1MCPL

Phosphocholine binding immunoglobulin fab mc/pc603. an x-ray diffraction study at 2.7 angstroms
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
220
structure length
220
Chain Sequence
DIVMTQSPSSLSVSAGERVTMSCKSSQSLLNSGNQKNFLAWYQQKPGQPPKLLIYGASTRESGVPDRFTGSGSGTDFTLTISSVQAEDLAVYYCQNDHSYPLTFGAGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IGA-KAPPA MCPC603 FAB (LIGHT CHAIN)
publication title Phosphocholine binding immunoglobulin Fab McPC603. An X-ray diffraction study at 2.7 A.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immunoglobulin
total genus 40
structure length 220
sequence length 220
ec nomenclature
pdb deposition date 1984-07-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1mcpL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1mcpL01
2CUMA 1FAKT 3QEQE 2R15A 3ARTA 1B88A 1P7QB 2VZUA 4HK3J 3FMGH 3T2PA 3OBAA 3GBLA 3MV9E 5D7IE 4BSVA 5D1XC 3HC3L 4NDMB 1L9MA 2IG2L 3A6CH 2VLJB 3QEUA 1P7HL 1U3HA 1C5BL 1R0AL 1PKOA 3OPZL 4HJGB 5BV7C 2GTWB 5CEXB 4LVOB 5I66B 2YWZA 1BM3L 1ZLSH 1E4WL 1HHIA 4OZIB 4NKIL 3T1FA 4TSCL 4MVBD 2R0WL 4KY1H 1BAFH 3G6JE 3JV0A 4FQ1L 1T1YB 5GS0H 4WW1A 1YPZF 4NM4L 1UYWL 3ARBA 5H37G 4X6DA 3TIEB 4HDIB 1CL7L 1MEXL 2EIZA 2XFXB 4HKBA 2GJZA 3V4UL 1M1SA 1LP9F 1UWEL 2AXGA 3GGWA 4OD1H 3U0TA 1NAMH 2GT9B 3QWQB 4LQ1A 2QQNH 4O2EA 5E24E 3E8UL 2PYEA 4I18B 1MFDH 3STLA 2ADGA 4H1LG 3KPLA 4HS8L 4JJHA 5IW6B 3REVB 3VMOA 4N0YH 1KCVL 1YJDH 1JWSA 4F37F 2ZUVA 4P23D 4QRUA 2X4QA 1BQHA 3DXAD 2H9GB 4R9HA 3VXUA 1XF2B 2BSSB 2R39A 3M45A 4MAUH 4E41A 4GAYA 3BZFA 2IH3B 2QSCH 4HWUA 3RVTD 5I1LB 3SQBA 4DKEL 5EZJB 4OCRH 2Q76A 4NGHL 5A16B 5J11B 3FRPA 1BOGA 3LHPH 5D2NB 1P4BH 3RP1A 4H0GA 1GZPA 4HZLA 1FORL 3KXFD 3GUTB 5D8JL 3WHE0 1R24A 4C56B 3QB7C 2RCSL 3TH4T 1FYTA 2NY3D 1WGOA 3FT3A 2O5ZL 3TYFB 5CBEA 4RFOL 5CILL 2BVEA 2HH0H 3HUJA 4TRPH 1CE6A 2J8UA 2JJUA 4V1DD 5FFLA 3OKOA 3LKSA 1MLCA 4PBXA 5LKNA 4QNPF 4Z7OF 5K59F 2X4NB 1OGAE 1T1WA 1KCSL 4YR6B 4QRRB 1UKQA 5BS0A 2Z0BA 4AEEA 1I1RA 2VDLL 4PP1C 4KHTL 3V0WL 2VN4A 1JMXA 1FRGL 5I8EB 2VH5L 3O3BB 3FT2B 3AREC 1NC4B 4NZRH 1JHLH 2MPAL 5DFVD 2Q7NA 4MJ6A 5F71A 4X6BA 3RGVC 1BFOA 2ARJQ 1ZANH 1FCGA 5IGXH 3Q0HA 2YPKB 5DSCA 3HAEH 3S5LA 4WTXA 1I8KB 5ID1A 3S35L 2FH8A 2F5BL 4YHPB 2KUTA 2FGWH 1SJXA 2ADIA 1YZZA 4MJ2A 4NUJB 4U6XA 4WHCA 2ADJB 5GGSB 1QKZH 3I75B 3FCTA 3RGHA 1PBYA 4ACPA 5IB5A 4H26A 1X5KA 4PJHE 4RBPK 5DJZA 3QDJB 4GBXD 1MLBA 2W9LA 1NGWB 3KPRE 2L7JA 1F45A 2HRPL 2VUOA 4M1DL 3CZFA 2P4AB 5GGUB 3VFNB 1OW0A 1PZ5B 4PG2C 2WW8A 2Q3ZA 3OAZK 3DX7A 4TSAH 2OTWB 1NCBL 3DYMA 1GGCL 1MFBL 1NEUA 1Q9OA 3L5JA 4K7PL 4A2MA 1F02I 2IPUK 3MBEC 1W2KT 1B2WL 2FYYB 3NCYS 3VD3A 2DBLH 3ZL4L 1A6ZA 4RAVB 4JFDD 4P3CH 4RFEA 2HFEB 4OZFA 2YA1A 3EDEA 32C2B 2R1YB 2YUWA 1I85A 4ENEC 1PQZB 1T5XA 3LKOB 1PG7X 3VFMA 4PRDB 1WZ1L 3V52H 2V2WB 2NY5L 3VGEA 3R1GH 1A6UH 2EO1A 2C4XA 1DSFL 4QGYA 3VMNA 2DMKA 2GI7A 4A6YB 4HK3N 4ZS7H 1NMAH 3FQRB 3MV11 4LSSL 1IE5A 2ICWA 1T7ZA 5H2BB 1S9VA 4TUOB 5ALCH 4QXGL 1KIPB 4LVNB 3BJLA 3GKWL 5AUMA 4NKOB 5MP6H 5I8CB 5F9WC 4FFZL 4HHAB 5DDHB 1ADQL 1OAZH 3QUKA 4RMUA 1T2JA 5F7FA 5EOQL 4EI5A 2OR9H 4LKCA 4ZOBA 3EDJA 4X4YA 4NN7C 4ODHL 1HYRC 3KVQA 3CXHK 4OV5B 4FQIL 1MCEA 4H0HB 3VXTB 3TO4D 1PW3A 1R5IA 4AYFA 3ZTJH 4OZGE 3D6GA 4OLXL 3ARBC 3V6OC 1K6QL 4XPAL 4MNQB 2A1WH 1BQLL 5HHME 5J57B 4G42B 4RGND 1F4XH 4NQCE 3V6ZB 5HYQA 3O8XC 2OL3L 4DTGH 2V7NB 1VGKB 1RIVH 3KPSD 3ULVH 2LFGA 5E08L 1T0MB 4Y4KB 4S2SA 1FE8H 1T1XB 2DL9A 5HHPA 1C12A 3T3PE 1E27B 5JDJA 4Q9QL 3B9KB 2Y36H 4ZSOE 1U92B 3VMPA 3I3EA 5IOPB 4PJ7B 1AD9A 5D7KD 3BSZL 1V7NH 1HZHH 3ZKMD 2QQLL 2A74B 3F7RA 4HJJH 1P2CB 2HT2C 3HMXL 1QSFD 1KULA 3LN5B 4K94H 3CSPA 1SY6L 3FHQA 2KQMA 4WW2A 5FB8B 4R7NA 1YECL 3L3HB 4L4TD 4X98A 3VFWA 3ARRA 1A6TA 4JPWL 3VG9C 4OLUH 1BZ9A 2ZJSH 3AFLA 3CMGA 1VCAA 4Z7QE 1RZ7L 4E42B 1MI5B 4KI5E 4KKNA 5I30L 5ENWB 4QWWC 3GRWH 3FB7A 2EXWD 4LSRH 5FYLE 4MJ5B 3WS3B 2UYLA 5D93B 4D0CB 2R9HD 4WU5A 2H6PB 1S7VB 4PJEF 4PJCB 3U9PH 5MEPA 2FEEI 5B21A 1KFAL 3KLAA 5IBTL 4NKMB 4RA0C 5KSVA 1X3DA 3OGCB 4K3HA 3CCHA 1EMTL 2P44B 3X3GH 5CP3A 2XICA 4PTUA 5E2UH 2HT4D 1J86A 2VDPH 2NY1D 1EO8H 5IESH 3FO1A 2EDEA 2P5WB 4AEIH 4JHBA 4IJ3C 3IFPB 2MWCA 4JJ5A 4M62H 4PUBH 4M8QB 3U48A 1NGQH 2PXYA 1NCWH 3QUYB 4ISVA 3RJQB 1ADQA 1LO4H 4PD4K 4Z6AT 2H26B 3PP4L 3W9EB 3BUYA 2EDTA 3MROB 1T7XA 5CSZA 4FZEL 5E8PB 1S7SA 5HI4C 1KB5B 3O0RL 1JNNH 5ALBH 1KC5L 1DUYA 2EKSB 2R2HB 3QWOB 5D1QA 4WI4A 5M95B 4M7KH 1OW0C 4NQDD 5FKPB 1MHPL 1NANH 3T65A 4GAJL 4LCUB 5I1HH 4YDKH 5E03A 5IMKA 4IRSA 1G7HB 4CJ1A 2D2OA 2Z8VC 1C16A 3O3DA 3RIAK 4KKCC 4YIQA 5EU6D 1KPUB 4NOBA 3W39B 4YWGL 4WY7H 5KG9A 1MRDL 3X3FH 2W0KA 1Z9SA 3FT4A 5FAAA 2X1QA 4OFIA 5ITBL 4E0RB 1HHJB 1N0LA 4AMKL 2ZUSA 4ODWA 2IALA 2AQ1A 4HFWB 5HTSA 3GHBH 1IGYA 1NANI 2D0GA 2CUHA 1IGFH 4NBXB 2GW5A 1MHEB 1UB5B 2FCBA 4YQXL 5AWNL 2YPLE 4EQ2A 2ZP0T 5EUOE 1UZ6F 3U0PA 4OGXL 3ROOB 3MGOA 3IS0X 5DEGA 4RQQA 1YNKH 5FUZL 4BQCA 4HUXA 1F42A 3EFFA 3FO9A 2IAND 4LHUD 3I85A 3LPWA 1JUFA 4EIGB 3SDXE 3IFLH 2DQDL 1T1ZA 1RZIA 2KPNA 1F2QA 1BBDL 3VXQB 4EI5C 1J11A 3B3IA 4KMTL 3OJVC 3VG0L 5HYJE 2OYPA 4RA3A 1QUNA 5EZLB 3G6AA 3ZKXB 