1X5GA 4GG6A 1WAAF 4FG6D 5ECJE 1RQ5A 1IQWL 4CUCA 1OTSC 4YE4H 2J5LC 4WI4A 5BOZG 1JPFA 1O7VA 3RU8H 3TBSB 1EFXB 3HC3H 4JLRA 3MLYH 3TN0D 3NPSC 3NPZB 5AAMA 1YPZA 2WW8A 3O4LA 3OKNA 2EECA 2E6PA 5IMMB 5ESQA 2BNQB 1KG0A 2OJEB 35C8L 1ZOXA 5HGGS 4NHUB 4XHQA 3DSFL 4HSQA 4F33A 2Q86B 3VGAB 3TESA 2H3NB 2ILLA 5EBMA 4IDLA 3S3SA 2H2PC 3ARQA 4PS4H 2BY2A 3DROA 3MJ6A 2ADFH 4OFPA 1AJ7L 3U82B 4Y4HA 2A77H 3IT8D 4PRAA 3IJYA 4UMGA 4WWKB 5TQ2H 4D3CH 2VDLL 3S35H 5ISZB 4E41B 4M3KB 2P48B 4LLAA 4EI5C 2JB5L 2NXYC 4OCWH 3HRPA 4JPWH 2CDEA 4NDMA 2CK0L 1JBJA 5DDHB 4KPHH 4PJ8D 2RQ8A 2EO9A 3OB0K 4PREB 2VDML 4UQ3B 1KN4H 5C2UB 1Q9KA 3CFCL 1BBDL 4LCUA 1I1FB 4ZAKD 5CAYB 5DD3L 5F1NA 4HS8H 1NGZA 4XVUC 2R69H 3VD7A 2ZNWA 4KJYA 2D7QA 3KYKH 1BWMA 2R2BA 4U0QB 1B9ZA 4LGRB 3H9SE 1G7PB 1MFCL 1WV7T 1DLHB 1PBYA 3FFCA 2EEDA 5I0ZA 4UU9B 3FKUS 1CGWA 5TPWL 4XCCL 5KVMC 1P4IH 3P73B 4I4WB 5HSFA 1NANH 3QUMA 1CICA 2DQJH 2P5WB 2YPKA 5SX4H 3X12A 4GXVL 4EN3B 1FH5L 3BT2H 5K9OA 1YEFL 3BMWA 3FB6B 1AXSA 3UTQB 1F42A 1RHHB 4PRIB 3ARBB 2CLRB 3SO3C 5E1AA 1MIEL 5AZEH 5TGBB 2FJGB 1T20A 2YPLB 3UJJH 2DMBA 4XCYB 3IDYB 1HHHB 1AGFA 3D6GA 3FB7B 5I8EB 3UC0L 1FDLL 4LNRA 1FZKA 3FQNA 4Y5XC 5F71A 5DWUH 4JRYD 4BSJA 5IFJA 4LAJH 5MEQA 4OM0H 2A38A 5JW5A 2UYLB 1S7WB 5KW9L 1XGYH 5GRVK 3DLQR 3TO4A 2DQCL 3C60B 3CSBA 4M5ZL 2DYPA 2AJ3A 3QXDB 2BXZA 3KXFD 2D7OA 3EOTL 3ZE0E 1KJ2A 4UB0L 1E0OB 4G7YL 3MREB 1NCBL 3BQUC 4IRJA 4KKBC 3LRGA 4W4OA 4LSQL 3TPKA 3L5XH 5K9KB 4NQTA 3Q6FB 5BS0E 2O5XL 5GSVB 4YFEA 3EW3B 3M8OH 4U1LB 5CGYC 4ZUTA 2DDQH 3EYOA 1FFPB 5GGTA 4WHTA 5IQ9A 4Z95H 3SQBA 3INUL 3WHXA 3BD3A 4LQFH 3H7BB 5JOPE 4TUOB 4P3DA 1URLA 5HHOB 3OKKA 1B88A 5D71H 3LD8C 5ESVB 4HKZB 4POYA 5A3ID 5DQJA 1S5HB 1J0ZA 1Z2KA 2Q8AH 2BZDA 3GSRA 1BVKA 1MIMH 1UZ8A 3UPCA 4A6YH 2DWDA 3FCTA 1DBKL 4G80B 4UAOB 1QFWH 5HYEA 1A21A 3QNZA 2ITDA 1BOGA 