1MCPL

Phosphocholine binding immunoglobulin fab mc/pc603. an x-ray diffraction study at 2.7 angstroms
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
220
structure length
220
Chain Sequence
b'DIVMTQSPSSLSVSAGERVTMSCKSSQSLLNSGNQKNFLAWYQQKPGQPPKLLIYGASTRESGVPDRFTGSGSGTDFTLTISSVQAEDLAVYYCQNDHSYPLTFGAGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IGA-KAPPA MCPC603 FAB (LIGHT CHAIN)
publication title Phosphocholine binding immunoglobulin Fab McPC603. An X-ray diffraction study at 2.7 A.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immunoglobulin
total genus 40
structure length 220
sequence length 220
ec nomenclature
pdb deposition date 1984-07-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1mcpL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1mcpL01
3D69B 4FABH 4GRLD 5I30L 5IVOA 1RHFA 3VWKC 5DJCA 4QTHB 4YHIA 2AJYL 5DJZA 3H6JA 1UZ6E 2FECL 3EZ8A 4JO4H 4JFYA 3STBA 1FIGH 3BI9X 4WJ5A 4UUJA 1VA9A 4KV5E 4MA8L 4YFDB 5T3XE 1NDGA 4I3RL 1U95B 2W59A 4HQQL 5CP3H 4E5XB 1NC2B 4WTXA 5GS1B 3VXOA 3MJGX 4K23L 5ESAA 5IB1B 4DZBA 2NCMA 5M7QA 1Z9LA 2PTUA 4KKLC 2IPUG 4RWYL 2ERJB 1PLGL 3QDJD 3RPIA 3EO9L 4X99B 4AMKL 3ILPA 2A74B 3O6MH 4MDJB 1F97A 2D7TL 1A7NL 1XR8A 3GSNH 5F7HA 1CGUA 1T7XA 4Z0XB 5B8CA 4YXKH 1IEBA 5I1KL 1KJ3L 3TF7C 4RFEB 3V7MA 1NC4D 3A6CH 3CDGA 4O02H 4X7SH 4ZOAA 2FX8H 3RX8A 1UG9A 4ZAKD 5J8OA 4YK4B 1L4IA 3VFPB 5EZJB 1INEH 4XCNB 4P4RA 1BVLA 4XTRD 1U93B 4OI7A 3WL9B 2OQJB 4WUUA 1FNGB 3G6JA 1H0DB 1ZS8A 3BAEH 4GUPA 3GO1H 3SBWA 4DKDC 3T8XA 5JOPE 2BOBA 1YEIH 4W4OC 3DYPA 1AD9A 1IC4H 1J05A 4MGXA 4U1NB 3GMPB 5D96B 2BNQB 3DO7B 3PV6B 4K71C 4Z5RA 1EHAA 2FEDD 3PWVB 3W0WD 3HPLA 3VH8G 1K2DA 1JHKH 5IQ9B 4LCWA 4ETQB 5LGJA 2FL5A 5IVXB 3O3EB 3QEQA 3QWRD 4LSUL 2X4TB 4DK3A 1BQHA 3B9EA 4OFYA 4IRZH 3HHRB 5FFLA 2CDFB 4FFVD 1ND0A 1LE5B 4NQDE 2CIIA 2ZCHH 2RFXB 4ODXB 5IQ7H 4PGEB 4J3VA 4FQ2L 3ZDXE 5DMIL 2Q3AA 5HHOD 5SX4H 3MRMA 5BRZB 3SDDB 2APTA 5CGTA 3H42L 1RZ7L 3L3IB 3MLSH 2DN7A 3O2VL 3O4LB 1TJHL 3BP6B 4PD4K 2R56H 5CCKL 1RZKL 3C08H 2CLZA 3FQXB 1KJ2H 4WO4B 5JO5A 3NBNA 4XGZA 5AYUH 2XWBA 5TFSL 2B0SH 4R96A 2F53A 1E4XH 1IAKA 1MLBA 4G6FB 2GY5A 5IP4A 5I0DA 3JWDH 3N50A 4P46B 5KAQG 3EJZC 2VC2L 1PZ5B 2YD5A 1WCBB 3IJSA 2J7LA 3IJYB 4Y5VA 1MFNA 5CBAA 1J5OL 2IGFH 4WW2F 1QFUL 4N9GB 1KTLA 4Q2ZB 1MVUA 5HI3C 3H7BB 5FA4A 5TDOB 3M1BB 4FQQB 5E4EB 1S9XA 1QQDB 5H35B 3VA6A 5B38B 1EVTC 5E8PA 4F7CA 1QLFB 2D4FA 2X1WL 1P9MC 1QRNA 4ESKA 1QNZH 1OAZH 3QNZA 1IJ9A 4N1CA 1IM9B 2F54D 3IDGB 2AJXH 3HS0B 3D2UB 3MFFA 5E6IB 3JWOH 5GGTH 3MTRA 5D2NB 2VNCA 4L4TB 5D8JH 3LIZL 5DTFB 2P48B 4XH2A 2DQJH 2GITB 1ES0A 3IFLH 4KTYA 3MXWH 3DMMB 3HR5A 5DQJA 5DK2A 3B3IB 3GSNB 5D9SB 4NBXB 2DJUA 3G9AB 5H37H 5BCAA 1R3IL 1U8LA 4UTBL 4PGJA 3ARTA 1RJZA 2OL3L 3W0WE 3AM8A 3H3KA 4LGRB 4YK4C 4XZUA 1N59A 1QLRA 1S7RB 4M7LT 5AZEL 4M6ML 3TT1L 2IQ9H 1YPZF 4XNXL 4QY8B 3RY6A 4WI7A 3U4BL 3RDTD 3SDCA 3LS4L 3MRGA 1H3PH 2MHAA 4OKVA 4BUHA 4Q7DA 3K0WA 3FTGB 4NQDB 3STLA 3ZDYF 5F6IB 3V4VH 1WEJL 1FLRL 1SM3L 2HT3D 1K8DB 4Y8DC 2V2TA 2YBRA 1GVIA 4GRLB 5DK3A 2VO5A 3OKYA 3P4LA 5I1IH 2F74B 4XWGH 1CD1B 3NVQA 3UO1H 2XN9A 3FAXA 2EH8H 3KYOB 1R24B 5C0EA 3MLVH 4YHOH 3B8YA 3NGBB 3EW3B 3MUGB 2HKHL 3VFOA 4DN3H 3RBGA 1F42A 3EZJB 5IB3A 5I1CL 2J88H 3VFTA 4BQ8A 4JVPA 5F97E 5DEFA 2IAND 4LLVA 1T6WA 1X4YA 4LPUA 4XMKH 5GJSL 3P4MB 3N85L 2AJ3A 4PJCF 4PJ5A 1C1EL 1CN4A 4UT9H 2BSRA 4JM4L 1B88A 3L7EB 4XBPB 4HKBB 3JUZA 4P4KA 3TPUA 3GK8L 3BD3A 3QDJB 25C8L 2YMXL 4G43B 3Q3GA 3SDDC 4I0CC 3RJDA 4PJGA 4GMTH 3C60A 1IC7H 5IROA 1DJSA 4QKXB 3I6LD 3KWWA 1Y0LB 2ZUVA 2NTFB 1KJ2B 2BP3A 2P5ED 2BY2A 1YPZE 2JTDA 3MRDA 3EDJA 4OJFH 1B2WH 4HPOL 1JI1A 4WO4C 2DI9A 1S9VB 2HA1A 4JVUA 4ZAKB 4TNVK 4S1RH 3T3PE 5HHQA 2HJLB 1JFQH 5FXCH 2VXVH 3U83A 2X09A 4P46C 5DVOA 3HUJA 1OM3H 1TZIB 5E5MB 1QSED 4XCYA 5JIPA 2XNAB 1IGJB 4HDIB 3WFCH 4MQ7B 3L1OH 4WUKL 4D9QD 1CT8B 1OSZB 3RA7H 1KCUH 4NZUL 4RMUA 2A9ML 3BP5A 5D1ZD 4HIHB 4L4VA 2Y25A 4TUKH 3R8QA 3G08A 5E4EC 3UYPA 4JZJB 1BFVH 3WJJC 4LVOB 5EWIL 5AEAA 2UYLB 3F7YB 4NQEA 3W0WB 1CU4L 3LQZA 1A3RH 2Q86B 4XX1E 1NSNH 3BO8B 1NPUA 4PJCE 3GKWL 1BGXH 3CMOL 3WN5C 4PRPA 4OF7A 2FJGB 1CG9B 2KBGA 5T5NG 3VJ6B 4GKSA 5IG7A 3DMMC 5LBSH 1UXWB 4WW2B 5JA9A 4XBEH 1SY6H 1U36A 4I5BB 3GJFK 1CGXA 4OAWA 1HEZB 5CJOL 2YEZB 2ZOKA 2JB5H 2Q6WB 4YJZL 4GQ9H 1IC5L 4BH8B 4HPYL 3V6ZA 4HKZA 3ZTJH 1ZEAL 5HHOB 4OD1L 3ULUD 1XF3B 5D70H 1MIMH 4PGCA 5F3HB 5IBTH 1OCWL 5ILTH 1OHQA 5CJQH 3LKPB 2GJJA 4HCRA 5A16A 2GCYA 1UA6L 1EPFA 1Z0NA 3UTQB 2CUMA 1ED3A 4WNQA 2IALB 1PG7H 5I8KH 1JPST 1YEDA 1QR4A 4LPXA 1MELA 2EKJA 4UNVA 2NTSP 2IANE 3PE9A 1S7QA 1S5IH 4UI2A 2E7CA 3WXVL 4HV8B 