2IADB 2FLBT 4IIQC 1KG0B 1YQ2A 3HLAB 1UWGH 1DQJA 5I8OH 3HNVH 3QIWB 4DN3L 1LEGA 3QUZC 4I13B 4JHAH 4TSBL 1ZA6A 1AO7E 5IMLB 1EEZB 5DJDA 4WHYH 4XWGL 2X1WL 2VDML 2VDOH 3NA9H 4LVHC 1FO0B 1WV7T 4HV8A 1LO2H 3ECBA 4P2QE 3EYSH 5EO1A 1FVDA 3T0XA 4KRPC 3UJIH 2H45A 3E6HB 4HFUH 1KJMA 3IAPA 5I1EH 3DYOA 2F54D 3QO0A 1S9YB 3X14A 4KK9C 3IU4L 4Z7UA 2EYTA 4YDJB 5FGBC 2D7TL 3BIKB 4J6RH 1KN4L 5BVPL 3QIUA 4WEUD 3KJ6H 1NBVH 5EH1A 4H8WL 5E8DH 3F7QA 3MJ8A 1JK8A 3SE8H 4N0UB 4U1MA 1AKJD 5MENA 1S5IH 3O41A 4OAWB 3MLUH 4XBPB 3UX9B 3EJYC 5EN2A 3NCYP 1YYMH 2I07A 3BW9B 2B1HL 2EE2A 2Z31D 4G6ML 3F7YA 1RV6X 1JGEA 4Y16D 1JPFA 2NY6B 4XVJH 4YXHH 2X4SB 5D1ZA 4M6MH 4AEHL 3CU7A 4ZO9A 2PYFB 2Q7YA 3O9WD 4CW1A 5J56B 4PJDB 4DUVA 2HMID 4H25A 1HXMA 1I7ZA 3TNNB 1I7UB 3P11L 3SGEI 1XCTA 5GJTH 1H3VA 1BF8A 3W9DA 4PB9H 2BHUA 3CGTA 5HJ3A 4CVZB 2NY2C 1JWUA 3T4AA 3EOTH 4Y5YA 3QDAA 4PB0H 3QI9A 4HF5H 3P0VH 1CQYA 3PQYA 4KZDL 1JPTH 1G7LA 4CRPA 2ICWJ 1CLOL 3P73A 3K7UA 5IW1B 4FQQA 4JFEE 5GJSL 3OF6A 2NY5C 3BUTA 4JFOB 3T09A 1S7XA 3D25A 1I3GH 4G5ZL 2HVJB 4U1GC 3QHFL 4WO4A 3VI4E 4EUPA 3T0EA 3Q1SL 4UQ2B 1LNUB 2VLKD 1UACH 2NPLX 1NC2B 3MFGB 4NPYA 4HJ0C 5DLML 2R2CA 3ES6A 4G6KL 4G7VH 3B5HA 5F1NB 4P2OD 1N7ML 1RMFL 3UJTL 3PWPE 2ESVA 5HI5C 3CFJB 4XBEL 3SKNA 4IDLA 4BK4A 1CGSL 3U79A 4UIKH 2R4RH 4FQLH 1Q94A 3V4VH 4MQXD 2XZCL 3CZJA 2C1OB 2FX8H 4ELKB 1FDLH 5J6HA 3V5HB 5EU7E 2BOCA 3FOMA 5T33L 3T2NH 3BEWA 5D6CA 1CTNA 4RZCB 4WI7A 5JHDE 3UC0L 8FABB 5HGHA 2CR3A 3UPCA 1EFQA 5GS2H 4MQTB 5BRZD 4ZAKA 1YYLH 1EZVY 5C7XL 5I1CL 4PRIE 3VE0B 2GJ6B 1U8NA 2N7BA 3BD5A 1GAFL 2APFA 3MRKB 3LV3A 1DEDA 4C83B 1P53A 4FA8A 43CAB 3HCVA 4XCNB 3L95A 4OFPA 3WUWG 4U2YA 4KJYA 3FONB 3WLBB 3CFEA 5FO7A 1YMHB 5GHWH 4J23A 4D9QE 3TVMB 1NGYA 3H9SD 2W65A 4Z78B 5A2FA 3ARDB 4FG6C 4JQVA 2FR4A 4DGYH 5DUBB 3WHXB 2I60H 1U91B 2F8XC 3TCXA 3L3DB 4LF3B 5T3ZE 4BQBA 1BLNB 1BBJA 4HBCL 4KTYA 1MY7A 4I77L 5FDWA 5TPWL 3MV7D 5F89A 1HHHB 4UT7L 4UNTA 1ZVSA 3PWUA 5F6IB 2BXZA 5B4MC 3WXWL 3DSFL 1FZJA 5IEKA 4KROC 1GYAA 2VZSA 3EYVB 2KL6A 4HUWA 5ITFA 3UPRA 5GISL 3WN5A 5DRWA 2J6EL 2OM5A 4X7TA 2DQTL 2R0LL 4S1SH 2BCKA 5CWSB 1MCDA 3QIUC 3P2TA 1LEIA 4L9LB 1MJ7H 2RAMA 3QFJD 2EDHA 5LQBH 1A7QL 1A7RL 4LLWA 1IC4H 2WV3A 4I5BB 5CFHA 4OI9A 1X5YA 1D5ZB 3PNWA 4QY8A 4ZPVA 3QAZB 4LBEB 1OM3H 1FBIL 4RX4A 1BVKB 1NBQA 3I6KA 4PTTB 3IDGB 3EHBD 5DMIH 1GSMA 5ESQA 1F6FB 5J13C 1UVQB 2BVOB 2FD6L 3FFCE 1K8DB 5D1XB 5FKAA 1ZT4B 4AQOA 3KPMB 4O02H 1MCCA 4JRYA 4P2RA 3RAJH 1J8HE 3QQ3B 5DUPH 5ETUA 1NBZB 4KGJA 2XXCB 4OLWH 3VFRB 1H5BA 3H0TA 5F7EL 4HWNA 5KW9L 1INDL 5DMGC 2VDNL 1W72B 4WFED 1NCDH 4XP4H 4UIMB 4Y5YC 2Q87A 3RHWK 3RY6A 3G9AB 3QI9C 3T2OA 4HBQA 4LHUG 3AROA 3QFDA 5E7FA 1JGDB 5HYSB 2IPTL 3VRJB 3O4LE 1MFEL 3IDIB 4JPIB 2P8LA 4NRYB 2VSDA 4PLOB 4LU5H 2APWA 1CCZA 1GGUA 3LKNB 1NSNH 4QXTA 3T0EC 4PRPB 4WJ5A 2FRGP 3RWGB 2Y5EA 2CRMA 3DETD 5F72S 2AXHA 1ULVA 2QL1A 1WBYA 5FYKE 2ATKA 3VWKA 1RURH 5D9SA 1MAKA 4X9BA 2XZAL 1J0KA 1AHWB 2E3VA 4RGMB 4XXDA 1RUPH 5EU4B 4KQ4H 3KLHD 2CO6B 4KVCH 2W9DH 4LPXA 3PWNB 4LLDA 4ZMAT 1FFOB 4OKDA 1UB6B 3MCKA 3L5XH 2QJDA 5I19H 5IQ9A 3QG6A 5L7XH 1XF5A 3U36B 1K9TA 3GSQB 5C9KA 1T5WA 1HCVA 5M94B 3DECA 2PN5A 1RZJL 2BY1A 4RWHA 3VFVA 3RX7A 1X9QA 4ZAKC 4GXVL 2N7AA 5ANMB 2VXQH 1RZKC 4D2NA 1R5VB 1Q1JH 1BZ7A 4JRXE 5DQJB 4FQXD 4HWZA 1QSEB 4PJ7F 2XKNB 1IT9H 4JM2D 1YN7A 3TPUA 2JIXB 3IRPX 1MWAL 3TBVB 1TETL 4UU9B 1RJLA 5I8KH 4H8WC 2W38A 4LRIA 3TESA 3ZSTA 2GK0A 4ORGA 3UTPD 4Z7NF 3GSNB 5L8KB 3AREB 1FNEB 3B5TA 5F9JA 3RGVB 4PRHE 4OLYH 1HKFA 2PCPB 2JCCB 3VDBA 3HA0A 4OLZH 4LL9A 2IF7A 3GBNL 4UILL 3B43A 4GJTB 4JREC 4S0SD 4JQVC 4RWYL 1PEWA 4Y1AB 4N1HB 1K8IA 5L8LB 4GW5A 5TE6L 5DD6A 4R96A 3V4PL 4F57H 2XZQL 4WWID 1CZ8L 2NYYD 3ALXA 1E28B 1CD1A 1RJYA 1U8IA 4Z77A 3EUUA 1TZHA 1Z9LA 1I8LA 2ITDB 1REIA 3KPQA 1QBAA 2V5RA 4NO2A 4CGTA 4FFVD 3RUGB 4S1RH 2F15A 5KZCB 3MRQB 4HT1L 4PJFB 5E99L 4Z76B 2FWOB 3MBEB 3BGFC 3WN5C 1WEJH 4LOUD 3JV6A 4QHMA 4X6DE 1SMOA 4YFLI 1HYSC 1FL6B 2VDRL 2Z8WC 4Q9BA 3RWIB 2AEQL 1BD2B 4M3KB 2WBJD 3GIZH 3PGCB 4TULL 2YKLL 2VXVH 3GKZA 3W5MA 1U8HB 3ZSSA 5HHNA 5EIQA 1U8MB 3CC5A 2PYEE 1M7DB 3P4NA 1DLFL 5IFHL 5C6TL 5JW4N 4K9EL 2EECA 1XGUA 5EBLA 5DWUL 3S3JA 1RULL 3TBWB 4TOYL 1SBSL 2XIDA 5IB2A 5IEHB 4XRCA 5DJYB 3VXUE 3HHRB 2PF6A 4MXWL 1WJ3A 2WQRA 4E41E 2XA8H 1HCFX 2VO5A 3LKQB 4LASH 2PO6D 3MREB 4RRPA 4WEBL 4PRAB 2P7TB 5FYLH 2HJLB 3GJFH 2DDQH 4ZYKA 1H5BC 2ED9A 4ELMA 1QP1A 1F00I 2D7PA 1S9XA 1WBZB 4JG1H 2G75B 1FHGA 1YDPB 2NY7L 3FB6B 2NNAB 3VGFA 2J5LB 3STZB 5CINL 5H94A 3DV6B 2VZ3A 3SY0A 1NAKL 1EXUB 4OIIH 3O8XB 4XTRD 4JKMA 2J8UE 1INQA 2DQEL 1D9KA 1HH9A 3GSVB 1JHKH 2VUYA 1FFRA 4JR9L 3CNKA 5EPMB 2DWDB 4JLRB 1RZFL 2JB6A 1FNLA 2FLRT 5IHLB 1S7QB 4JO4H 2BRQA 1PSKH 4TTDD 5BS0E 3FOLB 4PGDA 1I3RB 3I2CH 2FHCA 3H42L 3V2AR 5KVFL 4Y88A 1OP9A 1ZWIB 3QDMA 3ZTNL 5GS1B 4KTEL 3QDGB 3CFKA 5C09A 4Q9CA 2EH7L 1WBXA 5CUSL 3DMMB 3MJ9A 2Z4QB 1AGFA 4ZTPH 3TBSA 1NDGB 5K9QG 1FVEA 4XC1L 1CFTB 4Z5RB 2DQGL 1A6AB 1L0XA 5JTWA 1T20A 4XI5D 1P6FA 2YD9A 1V3JA 2DI7A 2F53B 1FFQA 4W6WB 1Q9LA 4OF7A 4ODUB 3LH2L 4IRJA 4KKAC 3ARGA 4K3DL 1QLEH 3GMMA 4NT6A 3BEVA 3ULSB 1A9EA 2BJMH 2VR4A 3ARFA 