4Y1AB 2EDTA 1D9KB 3JWOL 2EIEA 3RVXC 2DLGA 2UWEB 3PL6D 1BLNB 1QSZA 4X6EB 2Z93A 2A9MH 3S97C 1G6RL 3RUGE 3TT3H 3DETD 3MV9A 3UJIH 4PJ9B 4OSUH 3NH7L 4OCXH 1KTKE 3DVFA 4LRNH 2OZ4H 2X4QA 3MLSL 1KT2A 5JR1H 1T7YA 1VCAA 2R1YA 4PP2A 1NFDE 3C2AH 3SE4A 1FP5A 1JPTH 5D96C 5DLML 5A40E 3SDCD 5F9JB 4IMKA 5ILTH 1A6VL 4UBDC 5F9DC 3HZKB 3L3DA 3NZHL 4TTDD 5JDSA 3OG6B 3UMTA 4HLZH 2XIDA 1TZHB 2AJZA 1J0KA 3KPTA 4NGHL 4RX4A 2J8HA 4P5TB 1RZGB 1IGCH 3FO0L 3IRZA 3MRHA 1P7HL 4GKSA 4UILH 4HGWB 3WNMA 2Z8SA 3KPNA 4PRPD 4KTDL 2YPVH 4PJHA 3K4AA 1MOEA 4DQOL 3RZWA 2Q7NA 2Y06L 2C1OA 1G7JA 5IKCA 2ID5A 3V5HB 3CVHH 3BN3B 1CR9H 1N0LA 3VFGH 1W8OA 4BKLB 5B39A 2Z91B 3KLHC 1U8OA 2R0LH 1XR9B 4LGSB 3TA3A 1ZTXH 2OTUB 1LEGB 4ZUWA 3OJMB 4N8VB 5BVPH 2C3VB 3VMOA 4WUKL 2R4RL 2FH8A 3QISA 3ARGB 4GQPH 3OKOB 4ZNCD 1HYSD 1DDHB 4YZFF 1SBSH 1N5AB 1FORL 2HLFC 5IB4B 5IOPA 3VRLE 2Z92A 4MX7B 4LL9A 1RIUH 4J2XA 1KXQE 3U0PB 3GSNB 2FX9H 2QHLA 3S88L 2NW3A 2VXUL 2XTLA 4JB9H 5BV7C 3GGWA 2VXQH 4G8GE 4GAGH 3VXUA 3QO0B 4YUEH 5HGDA 1INEH 3C5ZA 3BGMB 3WFDH 1KPUA 1RZIA 3W9EA 5J57B 2ZUYA 1VGKB 4M7LL 1RZKH 2R0WH 2XG5A 2WSKA 1A1MB 1NCUA 3OAZH 4R0LB 3SDDC 4PY8I 2ERJC 2FO1A 2BDNL 3TYFB 5EPMB 3QRGH 4M6AA 2OR9H 3AS0A 2XKUA 4MS8C 4JM2C 1S5IH 4QHMB 1EEZA 2Y36L 3Q3GA 3VDBA 2EYTB 4GBXD 1K8IA 3MXVH 1HXMB 1TCMA 2L0DA 3CD4A 2J8UA 4KHTL 3OXRB 1RZ7L 3VXNB 1FG2A 3QP3A 1B4JH 2DI8A 5C1MB 2EIZB 1DBML 1FL5A 1NAKL 2XFXA 3EO9H 1KV3A 3LN5A 3DUUA 4C83A 4AENB 1KELL 2PYFA 3ZYZA 2I26N 3VWKC 5D7KD 5IJKA 3EYSL 2APBA 4WI2A 3VH8G 3OSKA 3C9NA 5EU5B 4NFDA 2VDKL 1LMKA 2FLBT 3KLDA 3DX8B 2PR4H 1T7WA 4HFUH 5TFSH 2XA8H 1GC1H 2HH0H 2H41A 3PWPD 3HZVA 4D9QD 1XF2B 4RFOH 4XCNB 1FFQA 5B4MC 1VKXB 4G9FA 5HGBA 1GRWA 2YR3A 3G6JA 5DJXA 1T89A 1V3LA 2GJ6E 1E6JL 4FQIL 4JANB 1EV2E 2ZPKL 1KEGH 4MDIB 1HEZB 1NMAL 4ZD3L 3F8UB 3DYOA 4LEXL 1JI1A 4I2XB 5I75C 