3P4NB 5EULV 3V7AG 2W38A 3GSQB 4X80L 4GOSA 1HXYA 4G7VH 4I2XE 4JZNB 1TTFA 1VESA 4GRLC 5GISL 4DEPB 3UMTA 4TVSa 1S7UA 2Q7YA 5DJAA 4B5EA 2RQ8A 4WW1B 4X4YA 3W11C 5D7LA 5FECB 2X2YA 4FQ1L 3C5SA 1BD2E 1ZT4B 3OF6A 4ZYKA 1L0QA 1KELL 4OZIF 4HHAB 4OCRL 5C0JB 1ZANL 1YPZB 4BQCA 1IE5A 4OLYH 5EBWB 1FN4A 2DBLH 3ULUF 1PAMA 4F7PA 2HKFH 2F54B 2EIZB 3C2SA 2R1YB 4JFDA 4BFIB 1JTTA 2YRPA 3DYMA 4JDTL 3VGFA 1H3TA 4MD4A 1TZGH 3MRNB 3SO3C 3S8WA 4OZ4A 5I8OH 5C8JA 1J0HA 2ID5A 4N0CD 1I8LC 4PYHA 2R2HB 4G8EB 4NQUA 3ZYIA 3P4OA 1EJOH 2ZJSL 3JUYA 4YR6B 5IMOB 2X4UA 1T1YB 5TE6L 3BDYL 1G84A 4MMXC 3TO2A 5ELIA 3WD5L 4X6EB 3X3FH 5J06A 4ZAKC 2X40A 3GIZL 3NH7H 4I1NB 1FZKB 3JWDC 4JHAL 4PJXE 5FO9A 1NFKA 3A6BH 1E6JH 3CFBA 4OBSA 2H32A 4XTRC 4PJCB 1CZ8H 2GJZA 3VI3F 3PHOB 3HC3H 3G5YA 1F8TH 5HYSB 1EK3A 1WUNT 1VSCA 2IH1B 1MCQA 2W92A 3X3GL 4XVJH 2WWKO 2C1PA 2ZP0T 3PABA 3RDTB 1OF2A 5T3ZE 2G75A 2ENSA 4NPYB 3DGGB 4YHKL 5E9DD 5HDQL 3CFEA 2YD1A 2RCSH 4F2MB 4NYLB 3WUWG 4HIEA 4YDVB 3PIQA 4BFGA 3WDJA 2PN5A 4JPIB 2V7HA 4PV9B 4HZAA 3ULUE 3EYVB 3NA4A 2FEDC 3DUUB 5GIRB 2APVA 2R1WA 3SKMA 3TVMA 1UM6H 1HIMH 3S88H 4FQCH 1FNHA 1P4LA 5D7JD 4F37F 2R0KH 5I1HH 4HF5L 3S34L 4J6RH 4UNUA 1GZPB 4WW2C 5EB9A 1MFEH 1JZ8A 2ZG2A 1XCTA 5LGHL 1A6ZA 3BD4A 1JF1A 2VDQL 4IMKC 2IANB 3BRDA 1IAOB 5EO1A 5IW6B 4P5MA 3GB7A 4X6CA 3G5VA 3BKCH 4PJIF 1CL7I 4FXKA 5ECJE 1HHHB 2CDEB 1O7VA 1WITA 4NT6A 4TSCL 2AJZA 3QULA 3VW3H 3U48A 1ZT7B 1ACZA 2CJUH 4HIIB 1U91A 5DRNB 1FYTB 4KJPC 1F6LL 2DLTA 4MNQA 1TJIL 3VI3E 2DD8H 3DV6B 2P5EB 1ORQB 1JGLL 3P3YA 4XWOD 2GSGA 4LGSB 1RK0B 3DURB 2FO1A 4X8JB 1R5IB 3LOWA 3TNMB 1LO4L 4QHMA 3BWAA 1D6EB 3BZ4A 5C0CA 3P73A 1MJUL 3ME0A 3OX8A 2BSTA 3UTPD 3QUZD 4JB9H 1QSEB 2BMKB 4WI4A 1G7PA 3QZWB 4DEPC 1XF2A 1C7SA 4PJ7F 3U0PA 4X8XA 2JIXD 3S5LB 1A6VL 2FEEI 5ITFB 4PBXA 4M4PA 1CICA 5D1ZB 5E56A 3HE7D 2IMMA 4RMWA 3CFKA 3F6IA 3VD9A 4S1SH 2JJVA 4LIQH 1SJHB 1C16B 5CWSA 4K7FB 3QEGH 3LKOA 2KQNA 4KJWC 4JZOA 4DCQA 4FQHA 3BISA 4X83A 4LHUD 2GT9A 4NZRL 1P7HL 2O5ZH 5ANMB 4D3CH 4DVRH 5KN5A 4JFQA 3FT2A 5EIQA 1MFDH 1QSVA 2BY0A 4PJIE 4DN4L 5JPMA 5D1XC 2R2BB 5TF1L 3EYOB 4CU6A 4NKMA 1BJ1H 3BGMA 3IDJB 1M7DB 1KEML 5ENWA 4LK4A 4GKNA 4NO5B 1WZ1H 3L9RA 2X89A 3HZMB 3KPPB 4LAJH 5D5MF 2DQDH 3EOAB 4NZTH 3O8XA 3HPJA 3ULVD 2GTWA 4OFDA 3IDUA 1TQCC 3DIFB 3LKRA 5DT1H 3X13A 5IMLA 1BQLH 4XAKE 5DZLA 4OZIB 1LO0H 2EIBA 1GAFL 2D2OA 3RZCA 4LKXA 1QSFD 1S3KH 1IEAA 4QHUA 2P24B 2BOCA 2UZIH 4I4WB 4N8VB 2AABH 5E7BA 4M7LH 3CLFH 2DB8A 5K59F 3OGOE 3CLEH 3LY6A 4TVPH 4RMSA 1D6VH 3RDTC 4E42A 2VDRH 2D7OA 3KHQA 4N0FB 2GSIB 3RX5A 4POYA 4OT1H 2VZ1A 4QRQB 4NBYB 1T2QH 1XGQA 4YGVA 5FB8B 3IU3B 4WHDA 3VFNB 4ZUUA 1NBVL 3DO3A 1XIWA 4UOW0 2HT3C 5E2WH 4XC3L 1SJEB 1ZGLB 4UIKH 3GSVA 1DVFD 1WV7T 5CJXA 4LPCA 1QLEH 2D0HA 2F58H 3BH8A 1DSFL 4IIQA 2VQ1A 3ULVF 3MBEB 2VYRE 1CD0A 3QWOA 1M4KA 1LO2H 4XI5C 5DRWA 1NKRA 2EIEA 5JW4N 2WIIA 3T77B 1LE9A 3MJ8B 1F2XK 3HLAA 3QCVH 1CGSL 2IFFH 3LSOB 2JJSA 2FO4A 4EVNB 4GRMA 3BD5A 2A6IB 1J86A 2C3WA 4OUUA 1UACL 3U0WL 4Y19A 4HJGA 3K4ZA 5MP6H 2R0WL 1PQZB 1PKQE 4ZSOE 3MV01 3HRZA 5L8KB 3QUXA 4MJ4A 2YK1H 1H5BA 2OM5A 3SKJL 3TEUA 4QRTB 2WBKA 4MWFA 3FT4A 4IMLA 2WZPD 1LNUA 1ZHNB 3NCJL 1TZHB 3BKML 4KH2A 5GGVH 1SEQL 2Y07H 4HUNB 2EE3A 4H26A 3ULVH 4GMSH 3RIAF 2OP4H 3OJVC 5HTSA 3REWB 3H7LA 1XGYL 4NSKB 5DK0A 3ROOB 1AQDA 4KRLB 3NTCH 3HZYB 1IGCH 2AKRB 4XPHL 1X5FA 1MEXH 3PHQB 4H1LH 2LU4A 4H20H 5HGGS 3MLWL 4GAYB 3H2WA 3H9HA 2Q8BL 1BAFH 35C8H 2FGZA 4PJIB 1QA9A 1N4XH 4XP9H 4LARL 1GYAA 1HK6A 1LP9F 5JLZA 2BVPB 5FHAH 3O9WC 1X5JA 1IGYB 5CBEA 5E9DB 1F3JB 5ALBL 4C56A 1A64A 1V3KA 3KJ6H 5D1ZC 3U0TA 3GSRB 1HHIB 5HVHB 4JFXB 3FQUA 2CRIA 3KXFA 2E9IA 2YS4A 4GBXD 2Y7QA 1TVBA 1HINL 1ERNA 5EC2A 3QAZB 4KGLA 1Q0XL 3W81A 1JZ3A 3L3DA 1E4KA 3WFEL 3V5HB 1BJ8A 1YECH 2GKIA 3JVGC 5FUOH 2DDQL 3FN0H 4PFEA 5D7JB 1A7RH 1EAPA 1NAKH 2PYED 1LEKA 3O0RH 4PJ7B 5ESVA 5C07D 2A6KB 3L3JB 4JJ5B 4FA8A 5M94B 4D9LH 3S37L 1G0DA 2FD6L 4K3GA 5J6HB 4ACPA 3D69A 2OI9B 4JPKL 3AY4C 4ODTH 3UJJH 2N56A 1C5DA 1CVRA 2QJDA 4WV1A 3ULUC 4UU9B 1BM3H 5KVFL 5KJRL 1S7XB 3QP3A 2ZG3A 4M62L 2VXUL 4BFBD 4F9LC 5HHVL 5KSBF 4KKCD 3HMWH 4M7KL 3QYCA 3MRIB 4YIQA 1IGML 4ELKB 1PFCA 3BIKA 5GS1A 1LP9E 4LLYB 4IHOA 1UADC 2F8XC 1VKXA 2BHZA 1VEOA 3VXMA 1CXLA 5D5MB 4PJAF 1M6OA 4QRRA 3QUZB 2VH5H 1YNTA 3VFUA 2D9CA 3L5JA 4V2BA 3AFLA 1ITCA 2E6QA 4J3XA 2VXTH 3FB7B 2J3SA 4ZSOB 4NHUB 3O41B 2P8LA 1IAIM 5F7EL 2JIXB 2AEQH 1XR9A 3VXPB 4JRXA 4NZJA 3GMNA 3GI8L 3HE7B 3QHFH 5D93B 3OXRB 4WVRA 4P3CL 2BRQA 1KN2L 3VFPA 3RVTD 4XCNA 1Z9OA 3SCMA 1P69B 3FO9A 4HUWA 4LSVH 5CZXD 4LHUB 1U8NB 2NLJA 3QUYD 3MRLB 1FNGA 4MAUH 3CMGA 1XT5A 5F7LB 4S11A 5GGVY 3QIWA 2G2RA 