3LZFL 3LAFA 4YO0A 4FZ8H 3IDMA 2W92A 4DK3A 3WUZA 3K4DA 2MCG1 1LWRA 2R56H 3TWCH 4QF1A 1F90H 2XN9B 3P77B 5ISZA 1CFSB 4HXBH 4NM8L 3Q2CA 4N1CA 5KSBB 2IQAB 2N56A 3E2HB 3EYUH 5DFWH 4HS6B 1GL4B 3OAYH 3UZQA 2EDFA 4LRIC 1IGTA 4MAYA 1WFOA 1ZK9A 1Y0LB 2QBWA 4EI6A 2FX9L 3D85B 4NQSA 1FL5B 4FNLH 4B5EA 2FL5A 3GHEL 3QNZA 4U2ZA 1F4WH 5DMKB 1OF2B 1W0VB 3TNMA 1AY1H 2FIKA 2P24B 4EOWL 4L4VD 3AGVA 3MLYL 4PJDF 4MA3B 1IEBA 4HULB 1XCQA 1NC4D 4BFEA 4D0BB 2CMRH 1IKNA 3D3VD 1KGCD 4XPFH 1KF9B 1HNGA 3UBXB 4ZFZB 1I7RB 1X5HA 3MLWL 4JDVA 1G9MH 4F7EA 5GS3A 2DD8L 4ONGH 1KBGL 4PJBA 2MSPA 1LQSR 1INEH 4Q58C 1ES0B 3WIHL 1BFVH 1IEHA 2AGJH 4MDIB 4P5TB 3ZE1F 2RIKA 2HFFB 2ENSA 3REWA 3S35X 3VD7A 1N8ZA 4MB3A 3S4SA 4E5XB 4DN4H 4Y5VA 5E4EB 1IZJA 3NN8A 3KXFA 3OZ9L 4O00A 3NFNB 1T6VN 4XZUA 5C0FB 2EZ0C 3CMOH 1RI8A 3PGDB 2HJKA 4PV9B 5IWLA 4IS6B 4PLJD 1X4ZA 5SWSD 4KJWC 3KYKL 4GSDL 1MAJA 3GJFK 1CDCA 3BH9B 1HHKA 1PD6A 2ATPB 1R3IH 2C7UA 4DW2L 1AE6L 1CGYA 4PJAB 3KYNB 4DKDC 1MVUB 3QEGL 1EBPA 2DYPD 4FS0A 4JCLA 4P48A 2C3VB 3PGFL 5CEYB 2E6JA 4OCWH 2EH8L 4WFGD 4I0PA 4PGBB 4PGJA 4HK0B 1EAJA 2BNRB 3C60D 5DRZB 1FG2A 5C1MB 3KS0J 5JUEL 5DGQA 3DBXB 2AK1H 2V5MA 5AEAA 1RZJC 2YA2A 3MRDB 3ZDZE 3ETBF 4IIQB 2ZSWA 4G8GD 1H8OA 1Z5LA 3GIVB 4Q0XL 1U6AL 1IAIM 5DJAA 4LSUH 1KLUA 4I3SH 2Y4SA 3QUZB 1QR4A 3HZVB 3FL7A 1OPGH 1CFVL 1NCAL 4HWBH 3W0WA 1F3DJ 2Y07H 3DIFA 3JWDL 3TA3D 1FNSL 3INUL 4S11A 2MFNA 1D9KC 4DJMA 4ZXBA 5I1GH 2E6QA 1FVCA 1U8QA 1RHFA 3C6LA 2BRRL 4QT5B 2A83A 4CUCA 1OARL 1DVFA 3SGDI 3DRTB 5ESAA 2X7LB 4UV7L 5GSVB 4O51A 4L8BA 3OKDB 4RFNC 1AFVH 5F9OL 3SDAD 1BQSA 1G7IB 1GOFA 3QUXC 3WHE1 4GRLD 3TT1H 1JCKA 5C0NC 4RMTA 2VAAA 4GQ9L 1YEFL 1FLRH 1UWXH 2ADFH 1EX0A 4Y19A 1VGEH 3P9MB 2DN7A 1H9VA 4KHXL 3HFMH 3IAGC 4M43L 3WIHA 3UDWC 4MGXA 3ARFC 3IDYB 3N9GH 4O2CB 1QFUH 2OQJB 4IMKC 4DQOL 1J1OH 4QOKA 4YE4H 2SEBB 5HPMB 3QIBD 1K3IA 4YAQB 3IFNH 3VXSD 4XMPL 5LGHH 5CJQL 3MUZ1 3CK0H 4D8PA 2X4UA 1UZ8B 1UH2A 2DQJL 2A6IB 4QO1A 4MAYC 3T4YA 4RISH 5GGTH 4AM0A 1RAMA 1OQOA 1TPXC 3WFDH 3NPSB 3WKNA 4K9EC 4KI1A 1SVZA 3SQOH 5DRXB 1QPXA 4JDTL 1SEQL 2K7QA 3DHMA 4X83A 1A7NH 3UTSA 4Z7VB 3P30H 1WIUA 3AB0C 4LLYB 3RWHB 5T3ZH 4CVXA 5BOPA 1IILE 1FGNH 5DS8A 1EJOL 4XX1G 2C1PB 4FTVB 5HXMA 1IKNC 4P23C 1M71B 3FQUA 1ZVYA 3IVKA 4PREA 2ED7A 3I3BA 2QR0A 1PY4A 1Z3GL 2GTZB 2IGFH 2BP3A 1RK1B 1XR8A 1S7WB 5BV7H 1YEDB 2UZIH 1FPTL 3A6OA 2BSRA 4F9PA 3G5YB 3VXOB 4XP1H 3EO9H 3RVTC 3JTSB 4JG0L 4RAUA 4NZTH 5D7JB 4JE4B 5EBWB 2OL3B 1BFSA 5ID0B 1ERNA 4Y5VC 3ZKND 3BP7A 4WENB 4JANB 4GRWE 4EIZC 1XGRB 1ZAGA 2WUBH 4Q9RH 2GUOB 4L5FH 4XGZB 4L3CB 4R90L 2A9MH 4LQFL 2L7UA 2A6JA 5I1IL 1PDKA 5D7SL 2D03L 1EUUA 1HHGB 4R8WL 3UAJC 1UG9A 1OAKL 3OJMB 1KELH 4XNMB 4LPYA 4BSWB 1TQBB 4PJGB 4POZD 3FQTB 4X8JB 4XMLL 3CJJA 4Z7UE 1DBML 1VADB 2J88H 2RJMA 4JZNB 3ARZA 1HXYA 3UPAA 3QUML 2VLRA 2IC2A 1AD0B 3NCFB 4I0PC 5E6ID 4EVNA 3PWVB 3EO0B 5MENE 4XC3L 5DFVC 1CI5A 5BJTA 4U49A 4QKXB 3ZE2E 3G6DL 4GO6B 3VFTA 1I9JL 2KZWA 2X70B 1EFXD 1FL3A 4TUJA 3MSPA 5HY9A 2HVKB 4U05A 3WFBH 2R29L 3T77A 4MNGA 4OTXL 2NLJB 5E9DD 2R0KH 1LE5A 2P49B 3VXRD 4OSUH 5EUKB 3N1MC 2AK4D 3T08A 1FSKC 2YR3A 2QTEA 1SEBB 3MMEA 1ZHKB 4F7CA 5DK2A 2JJWA 1NLDH 3TN0A 1WUNT 2ILLA 4KROB 1IC7H 4YXLH 2AERT 1V7ML 3O3AA 5JQHC 1IGML 2JCCF 5EORL 4H88H 3PQYE 3QPQD 4NNYB 5FYKH 4MXVF 5GSRB 1HQ4B 2WWKO 4Y4FB 1DVFC 5DEFA 4XVTH 4XVUD 1UWXK 5J9PB 1Z0NA 4I4WA 1JGUH 4WI8A 3KYMA 5F1OB 4LLQA 4YX2H 3HNTH 3T0EE 2JELL 4R4BB 3PP3H 1JPGA 3LKRB 4NFCA 4WWKD 1TCMA 2VC2L 1NKRA 2M8XA 4QTHA 2BDNH 5C08D 2VQUA 4YPGA 1U95A 43C9A 4AIXA 5F96L 5KS9B 4JO3L 4R7DB 4UT9L 5ESVA 1NFDB 2OTUB 1EJ6A 5J13B 4UMGA 2ESVE 1MF2H 4PJ5D 4V2CB 4X80H 2HJFB 5E2VH 3RUGF 1T3FB 1RUKH 5GRXG 4Z95H 1FJ1B 3OAUL 4HS3A 1YEGL 4MX7B 1JFQL 2FATL 4PJFF 1YPZA 4LEOA 4I48A 1H3PH 2WWMC 4Q6IB 5CKGA 3MRGB 4D9LH 1UH4A 2VITB 3IKCA 2CDFB 3EFDL 4WU7A 1AGEA 1YUHB 2Y6SC 1NL0L 4ZPTB 4K23L 5DHXB 5DMYA 3EBAA 3ARWA 1J10A 3QJHA 1X7QB 3S88L 8CGTA 4KGLA 4WV1B 1D5XA 2QV2A 5DYOB 4GQPH 3KDMA 4J8RB 1H15A 3SKJH 1DBJL 1TIUA 2IFFL 4XAKE 3NCJH 2OR8A 3MRCB 4APQA 4HPYL 4NO3B 4LIQE 1RU9L 4NP4H 3BQUA 4FQCH 3QUMA 4LCYB 3HE6D 1A3RH 3BO8B 1OB1B 1R3KA 4U6YB 1MUJA 1JNJA 3CAFA 1IGCH 5DVMA 4KAQL 4X4XB 3WE6B 2LQRA 3RVWC 4LSPL 2X40A 4EDWL 1U8OA 1NPUA 1U58B 3M07A 4H20L 4M00A 3UTZA 1Y6NR 4HQQH 5C0BB 4OJFL 5IVZA 4N5EC 3C5SA 4KQ3H 1OAXH 1P6AB 1TCRB 4XCCL 2HKHL 3P4OA 1MCPL 4P59H 3R06A 3SCMD 5BCAA 1QTYT 1XIWD 3JWDC 5JHLH 4P99A 1AP2B 2AAVA 3DV4B 3BWAB 5I2IB 4QRPD 3ZO0A 5C71A 3DROB 2AABH 1AR1C 3X13A 4XP9L 3MGTA 5C0CD 3LPFA 4X6CB 1G6RH 1MH5A 3BP5A 5HGAB 4WCYH 1A5FH 2APVA 2BVQA 2FJHA 1N64L 5GS0D 5D96B 3DX9B 3C09C 4M7ZC 1CLYL 1DFBL 4LSQL 3SDDA 4UTBH 1F97A 3OV6A 4EN3A 4F7MA 3RIFF 1JGLL 5E94B 2GJ6D 3MXVL 4JFHD 5F1SA 4NBZB 4U1KA 4JREB 1IZKA 2NY1C 1U3YA 4HUVB 2X5PA 4JFQB 4N8VA 4J4PD 4QRQA 2Z92A 3RX5A 1N6VA 1F8TL 4HPOL 3UTQB 4YHZH 4GT7A 5CMAB 4N0FA 4Q7DA 5LGJB 1WF5A 4HCRA 4D3CL 5SWZA 3BGAA 4LCWD 5ELIA 5GGQH 4DKFH 3UEZA 1QRNA 4U1SA 1VB9A 2C26A 3V7MA 5KSBF 4IOFC 1LMKA 4XBGB 4P2RE 4JRYE 1AI1H 3CPLA 4G8EA 2JJTC 3W2DL 4HGMA 1QFWL 1VFAA 3C6SB 3PP3K 3CFDB 5C2UB 1WQVT 4DEPB 1IBGH 1MOEA 2GK2A 5HPOA 3JWOL 