5I66A 1OAKH 3QI9A 3LN4B 5GS1C 4PG2A 4WI9A 4NKQB 3KS0H 3LRSA 3DRTB 3MOBH 5CLWA 1DANU 1EFXD 4XPFL 2PTTA 1O0VA 1T6VN 3QDJB 1FHGA 5DZOA 4UQ2A 5ICYA 1QNZL 1LNUA 1NCWH 5L88H 2X4TA 1BFVL 3WFCL 4Z7OF 4C4KO 2BNQD 2X4SB 2Y5EA 4X6DF 4WU5B 1UG9A 1EO5A 3EDDA 1NJ9B 4MJ5B 3G5VB 5HHPA 5IFAH 2R39A 1AE6H 1IE5A 3VCLA 2DQIH 5FM5M 2FWOB 3ALWA 4YPGA 3WLBB 1B0GB 3HRZA 1ZWIB 4HPOH 2XPGB 4E0RB 4L3EA 3BHBA 1TJHH 3UDWC 1KCUL 1MAMH 2I27N 2AI0L 4FXGB 2EDDA 1HK6A 4HHAA 4CJ0A 2YBRB 1I1AB 3RGVA 3MYZA 4WWKD 3MCLL 4LPCA 5FK9B 5ANMA 4ZUUA 3WFBL 5ISZD 1LO3L 3ROLA 5GGSB 4A6YA 4E41D 4NO3B 3FQUB 4NQCB 1MHCB 4HEPG 1U3ZA 3BRGC 5GJTL 3KPMB 4HV8B 4YGAB 1RD6A 1E4JA 1DUZA 4A2MA 3BN9D 3GMNA 1HH9B 4DW2H 3OAUL 2VZOA 2HMIC 5BMFL 1KIQA 1ACYH 3VFSA 5DGQA 4KKLC 3RI5F 4K94C 2X4RA 3RWFB 1CXKA 4PV9B 1I7RB 4JDZB 5JW3H 4OTXL 4JFYA 3QRFM 4DEPC 2V7NB 3GZKA 4NUJA 5DJYB 2AXGA 4W6WB 3LCYA 5IHUL 3E1F1 4ZO6A 2P5WD 1IAIM 2BOCB 3TH4T 1LE5A 4UDUB 3UBXB 4EN3D 2YWYA 5CINL 4YR6A 2FO4B 4LP4A 1ZXQA 2D3VA 4G6ML 1UVQB 3UZVB 2IFFL 4X4MA 3QCUH 1KENL 2FLRT 4PRID 3ARBD 3ZTNL 2R9HD 1QA9B 1JNLH 5E99L 1QRKA 2VB5A 2YZ8A 2DLTA 2HJKA 4GW1B 3HMWL 1AP2B 2YPLD 4OUOA 4OFYA 1U92A 1XF5B 4JKMA 3VU2A 5DQ9A 1FYTB 1PW3A 1X7QB 3PWNB 4Z7WA 4U6TA 5DJ8A 3RIAF 1LEKA 3CVHA 1CVSC 2FD6L 1ZA3B 2UZIH 4GRWH 1MI5A 5GSRB 4YHYC 5KS9B 2HP4A 3MRRA 4OZ4A 2R2HA 4FQ1L 4AG4L 4QTIH 1CDBA 1JHTB 3C60D 3QG7L 1YECH 5ACZA 1MJUH 3EOAA 2E5EA 3VMPA 4M43H 4CVXB 4YDIL 2IALA 1KCRL 1S9WB 1U6AH 1V7MH 3MBEC 2OK0L 4DGVL 1U8HA 2DQEH 5EZLB 1CFBA 3SE9L 2QQQA 3JBG7 2ITCB 3QEUB 1GSMA 2BVOB 3TV3H 3WUWA 3GJFH 3CSYB 1GGIH 2AP2A 1L6ZA 2XKNB 2PUQT 1VSCA 4HUXA 5FFLA 3V0VB 2FDBP 1JGDB 2WBJA 3KJ4C 1LO2H 4ODXB 5J8OA 3BAEL 1VDGA 2C7UA 4M5YL 3T4AA 3H9HB 5SWZE 4G5ZL 5HHOD 3FQRA 4M7ZB 4R7NA 1EEYA 1JNJA 3GSWA 3VW3H 4MB5A 2Y6SC 3RWDB 1KLUA 5D7LB 4DKFH 3FT2B 1AIFA 