4ODVL 4U2YA 1F02I 5F1KC 4N0CC 5A40E 3INUH 3U46A 3QHZH 3V0VA 3WSQH 4RMVA 5E99L 1BVZA 3RGVA 4EZMA 5KSBE 4ZXBD 4UT7L 2P45B 2VLLB 4X6BA 3PWVA 4WWKA 5SV4A 4MDIB 4H1LB 2B8OT 3M17A 1QSFB 1YUHB 3S96B 3QRGL 2W9LA 2FATL 1JJUA 4Y4FA 4PJAE 1JYNA 1JYXA 1OPGH 3VXQB 4PP1D 4EBQH 4XNYH 2Q20A 4PJEA 4WDIB 4PGDB 3OJMB 4G9DB 3S4SG 1EEYB 2YWZA 4PJ9D 4NNXB 2PYEE 4PJBA 3K4AA 3RIFF 4MQXD 5C07E 5D71H 4YQXH 2EO1A 5DLMH 2Q1EA 4LNVA 3ILQC 2WM0A 3EO0A 3IF1B 1Z6JT 5T1LA 2C3VA 2NY7L 1F2QA 4Y2OA 3IDXH 4NCDA 1PBYA 2VE6A 1KPVB 3V0WL 4PGEA 5DC9B 5HVHC 3G04B 1YEFL 4KUZH 3S3SA 4CU7A 3N1QC 3QAZC 4Y16C 4TNWF 1DVFB 3MO1B 4CVWA 3FN9A 5TH2B 1DQQB 3VE0B 2IFGA 1NEZG 2WBWB 3STZA 5TQ0L 1EMTL 4X6FB 4FZ8L 2EEAA 2PO6A 4MCZA 4QXWA 2N7BA 4UV4H 1U8QA 4MLSA 2NNAB 3WMSA 1EEZB 3QBTB 1LP9B 2H45A 1V3JA 1N64H 3U4EB 1BVKB 1CXKA 2QR0B 3V5DB 3N0PB 3IGAB 4NOFA 1JV5A 1MAMH 3B6SB 5GPRA 3BKYL 1FO0H 1DTUA 4X5WA 4Y7MA 3FFCD 4TSBH 3WFDL 5CEZE 2VUYA 4OLXH 2XQYK 2FBJL 5DHYB 4F7EA 3DXAA 1EFQA 3B9VA 5TDOA 5F71A 5HPMB 1KCRL 4CVZA 1UH4A 1QLFA 4FQXC 3MOAL 3CVIL 4FXGA 5SX5H 4XWOC 4JPWH 2B2XL 5AD0A 5BQ7A 3HI5L 3HS0A 3VRJB 2BVOB 4KU1A 4L4TA 1MIEL 4Z7QF 2VDPH 1NL0L 3P0YL 4KZDL 4WI2A 3P0VL 3MGTA 1MHPH 3E3QC 3RAJH 5IB5A 1YZZA 4B7IA 2X9XA 2VL4A 2ZSWB 4PBWD 3G5XB 3MNZB 2ARJB 2YPKB 4JANB 1I8IA 4X4XB 5BS0B 2QQLH 4ZO9A 3TV3H 3BRFA 3HE7C 5KW9H 5KAQF 5D93C 1QHOA 1S7SB 2VLJA 3BN9C 5KSBB 4PRBB 2YWYA 4GBXB 3BPLB 2ED9A 3UZVB 2ED7A 3VFMA 2ZSVA 3SJVD 3V5KA 1KB5H 2X7LB 4F7MB 1F4WH 1LD9A 3QXDA 4KKBD 3HAEH 4PJAB 4QXGH 1FGVH 4RAUB 2H1PH 1CQKA 1AE6L 4X5XB 1CFBA 2A1WH 3ARUA 4G8IA 3R8BB 4WI6A 5L7XH 1RZ8B 5GHWL 3I9GL 1UENA 2PYEB 3TIDB 1ZTXH 5C07B 4JM2D 5FV1L 3KNBB 1W72H 5IHZB 3V95A 1FYHB 4R97C 4Q97A 2VKWA 3O2DL 1WIUA 1I8MB 3PWPE 5F9DC 4GRWE 4YWGH 3GBLA 4LSQL 2F74A 1JK8B 3HB3D 1JGVH 2AJVH 1CVSC 4U49A 1EX0A 3ARWA 3V4UH 3NZ8A 4AG4H 2IG2H 4YFEA 3UTTA 5F9WC 3UYRL 2P8PB 4ZUVB 5I1AB 4ZPTB 3T0EB 1PYWB 3G5ZA 1F4XH 1YC8A 2EH7H 5HXMA 1NCCH 4HJ0D 1YEEH 3FN3A 2AK1H 2BCKB 5JHDA 4RX4D 4FXLA 3QA3B 2CLRA 5FO7B 1EGJL 4DTGH 4HKBA 4NO0A 3ARGD 1WWWX 3AB0B 3RNQB 2E9JA 3LEVH 4G43A 3D85D 5C0AA 5LXGH 4OLUL 1DVFC 2HYMA 2FJFA 4JM2F 5FO8B 5I8CA 5F6HI 5KOMC 3OJ2C 5B39G 5DSCB 1UT9A 1WWCA 1NMAH 4O5LL 4HC1H 3PGCA 5BZWA 4DVBB 3TH2T 1RUQH 4LEOB 1L6XA 4NFBA 1EA9C 4KRMB 3QQ3B 1Q9LB 3PL6D 2V5TA 1OW0C 5J1AB 1MJJA 1NBZB 4Z7VA 4LLQA 4OBRA 1LVEA 4Y4KD 3QUYB 3LZFL 2CQVA 4YHLL 1FO0B 3CXDH 4J3OC 1MREL 3JZ7A 4AEIH 2FB4L 4U6HA 4BJLA 5ETUB 5KVDL 3CFDB 3C2AL 4L4JA 3WJLC 3U1SH 1PVHA 4JO1L 3KPMA 4W4NA 2AXJA 4XAWL 3LRSA 4X7FC 1VERA 2R69H 5KBNC 1ADQH 1D5XB 1JNHB 4OQTA 1GIGH 2WMPA 1DE4A 3BN3B 4X0KA 3HE6C 4OM0L 4ZXBB 1C5BH 3F7VB 3VG9C 1HDMB 3ZSTA 3FKUS 4LEXH 3OMZA 3QNYB 4PRNB 3X12A 3K74B 3PP4H 5FGBC 2NY1D 3FO0H 5DJ6B 5GGTA 3SJVE 3BO8A 1FSKB 4DUWA 3CUPA 5TQ2H 1G9NC 3FOMB 1CG9A 4ZUSB 5L8JB 1URLA 4KQ4L 4BA8A 1J1XH 4PJ9B 4GW1A 1JWUA 4LVHC 4NM8L 3NACL 4NC1E 1HSAB 5DQ9A 4I5BA 1L6ZA 4UBDD 3H9SD 4ZMAT 4XC1H 1FBIH 1EIBA 4BH8A 4WY7H 4P5TD 4N0YH 2HLFD 4G6JH 1U8IA 3L95A 3MRFB 4HD9A 1N3NA 1K6QH 1FNFA 5LCVL 2AJUH 5H94A 2ZUWA 1YJDH 4ZFFA 2YD7A 3OB0H 1XF5A 3UTQA 3IETA 5F1NB 1UB6B 1K8IB 2VLMD 5BJTA 3MLTB 3C5ZA 1TJGH 2X4OB 3MV11 3UTZB 1EDQA 4F80A 4RGND 3T1FA 5HYIA 5E94A 1W72B 1DFBL 5I71B 1JCKA 3CFJB 2GTZA 4JFFD 1MRCH 4LQFH 3AAZB 5KG9B 1CYGA 3KDMA 4QRSA 4IOSD 4JFHD 1EH9A 3BPCB 2C26A 3FFCB 1INQB 1MNUL 4MXQD 4X9HA 3SKOA 4CMHB 5C2BH 1DLFH 1C8PA 5EOCJ 5EZIL 2FECI 5EORH 4X4ME 5T5NF 3DPBA 2P4AB 1L7TH 4IDJL 4NRZB 1I7UA 2OTWB 5F96H 1NAML 5INCB 3ZZ1A 1UH3A 1CGWA 3DVGA 4KHXL 3NN8A 3SGDI 3GMLB 4WFHD 1F11B 4MS8D 4NJAL 1YDPB 5EBWA 4UILL 5DA0B 3VXRD 2EYSA 3GMRB 2J4WH 3KPRD 3QEUA 4HLZG 3QUKA 2CKBH 5F6HJ 2ILLA 1E6OL 1CFVL 2EIZA 3ZL4H 1R3JB 2R1YA 2Q76A 5M95B 2PXYD 3WBDA 4HG4K 2D7NA 1ZWIB 3QI9D 2E8YA 3QCTH 4FHBD 4U2ZA 3AB0C 4PJDE 5I73B 5DJXB 2FR4B 1QACA 4XB7A 1IAIH 5D2LA 3O81A 3WEXA 4Z7NF 5EFIB 1J0KA 4NCC2 3TYFA 3QCUH 4W6XB 3WHE0 5IMOA 2FHBA 4G8FA 4LAQH 4NNPH 3QPXL 1YY9D 4K9EH 2DYPD 3MYZA 1NGYB 4MJ6A 2MKWA 3OZ9H 5GJTH 2EDTA 2FGWL 4J12A 2OK0H 4XNUH 3PWUB 3QUYC 1ORSA 4G3YH 3QIBD 1T1XB 4L9LB 3U36A 2GJ6A 4I48B 4Z77A 1A6WH 3TA3A 3WO4B 5JW5A 1I7ZA 4LNRA 1HH6B 4LBEB 2N4IA 4U6VL 4NPYA 3CH1B 2XWTB 4F8TA 1IQWH 4JM2B 4TOYL 3THML 1KLGB 5C2UB 2R4RH 4ZFGL 5DHVH 1V3LA 2VL5B 1KT2A 1MH5B 1D5MB 4W6YB 1SMAA 1S7TA 4G6KH 4MNGB 5GGSY 1Q8MA 3OB8A 4PJFF 2YUZA 2R2CA 5MHSD 5A2FA 5F89A 2BDNH 5GGSB 2EXWD 1I1AA 4KQ3L 4PP1C 2WIMA 2JCCF 5EIVA 2BRRH 2VZOA 2CPCA 3ABZA 5C9JB 3P11L 3V6FB 4ZS6D 1SY6A 1JHLL 4R3SA 2XZZA 2DMKA 1XH3A 4G7YH 4MQXC 3SQOL 5CINH 1IAOA 3VGBA 2EDQA 5IW6A 3O6KL 1E27A 1F90L 4JKLA 1YQ2A 5IR1A 1P7QA 2ADIA 2CDEA 3ARGB 