3U0WH 1N0XL 1NCTA 4KK6C 4RIRB 1V8HA 3RZCB 4EZMA 2QKIA 4HKJA 3EYFA 1ZGLB 2V2XB 4G9DB 4XNYH 5GGSY 4BZ2H 1CXLA 5KVGH 1M7IB 4ZD3H 5HHOB 4RNRB 1DBAL 2NTFA 4XMKL 4BFIA 1NCCH 5J12C 4EDXB 2EDWA 1G7JB 3E6FB 5IB4B 4XHJD 3NABH 5AG8A 3FQWA 3A67H 2YUXA 5I1AA 1OSZA 4QRTA 3U82B 1ROWA 3FQNB 4X9GA 4C55A 3V5KB 3OPZH 1EAPB 3MRJB 3IF1B 2E8YA 2VDQH 3WJJA 1VFMA 2B4CH 2X89A 4LNRA 3EO1A 2EDOA 4LAQH 5KAQG 2JB5L 1UYWH 5LBSH 4O9HH 4TNWF 2X41A 1IFHL 4M4RA 3S6CA 1YA5A 4OGZA 1YMMA 4YEEA 1MRCH 1MEXH 2DQUL 3Q3GA 2MHAA 1MFAH 1VHPA 3NIFF 5JW3L 1UJ3A 4NRZA 3TJHD 2EEDA 2NW2B 5F88B 1B6DA 1ZLWK 4H1LB 4BK5A 4OZFH 3CU1A 4XAWL 3GK8H 3I50H 5FOBA 4PJAF 3UBXI 2J7LA 1T22B 1XGPB 1K4CA 1IM9D 5F3HB 2Z35A 3BQUC 2EDYA 1MAML 1YC7A 3F5WA 1KCLA 3HMWH 5L2KB 2BX5A 3MNWA 3RL1A 3SDCA 2AKRA 4N0CD 3BKML 3R0NA 1XGTB 4NGHH 1KIQB 1GRWA 1ZLVH 2AW2A 3O6FB 4KJQD 5T1KB 2VLLA 4NJ9H 1PX4A 3QFJA 5D8JH 4PGEA 2AV1B 2EYRB 5T1LA 2APTA 4DAGH 3VDCA 2I5YL 3K81A 4HIIB 5BQ7B 1I4FB 3O3EA 3U9UA 1A4KA 5T3XE 1G1CA 2IPKA 3K3QA 4FFWC 4PJEA 4OM1L 2E7LC 1KLGB 2Z31C 2ICWI 2X4TB 2ZZUT 4O58L 4GXUM 4LLUB 3LRHA 5DT1L 4C54A 1KCSH 4I2XB 2HMIC 3RWFB 1NKOA 5L9DL 4YHMH 1UM4H 3CDCA 4LKXB 3O2DA 3CFCL 3NZHH 1KCRL 2PR4H 3SE3A 3B2UD 3D2UB 3SDDC 4JQXA 1WFNA 3RTQD 2CKBL 4EN3C 3C5JB 5F7WC 5E00A 2DIJA 3U4BH 4LEXH 4BZ1H 3HC0A 2JIXD 3ULVD 4JVWA 4DWHA 5GRVK 3W81A 4K7FA 4PRNA 3QCVL 5IB1A 3MUJA 1C5CH 1WCBB 3HPLB 1P9MC 1MJJB 1MCRA 2YD6A 4MJIE 4MQ7A 3WS6A 5B39G 4P2OC 3UJJL 1Y18A 5I76B 1X5GA 5DMJB 1EHAA 1OAYH 1HH6B 3WIIL 3JUYA 1SJEA 2EYSA 3EYQD 4AIZB 25C8L 5CD5D 5I1DB 5KANI 4UDUB 3H7LA 2ZSVA 3GM8A 4ELME 2Y7QA 4MQXC 3OKNB 1CDGA 2ERJC 2JJSA 4L8SA 5I9QC 1AGBA 2VL5B 1KEGL 4LRNH 5D7LB 4LSVL 1Q0XH 2EXYD 1T66D 5JXAH 3K8KA 1IGIH 4N68A 5CP3H 5T1MA 1JPST 1YEHH 1PKQB 2YBRA 3B9AA 4YBQD 1JHTB 2BNQA 3QEHA 1KN2L 3BD3A 1YEEH 2IPUG 4YBLC 2AJUH 5T1DL 2VSCA 3N0PB 4QHUB 4FP8L 3OKEA 2VE6A 1OAUH 4JFFB 3P0GB 4QXGH 1DLHB 3LDBB 1ZMYA 2BMKB 5KJRL 1ADQH 1NLBL 3OKKB 3GMQA 1BD2D 3SPVB 2JLLA 2E6PA 2FO1A 3QDME 4LLMB 4YUEH 5BMFH 3PWJB 3KPOA 5C09E 4PJ8B 4GAGL 3WJJC 5B38A 4ZQKB 4G3YH 1JRHL 4ZO7A 3PDOB 2OSLB 3KR3H 4WUUD 3THMH 1YQVH 5C07D 2NX5B 4R97B 3L7EB 2IBZX 1QLRA 3LEYL 4XPAH 1ZSDB 1IM3B 5SWQB 1DBKL 4P4KB 3MC0A 1LO3H 5JA8B 1UJ3C 1I1YA 3HG1B 4LARL 3LKPA 3WXVL 2NW3A 3NMEA 4PY7B 5E1HB 4PJGF 1MWAB 1ZLVK 3BP4A 3ULUF 3HZKB 3EOAB 5ISZE 2P5EB 5EFIA 5C0AD 2OXHA 3L3GA 3BP6A 5IHUL 1NJ9A 2CLZB 3BGMA 1EERB 3BSZH 3IFOB 4NQEB 2HWZL 4FQHB 4JHWL 3UCRA 3SDCC 5TDNA 1NDMB 3C2AL 5IW3A 3GSWA 3SJVA 1C08B 4RFNB 1PLGL 1T0PB 4CL7A 4G9FB 2BNUB 1FZKA 1E6OL 4TVPL 5CZXD 3D39D 3QCTL 2WBJA 2O61A 3QUXB 5ECJE 5L2JA 2BSTB 2GITA 4FMFA 5DVKA 5F70A 5HHQA 3VXMA 1HWGB 5IT2L 1DE4A 1YC8A 5JQ6L 3GSXA 4KRMB 5KSUA 4PS4L 3S37H 4XNXH 4LGSB 3IU3B 1UKSA 4UAOC 4F3FB 4G43A 4GRWH 3NCCB 1CGTA 3EHBC 1GZQB 5AZ2H 5BO1L 3JWOC 1Z0MA 1ZTXH 4PJBE 4S1DD 5C0DA 1A14H 1UM5H 5TQ2H 3MRBA 3G5ZA 3TFKC 5DRNB 4DCQB 5FYJU 5F6HJ 5IVNA 1N5YL 1NGPL 3BZ4A 2X9YA 4CNIA 3UO1H 1UC6A 1S7RB 3KJ4C 1QVOB 1P7QA 4QHNB 5HDLA 5INCB 3LQAL 3RU8L 3HAEG 3UP1A 3PDGA 3SE3C 3UTTD 1TPXB 4JQXC 4NDMA 4NHCL 4A2LA 4KPHL 4C4KO 1F58L 5KS9F 2XN9D 2VLJA 4OZHB 5E8EB 2CH8A 5I18H 4HJGA 1NFDF 2GTWA 2PTUA 5HGDB 5CEXA 5HDQL 5I66A 4XT1C 3PP4H 4OZIA 4OUUB 4NC0B 4WTZA 5TE7H 5K9OB 4OZGF 3NH7L 3P9WB 4FZEH 1NGXB 1T1YA 4J7RA 3PWLB 3O0RH 3S9DB 2R4SL 1ZV5A 2QQKL 2W0LA 4P23B 3TIEA 4HDIA 3NAAL 4X4ZA 5HI3C 3DXAB 2XFXA 2VXSL 4BKLB 3TH2T 1BEYH 3N1FC 1EHLH 1A2YB 3QDHA 3CVHH 2GT9A 1GIGL 3MRFB 1JL8A 1BVZA 3HE7D 1JGVL 3NGBB 1ZHNB 4I18A 3HB3C 4YWGH 3RKDC 1OD9A 5IW6A 3REVA 2R8SL 4CMHB 5MERB 1MRDH 1U8KB 1WT5A 5MHSE 2COQA 2JJSC 2V5TA 4L8SC 4G6AC 4FQPA 5ITBH 5BW7A 4C59B 4G6JH 2H9GA 1XF2A 2BSSA 3MBXH 2XYCA 4A6YL 4JFYB 3W0WE 4JO2L 2NY3B 2IH3A 3BPNC 3QRFM 4NYLB 5I1LA 5F44A 5EZJA 2BVYA 5A16A 4V1DB 4KH2A 1I75A 4OGXH 5D2NA 5EBMB 1CYGA 1UQSB 4Z7QF 1ZGLP 4RGOL 4JB9L 1CU4H 3SE4A 1IC5H 4JM2C 3GUTA 2WWKT 4C56A 1OP3H 1GHFH 2QEJA 3TYFA 2XA3A 4EQ3A 4KMTH 4JCMA 3VG0H 1EEUA 2A9NL 4NC1C 5HYIA 2AEPL 4DK6A 1YN6B 5IVXB 2CJUH 1A7OL 3ZTJG 3WD5L 2X4NA 4FABL 2HN7B 3RA7H 3HRZB 4YR6A 4QRRA 5KVMC 3BE1L 4OQTL 1OT1A 4NNXB 1Z6JT 4X6CF 2WINB 3D0LB 1H3GA 4Y19E 5I8EA 4I3RL 3O3BA 3FT2A 4HIXL 1NC4A 3BYYA 4K3JH 3U7WL 3EYOB 4GBXB 3VCLB 1TITA 1BJ8A 1RZKH 1JNHB 2NYYC 2A77L 2YPKA 5E2TL 1I8KA 2AXGB 4HUUB 1G6RB 4X7SL 4YHPA 4QOKE 1QLFB 5DD5H 3IU4H 5LVEA 4LIQH 3SE9H 3MV8D 4NUJA 5GGSA 2ADJA 5FYKU 1QZ1A 2J4WL 3I75A 5GS2D 4NFDA 3T8XB 7FABH 2OS7A 1A6PA 2XG4A 4LDEB 5EZIH 3QDJA 4LDLB 4G80B 1NGWA 4FQ2L 2VB5A 4LOUC 2EC8A 4ONOA 1ZKAA 4JFDB 2H2PD 5GGUA 3VFNA 1PZ5A 1LK3H 3F62A 4U0RC 4AK1A 4U7KA 2OTWA 2WBJC 4XNZB 5J7CC 3UTSE 2W9EH 2AJVH 1OTTC 1N5AB 3QEQD 4M5ZL 5KBNC 1A7PH 4LDOB 4ZFGH 2EC9U 5E95B 1OAQH 1TJGH 2FYYA 1T83A 3P11H 1NGZB 5CS7A 3P4MB 4RAVA 5KVEL 2HFEA 4N8CH 2XTLA 3MV9D 32C2A 2R1YA 3QXUA 5B22A 1PQZA 1AGCB 3F58H 2VTFA 5GRJL 2R69L 2Y06H 3LKOA 4GUPB 4PRDA 4HWEL 4KZDH 2V2WA 1H0DB 2PO6C 3WO3B 1SM3L 3LCYA 4A6YA 5CAYB 4ONHB 2VXTL 4P3WA 5DJXB 3FQRA 3ARUA 4Y5XB 5H2BA 4TUOA 3TZVD 3TO4B 1KIPA 4BH7B 3IJSB 4NKOA 5EO9B 3RY5A 5I8CA 4HHAA 5DDHA 1RFDL 1F3RB 3WSQL 5DLMH 3HZYB 4RGNB 4LVOC 