5DFWH 4YXKH 4Y1AD 1OWWA 5L2KB 5GJSH 1D9KD 5TE4L 3MLVL 1ZANH 3TEUA 1AKJA 1MCDA 5EUKB 2J2ZA 3P9WB 4JPIA 2X89D 3FB5A 3FHAA 2I60H 4LCCC 4PJ9D 3U36B 1FLTX 1KEMH 4K07A 5DSCA 4YEEA 4JFFE 1MFAL 1SHMA 4GQ9L 4YDLC 4E5XA 4KZDH 2ZP0T 1MFDH 5CFHA 4NN7B 3PL6A 2I25N 1SVZA 1TXKA 4U33A 5EBWA 3E8UL 4NQSB 4R26L 1N6QH 5CJXC 4NZUH 1P7KB 4OUUA 1VGEH 4OFIA 5C0RH 3LY6A 3GSOB 2BNRA 2HT3C 1A7QL 4NM8H 2IAMB 1B3JA 2R4SH 3MZTA 2CDFB 4P23A 3HE7C 1OLZA 4P5TD 5EU3B 4P9HH 1HCVA 2Z35A 4ODVL 2LABA 5IHZB 3ECBA 3V6OA 4M7LT 4HPYL 2OYPA 3U7WH 2WANA 3NCMA 3H3PH 4Y4FB 3QNYA 4YK4B 1G9NL 4GLRI 5KVEH 4Z0XB 5DEFB 5DUML 4KXZH 4YHZL 3IFNH 1T83A 3VFUA 4U3XA 1SEQL 4LEOA 3I9GL 1C5DB 2APTA 2GSIB 5J4MA 5IM7B 2F54B 3SDAB 1II4E 2UUDH 3DVGB 1EO7A 5JW4M 1CE1H 3GDBA 4PJ5B 5EU6A 5KSBA 3MUHL 3P30L 3N06B 3VMNA 4U7KA 4JHAL 1J1XH 1V8HA 5FUOH 2F5AH 1QFHA 1CBVH 3HLAA 3O41B 3RTQB 1IBGL 3ARGD 3RUGF 3Q6GL 3QIUB 1LD9B 2H26B 3BSZH 1ES0A 4PJGB 3WXWH 2C9AA 4H5SB 4KJQC 2NY0C 2PYEE 4WW2A 3X3FL 1RK1A 3IRPX 4IOSD 1TVHA 3NZ8A 3B2UD 3QIBC 2NXZB 1NFDF 4NT6B 3T0AA 3IETB 4R7DB 4U1GB 4H26B 1JUFA 1AD9B 5C0IA 2BRRH 5EB9A 1I8IA 1JK8B 5AZ2H 1A6WH 1T66C 5IK3A 2G75B 3MRKB 43C9A 1I9IL 1QLFB 1XF1A 2NY7L 5F7DA 3ZYIA 5J0BA 1JYXA 3P77A 1I9JH 3ARVA 1X5XA 1DFBL 3GI8L 5EIVA 5HBBA 3M17A 3AVEA 3BKML 5F88A 3RL2B 1KN2L 3F58L 1T5XA 4NYLA 3MJ8B 4MHHG 4O4YL 3S5LB 5DVNA 2AEPL 4WW1B 3VRIB 2VZVA 3QQ4B 2EIBA 1JE6A 1KC5H 4GMTH 3V0AC 4X9IA 3U46A 4B5EA 1QLEL 5D2LB 3EGSA 3WEXB 1W72L 4O51A 2HLAA 3LPGA 5C70A 3KJ6H 3I6GB 3VFTB 4DFHA 1BFOA 5IMKA 1IAKA 4ISVB 3TJHD 3KPQA 1IGTB 1YC8A 4GAFB 2H32A 1WVZA 5EOTB 4FFZL 1HZHH 1QSEA 4QLRA 3PG2A 2FX8L 5E56A 3DV4A 1TPXB 3LS4H 3VRLF 3X11A 3CFBB 2VLRE 5AWNL 1F4XL 1F11A 5MHSE 5FCUH 1CG9A 2WLYA 3U30B 3LIZH 4YDVB 4NBXB 3I6KA 4MD4B 1GGCL 3O6FA 2BSTB 4RFNC 5FO8A 4TPRH 2ADJA 4I77H 2MTPA 3B4NA 3PGCB 