4JFHE 1DQLL 3DV4A 4M8QA 3BP7A 3QPQC 4K3JL 1B90A 3KGRA 1ZLWK 3D85B 1WZKA 1FYTA 1AP2B 1JL8A 1TPXB 3HZKA 1G6RA 1GXEA 3I2CL 3F58H 5SWZD 1ORQA 2NW2B 4KGJA 4WFHE 2FZ3B 4F37K 3AU1A 3P77B 2EC9T 3CX2A 4RNRA 5KSUA 4F9PC 3TNMA 1OLLA 1G7JB 3HNSH 4R2GD 4LSRL 4CKVX 2NY5H 3PL6B 5EU6E 5DUPH 3MACL 15C8H 4Y4KB 4UIMA 2HN7A 2BMKA 5DRXA 3ESVF 4QRPD 4ORZC 3P9MA 2V2WA 1NGPL 4CMHC 5ICZB 1JGEA 4MJ5A 4M48H 3FOLA 4LDOB 3JV0A 1SBSH 5D6DC 3OKMA 1RZGB 1ZA3B 2ZCLL 4P59H 3UPAA 3LKQA 5JMOC 3NPZB 5C0BD 4TRPH 3MCLH 3L3GB 1MWAH 3V6OA 4K2UH 4O51A 3ARDD 4R26L 5CILL 5DVLA 4YPJA 4R7DB 5I74B 2CKBB 2CUHA 4GAGH 4MYWB 3EFFB 1CWVA 1FP5A 2NY1B 4MZ3A 3HMXL 3ZE1E 3MRCA 4ONOA 2R23A 3DWTA 2OXGA 5C09E 4Y4HA 1PKOA 3W2DL 3WFHB 1A5FL 3V9FA 5C0DB 2NY0B 4NFDA 1YNKH 4M9PA 3IDJA 1AR2A 1M7DA 5I73C 5HGDB 3D39A 1PW3A 4CRPA 2V5YA 1OP5H 1RPQA 4DQOH 3ARFA 4ODSH 3EOAA 43CAB 1INDL 3T0VA 4AT6A 5LKNA 2XIDA 3H9SB 5BOPA 5KANG 1MFBH 4RMQA 3S37X 1RZIB 4FFZH 5DRZB 4P5TB 3VD4A 4RAVB 2DQGH 3D9AH 5KSAA 4HX1A 2ARWA 3MLZH 5MHSE 2AP2A 1X5YA 2JK5B 2P24A 4PLKD 1ZGLP 1CL7H 4TULL 2YC1B 4N8VA 4KKBC 3HNTH 5L2KE 5HVWA 4L9LC 3HCVB 5J3HC 3WNMA 1Y18B 1MRDH 4M03A 3UJTH 3WHE1 4PG2A 1T89A 5I1GL 4N0FA 4RGNB 3S36H 2GSIA 4P9HH 4NC1C 1NDMA 4ZPVA 5E2VH 3IFNL 4JFFB 1H3UA 4N90E 3VFNA 2N7AA 1AHWA 5DHVB 1EZVX 2IPTH 1JNLL 3GIVB 4D0BB 4GW4B 1SJEA 4OIIH 2B5IC 4YEEA 5I18H 2ICEB 5CZVH 1FGNL 5CD3B 4GAJL 3U7YH 2Z35A 4JJHA 2JLLA 3KPSE 3CK0H 5T1MB 3MBEA 3OJDB 4ONGL 5SWZE 3RWDA 3KS0J 4ELMF 5BVJB 1VB9A 4MSWA 4DGIL 4YE4L 3VXRB 2X44D 3CH8A 4Y5YB 4HJ0C 4WFGD 3GHBH 3QUMH 4OM1L 5SV3A 3KPRB 4N5UA 3OAYK 2O61A 1LGVA 4Q9RH 2HG5B 3VRLF 4PRDB 2PXYB 3LDBC 3L3KA 3MA7A 3QI9B 1MUJA 1H8OA 3ARVA 5FYKU 3GUTA 4LRIA 1RUMH 1I1YB 4O00A 1JE6A 4M6NH 2ZUUA 4NWTH 2QQKH 1HKFA 4PJFB 3PQYA 4RIRA 1FFNA 1TPXC 5C0BE 1PDKA 1JN6A 4YC2B 3GI9L 2D7QA 2CO6B 2JCCB 5FA3B 2DMCA 1AKJA 4NSKA 2DYPB 3ROOA 5F7DB 3I3EA 3VXSE 2AKRA 1EGJA 3UTOA 5BXFA 1JHTA 2HT4D 1J8HA 1Q1JL 2O5YH 1ULVA 3PL6C 4GLRH 5T3XL 3Q6FB 2F8VA 4Y4KC 3Q48A 1L7IL 1UKQA 1HI6B 2E7BA 5TGBA 3TNNB 4C4KT 4KAQH 1FG2B 3QIBB 4RFNB 2IBZY 5JORB 1OTSD 3SDYL 3ZHKA 5GS0D 1MCFA 4FABL 4M1DH 1Q94B 3LEXB 3BEWB 3MLXH 3QO1A 5E9DA 4XPGL 2W9EL 4MD5A 3Q5TA 2Y6SD 4ELME 3MV9A 3TBTB 1RK1B 3MA9L 1WAAA 1I4FB 3WYRA 1T1ZB 4J3SA 3RIAK 1K3ZA 3BQUC 1D5ZB 5I74C 3W9EB 3ZKNC 2ADJB 3DSFH 4M02A 1AGBB 5ISZD 1T7YA 1TVDA 4YXHL 1FG9C 4CMMB 3BT2H 1A1NA 5DO2C 1KIPB 1WBZA 5FYLD 4NUGH 1YQVL 1Q72H 4HKJB 4Z7WE 4HUXB 2C7UB 2HFTA 1MCEA 3EDFA 2X4NB 5IJKC 2A6KA 2HFGL 3BJLA 3CCHA 5CHNA 2X4RA 1DBKL 4NQSA 3VRIB 5IM7B 4Q0XL 4BQBA 5J6HA 1IGIH 2X4SB 4JPVH 3K2UH 3IFPB 1A7QH 3H9YA 3IYLW 5CP7B 3DETD 4AQ1B 1L9NA 3UBXB 4P5TC 2HLFC 5GGQL 1TETH 4XP4L 1ZMYA 1U9KA 5E2TL 5SWQB 1OSPL 5HGAB 3WS6A 3LKSB 1B3JA 1XGPA 5DD0H 5SWZB 3WV0A 4NC0B 4LF3B 3MRIA 3MRKB 4TQEH 4N0UA 2XV6B 4APQA 5JR1H 5DUBB 3LMJL 4HWBH 4RGMB 1MFAL 4RGNC 4R2GB 1NLBL 2CLVA 1YEIL 2GFBA 3QUZA 3MUJA 4OF5A 4JO3H 4EI5B 5I8EA 4QRPB 1A9EB 3JV4B 4F3FA 3ALXA 5C0GA 4HWEL 2ENYA 1RIHL 3BSZL 4MXQC 2YPLE 3O41A 2KKQA 1EHNA 2IBBA 1JF6A 3VFGL 2C9AA 3CPLA 4OTXL 2PW2B 4R6UA 4WUUD 3FFDA 1TVHA 5E6ZA 3MCKA 3FL7A 2AQ3A 2FX7H 2XA8H 1KG0A 4G5ZL 3ARDB 1DEDA 1AXSB 3QUMB 4MS8C 5HY9B 2YD8A 1YYLH 3NFNA 4Y5YC 4U1HA 3BKJH 5DUMH 3QDAA 3T2NH 1M1SA 4P23A 4IEFB 4JDVA 1AIFA 3BE1H 2VDKH 2YPVL 3P0GB 1A9BB 3V4PH 4HIXL 2Y06H 1F13A 3IRZA 3QI9C 2NXZD 1TMCB 4K7PX 4ZG1A 2C4FU 5FYLH 5IOPA 2DLFL 1NAMA 2BVQA 4I18A 4LCWD 5IW1B 2HVKB 1T4KA 3GRWH 3NIGF 5EPMB 3QEQD 1EEUA 2X05A 3N9GH 1FVEB 3RWGA 4AIZB 4G8GA 4RFOH 4OFYD 1QFOA 4ELMB 3BPOB 4AYFA 2PCPA 3LAFA 4BH7B 3VFVB 2ICWI 1WVZA 4OZHE 1XGUB 4QF1A 3CFCL 4LLAA 3MGOA 5BZDA 3S96A 1A6TB 1N5YH 3QDME 5IV2A 2WW8A 1XGTB 5GSVA 5DMKA 1JPTL 1A7BA 4K94L 1I3RB 5FYLE 4L8BA 3G6JF 3JWDL 4D9RE 3QIBC 4RFNC 1HH9A 3G6AB 4NNXA 1I1FB 2QSTA 2Z93A 1MLCB 1CFTA 4JFZL 5DF0A 3ZT7A 3LKNB 3QNXB 4PP2A 4UT6L 3SY0B 3DX6A 5TDPA 1IQDA 4MA7L 1XGRA 3EDKA 3I02B 4NNYA 1CDUA 1DL7L 3L3HB 4R0LB 5C0RH 5TPWL 2E7LC 3BW9A 1V7NH 2F53D 4IOFD 4UQ3A 1WBXB 1WIPA 1RHHA 2HVJB 4NQCA 2WQ8A 3F7RA 4UQ2B 5JW4Q 3EYUL 3M8OH 2HJFB 5F3BA 4KI5D 4D0DB 3FQTA 1P2CA 3KYAA 2VXQL 4HXBL 1G7HA 3ZTNH 3Q2CA 2EXWC 4K8RH 3P30L 4YH6A 1RMFH 1RJYB 5L0QC 3MOBL 4XMPL 3L5XL 2J6EH 2ZPKH 3RIFK 4ZS6C 5MEOB 4YNYB 2OLDA 4NQXB 3IFLL 3S97C 4O58H 1BVKA 1FAKT 3BZFB 4Q9QL 5I1DB 5D1QC 4G9FE 3RVWC 1U2HA 1PX3A 1QRND 5HHXL 2YD3A 1QR1B 5IB4A 4TNWK 2A6DA 4JY6B 5EBMB 4HS6B 5DHYA 3MRQA 5I9QB 3LPFA 3F65A 4WUUE 4Z8FH 3AS3A 1J87A 1Z0MA 3EAKA 3G6JE 1ZHBB 1DBJL 3MLRH 2PUQT 3KYKL 4M7ZC 5IFJA 4RSVA 2FWOA 4LLUA 3OKNA 5DJ8B 5D7KE 3PJSA 4LSPL 4GG8B 4WU7B 4KJYB 4P9HC 3GNMH 4YPGB 2B1HH 4WFFD 3U30B 3F7PC 4E41E 