4XTRC 2QSVA 3CX5J 1RMFH 1ZHLB 3QXAB 4OV5A 4NKQB 3N1PC 4NN6B 3KPSB 3VXTA 2EE3A 1MQKL 4MNQA 4TTDC 2VLRE 4G42A 1ZEAL 3FTGB 3LN4B 3V6ZA 3OHXB 5T33H 3RWCB 4WRLA 2A6KB 2V7NA 2VWEC 4HG4J 1VGKA 1AC6A 1QSFB 4P2CG 2UY7A 3JV5A 4RMVA 1JF5A 4I18C 3F65A 4BZYA 1T0MA 4ZUTB 4Y4KA 4N9GB 1T1XA 2ZNXA 2YMXL 1E27A 1WT5C 4L4TB 3B9KA 4MNGE 1U92A 5BW7C 5IOPA 1UXSB 3NIGE 4PJ7A 1KJ3H 4XI5C 5ICYB 1OP3K 4OF5A 3WNMA 4WI2A 3O6KL 1GAFH 3HPJB 1ND0B 1CLCA 2A74A 2MCPL 1P2CA 5FA3B 4YHYB 1I1FB 5FM4A 3WUWB 3LN5A 3WEXB 4M48L 1OGAD 1FAIL 5FB8A 5A2IH 1FFNB 1IJ9A 5J11C 3L3HA 5D7JD 2G9HB 3QQNA 5DUMH 3IDJB 5HHXH 2DQCH 5J1TC 3MLSH 4M7ZB 2FECL 1X6LA 3SE4C 5L88L 2D3VA 1M6OB 3S34L 1DQDL 2Z8SA 5HVWA 2CIKB 2VIRB 3VD5A 5C2BL 1BGXH 1MI5A 5AYUH 4E42A 1DANT 1SMAA 3GI9L 5ENWA 5JR1L 4UV4H 2ICEB 4Y4HD 4K71B 4MZ3A 4M4PA 2NY1B 3WS3A 4MJ5A 3GBMH 4P5KB 3RWEB 4D0CA 3IJYB 2CO7B 3QUKB 2DQHH 2H6PA 1S7VA 4PJCA 2F58L 5DK0B 4K8RC 1MY5A 4XP5L 1IGJB 5DQ9B 3L5WB 1KCUL 5DD1H 4WHYG 4NKMA 3D0VB 5FCSH 5JOFB 4UT7H 3FZUD 3OGCA 2Q8BH 1EV2E 1QBML 3VI4F 3KPRD 4FFYL 3P40A 3WXWH 3MCG1 2P5WA 3DNKA 3C08H 3IFPA 4ZOCA 4F9LA 4F2MB 5GISH 3AS2A 1T7YA 3CH1B 4NQDB 1KACB 3PXJA 4M8QA 3LQAC 4OCSH 1RJZB 5TQ0H 1AQDB 3QUYA 3S97C 2VISB 1DQMH 4ERSH 2H26A 3W9EA 4LCIL 4OB5L 5I15H 4MA1B 4QXUL 3MROA 2ZG1A 3D69B 5E8PA 5EU6B 1YNTB 1QSVA 3R4DA 1H8NA 3X17A 1KB5A 4NSKB 1F3DH 2EKSA 2R2HA 3QWOA 2ZUUA 1CFBA 4P9ML 5FKPA 4LCUA 5HDOA 1VESA 2DWEB 3QRGL 1HIML 3VH8G 1G7HA 1WCQA 4PLJC 3PJSB 3VDAA 5JNYB 5IBUG 4Y4FD 4FXGB 5CIPB 3ZLQC 1KPUA 3W39A 5T3XH 1D6VL 1T83C 2NY0D 1HWHB 1J1PH 2ORBH 4YPJA 4E0RA 4YDIL 1HHJA 2QHRH 1GGBL 2I9TB 4YGVB 1INDH 2VDNH 4CMMB 2IANB 4LHUB 5EU5B 4HFWA 5IQ7L 5BZWB 2J12B 1QOKA 3C60C 1MHEA 1UB5A 3EOYG 1LP9B 2HKFL 2IAMB 4TUKH 2BK8A 1AXTL 1G6VK 1R3HB 5FUOL 3ROOA 4QNPE 4Z7OE 2LVCA 1RHHB 5K59E 1A4JB 3PHOB 5HHMD 4OLEA 4LVNC 4CU7A 4R4NC 5CJXA 4NQCD 4JZOB 1BIHA 5HVHC 1W8NA 3V5DB 3LSOB 3VXQA 3FMGL 3GSOB 3TA3C 1F11B 4WUKH 5E5RB 4ZUSB 5L6YH 4FQJH 5EZLA 1KYOJ 3O6MH 4XPGL 2IADA 1KG0A 3HLAA 4KVNH 5D6DC 2D0HA 3PL6D 2F54B 1QQDB 1VKXB 4MXQC 4XPHH 3QIWA 4GS7B 4NN5C 4TNVF 3EJZD 5IMLA 1EEZA 1VFBB 4KY1L 1BAFL 5GS0L 1FO0A 2AEWA 3T0WA 5CZVH 4AENB 2YWYA 1X5ZA 1AKJB 5EA0L 3E6HA 1D6EB 3MOAH 5F1KC 4CAGA 4GMSH 1F4HA 1D5IH 4PY8J 2F74B 4GXVH 1A6VH 4OD1L 1S9YA 1NAML 3GSUB 2QQNL 5SWZE 2Z31B 4YDJA 3BIKA 4Y16B 1EHNA 3GMNB 5MEOB 4KI5D 1QRNE 5J89A 2NXYD 4N0YL 5FYLD 1VPOH 1YJDL 4R2GD 4N0UA 4PGZA 3O9WB 4NJAL 4BUGA 3MGAA 3PHQB 1NMBH 4OAWA 4XBPA 3BIBX 1U2HA 5FK9B 1O7VA 2VL4A 3BW9A 5FUCE 1DQQB 4UQ3B 3QIBC 2QSCL 3QA3B 2X4SA 5DF0A 1BWMA 4F8QA 3V95A 4OCRL 5DA0B 2PYFA 3VFUB 3FB8B 3LHPL 5GRZA 1P4BL 4PJDA 3TNNA 1GPOH 1I7UA 5LWYH 2E5EA 3MJ9H 5D93C 1U8PB 35C8L 3C5ZD 1JZ6A 4CVZA 5DHVH 2VLKB 3UROR 3V4PH 2HH0L 3F7VB 1KTLB 4TRPL 4M93C 3W82A 3DUSB 4Y2OA 2EDNA 3GI8H 4P2OB 5IW1A 4FHBD 2WIMA 4JFOA 1RJCA 1A64A 2P48B 2HVJA 3G5VB 5D2LB 3MRNB 4EJ1C 4UQ2A 1LNUA 1KJ2B 4F9LC 3F12B 1T0NB 1NC2A 4NZRL 1IQWH 1JHLL 5I9QB 1XAUA 5F1NA 1YMME 3KYOB 4W70A 1ZANL 2AJZB 4OZHF 4U6HB 5IGXL 3BH8B 1P5UA 2YKLH 5GIRB 3CFJA 4Z9KB 2FGWL 3N85L 1BVLB 4K2UH 5D70H 1DTUA 3NPZB 4WHDA 2YSSB 5BRZB 1QKZL 5IFHH 5C6TH 2C1OA 4ELKA 4L3AA 1RULH 5DO2C 3V5HA 1XT5A 2VABB 2YPLD 3FN0H 4HX1B 4RZCA 8FABA 1T6WA 4N0RA 4TSAL 2BVPB 4YXKH 4POZC 3BDYL 3LOWA 4DUWA 4TYUA 5DJCB 5C3LD 3VE0A 2GJ6A 4OCXH 5E70A 3RDTD 3I9GH 2F5AH 3CVHB 5HYJD 3MRLB 2DBLL 3H9SB 3MRKA 2ZWLT 4C83A 4JQIL 3MX0A 2AJSH 2LVEA 4OFDA 5CINH 43CAA 1Q9WB 4XCNA 1NAKH 1MELA 4UUJB 4PLKD 3O45B 3RVUD 3V52L 5TDPB 4PJEE 3U4EB 4NZJA 2GAZB 3R1GL 1AO7D 3FONA 3WLBA 1C7SA 1YEIH 5I71B 1YMHA 5CJXC 4ZS7L 1J87A 4NRXB 3TVMA 1NMAL 5FM5O 1RZFH 3MV7B 2VZTA 4Z78A 3KLSA 3ARDA 2IQ9H 5E5UB 4P2QD 5ALCL 1FZOB 5DUBA 1WAAF 5AZEH 5TDOB 3WHXA 1J18A 4OBSA 1U91A 2PTTB 3L3DA 4LF3A 5MP6L 4JO1H 1OAZL 3OKLB 1BLNA 1OY3B 3QXDB 5TF1L 3ZKXC 3TJEH 2E9JA 2BVUA 2C4FU 4EBQL 2OR9L 5CUSH 3HNSH 3D18B 5IVXF 1X5JA 2R1XB 4WI9A 3QIWC 1HHHA 4C4KT 2X42A 4U1IB 3IB4A 3K2MC 4DGVH 4JDZB 5FHAH 1B0GB 1ORSB 4M7JL 3EYVA 1LDPL 1F4XL 5ACZB 5D72H 1QPPA 2KZ1B 2Y23A 2DTMH 4DTGL 3I02B 1RIVL 2CGRL 1F6AB 5CWSA 3O6FD 4L9LA 2R0ZH 1FE8L 3FKUS 4HEME 5JXEA 3WLWD 3NACH 4OLVH 1N6QL 3S8WA 2Y36L 3IGAB 5IROA 4I5BA 4HKZB 5EDXA 3HTLX 1D5ZA 2YUZA 5MEQB 3Q6FB 1HZHL 1MCLA 3BPOC 4LBEA 4HJJL 5C9JB 1BVKA 3KJ4B 5F7YC 4PTTA 3IDGA 4K94L 2FEEL 4JFED 1UVQA 2BVOA 5D1XA 4W4OA 1K8DA 4LPWA 2GCYB 1ZT4A 3KPMA 3GMRB 4KXZI 2BNQE 3TLRA 3QQ3A 1UZ6E 1NBZA 3MLYH 4OLUL 2ZJSL 2XTJE 3VFRA 5IFAH 4QHKJ 2P46B 1W72A 3BT2H 3QHTC 3GRWL 4UIMA 3STBA 3LPGA 4HC1A 1L7IL 4U1NB 4IRZL 4OGAD 4DKAA 4M7LH 3PWPD 1JGDA 5F7NC 5HYSA 3VRJA 2E27H 3IDIA 4JPIA 4X0KB 4NRYA 4PYGA 3U9PL 1DCLA 2NQCA 1QBLH 2VZOA 3WIHH 3OJDB 3S36X 3LKNA 1JJUA 4PRPA 3VJ6B 4JM4H 3RI5K 3RWGA 3X3GL 2W0PA 4NO0D 2VDPL 4F7TB 1EO8L 5IESL 1SYSB 3OZ9H 5FGCE 5JHDD 4WFFE 5EC1B 4B7LA 3SCMC 4M62L 4AZ8A 2YOCA 3ZMRA 3FQXB 2V9QA 1AHWA 1XIWC 2OZ4H 4PRID 5EU4A 1NGQL 1NCWL 5TH2B 4HEPG 2O93L 2BY3A 4JN1H 1S7TB 3PWNA 1FFOA 3OSKA 1UB6A 1KT2B 1AE6H 1HI6B 3QEGH 3ESUF 3MLVH 4KWUA 2DOCA 4FQXB 3U36A 1JNNL 3GSQA 5EC2B 4JM2B 4IM8A 4M7KL 3G08B 4N8PA 5GS0C 5I1HL 3MODH 5AAWA 4Z8FH 5KSAD 