3V4VH 5MERB 3ARZA 5DJ0B 5K59E 4PLKC 1BQHB 3PHQB 1CF8H 4IHOA 1VPOL 2AXFA 3KR3L 5D72L 4ODUB 4QNPF 4YO0B 2YEZA 4Y5YB 3SGJA 1HOCB 2BJMH 4XXDA 3ILQC 3RDTB 1A9EA 1A6TA 4QT5A 4P9ML 2IANA 1U0QA 2MQ3A 1NLBL 2QL1A 3QQ3B 2MPAL 2QQNL 3T65B 5T1DH 1DJSA 4FFWD 5JZ7C 3QDJD 4EJ1C 5GS2D 4RMVA 2V7HA 5MP6L 4UV4H 4XVJL 4NO5A 4M61A 3UTSE 3V6BR 5ALBH 3D18B 1O5DT 5DURB 5DTFA 4X99A 5IVXF 5AYQA 4AEFA 5I17A 2WWMC 3IDMA 4YXLL 4NWUH 5I30H 3TBVA 3WJLC 4IMLB 4ZMAT 3ZL4H 1XEDA 2ENSA 1HKLL 4HKXA 4PG9B 1FPTL 2D9CA 1BQLL 2GSGA 5JQHC 1MLCA 3TIEB 5EO0B 4TSAL 2Z31B 1XGRA 3OF6D 5EU7C 1UWXK 3RWIB 2DB8A 4NJ9H 1I1AD 3FT4B 1IKNC 3IDJA 1G6VK 4M6ML 2EEAA 3N1GC 4YDJA 1WBYB 4KDWA 1FFOB 2LVCA 5C7XH 4NQCD 5CWSB 3O2WH 3IDNB 4Z7UA 1A02N 3BRDA 1WAAA 1I3UA 4JFDE 1A3QA 3MXWH 1FSKC 5DI8B 5GGRA 3BGAA 3IF1B 1MPAH 4K3EL 4BH7B 3QDMB 1G1CA 4NZDA 5DC4B 5FECA 4OZGB 4ZXBC 1Q38A 3U2SB 3NFSH 5EFIA 5T3XL 4CNIB 2CJUL 3K7UA 3FQWB 5E6IC 1E6OL 4I0KA 1MWAL 5JIPA 1JGEB 1XCQB 4JRWA 5GZND 3QEHB 2VDQL 4XZUB 2RGSA 3KYNB 5C9KA 3Q5YA 1TMCB 4CDGC 5I1LB 3GFUA 1PZUB 1Q8MA 2H2SD 1T1YB 2ZCKH 4FMKA 1OQOA 5HI3C 3R1GH 1EBPA 3W11D 3F7VA 4YC2B 2J8OA 3BJLA 5E8NA 5JHLH 2HVKB 3CDYA 3P9LA 5SWSE 5I8KH 2EC9U 2W92A 4WUUB 4YIQB 3V9FA 2AV7A 4OT1L 4E42B 4F7EA 2VDOH 3L3GA 4JFHE 3WMSA 2CLVB 5GZOC 1N3NA 5T3ZD 1F6LL 1FYTD 4ZYKA 5HI4D 4QRRA 1UM5L 3DGGB 2P44B 1GZPB 1MAJA 1BZ7B 4LOUD 1YZZA 4PJCE 4N0FA 5JQ6H 4J4PD 4PJAE 1BGXL 2FX7L 4TSBH 5IF0A 4F7CA 1NGPL 4MXWL 3D3VB 4YAQB 5C0BA 1EH9A 4LK4A 4HWBH 1HIMH 1FNGA 5LXGL 2CRZA 2FEEL 1RULL 1JPSH 4WCYL 3EYFB 1NUNB 2A73A 4KKCD 3O3BA 4XP9H 2VISB 2V2XA 3MJ9L 1QQDB 3DBXA 1QBLH 1UH2A 4Q9QH 2DQGL 5FOJA 2PW2A 3F12B 3FRPG 4PTTA 1XCTB 3OQ3B 5DUBA 2YMXH 2DKUA 5I1HL 3O8XB 4L4TA 2MHAB 4WTZA 4QOKA 1BECA 4FABL 1XGTA 1YNKL 3IXTA 4R4FH 3C8DA 1JFQH 4JY5L 2BX5A 3TPUA 5E2WH 3GIZH 1PSKL 4HUMB 3LKNA 3PHOA 