1RUPL 4TUJB 4QOKE 4I0PA 4KI5F 5KS9E 1DR9A 1TCRB 2Y72A 3SDXA 4DOHB 1HOCB 1FAIH 2FRGP 3HNVL 5FHBL 2AGJL 4YUEH 2X4PB 4BSJA 4QHLA 4ERSH 1TTGA 3QG7L 4Z95L 2AEWA 2AV7B 3V4VL 1VFBB 1T2JA 3PWLA 3RI5F 3NPSB 3VFSB 4LCWE 1MVFA 3G5XA 2BVUA 1RFDL 1IKFH 4MHHG 5ICXA 4NHCL 3T0WA 5BS0A 1DBBH 3UO1L 5I2IA 3V52L 2JJTC 3FQNB 4HS8H 5K33A 1A7PH 4JFEA 2HRPH 4FFYH 2A73A 3P40A 3PGFL 1H3XA 3ARPA 3SDCD 5FOBB 2EE9A 4QYOB 3ROLB 5ISZB 2Z4QA 3BHBB 4AQOA 4F7MA 2LV4A 1DBAL 2XZAL 2ICWJ 5GGUA 5L9DL 5C9KA 4R8WL 1UM5L 3SN6N 3U7AA 1Q9WA 4LOUD 5DJCB 2VXSL 2XN9D 4YHIB 2MCPL 5DJZB 3LVEA 1I8KA 5CJBA 4L1HA 4ZDHB 4JFYB 3ARBC 1DQML 4S2SA 2H3NA 4WI5A 4DUXA 3HMXA 3E6HA 1NDGB 1IZKA 1UWEL 2F53E 1G7MB 5EUKA 4FZEH 3AUVA 5C0NC 3VXOB 1Q9KA 4ZUVA 5I1AA 4LASH 4PJ5D 4DZBB 3T0EA 4G6AD 2PYFA 4P4KD 1I85C 3KPNA 1BBDH 3RPIB 1JGUH 5DZOA 5C1MB 3LEYL 3ILPB 2BCKA 3C60D 1KCVH 2NY4D 4JN1L 4KK9D 1GGCH 1BQSA 5BVPL 1XR8B 4CGTA 3RU8L 5B8CB 4F7TA 2I9TB 1IEBB 3C09B 3RA7L 4YDJA 3DUHA 3CDGB 3RNQA 4R0LC 4TUKL 5F44A 3NABH 1FZMA 4X98A 4YGAB 1HWGB 3H3PL 1NCWH 4M1CC 4P4RB 1BVLB 3JV6A 5FM5O 1RIUH 2FDBP 4WUUB 5DSCA 2Z91A 3ZE0F 2W9DH 3ZYZA 1NSNL 3G6JB 1ZS8B 2GY7B 2XQYG 4GUPB 5GQBA 3OR6A 4LQ1A 4PYGA 3EBAA 5F9JA 3T8XB 3I6GA 1PZUB 4S1QH 3ZLQC 1A3LL 1AD9B 4L4VD 1J05B 1JRHH 3SE8H 1X44A 2XYCA 3ARRA 4GXUM 2V17H 2WWMD 2NXZB 4Z5RB 4NQED 4PS4H 4PJGF 3HPLB 4J7RA 4Z9KB 1K2DB 4PY8J 5I9QC 5L88L 5LGJB 2FL5B 2DWEA 3QEQB 1T2XA 4U1IA 3FCTB 1B4JH 5TDNA 4PRPD 1BQHB 5ILTL 2I27N 3OG4B 1HDMA 3VGGA 2EO9A 5E70A 5H37G 4CDGC 2MTPA 5I8KL 1R5WA 3QHTC 3U30C 1ND0B 2HT4C 2X1PA 3CDCA 3HUJF 1RJLB 2OZ4H 5D7IE 5J56B 2CIIB 1J1PL 3FOMA 3OR7A 1MCWM 7FABH 2KZWA 2R0LL 4RDQG 3VXNA 4YHZH 4I3SL 2XN9E 5I16B 5GS0C 3NPSC 3TWCH 3BIAX 3KR3L 4J4PD 2QSCL 4OCXL 2CLZB 3MJ9A 4NUJB 3ZE0E 4RGOH 1KCSH 5C7XH 2VDLH 4GFTB 5JO5B 5I1EL 4XGZB 4LSSH 2XWBB 4AM0A 4R4ND 4R96B 5F7YC 1OT1A 5BV7H 1IAKB 2W07A 1KB5A 1H3WM 4HGWA 4OLYL 4HZLA 1NANI 4O9HH 5JUEH 3RWFA 3HAEA 4OGXH 4YBQC 2LTQB 4Y5XC 1QFWH 2MOVA 5CBAB 3ES6A 3IJSB 4Y5VB 1RUKL 1JZ7A 4IRSA 4HT1L 4WEBL 1BECA 3W82A 1Z9MA 3HRPA 4OF6A 5DHXB 3PHSA 3S35H 5AUMA 1KTLB 3EKCA 4JQIL 4YHML 2FEEL 3W5MA 4KHTH 5FA4B 4OZGE 3OF6D 3IAQA 4BQ9A 3WJJA 1S9XB 1LO3L 1MSPA 3WDIA 5T3ZL 5E8PB 2DQUL 4F7CB 1FC2D 2DQTH 3BPCA 2R8SH 1LK2A 4NN5B 1QRNB 3QNZB 2X42A 2QQQA 3FB6A 1WCQA 4M4RA 3HUJE 3T2PA 1F4YL 3C9NA 3MFFB 1HNFA 2DAVA 3NH7L 4JFDD 4MA1B 1V3MA 2PR4H 3ZT6A 1NBYA 3MV7E 4S10A 3ULUL 4NFCA 2ZUTA 4XH2B 6CGTA 2ZOLB 1CZ8L 1ES0B 2HH0H 1AJ7L 2BJMH 3HR5B 4I3GA 5DQJB 2VLKE 3DX7A 5DK2B 4P2QB 5DQDL 3ARSA 4L4VE 4J3TA 5IVZA 1S7WA 1ZWIA 5B4MD 5B8CC 4BELD 4OGZA 2P44B 4KY1L 1U8LB 4Z0BH 5E08L 1RJZB 4NQEE 1RUAL 3EOTL 4XVTL 4XX1G 2CO7B 5KTEL 4XZUB 1N59B 5HYSG 4Q9BA 1QLRB 2DJSA 2NY6D 4FS0A 3LHPH 3D3VA 4PRPE 3T4AA 4NOBA 1BZ7B 4HCRH 1ACYL 1S9KC 1S5HA 3BX7C 4XXDA 3SBWC 1UM6L 4NO2B 1B0GA 3SDCB 2MHAB 4OKVB 5DVKA 5BO1H 5CEXA 3HN3A 3DJ9A 1ZKAA 3SOBH 3SKNB 3STLB 1OD9A 3U4AA 1GPOH 4XMLH 5EA0H 2V2TB 2YD6A 1J1OH 5T33H 2YBRB 3BMVA 2NXZC 1VGEH 4LLWB 1RIVH 3FRPA 4Q9CA 4GSDH 1NCTA 2XN9B 3CH1A 3VW3L 2XWTA 4PJHB 5C0EB 2CJUL 4JM2A 3TVMD 1RZFL 3EYSL 3VFOB 3OKDA 5IB2B 1IL1A 5IB3B 3QG6A 2Y9RT 3VFTB 1MH5A 4JREC 1KB9J 4JKPH 4MNGA 5DEFB 3MRJA 4N5ED 2D31A 5MI0C 4JQXC 1A4KB 2CRMA 4LLVB 1MQKL 3ZTJG 1GGIL 2J8UE 5CFHA 4PJ5B 4OLWL 1T5WA 5I30H 2NMSA 4Y1AA 5J7CC 3ZYJA 4P4KB 3TPUB 1KENL 2AJYH 5HDBE 1DANT 1VFAA 3Q3GB 2IMNA 4PJGB 3C60B 3WO3B 2NY4B 5D7LE 1I8LA 2XZCL 2VITB 4MNQD 3KWWB 4MA8H 3TIEB 1BWMA 1BP3B 4HQQH 3MRDB 4K23H 1MFCL 1FVCA 3PXJA 1N2RA 4HKXB 4MNHA 4IOFC 2ED8A 5HHQB 1AP2A 3OQ3B 5C0CD 4JFDE 4RWYH 2YXMA 1PLGH 3E8UL 3HUJB 2LTQC 3EO9H 3QZWG 2EDLA 4AMKH 5JXEA 4XCYB 3Q1SL 4M1GL 2GIYA 3S5LG 1E28A 4FTVB 1A7NH 5KVEL 5I1KH 3LRGA 3T0AA 3CDYA 1OAQL 1CICD 4X6CF 4L4VB 3G08B 1NCNA 3BEVA 4YXLL 4MXVE 4U33A 4NN5C 5I6XB 3TN0A 2CDGA 4PB0H 4WTZA 2VWEE 3LH2L 5ICZA 1NGWB 1BZQK 1LEGA 2OJZL 3TZVB 1ZA3A 5DFVC 1DEEA 4PGZA 4HH9A 3L3GA 1QUNA 4CAGA 3EJYD 4GKSB 1CK0H 5IG7B 2P5WA 1L0XA 1FORL 4H88H 4KMTL 1XZ0A 4IMKA 5FV2A 2X89D 5MEQA 2OR9L 2EDJA 3O8XD 1NCAL 3I75A 1SQ2N 4BUGA 2PKDA 3CVHL 2DTML 3CGTA 4OAWB 4OT1L 5C0DA 2ZOKB 2UVFA 3V6ZB 5ALCL 4PPTA 1U8OA 3RZCD 2F5BH 3AM8C 1MCSA 2XWJA 4N8VG 4LSUH 4PGCB 5E2WL 2JF1A 2V5RA 3D1MC 3OKLA 5A16B 2GCYB 5ADPL 2FX9L 1QLEL 4HH8A 2IQAA 4WNQB 2NYYC 3WKML 1YEDB 1U3JA 1S7QB 1T3FA 2JK5A 4KTDL 4FQ2H 4L9DA 5DMIH 4AL8L 2X10A 3FQWA 2IFFL 3D25A 3QEHA 4BYHA 3GZKA 4PD4J 1XIWD 3H42H 1RZ7H 1D9KB 1Z3GL 4LOUC 1S7UB 5CCKH 1X3DA 1RZKH 1YEGL 5DJAB 4QCIB 4X4YB 4HAGA 1BPVA 2ZG1A 3U79A 3B8SA 5I17B 3C5SB 5E8EA 1MCOL 4ZYKB 5TFSH 5IT2L 4B53A 1TENA 5E8DL 3X11A 1FN4B 4P2RA 1V7ML 5C0CE 4AZ8A 2E6PA 