4NC2B 5DJ8B 5ANMA 4D9QD 3SJVE 3LVEA 1R5VA 1JV5B 3JV4B 1J88A 1T03L 3T04D 5DQJA 5TGBB 1MIEH 1BIIB 2EDQA 1QSEA 1NBYB 2XKNA 3X3FL 5IM7B 5T3ZD 2JIXA 3TBVA 3CH8A 3VXME 3P9LB 4UU9A 1CFVH 1NCAH 2XPGB 1MCWM 1ZT1B 1YJDC 3FRUB 3GSNA 3GHBL 3ZT6A 3AREA 2DIBA 1FNEA 1IGFL 1XEDA 3RGVA 1NEZG 3LMJH 2PCPA 3MLZH 1QNZH 2JCCA 2W91A 5EBGA 3LQMA 4P46D 5F9DC 4HKXB 4DVBB 1QD0A 5I6XB 3ARDC 3NFSH 4XP6L 5TE4H 5AAMA 4Y1AA 5EIIB 1YNKL 3O11B 2CKBB 2Y1VA 5DD0H 1T2QL 2FHFA 3IFLL 2WP3O 5DJ0B 5CJOH 4HMCA 1FIGH 1OTSC 4ZG1A 2DJUA 2VKWA 5JDSB 1E28A 2BOBB 3CXDH 2HLAB 4U0RB 3ME0A 5DFTA 1T21B 4PG2A 1UWGL 4HXAH 2VLJE 2ITDA 4CU8A 5F6IC 5I8OL 1QA9B 3HNVL 3RUGA 1T04B 2OMBA 4OZIE 4JHAL 4N90E 1QHPA 5FO9B 1WC7B 5HYEA 3MRQA 4PJFA 4Z76A 2FWOA 2VDOL 1KIRB 3MBEA 4M43H 1OP5H 1LO2L 2XQYK 3EYSL 3WL9B 4DQOH 3UJIL 3FFCD 1FL6A 4C57C 5JIPA 3QZWG 3DGGB 4HFUL 4KRLB 4X7EC 3RWIA 1BD2A 1J8HD 3E3QC 5I1EL 2YHGA 4X5WB 4LSTL 2A73B 3PGCA 1EBAA 4ZFOB 5CJQH 1U8HA 1CICB 1U8MA 2PO6B 4J6RL 4XHQA 3KJ6L 1M7DA 4OT1H 4U1LB 1NBVL 4AH2B 2G60H 3F8UB 1K4DB 3SE8L 3GMLB 3TBWA 3O4LD 1A1NB 1DBBH 3MLUL 5IEHA 5DJYA 3L5IA 4W4OC 15C8H 1DQTA 1ZA3B 2VYRE 3LKQA 4WW2F 3B2VH 3MREA 4YXHL 2MQ3A 2H32B 2P7TA 4PRAA 4XVJL 2HJLA 4M6ML 1L0QA 5D2NE 2EDKA 4MHHG 2A6DB 1WBZA 1KEMH 5FYKD 4PP1D 2G75A 3CXHJ 3F6LA 1YDPA 3FB6A 5GJTL 3L9RB 2NNAA 1XGQB 4TVPE 3V6OA 4C56E 3STZA 4PB9L 3DV6A 1BP3B 2XQBH 3EOTL 4PB0L 1EXUA 3HR5B 4HF5L 3O8XA 3P0VL 4NOFA 1JPTL 1ZT7B 3GSVA 4JFPB 5EPMA 2DWDA 4JLRA 1Q0YH 2ID5A 4O4YH 5JW4M 2DS4A 4QRSB 1S7QA 1OSPH 4QRRE 2RGSA 1I3GL 1KCKA 3FOLA 3V0VB 1I3RA 5FHBH 2WM0A 5FIEA 2CIIB 1ZWIA 1VEOA 5GS1A 3H2WA 2QADD 5K9JL 1AHWC 3QDGA 2GYSA 2IMNA 4RGMC 2HAZA 4G7VL 4X5LA 2MQCA 3DMMA 4JRXD 2Z4QA 1OWRM 1NDGA 1JIBA 3AMLA 2D9QB 1CFTA 4Z5RA 1A6AA 3R0MA 3MXWH 1MRFH 4MLIA 1FGVH 1IC1A 3ARXA 1TTGA 3QUMH 4UIKL 2F53A 2R4RL 5DA4A 4P49A 4OD3H 3V4VL 4ODUA 3RRQA 4YLQT 5DURD 2FX8L 3ULSA 2MTPA 3QDJE 1XH3B 4MJIB 4XC3H 5ICXB 4PRHD 5IFJB 1SVCP 5E6YA 1IAIH 5FV1L 3VWJB 3T2NL 3O2WH 5CLWA 3V9FA 3BKYH 3RTQC 2DLHA 2J2ZA 2XN9A 3P77A 1CFSA 1S9KC 2P43B 1I3UA 1I8MB 5KSBA 1IEAB 2IQAA 5DQDH 4L4VB 4HS6A 4L3EE 5ADPL 4L8DB 4F33B 1Y0LA 5GGVY 3RPIB 3D85A 1FL5A 3IDXH 4U1JB 4ZTOH 3D3VB 1SJHB 2J8HA 2G5BB 2ZPKH 2X6MA 1U3HD 1IAII 5DMKA 1OF2A 1W0VA 3VRLE 2P24A 5DJ6B 2Z91B 4IEFB 1EEYB 1LO5B 5KTEH 4HZAA 3EYQC 1U3JA 4MA3A 5GHWL 3DX8B 3ARBD 3IXAB 4D0BA 1X5LA 4PD4J 4DGYL 1OP5K 3HC4H 2I60L 4JY4B 3UBXA 5FGRA 4ZFZA 1KPRB 1I7RA 2EXYC 1T66C 2Y72A 1GVIA 1TFHA 1Y6MR 4S1QH 2PYED 5SWSB 1ES0A 3OGOE 3PABB 1KTDB 3IT8D 5DHVB 4MDIA 4AL8L 2NCMA 1ZS8B 4P5TA 1RVFH 2HFFA 1N26A 3MRHB 5D2LF 4E5XA 3TYGH 1E6JL 1JI1A 3VXUD 4HCRH 3B9EA 4UINL 4MNQE 3NFNA 4E41D 1G0DA 2DYPB 4PGCB 4ETQB 5C0FA 2HT2D 2CLVB 3EFDH 3PIQB 3PGDA 1MCJA 2DLFH 3E1F1 4PV9A 1CFQB 4IS6A 2WMPA 1NL0H 2MQ0A 2WIIB 3GMOB 3OXRB 4LCCB 4S1SL 3BH9A 4MSWB 3C60B 2Y5TB 5E6ZA 3BISA 1MJ7L 2ATPA 4MCYB 4KMLB 4PJAA 3WFHB 3KYNA 3BRFA 1MVUA 4H5SB 4G8GB 1IC4L 1DBJH 4UDTB 4PJ7E 2C3VA 1FZMB 3WO4B 5CEYA 5I1JH 1HE7A 3ZE2F 5HVHB 4PGBA 2YXFA 1OM3L 2H8PB 4HK0A 1X5XA 2BNRA 3TA3B 5DMIL 5DRZA 4Z7NE 3TF7C 4K3GA 4J2XA 1C1EH 1AQKH 3DBXA 1RD6A 3L3JB 3MR9B 2Z8RA 3MRDA 4IIQA 5I17B 5BS0D 3GIVA 3RAJL 4HH9B 1Q9KB 4U3CA 5DUPL 1S5HB 1AXSB 1L0YA 4OLWL 2J5LC 1TJIH 3MFFB 3B83A 4NN5B 3QUZA 2QSQA 3HZVA 1XR9B 1MI5E 2HKHH 2I24N 5ICZB 1NCDL 4XP4L 2J3SA 1CD0A 1WITA 1CLZH 1NUGA 1FNGB 4F37K 1SBBA 1ZXQA 4PJCE 1F6LL 4HAGA 1E4XH 3BKCH 4JPKL 3MRIB 3SDAB 1PEZA 2FJFB 1XF3A 4LU5L 3SOBH 4QT5A 5JPNB 5F6HI 3VFGH 4GRLB 5F7DB 1EO7A 1RZ8B 1JN6B 5FGBA 3DRTA 4JKLA 5EOCH 4HMEA 2X7LA 1L9NA 5A3IC 4HIEB 5GSVA 4D0DB 5GS1C 3L7FB 2P5WE 3OKDA 5IKCB 3ULUL 1RURL 3DMMC 3RWDB 3ZDXF 5DI8B 1TMCB 1G7IA 2AV7B 2DQFB 3ZDYF 1RUPL 1F4YL 4S1DC 4KKCD 4KQ4L 2V2TB 1E4XI 4WI3A 3QIBB 3VXSB 1TVHB 4KVCL 2W9DL 2E9IA 2CK0H 3P9MA 1P4IL 5TFSL 5I19L 3EOBB 5A2LH 2XNAB 5L7XL 4I0KA 4O2CA 1I7TB 2RFXB 2OQJA 3HI6H 4PYHA 1O0VA 3IAQA 5HPMA 2SEBA 1G7QB 4YAQA 4D3CH 5I75C 4M93B 3E2HC 2VXQL 1UZ8A 1AC0A 4U7MA 3EZJB 2A6IA 3PE9A 5EZOH 3O6LH 3W2DH 1I9RH 1DJSA 4YHOH 4DZ8B 3QAZC 2IH1B 5I8KL 4EI5D 1HINL 1V3MA 5DRXA 3DLQR 2FEDD 4E9LA 4QCIB 5F7KC 4Z7VA 5J3HD 4MZ2A 1QHOA 4KFZC 1LD9B 4OLYL 4LLYA 5C8JB 3RWHA 1GOHA 3O2DH 1ZGLM 2HFGL 4ZOEA 2C1PA 4FTVA 1LK2B 1M71A 3H6JA 4XMKH 3L3OB 2GIYA 2OBGA 1RUQL 1QACA 2GTZA 1JYNA 1LE9B 2F8OA 1RK1A 1S7WA 3VW3H 3KWWB 1YEDA 2VN7A 3DX6B 3S3SA 4F57L 3G5YA 4NWUH 3VXOA 3JTSA 3V6FB 1DP0A 1V3LA 5EBWA 4P5TC 5D7JA 1NCUA 2V9RA 2OL3A 5ID0A 1GJIA 1KPVB 5E4EC 4RMQA 5JZ7C 5T5NF 3HZMB 4JANA 4S1RL 3ZYIA 3MYJB 1XGRA 5DD3H 3BZEB 1J1XL 1X5AA 2GUOA 4XGZA 4L3CA 5LG1A 5LCVL 1OT2A 5J1AB 1B9ZA 12E8L 1WEJL 1QR1B 1RUMH 5E6IB 2B5IB 3AVEA 1HHGA 1WWWX 3HI5L 3ARVA 1GGTA 5BVJB 4XNMA 4BSWA 3GIZL 4M9OA 4PJGA 1EFXB 3RVVD 3HMXA 1GC1H 2XXMB 3G5XB 3FQTA 2VXVL 4X8JA 5I74C 1DDHB 3EDKA 1VADA 3H3PH 4JZNA 1U93B 1SY6A 3MJ7B 4KUZH 5E9DB 4O5LL 1AD0A 3VXRB 1CFNB 4JM2F 4N0UE 4MDJB 2AK4B 3PWVA 1MAMH 3EO0A 2NY2D 1FG9C 2IAMD 2X70A 4Q74A 1DUZB 1WISA 4KTDH 2HVKA 2XA8L 4LASL 1A3QA 5FYLL 2NLJA 4X7FC 2DDQL 1B4RA 4IMLB 1BFTA 1MFCL 1WK0A 3RBSA 5EUKA 5HD8C 4JG1L 4PJDE 3HR6A 1RUAH 2XWTB 1SEBA 5C0IB 4U6TA 1EA9C 