5B38G 2P43B 3BVNA 3D69B 1GZQB 1DQMH 2PXYA 5EIIB 3PWJA 5D7LD 1FN4A 4Z77A 3EJYD 4L4VE 3QHFH 3HNSH 5L2KD 4LHUB 3ESUF 1MELA 3SBWC 1A6UL 1P4BL 5T3XE 3JWDL 4R8WH 1MJ7H 4GRLC 2HT2C 1UXWA 4JG1L 2PCPB 2CUIA 4FNLH 2A6JB 3VXOA 1BM3L 3B9EA 4LLMA 2VR4A 2R1XA 1NFIB 3SDXB 3CFIC 5EZIL 1FBIH 5D1ZA 2X4UA 2F8VA 4NJAH 5EH1A 4PJDB 1NL0H 3WDIA 3N1MC 1U8NB 4NQEB 4BZ1H 5IIEB 3AXLB 3MCG1 4QRUB 2IAMD 4PLJD 3TH3T 1H5BA 5GS0D 1FVCA 2XZCH 1WWWX 4LLQA 3WD5H 3VD9A 2XQBL 5DK0B 3IDIB 1T0NA 5IWLA 3EOYG 1QR1A 4N0RA 2JCCB 2M8XA 2O93L 5KVDH 4PGEB 4Y4FD 3PQYA 4LLVB 4PV8A 2V2TB 4H0IA 2OP4L 4Z5RB 4GRWB 3SJVA 4DUWA 3WIFB 1IC4L 3LAFA 4KAQL 5KSVB 2WUCH 2HT4C 5IG7A 5EA0H 2QSQA 5SWQA 4XVSL 2F54D 3SDAD 1S7UB 2BHYA 2RCSL 3RVVD 3ZKSD 5I6XB 5L2JA 4PJ5D 1NGYA 3E6HA 1UM6H 2NY4C 2P46B 4UTBL 3LH2H 1YY9D 1RUMH 3RNKB 5F96L 3ILPA 5FGCE 2G9HB 2OL3H 1U8LA 4LCIH 3HFMH 3RTQD 4XP1H 4NO2A 5J9PB 4LVNB 3STLB 3TWCH 1YEEL 1MCLA 5JHDB 3GJFB 3HPLA 3QIUD 4ELKA 2QQLH 1NGWB 1RHFA 2ZSVB 4XNQB 2B5IC 3PNWA 4DOHE 1OSZB 1JPGB 2NXZD 1VFAB 1F4YH 1UJ3B 1CL7L 1YYLL 2KZ1B 1BJ1J 5KSAB 3N85L 4PR5A 4S1DC 3RWJA 5ICZB 1T3FB 3IKCA 2IPUG 1U8KB 3V5DA 4JGMA 4X0KA 2HFGH 2EH8H 1JIBA 2DQDL 5F8QC 4C55A 1XT5A 3ARDB 2P47B 1QO3B 3BZ4B 2NY1C 1DQDH 2J4WH 1RZ8A 1CFTA 5DHVH 2UY7A 2VN7A 1YQVL 1T2QH 4NZRL 5I76B 1JGVH 3ZDZF 2E27H 3MCKA 2XWJA 3K2UH 5FEBA 4J3TA 3C6SA 4NQVA 4C56E 5FOBB 4LSVL 4GW4B 4DK3A 2MWCA 3BW9B 5L7XL 1KGCE 2FBJL 5JO5B 3TF7C 3ULUD 2BSSB 5DJ6B 2P1YA 1VGKA 3DVNB 4M6NL 4O58L 1GIGL 4H0GA 4WENB 1Q1JH 5JPNA 1TETL 4OD1H 4P4KB 4WRLA 3C6LB 1EAPA 2YD2A 1E28A 5KTEH 3PWVB 1OGAB 2KDGA 4JM4L 4MA3B 3ZHDA 1J1OL 2VXSH 4LBEB 4WJ5A 2EKSB 1QKZH 2X09A 3AUVA 1LP9E 5J1AB 2EYTA 4HK0A 1BHGA 1EMTL 3MRMA 1YEDA 2GITB 3DECA 1BWWA 3E6FB 3T2NH 1RJLA 3OXRA 1LGVA 1OAQH 2BOBB 3STBA 4S1SL 1DBAH 4JQIL 1ORSA 4UT6H 1BF2A 1P4LB 2VLLA 4R96B