1QEWA 2E27L 1IRAY 4JFDB 4Y19D 1J5OH 5D1XA 1BIIA 4G6AC 2DOCA 1QFUH 5JA8B 4P4KC 1BAFL 1ZVYA 2E8ZA 3VXRA 3RPKA 3QUXD 5H8DA 2AI0L 1U8KA 3HI6L 4OZ4B 5F88A 5IROC 2NY4C 3V8OA 5C92A 1IKNA 1U8JA 2HG5A 5C0FA 4J2XA 3LB6D 1H3GA 3BUTA 3P4OB 1U3HA 4FOMA 2X4UB 3TO2B 3QRFM 4M93B 3A67L 4CN6A 1IEHA 2NY3D 4PJFA 3B9DA 4Q6IA 2Y23A 3LIZH 5FO9B 4HMDA 1LHZA 1HHJA 1KFAL 2H32B 2NY6B 2GJZB 3GSUA 3KPLB 4WCYL 4CUCA 1WFTA 1NJ9A 5A3ID 1IT9L 1IVLA 2BXZA 1II4E 4ZOEA 3MGAA 3PABB 1WFNA 3FN0L 1OF2B 2G75B 1QBLL 1QTYT 1R3IH 3CFEB 4C56D 4UTBH 5IESH 4HIEB 1HI6A 3PDGA 5C08E 3PIQB 2DI7A 2NW3B 3KXFD 4D9LL 2V7HB 4LMQE 2WWMC 4XHJD 2ITDA 5DGRA 5AZEH 4M6MH 5CGYD 3LEXA 3RQ3A 1D5IL 2HTLD 2IAMB 2R1WB 5JIKA 1MWAA 4ODWA 3SKMB 4XNXH 5IBUB 3RWIA 1PX4A 3OG6B 1LQSR 4XP1L 4M9OA 1P4LB 3LS4H 3N1FC 2EDRA 1D5ZA 2ADJA 2Q7NA 4LPTA 3HMWL 1PSKL 1XCTB 1A6ZB 1JF1B 5DD5L 1HWHB 1WEJH 4KZEL 1FLRH 1SM3H 2G9HA 5FYJD 5EO1B 2OTUA 4P5MB 5CMAB 1NQBA 3GB7B 4X6CB 3G5VB 1JPSL 1NUFA 4FNLL 1UZ8A 4HKJA 3DYOA 4I2XA 4NT6B 5MENA 1G9NL 2AJZB 3QULB 5A2LH 4CADA 3I50L 2L0DA 5DI8A 2X41A 4L5FL 2HKHH 3RNKA 4OCNC 3MXVH 3VRIA 3AVEA 5I1CH 4MNQB 1IBGL 4GG6A 3UBXA 1BD2A 4JY5L 2GSGB 3SE3C 2H41A 5GJSH 4DUVA 1MOEA 2NXYD 4R4NC 1C1EH 4QHMB 3BWAB 1KJVA 1NGXA 5HGAA 4JM4H 3BZ4B 3CZJA 1WWAX 3QT2A 5C0CB 3VXMD 2ZKHH 3P73B 3LKSA 2BSTB 3GK8H 2QHRL 3PNWA 4QRRD 25C8H 2YMXH 2FJHA 1OAYL 3FHAA 5F7NC 4ODBD 3V6BR 5IFAL 1G7PB 5DUBA 2PNDA 1XF2B 3ZYOA 2I9LB 3U0PB 3U9PL 3LD8B 3BWUC 2OX5A 3MBXL 1FIEA 1C12A 4JRXD 4HPOH 1CICB 1XMWA 5KVMC 4ZNCD 2ZCKH 2LABA 4EI5A 5CWSB 3JV4A 4D2NA 4LHUG 4OGYL 5K9QG 2XFXA 4JZOB 4DCQB 3SCMD 2EEBA 4N8PA 5CD5C 4FQHB 1AXTL 1OB1A 4PJXA 5KN5B 5FCSH 4JFQB 3FT2B 4LMQI 5JPMB 4H5SB 4H8WC 1A47A 1S78C 3QIWD 3ARDA 5B3NA 4NKMB 4NZUH 3BGMB 2E5EA 2A9MH 2FH8A 4ZUTA 2ATPB 1KPUA 3O3BA 4GKNB 3I3BA 1BX2A 4C56E 3WIHL 2E6JA 3L9RB 1YEHL 1A9BA 1EO5A 5D71L 4Y0GA 5GZNC 1BQUA 3O8XB 3HPJB 3AS1A 2Y5TA 5EWIH 1SYSA 2GTWB 5KANI 3RGVD 5B4MC 3LKRB 4H1LG 3X13B 5IMLB 1CU4H 3AY4A 2H8PA 4WWKD 2AK4E 4M93C 3ZSSA 3MJ7A 3RZCB 3GKWH 4HULB 4LKXB 1CDBA 2APWA 3MRBA 2VWEC 1IEAB 4QHUB 4Y4FD 5ERWB 1FVEA 2BOCB 4AY0A 4AIZA 5CEZL 1ZHLA 4EIGB 1FHGA 3BPNB 4NDMA 3IKKA 1GC1C 1KEGL 2EDOA 1S8DA 5GRJL 4ENEC 4E42B 5HYQA 2P7TA 4UV4L 4X7DC 5D72L 1XGTA 5EOCL 3BFOA 5FYJE 5CJOH 5T1LD 1UCBL 1KJMB 1RJCA 1XGQB 1ZEAH 3SQBA 4OD1H 4ZUUB 3G6AA 1TTUA 1XIWB 1A14L 1MAML 4QT5A 1OCWH 4EDWL 1JPGB 5DD3L 1UA6H 1FFQA 2VSDA 5DFTA 3FJTA 3RWHA 5SWSA 4IIQB 2VQ1B 3TVMC 3QWOB 2PO6D 1DQDL 5DRWB 2WIIB 4BFEA 1LE9B 2WANA 3HLAB 3WXVH 4N5EC 1P84K 3VDBA 3IKCA 4JDZA 3VXME 3WFZA 2GUOA 2XG5A 2VB5A 2IWGA 4OCWL 4GRMB 4QRRE 3MR9A 4PJEF 4OUUB 3NFPA 4Y19B 2QBWA 4HJGB 5GISH 1RJYA 4PJ8A 2KPNA 1BFOB 2VDPL 3BIBX 3GBNL 3HRZB 4PJBF 2DS4A 3QUXB 4NM4L 5MEOA 1H5BB 4NQXA 4EDXB 4FQ1H 1RZJC 3DXAD 3FT4B 1F58H 4IMLB 4MWFB 3VI4E 1LNUB 4F15C 5IGXL 3VXUD 1KELH 4JRXE 4OCRH 2OMNA 1ZANH 1FJ1B 1NGQL 3FB8A 4OFVA 1UKTA 4GKOA 4PGBA 2DMBA 4H26B 1R5VA 2J5LC 4ODUB 5DK0B 3KYMA 4OFIA 4JY6A 4LCCA 3VD7A 1ZVSA 2NY3B 2W60A 2DQIL 4KXZI 4JDTH 3B9AA 4MVBD 5B22A 5EZOH 4L4TD 3H9HB 3KLHC 1U8HA 2EEDA 1NCBL 2MPAL 4JRYB 1BMGA 2YSSA 1QA9B 4X7TA 1UH2A 2VABB 4HWBA 4GG8A 1K9TA 2DQCH 2H1PL 5JLZB 3SDAB 1FRGL 5L7XL 4LSDA 1WBYA 2G60L 2ZJSH 1N7ML 1DN0B 4HBCH 5CBEB 1TCRA 5TE6H 3BDYH 1HOCA 1PG7X 3IDMA 4IS6A 3WD5H 4C56B 5CSZA 1CICC 4ZUWA 3U0TB 1XCQA 3FQUB 2VLJD 1W72L 3GIZH 1BZ9B 3KXFB 2Y7QB 1TVBB 5EC2B 4JHAH 2XZQH 3VFSA 4KTEL 5IVXE 3L3DB 2KDGA 2F19L 1L0YA 5DMJB 3X3GH 1GJIA 4KK8C 5T1KA 1HZHL 2E9WA 3ULSA 1EAPB 2IH3A 2HRLA 3EJYC 4YHKH 5HDQH 1X4ZA 1LEKB 5CZKA 5ESVB 1NCCL 1UGNA 3RVUC 4LCYA 3OAUL 2AK1L 1T21B 1CLYH 3O8XC 5F9AC 4UDUA 1FVDA 1ZOXA 5BRZE 4P5KA 2EDNA 4WENB 1DQJA 2VDNL 4KKAC 4DTGL 1I7TB 1C5DB 3DVIA 3GRWA 3O4LE 3RI5K 4WV1B 4OCSL 3UTTD 4ZDHA 5EH1A 3GHEL 1T04A 3R0MA 4HF5H 4FQXA 4MMZC 1G7MA 5LGHH 2VDQH 4YIQB 3BIKB 3AXLA 2NXYB 5JHDD 4IHOB 1TIUA 1T83A 3CVHA 3U9UB 1VKXB 3BUYA 1JBJA 3O45A 2FLBT 3JSSA 3VXMB 4L8CA 2AQ2A 4G80A 4NO0D 4TSCH 1M6OB 1EEQA 2QADD 3NCEB 4QRRB 3RTQC 5DJDA 3DX8A 1YNTB 3VFUB 1XIWC 1PKQA 3CAFA 5C0AD 1MCJA 1C5CL 3R0NA 1K4DA 2EDFA 1CBVL 1NCDL 1TJIH 1P1ZA 1A7OL 2UWEA 5CJXC 2P8LB 2O93L 1XR9B 2I9TA 1JGLH 4X7EC 4IIQC 3GMQB 4JRXB 3GMNB 3MREA 2DWDA 2R69L 4LP4A 5IHUL 2NY2D 1GIGL 1LO4H 4FFWD 2CUIA 2QEJA 4R4BA 1I3GH 4ODHL 5EOQL 4R7NB 3SCMB 5D2NE 3FO9B 4HUWB 4L4TE 1NMBL 2NLJB 2JJSC 3BP4B 2DQHL 3IRPX 2J6EA 3QIWB 3TYGH 5HHPB 2EDDA 4CNIA 5GRVK 2G2RB 2W0FA 3QUXC 1A6VH 1T7ZA 4CVUA 2YD9A 3U82B 3U46B 3V0VB 4JY4A 4LU5L 3LB6C 1NBQA 3LN5A 2VLJE 3RGVB 2FLRT 3ARQA 4X6BB 4FP8L 2DTSA 4OF0A 3KPOB 4WWKB 4GH7B 2HJKA 4NZRH 4RZCA 3M17B 2X1OA 1QSZA 4G6JL 2V2XA 4AH2A 4DN4H 