1ZHKA 2ZCHH 2N1KA 4XPBH 2H2PC 2XRAH 3TV3H 4M02A 1A6WL 2PXYD 4WWKB 1S3KH 4L29B 4OIIL 2FDBP 5JPMB 4GMTL 4NNYA 5C08B 5GSRA 1HQ4A 3B5GA 4Y4FA 5GGVL 5HI5D 4ONFH 1JHKL 2DKSA 4ODSH 5DT1H 3IETB 5J9PA 2B0SL 2KH2B 3SGEH 5D1QD 1HNFA 3RWJB 2B2XH 2CKNA 3HS0B 4PJ5B 3ZE1E 1CK0H 1PSKL 4R4BA 3I2CL 4UOW0 3D9AH 4UT6H 4Y7MA 3LKRA 4Z0XB 4IRSD 1CE1L 1BQHG 3LIZH 3BPOB 4JY6B 4UOJA 3CLEH 5IIEB 5KS9A 1X44A 3OWEA 3GMPB 3X12B 3DVGB 4V2BA 1NFDA 2OTUA 4ZTPL 2N4IA 2E8ZA 2HJFA 1T3FA 1U36A 1FJ1A 3K1KC 3FRPG 4MX7A 4R0LC 3IDYC 4NFBA 4N1EA 1XMWA 4Q6IA 3MRGA 5B39B 2YD3A 4OBRA 2VITA 2CDFA 2BJML 4U0QB 3QBTB 4YEFA 2MKLC 1YUHA 2WSKA 4ZPTA 5AD0B 4OZ4B 2IFGA 4FZ8L 3TPKA 4MS8D 3HE6B 2LU4A 3TWCL 2WBWB 1F90L 5D71H 3WIIH 1X7QA 4QHLB 4HXBL 4WV1A 25C8H 2Q8AH 5DYOA 4J8RA 3EYUL 5FF6B 3WFCH 4WDIB 2IBZY 1S9WB 3RKPA 3NPSC 4Q6YA 3MRCA 1FNAA 4NO3A 3NZ8B 1OLZA 4LCYA 4CKVX 4FNLL 4CADB 3BO8A 5CEZE 1OB1A 2OJZH 1UKTA 3BIAX 1F4WL 3SCMB 4X4XA 3WE6A 4YK4C 1SHMA 1XIWB 3S5LG 2MNUA 3KLDA 4OF6A 3TBTB 1U58A 4QRPB 1JVKA 2PNDA 4M1GH 5C0BA 3FJTA 3HN3A 3UYPA 3BRGC 4G8IB 1DL7H 1TCRA 4ZOAA 2CMRL 4Y0GA 5C0CB 4XPFL 2FIRT 3VGAB 4MA8H 3KAAA 1MFNA 4JY5H 1G9ML 2WP3T 4ONGL 5D7JC 4BYHA 4KZEL 5IMOB 1AP2A 5BZDB 3DV4A 3BWAA 1INEL 1TZIB 5I2IA 3QIUD 4AIOA 4YNYB 1JRHH 4HUMB 1BFVL 3DROA 4YDLB 1JZ2A 3F6IA 5MEND 3LEYH 4BH8B 3L3IB 4F7PB 4X6CA 1NAMB 4DN4L 5DR5H 4YHLH 1DBKH 5HGAA 4D9RE 4Y4HC 3U7AA 1HOCB 5FYJE 1PJ9A 1IQDB 3CMOL 4LARH 4OZFG 4XNQB 3DX9A 1TQBC 3RVXC 3UXFA 5D1ZD 4NCC2 5IJVB 3ULUC 3WCYA 4XXCC 2UWEB 1MPAH 1KUMA 5E94A 2K3TA 4LCWB 1Q72H 3E3QE 1JRHI 1R3IL 1M05B 2HWZH 2YRLA 4HUVA 4JFQA 4NQVB 3CX5K 4IDJH 3QI9D 4OCWL 3PQYD 1P4LB 3UTQA 3AAZB 3QXWA 2YPVL 5CMAA 5LGJA 5C0RH 2XACC 2H1PL 4TVPH 1E6OH 2AK1L 3OF6D 5EWIL 3AM8A 4NNPH 5DEZA 2PW1B 4XBGA 4X6EB 3RX8A 3T0ED 4WO4D 1I9IH 1B4JH 4XWOD 4LSUL 4I3SL 3C6SA 1VEPA 5BXFB 3CFDA 3UZVB 4HG4K 4B0MM 2LE9A 2BFVH 2A0LD 2R1WB 4HWBL 4PV8B 2Y07L 3BPCA 4K8RH 3CUPB 3MOBH 4RIRA 3NFPB 5BO1H 4Y4FC 2ESVD 2VQ1B 5I1GL 3RZCA 2O5YH 3TM6A 2WNGA 1ZGLA 2V2XA 4G9DA 2CDEB 3NBNA 2NY0C 3C8KB 3MNVB 1M7IA 2HFTA 4PRPE 1R6VA 5HHOA 4RNRA 3HAEB 4JRWA 2Z93B 4GKNB 4KK5C 5CGYC 3RU8H 4EDXA 2RR3A 1G7JA 1Q38A 3E6FA 5IB4A 3VFSB 1JTOA 5JLZB 1AFVL 2DI8A 1DQLL 2CRZA 3FQNA 1PVHA 5KANG 2NZ9C 5IK3B 3V5KA 1EAPA 1MHCB 3MRJA 3IF1A 4N5UA 3TT1L 3T3MF 3NH7H 4XAKD 4Q6IC 5F1IB 5HSFA 1FLRL 2ADFL 2HP4A 1VGEL 1D5BB 1IL1B 3ROLB 3HFML 2QQKH 3VXNB 3MNZB 3N9GL 1QFUL 1IM9B 4PJ9B 1J1OL 4PY8I 4M61B 2NW2A 5F88A 2IEPA 1GIGH 3MV01 4H1LA 3IFNL 3PL6C 4I0CC 3HRPA 4WV1C 5LGHL 5ANME 1JGVH 1RIUH 1K5NB 3CK0L 2QSTA 1T4KB 3AUVA 1R3LB 2R8SH 5FO8B 3ILQD 3EJZC 2DLIA 1UCBH 1T22A 1XGPA 3ZE0F 2R2BB 1QSEE 4RISL 1P84J 5GGTL 3LS4H 5F3HA 3RNKB 1TDQA 3WFDL 4GKOA 1CF8H 2F19H 1S78D 4QTIH 5J8OA 5L2KA 3KPTA 3ZT7A 2YK1H 3SQOL 1CT8B 4X4MA 3TIDB 5SX5H 2I9LB 1XGTA 5IVOA 1A7NL 1MIMH 4P5MB 3P30L 3RZWA 4Z7WB 4X9HA 1KIQA 4CN4A 2JCCE 5T3ZL 5FA4B 3O6FA 5T1KA 4MXVE 1GGYA 2K7PA 3CIQA 4GLRH 4I9WE 3BDBA 2NXYC 4NIKB 1X6NA 4Y1AE 2AV1A 2EYRA 2HT3C 1GXEA 1CXEA 5CGMA 4HIIA 5BQ7A 1I4FA 2IGFL 2Q6WB 2FB4H 1JZ4A 5BV7L 2UZIL 1KLGA 2AQ2A 2X4TA 4XP1L 3EO9L 1XZ0B 4LLUA 3QQ9D 4FABH 3L6FB 2FNBA 4QGTA 3RTQB 4NZTL 2VR5A 4I2XA 2Q86B 4DZBB 3PG2A 2J6EA 3SEPA 3RWFA 3SKUD 4B7IA 4YHNB 2FX7H 4GLRI 1MCOH 3RUGE 3CDYA 4L5FL 2NTSP 2A9ML 4PJFE 5D96C 1EUTA 3C5ZC 4LKXA 5D5MB 3QYCA 4ZFFB 3GB7B 1KXTB 3D2UA 2A77H 2ZUXA 5LAXB 4LMQE 1KELL 3C5JA 1Z9MA 4P2RD 4JRYD 2XKUA 3MCLH 3RL2B 4W68A 4X9FA 1A02N 2J4WH 2J88L 4P4RB 5E1AB 4Z0BH 5GQBA 1VA9A 4OFYA 1PG7H 4X6FB 2AXFB 1F3JB 4P57B 2LU3A 1KYOK 1WCBA 3HPLA 4FQ2H 3M17B 4NQUA 3VA2C 1MJJA 3V79C 3BXNB 1NQBA 4MNHB 3C9NB 1V05A 3U46B 3GJEB 5I76A 3AM8C 3WFBL 1HH6A 1IAOB 3TO2B 1EVUA 1JNLH 1U8JB 5KVDH 4F8TA 1HK6A 4AIZA 3FN3A 2R0KL 5M7QA 1G7PB 5E2WL 5I1DA 4UDUA 4OSUL 4DEPC 3OKNA 4WGVB 3VWKD 2VL5A 5F7LB 5D7LA 4WFHE 5HGBB 3V6OE 1NLDL 1T2XA 4TPRH 1IC7L 3QNXB 3RZCC 3SKMB 4YXLL 3QWRA 1MREH 5B3JF 1PKQA 1JHTA 1MJUH 1KJVB 2X05A 5FYKL 2VXTH 1CS6A 1OL0A 3MACL 5CJ5A 3SO3B 4QHUA 4XVTL 2AJ3B 4JFFA 5CHNB 1JGUL 1JYWA 4PG9B 1DLHA 4WUUB 5C07B 4OI7A 4YX2L 3HNTL 2BMKA 4GRMB 1CDBA 4KKAD 3OKKA 3SPVA 4LLMA 4RDQF 2H2SC 3PWJA 3QDGE 1KB5H 2FJGB 4PJ8A 1CICD 1PYWB 4ZQKA 5FCUL 1T80A 5ERWB 1N59B 3LS5L 5IV2B 1G9MC 2DTSA 5DHYB 3WNLA 3WMSA 5KAQF 2OSLA 4AT6B 4OGYL 2ZKHH 1MF2L 4X80L 2NX5A 1LDSA 1RUKL 1MQKH 3L7EA 4Z95L 5ABDE 1ZSDA 1IM3A 5C0AB 5SWQA 2F53E 4P4KA 2JJVA 4D9LL 2YD4A 4KU1A 1BREA 5CCKL 3HG1A 5KOVC 1FYTE 4WVRA 1W0WB 5SX5K 1UA6H 5CZKA 2YZ8A 4PY7A 2EC9T 3HUJE 1MWAA 3QISA 4JHZA 5MI0C 3HZKA 5JO5B 3EOAA 3X11B 2P5EA 4M5YH 1E0OB 3D39B 3O81A 3SDYH 2CLZA 1G7MB 2DMCA 4AG4H 5KSBE 3IFOA 4NQEA 3SKJL 4J3VA 2YRPA 5T3XD 4FQHA 1GGIH 2APBA 4URTB 1NDMA 2FZ3B 3NCJL 3QH3B 4GKSB 2XZZA 4NP4L 4FQCL 2LTQB 1C08A 3G9VA 5H8DA 1A3RL 1SYVB 3G04B 3ILPB 4G9FA 4YDVB 2BNUA 3BN9C 1GCFA 3O6FC 1IGCL 3Q6GH 2EE9A 2PUQT 4PRBB 3QUXA 2YN5A 3QNYB 2BSTA 1H8SA 4P9HH 2O5XH 4QHKI 1CXKA 2VLME 2FGZA 3DVIA 4KQ3L 3A6BL 3IU3A 1UENA 2R2EB 4MD4B 1RPQA 2EZ0D 4P59L 3UDWA 4F3FA 1ED3B 1MCHA 1GZQA 3UTTB 4IMKA 3BESR 5JHLL 3MLRL 1FO0H 1KCUH 5D4QA 4K55A 4PJXB 2VXUH 5I75B 5K9KB 5DRNA 2FECI 4DCQA 