3FCTA 4Y4FB 5JDSA 1RULL 1AGCA 4PJEB 3BRGC 1T1WA 1KUMA 1KEMH 3OAZH 5A3IC 3K7UA 3VG0L 5JXAL 4PJBB 1YNLH 2OJEA 3CSGA 5FGSA 2EIDA 1KSRA 1J10A 1KCKA 1WQVT 4Z7VF 4MD0A 1RJLA 3EO0B 2I60L 1K5NA 5T1LB 2C3VB 3C6LB 3MLPA 1GAFH 1KPRA 1VFOA 2VE6B 4TUOA 3TH3T 2OTPA 3LQAC 4F58L 5J6GA 2AW2A 5T5FH 1RI8A 4ZNEA 5I16A 4XHJC 1OAKL 4ZS7L 3MMEA 1T0MA 1Q0YH 4RBPH 2VMFA 4NUJA 3STZB 5EORL 5BW7C 3VFWA 2PO6B 3S3JA 4NKDA 3RL1A 3C5ZD 4MCZB 2MCG1 1KXVC 1U8QB 5C3LD 4OLZL 3O4OC 1ETZA 2VTFA 1OW0A 3Q5YA 1FDLL 5E1AA 1NBVH 4FQJL 3CC5A 4XC3H 3QDJE 1JV5B 3B9KC 5DD1L 1JUFA 1LDPL 4YDIL 3QB7C 4X5WB 5BMFH 1GH7A 4PIRF 2OCFD 2LU7A 3O3DA 1DSFH 1P7KA 4D8PA 4F7EB 3DXAB 1CLOL 2AXHA 3WS3A 1U41A 3VXUB 3QCUL 4CVZB 3HE6A 4OQTH 3FMGL 1CGSH 4NN6B 4FXGB 4R90L 4OCLC 3QIUA 5GS1C 5AD0B 4LCUA 2NXYC 2PTVA 5BQ7B 4RDQF 2Z0BA 2MQ0A 4Z7VE 1MY7A 1UACH 3U0WH 4JG1L 2X9WA 2R0WH 3IVKA 3KLDA 3NCYS 5J57B 1S9YB 3RBSA 3GSWA 2ERJC 1N6UA 2ZOLA 3IAGC 3SKJH 4OCYL 3MGTB 5F9OL 5IB5B 4G3YL 4MHHI 4P2QA 1A6WL 1I8IB 4HK0B 5F8QC 3QXUA 1XGYH 1T7VA 1KYOK 4M8VA 2DF3A 2VLJB 3RVXD 4XPHH 5ACZA 1AO7A 3RGHA 3MLWH 1MCDA 5EOTA 4ALAL 3FONA 3VFMB 2ZSVB 3V5KB 3OKKA 1LD9B 3QXDB 1BZ7A 4KPHL 1RAMA 4LARH 3FRPG 4ZTOL 2GJ6D 1UJ3A 4U05A 3LRHA 4CN1A 4G8IB 3QO0A 4NO2A 3TA3D 1BJMA 1OTUD 2XI9A 4A2LA 1HILA 5ALBH 3CFIC 1JI2A 4OD2A 3SKNA 1HINH 3CX5K 5D96C 5FUZL 4EUPA 3GM8A 3RGVC 1GOFA 5HHOE 4OFPA 3TBVA 1Q0XH 4LCIL 2A0LD 4LLWA 1OTTD 1O0VA 5D2LF 4WWKC 2P1YA 2H9GA 3BDXA 3WFEH 1K4CA 5E00A 4Z76A 2IADA 4PJHA 1D3CA 5SX4I 1ZLUK 3NZ8B 3UTTB 2BSED 2DL2A 2DDQH 1I1AD 3HZVB 5EO9A 5IB2A 5ESQA 3JTSA 3K3QA 3T0BA 3G5ZB 5D7SL 5LWYL 3DLQR 3WIHA 1T66D 1UYWL 4XPTL 1KXTB 2WUCL 1A4KA 2BFVL 2FD6H 5JHDB 5GRUL 2OZ4A 1YMMA 4C4KO 2EDKA 2C1OA 2CLRB 5E95B 5GRWA 3RKDD 3DVNA 1P7QD 2LU3A 4NO0B 2QADB 1CIUA 4BZ2L 5KVFH 2VR5A 5KJRH 1JYWA 3ESUF 5C0AB 3DNKA 1FYTD 1DUZA 4B50A 2FJFB 2VITA 2VXUH 4M62H 1G7IB 3Q6GL 5E24E 5I8CB 5HHVH 3TIEA 5CIPH 4M48L 1FCCA 2UY6A 1IGMH 5FGCE 2AEPL 1FE8L 2VR9A 3PGCB 2PO6C 5BZWB 2NY2B 4HKXA 1O5DT 4MA3A 3PV7A 1AGDB 3AREA 4K2UL 2F54E 4V2CB 3WIFA 4I13B 4GW5A 1MJJB 1MRFL 4Z7VB 4LLQB 4AK1A 1T0NA 3ZDYE 3DX9A 3O6FB 4U6HB 4HWZB 4FTVA 5F7EH 3WLWD 4EKXA 3KPMB 4IRJA 2EDHA 3LRSB 4C83A 3GI8H 3BVNA 2JJWA 1AY1L 3BGFB 4P3CH 4NGHL 1KN2H 1DE4B 4X0KB 4XCCH 3L7FA 2Y5EA 1FFOA 1I3VA 3X12B 2NZ9C 3O2WL 1NGWA 1CF8L 3TZVA 3FZUC 2NX5D 4I9WD 5E6IC 2XG4A 5AZ2L 3FT3A 5D2NC 3CUPB 4Y4HD 4MVBC 3VH8A 5EU4A 2OS7A 4XRCA 5F1OB 1IAMA 4ODVH 4K07A 3MODL 3VFRA 2DLHA 4OLVL 4PR5B 3D39D 4GW1B 1JWUB 1WF5A 5I1LA 1CDJA 3ARFD 5DQ9B 3NIFF 5E99H 1A6UL 2ZUQB 4PRAA 3TCLA 3S36L 4QXUH 4KVNH 4P9HL 3H9ZA 4NWUL 1D7FA 1U8IB 3L95B 1BEYH 1KTDA 1N3NB 3O6LH 3QRGH 5KSAD 2FATH 5LAXA 5H94B 4OIIL 3TO4A 4J4PA 1ZT1B 5I18L 4P9ML 1I7RA 4ZFFB 1BOGA 4LP5A 1WSST 5JIHA 5DEGA 1XF5B 3VU2A 1G6RH 3QDGA 3MFGB 3UYOD 3IETB 3CK0L 1MCHA 5BJTB 1A1MA 3C5ZB 4F9PA 3PGDA 5A2JH 3H0TA 2NY7H 2V6HA 4P2CG 3T1FB 1JIBA 5E94B 1P4BL 3REVA 1YEFH 2GTZB 5F6IC 5JW3L 4Q9RL 1TQBB 3KDMB 4QRSB 3MC0A 1FV1A 2MNUA 1D9KA 1OAXH 1FYTE 2ADFL 3SKOB 4QCIA 4KDTA 3I6LE 2VKXA 5TQ0H 1EMTH 4L8DA 3NGBC 1I7UB 5I17A 1CDHA 3MBED 4O2CA 4U1LB 2P5EE 3MV8A 1FZOA 4U6YA 3JXAA 5JMRA 3DVGB 3NN8B 5FGCB 2Z92A 5HGHB 3UTSA 2EYSB 5HD8D 2YN3A 4HGMA 3QEUB 5GRYA 3QUKB 3B2VL 4ZD3L 2Q76B 3HC4H 3BKYH 3UPCA 5MEPA 1QSEE 3MRPA 3WFDH 3RWJA 1A8JH 3WFBL 2CMRL 3TT3H 5FOJA 3MRRB 4BQ6A 4D9QE 5D2LB 3WEXB 1S9WA 1NKOA 3QISA 3GSXA 3PQYD 1KCRH 3TYFB 2A9NL 4OF8A 1WWBX 4N0RA 5GRZA 3MOAH 1EFXA 4JG0L 1I9JL 3V6OE 1RY7B 4G8FB 2B2XH 2ADGA 5KSVA 5DWUH 1AKJD 3HI5H 3MPCA 2NY2C 4QTIL 4MJ6B 1J8HD 5ANME 4I9WE 4JFPA 1EERB 1NL0H 3P0YH 1F6AA 4KZDH 3FRUA 3KPLA 1ORSB 3NAAH 2CKNA 3U36B 1MCBA 2GJ6B 4NIKB 3BT2L 4Z77B 3DRQA 2XACC 3IT8D 3TA3B 5C3TA 5JW5B 1I7ZB 4LNRB 5IKCA 3QJFA 3TCXA 4ONHA 3QJHA 3CU7A 1DUYA 4A2MA 2EE2A 1P6FA 3MV9D 5GRXG 4OZIE 1KC5H 4JZJC 2NW3A 4XCEA 4LVOC 4JPVL 3K2UL 1YYML 1KT2B 1UXSB 5HPOA 4U4BA 1S7TB 4Y2DB 3WNKA 3D0VB 5FCUL 5C6TL 2IAMA 3JWOC 2C3GA 5F89B 1AE6H 1I1AB 3I9GH 2P47B 1I1RA 4YO0A 1BOYA 1OVZA 1CDYA 4R3SB 3IDNA 1XH3B 3O2DH 4FFVC 3UBXG 4YZFF 5AAMA 2ZUQC 5CMAA 4LSQH 3VCLA 1E27B 4GQPH 4FN0A 5TE7L 5IR1B 1P7QB 2ADIB 3DV4B 4M8QB 3BP7B 3ELAT 4M7JL 3U6RA 5INDA 3D18A 4X9FA 4XPFL 1G7LA 3ARYA 3UYRH 4XP5H 2R2EA 3GGWA 2EYRB 4M00A 3O11A 4EN3B 3M45A 3HZKB 1G6RB 1CIDA 3WHXA 4PB9L 1QBML 4XNZB 5GS0L 2ARJQ 3NFSL 1WAAF 2CXGA 2QSVA 1CTOA 3DBXB 4TVPD 4APQD 5J9PA 3AU1B 3C5ZC 5HHMD 3R1GL 4RNRB 5JPNB 3D5OF 1ZLVK 1TFHA 5KSUB 3HFML 1EGJH 3QFJB 4KK5D 3W39A 4BKLA 3HKFA 1W0YT 4UIMB 2HN7B 4NP4L 4OLUH 5DRXB 1TQBC 2EZ0D 2Z8WC 3P9MB 2V2WB 4EOWL 4PJDA 4B7LA 2I9LA 4GT7A 5FYLL 1JGEB 4MJ5B 3FOLB 4AIOA 5IJVA 4GS7B 