4WIQA 1YY9D 1QBMH 4B53A 2AABL 1HDMB 4NCC1 3N50A 1S7RA 4JZJC 4MJID 1IKFH 3I84A 5C70A 1QVOA 4QHNA 5INCA 1G6RL 2EEBA 4WCYL 3VWJD 1A5FL 2PW2B 4PJIB 1A1OB 1WZKA 4RMSA 4OI8A 3K46A 5GRUH 1W0YT 4OD2B 4OZHA 3QSKB 5E8EA 3NIFE 5HGDA 1RY7B 5ILTH 4OUUA 4OB5H 3LD8B 5K9OA 3LY6A 3HE7B 1NGXA 3O4OB 3PWLA 3UZEA 4PJAE 5EU7C 2YD7A 3VH8B 5DZNA 4P23A 3DUUB 3DXAA 5CP7B 4BKLA 5IBUB 1YNLH 4YHZL 1A2YA 3DVNB 1D9KD 1VERA 2BNRE 3JTTB 3MRFA 3EDFA 3DARA 4U6VH 1HSBB 1ZHNA 2MKWA 1E4KC 5GGQL 4DKFL 1D6VH 3W11C 5MERA 1U8KA 4KK8D 2XG5A 3QULB 3V8CA 4L9DA 1AI1L 1N3NB 2D31B 5DVNA 2XWJB 4DOHB 2B1AL 1GGBH 3FO0L 3QDMD 1KTRL 5T5NG 5EOTB 1FV1B 3LEVL 1YEKL 5C09D 1IBGL 4JFYA 2DLTA 1A3LH 3U0WL 3H9HB 4TQEL 5KSAC 1BMGA 1MHHB 4NYLA 2R23B 2ZUTA 1ACZA 5IG7B 5GGRB 3AXLB 4J1UB 4V1DA 1NUFA 5B8CC 1G9NL 1J05B 4JAMB 5EBMA 1A9BB 1UQSA 5C0ND 3LDBC 2HG5B 4JKPH 5I74B 3L3KB 3IJHB 2V6HA 4OCYH 4ZD3L 1J7VR 4IRJD 1WAAA 3ARGD 3DRQB 3I6LE 1KTKE 2EEAA 4XVSH 1NCCL 3ARFD 1UEYA 4GG6B 3CFIC 3NABL 3A67L 2ZUWA 5JW4Q 3VFPB 4PJ8C 3NTCH 4MA7H 5JOPE 3I3DA 2WANA 3P4LA 4XPGH 1YN6A 5IVXA 1EH9A 5ISZD 1I8IB 2CDGB 4P46C 2HN7A 1RK0B 3ZZ1A 4R97C 3HRZA 4DFIA 4HIHB 2VDQL 4JKKA 2B4CL 4ZUWB 1JF6A 3SGDH 3MV8B 4YZFF 4P4KC 4MAYD 1D5MB 4NNXA 2WINA 2XY1A 2CXGA 3D0LA 4JPVH 4LAQL 3IXTB 1DN2A 2W07A 5LBSL 4O9HL 2J8OA 1NFIB 3EYOA 4GBXA 5EA0H 3VCLA 1CXIA 3O3UN 1MRCL 1K2DB 1JNHA 1IARB 1MFAL 4L1HA 3GNMH 4HUUA 1G6RA 1QLFA 4YHKH 1WFUA 2UWEF 4BQ9A 3GK8L 3I50L 5CEZH 2BHYA 4MD5B 4R4FH 3T8XA 3GM0A 3CSYB 3QEQB 1FH5H 4N9OB 3J8F7 3ARQA 4NJAH 1BZQK 3B8SA 4G80A 2YD2A 3RNQB 4JFDA 3VI3F 2VDKH 3MV9B 5D7IB 4LLVB 2OJEB 3MRPB 3HMWL 2VKXA 4XPTH 2YEZB 4K3EH 5C6WH 4Z7VE 1A0QH 1ONQB 3B8YA 1N5AA 3G6JB 1AGDB 4UZGA 4NJ9L 1NGZA 3P4MA 3IYLW 4OF0A 3MLXH 4FTVE 3TZVB 4DAGL 35C8H 1S7UB 4OUOA 4R0LB 3MUGB 3WFZA 1AGCA 3TBYB 1JBJA 1YEJH 2CK2A 4GUPA 2CLRB 1H3TA 4WHTB 2AJYH 2H3NB 3UAJD 3WFEH 3MZTA 1H0DA 2I27N 1DEEB 1QSZA 1FNHA 2ZCLH 5FYJH 1F4AA 4ONHA 2AEIT 5DJXA 3SBWA 4Y5XA 4MVBC 4M6OH 3ARPA 2L4OA 2QQQA 5DZOA 3TO4A 5E7BA 3O2VH 4BH7A 4YHML 3IJSA 5EO9A 1UM4L 1ACYH 4I0PD 3CD4A 3KPPB 3HZYA 3DYPA 4G6FB 3NZHL 5HDBE 2PR4L 1OQXA 4L8CB 4MMZC 1ZHLA 3QXAA 4LHJB 4HIJB 3K0WA 5GPRA 5MHSD 1JYXA 3KPSA 4ZNCD 3N85H 4PJGE 5CD3B 3U4BL 4BZ1L 4LEXL 3ULUE 4YK4B 1MVFA 4ZUVB 2XWBB 4UNVA 5JW5B 4JKWA 4NHUB 4ODTH 5F7UA 1QEWB 2WLZA 1OGTB 3SKOB 3W0WD 1VACB 3FTGA 3LN4A 4QYOB 1C5CL 2D7NA 3OHXA 3QXTA 2QADC 3RWCA 2A6KA 2KDGA 4OKVB 4ZXBD 1QSFA 3NGBC 5I16B 3C6LD 4ZUTA 4OF3A 1YY8B 4N9GA 4BJLA 1OGAB 3MA7B 4NCDA 1OTUD 1W72H 4CMHC 1OAYL 3BDYH 4L4TA 1L4IA 1DVFD 1F13A 1U0QA 1UXSA 3Q5OA 4HC1H 5ICYA 4L3EB 3FFDB 3E0GA 3AU1B 3UYRH 4OCLC 5DZLA 3HPJA 1ND0A 3DURB 4UTAH 4JQIH 4WI6A 2NY3C 3RIAF 3P0YH 3PV7A 5FA3A 1I1FA 4LRNL 5IBLD 1Q0XL 1EIBA 2OI9C 1WWAX 1U9KA 3WUWA 1N2RB 3WEXA 4Y4HB 4YHIB 3BKJL 3EW3B 4NZDA 5JXAL 1IGIL 4TN9A 1FFNA 3EGSB 2OCFD 2G9HA 1YEHL 5FXCH 2DM4A 3IDJA 4Z7WF 4ZUUB 4F80A 1YEEL 1UXWB 1M6OA 4Y19D 4M1CD 2AJUL 3GO1H 3TT3H 2CIKA 2VIRA 1OAUL 1UM6L 4PJHB 3B9DA 3KPRB 2ICEA 2HTLD 2IWGA 2WWMD 2WK2A 5DTFB 1Z2KA 4P5KA 3RWEA 3IJYA 1U3ZA 5TF1H 3U1SH 4QOKD 2BERA 5DK0A 4P2YA 1CG9B 1U3HC 2Y6SD 4EBQH 4U3HA 1CR9H 4YUEL 5BMFL 3U2SB 4F58H 1IGJA 1N4XH 5DQ9A 3H9ZA 5T5FL 3L5WA 5KS9E 5FM8A 5JOFA 3D0VA 3QCUL 3BD4A 1AXIB 3MOQA 2DQIH 4G3YL 1NFDE 4S10A 3U7YH 4RRPG 2AJXH 1GOGA 2RBLA 3KR3L 3THML 1YQVL 4HGWB 3ULVF 3S96B 2JJTA 4GBXC 4M7JH 5D5MF 4W4NA 1LDPH 4F2MA 1LO3L 2GFBB 3CH1A 4U1HB 4NQDA 3PHSA 3UTSD 1RJZA 1TENA 3TP4A 1AQDA 4Y2DB 1QFWM 2CGRH 2VISA 5IR1B 1Y6KR 3QPXH 1JF1B 2P8MB 1RIHH 3D69A 5EU6A 3RVWD 1YNTA 1N6QH 3GSNH 3NCEB 4MB5A 1ORQB 3B6SB 4NSKA 2GY5A 4OM0H 1HILB 2NY0B 2V7HB 3M1BB 3QO1B 4G7YH 2E7MA 1ODAA 4N5ED 3CLFH 2DJ4A 2DWEA 3L1OH 1CN4A 1HKLL 4XNZC 3PJSA 4KV5F 5JNYA 2M2DA 4FXGA 5CIPA 5ADOL 1CDIA 3VFOB 4PBWD 4UB0H 1B0RB 4XCEB 1KENH 2EE6A 3V7AE 4X5XB 2ARJB 4OZGB 1AR1D 3CDGB 5L0QC 3MO1B 1Q8MA 5DC0A 2C4FT 5HHMB 3ZT5A 2I9TA 4YGVA 2JK5B 4CMMA 5C0BE 2IANA 4LHUA 3BWUC 5EU5A 4NQCB 3S37L 4XNXL 5BZWA 1MJ8L 1L7IH 4IRZH 4JFZL 1ETZB 2BXYA 4ALAH 5C0EB 5GRWA 1LP9A 1JWMB 2OP4H 1K85A 5A40E 2W60B 4XCFH 2IAMA 3BMVA 5AZ2L 1R3HA 1KJ2L 1TJHH 3DI2B 1AJ7H 1ZTXL 3SBWC 4Y5XC 1A14L 1RHHA 1UM5L 1VDGA 1A4JA 3PHOA 3PL6B 4ZSOB 2VLRD 3TO4C 5TQ2L 2CXKA 3VXPB 3K80A 2E7CA 1G9NC 4JZOA 4FMKA 1HSAB 3V5DA 3UO1L 3LSOA 4X6CE 3GSOA 4RGNC 1F11A 4KKLD 1H3XA 4F15C 4ZUSA 4QEGA 5IF0B 4KJPD 4NN6C 2YC1B 5A2JH 1I1AB 5F7MC 1P69B 2YD1A 1UEMA 5I18L 5HVGB 2F54A 4JN2B 1QQDA 1ZLWH 5IHZB 1VKXA 4GG8B 4IOFD 4PR5B 5TE7L 1VFBA 1V3KA 4DVRH 1J5OL 4WNQB 3DPBA 1QYGH 1UFUA 3BPLC 4LMQI 2B4CC 3NOIA 5EB9A 3TN0D 1A22B 2NXYB 3Q5TA 4J12A 5C3TA 1BHGA 3GJFB 3WKMH 4R2GB 4AENA 2YXMA 4GW4B 4NZUH 1AKJA 1TZGH 1D6EA 1BEYL 4KK6D 2F74A 1EHLL 3CVHL 4Q2ZB 3GSUA 4ODVH 4EXPX 2E7LA 2Z31A 4Y16A 2OK0H 3FO2B 1T03H 3GMNA 5MEOA 5C0JB 2WUCH 3O9WA 4YHYC 1I85C 3PHQA 4G6JL 4Q97A 2EXWC 2V9TA 3S4SG 5FK9A 3IDNB 4M6NH 3MBXL 1NEZB 4YC2C 2XT1B 1HEZB 2R9HC 3C5ZB 4GKZB 4PP2B 1DQQA 4UQ3A 3QA3A 2D4DA 3KPNB 2RHEA 3VFUA 3FB8A 4JGMA 2E7BA 4XP6H 1CU4L 4IBLT 2HT4C 1IC5L 4K71C 4NKDB 3OXSB 1T2QH 1U8PA 5HHOE 4FRWA 1GHFL 5E8NB 3MJ6A 2VLKA 3LEXB 5J4MA 3BAEH 3F7VA 1KTLA