3J7HA 3OKMB 2MMXA 4O5LH 1JZ6A 3LKQB 3TJEH 5IEHA 4JE4B 2W65B 3SEPA 4O51B 4CW1B 1IGFL 3GBMH 1VEPA 4HAFA 3BQUA 2OR8A 1J8HE 1HHGA 3Q5OA 3V8CA 3LZFH 3G6DL 4P23D 2J12B 3R06A 4YZFE 3MRCB 1MREH 2NX5B 2FB4H 2R23B 5KVDH 3C2AH 4Y4HB 2QSQA 4H5SA 5A1AA 3KLAB 1U8MA 1N0XL 1UQSA 4JO1H 3K2MC 2XY2A 3GJFH 4G6ML 3VWKD 4CVXB 1Q38A 3D39B 1NUDA 2ATPA 2VISB 5IJKA 4RWHA 3PXHA 5E9DE 5JIIA 5GGRA 4HJJL 3ARFB 1YEJH 3MV9E 3B4NA 4LIQE 4MCYB 4OM0H 5DC0A 4AT6B 2DL9A 4G8GD 4YFLI 2C4XA 2DIBA 3TBYA 1ZA6A 3RVXC 5C0RL 5KSAB 1EO8L 2NPLX 3EOYG 4HX1B 2X4QB 4AENA 5ERWA 4NJ9L 5DXWA 4KQ4H 4QEGA 1VPOL 1PEZA 4TSAL 5JOFA 4XVSL 3K4DA 1X6LA 4NM8H 3NACH 2CR6A 2Z31A 4PJ7E 3OGCA 3TA3C 2DM3A 2VDML 5DVMA 2MFNA 2OL3A 2ZPKL 4N1EA 1NDMB 1DZBA 4HLJA 1KJMA 4ZPVB 3WXWL 4O58L 1EXUA 1AHWB 4ORGA 2DKMA 5LCVH 2A0LC 1OTTC 4NQCD 2NR6D 1JPGA 1HSBA 2Z35B 1UB5A 1U8PA 2HT2D 4HUUB 4XXCA 3RWDB 1UEMA 2I24N 1I1AC 3O3AA 2B7DT 4N0UE 4MSWB 3FO1A 4TVPE 5HHME 4NKIL 3S3PA 3MLRL 1DFBH 3MLYL 1T66C 3P2TA 5D5ME 2O61B 3F5WA 4RQQA 3UTPE 5EU6A 2YD2A 3MUY1 1QBBA 1VHPA 1UM4L 3E3QE 3L3KB 3MA7B 1DP0A 4MXWL 1MNUH 1MUJB 3MLUL 1ZSDA 3RKDC 3SE9L 3RY5A 3CXHK 1BFOA 5EZIH 3GUTB 4YUEL 1KGCD 4IDJH 3QXVA 4CJ0A 1M71A 4EXKA 4EDXA 3BH9A 1NAMH 1RURL 3KJ4B 4YX2L 3PQYB 2K3TA 4RIRB 5I66B 1FFNB 3UP1A 4KHXH 1FJ1A 1M7IB 4NJAH 4WEMB 4KRPB 1JN6B 4UILH 4XNZC 4BM7A 4Q6YA 3N1MC 3TM6A 3LN9A 3VGAB 5HGBB 4HG4J 4ODUA 1AKJB 3PF2A 5EIIA 5K59E 1E6OH 1CFVH 2WK2A 5BXFB 1JHTB 1J8HB 2A77L 2CRYA 4I0PD 1JTOA 2UY7A 2FYYA 2L7UA 4JRYA 4WHYH 4C58B 5TGBB 5C09A 5LG1A 3TPKA 2VABA 4AEHL 3SDAA 3IXTA 2G5RA 5BS0D 1DN0A 3NZHL 3QO1B 3QPXH 2DM4A 4GS7C 4MD5B 4TYUA 4IJ3B 3EHBD 2B1AL 3ULVE 3MV9B 2B4CL 4M5ZL 4JFED 1BBJA 1BZ9A 3V6OC 4OSUL 4YAQB 5KVGH 3GMMA 3WUWA 4DKEL 5MERA 2FGWH 4N8CH 1QSFE 1HXMA 3ZKMD 1CE1L 3EJZD 3N06B 5CJ8A 3S98A 1A1NB 4WIQA 1B6UA 1WBZB 4Y4HC 1IGTA 1ZE3C 1F3RB 4U6VH 5I1JL 1JTPA 4U1KA 5L2KA 4DZ8A 4I77H 1VFMA 2HLAA 1BBDL 4TOYH 2KZ1B 2M1KA 3CCHB 3THMH 2J8OA 1G9MH 5CHNB 2X4RB 1CTNA 4NQSB 5HI3D 3SDXF 2R1XA 1T21A 4ZFGH 1SMOA 1GGCL 3RUGF 2APFA 4DGVL 4GKZA 3JBG7 1LEIA 1I7TA 4NQCE 4POUB 1OP9A 1G0XA 5KSAC 3GDBA 4NBZB 1JNJA 4KQ3H 3T0ED 4ONFL 3KPSA 1X5LA 1XGPB 3DGCR 1PJ9A 1X5HA 4JFOA 1JHLH 3UJIL 1RIUL 5EZLA 4N0UB 3SQOH 4APQB 5HHMB 3U9UA 1CXHA 3O6KH 1F90H 3WE6B 2BNRB 2PTTA 2EDBA 3DHMA 5C70A 2CLVB 1DQLH 2GFBB 3IU4L 4K3JH 4XNQA 1PD6A 4OD3L 1L9MA 1KGCE 5I8EB 3VGEA 4F3FB 4KXZH 5C0GB 3I2CH 2A38A 4PS4L 5DMGD 3CPLB 4HW6A 3GMQA 3FFDB 1TVHB 3MBEC 3MCKB 1JYVA 1J12A 1KG0B 1CXEA 2C5DC 2GEEA 3TBSB 2EXYD 4A6YL 4LSRH 4U1JA 3NFNB 3GMOA 2XKUA 4P3DA 2EKSA 5HD8C 1H15A 4R7NA 4U1HB 1NGZA 3MACH 3VXSA 2EDEA 4P23B 3SDXE 4JDVB 1JGDA 1AIFB 3RWEA 3BP4A 1CR9L 5CSBA 1WT5A 1MPAL 1NGPH 3OPZL 3EFDL 3FO2A 5HHPA 2NZIA 5IOPB 4LRIC 3VWKB 3KLSA 1AD0A 1NAMB 2BVQB 4I18B 3VWJA 7FABL 2UUDH 5BS0E 1BQHG 5E2UL 1T4KB 2VLRA 3ARBA 4KMQA 2DLIA 1FH5L 4DAGL 4R26H 5CILH 3RWGB 4G8GB 1FLTX 1XF1A 4K3DL 2PCPB 4CBPA 3VXTA 2AV1A 3VGAC 1WISA 1PEWA 3KPOA 3QSKB 1OD7A 3SGEI 4WGVB 3HMXH 4QF1B 4M61A 5I19L 1BJ1J 3DRTA 3MGOB 4EQ2A 5BZDB 1AGEA 5IV2B 4UMGA 3W2DH 1A5FH 5GSVB 5DMKB 2H6PA 3LS5L 4L8BB 4XNMA 5EBLA 4OZFH 1D5BA 1HH9B 1QFWL 3OHXA 2EC8A 2Z93B 1CFTB 4Z7WA 3D6GA 1INDH 5JHLL 4PP2B 3VDAA 4KMLB 1R0AL 2D0FA 2ICWA 4J23A 3DX6B 4JHWL 1IQDB 1T5XA 5TDPB 3C6LA 4IJ3C 1XGRB 2HWZL 5EN2B 4FQIH 5FKAA 4NNYB 3NOIA 2XICA 3MNVA 5T3XD 1FQ9C 4ZFOL 1YN7B 2H26A 3BW9B 1G7QA 4UQ3B 1RHHB 4NQCB 2ESVA 4TULH 4LFHD 1QVOA 4PREA 3T0EE 3PWJA 5F3BB 1IZJA 3FQTB 1P2CB 2IC2A 3ZDZF 1G7HB 2BVEA 1FFPB 5D7JC 4IRSD 3EGSA 1ZXQA 3IS0X 2IBZX 3I3DA 3IFNH 4POZD 4OIAA 4F57H 2XPGA 1QD0A 3W9DA 4NO3A 1AI1L 1JNLH 5B21A 1JVKA 2OI9C 1MJ8L 4GAJH 4P3WA 1CLZL 4W68A 5IB4B 2A6DB 1UZ6F 3MRQB 3T04D 2CSPA 3VXUA 2R29L 3WS6C 3IXAB 4YE4H 3OWEA 2JELL 1OGAB 2AXFA 4KV5F 4OM1H 2AQ1A 2FWOB 4LLUB 3OKNB 1QO3A 2APBA 2V9QA 4X9IA 5IFJB 3E6FA 5DVNA 3PJSB 4APQC 5I76A 3ECBA 4PBVC 5CJ5A 5JOPD 3IDIA 4KWUA 1S9YA 4I0PB 4JHZA 1YY8A 3SDXB 1GRWA 4KK5C 5BO1L 5ITBL 5F1IA 3RUGB 4QHLB 3QUZC 1OAUH 4LKCA 1CLCA 5JQ6H 2EDYA 3PWLB 1EHLL 4XBGA 4J3WA 4OB5L 5ICXB 4HK0A 3SE4C 4GXUN 1G0YR 1KULA 5I2IB 3D3VD 2R4SL 3GI9H 3Q0HA 2PETA 1T22A 2WBJA 2SEBA 3MJ9H 2QLVB 4JFEB 5DJ0A 4L29A 2A73B 1QFPA 3S36X 1LO5A 2UZXB 1Q1JH 3B5TA 3BGAA 3HG1A 5T3XH 2Y1VA 4OZHA 2GQHA 3QXWA 1J0ZA 1L7IH 4P23C 2Z4QB 3QDMA 4Y5XA 4K7PL 1FL3A 4X6DA 1NCUA 3SDYH 3IFOB 5GGUB 5J13B 4MQTB 1EUTA 1Q9WB 4I18C 4XPGH 2W9EH 2A6JA 4ISVA 4H8WL 1I8KB 3W11D 2VERN 3FHQA 3MA9H 2VDOL 4UV7L 3KYNB 3ULVC 1X5AA 4S2SB 2H3NB 2DM7A 1ZLSL 5ICYA 4NKQB 3E6HB 5HI5D 5JOEA 4GAFB 5EUKB 4YXHH 2W0KA 4HXAL 1Q9KB 3ZKQD 4JEGB 4CJ1A 1GHFL 5IMMA 4Z7QE 3HZVA 1YQVH 1DDHA 1H8NA 4Q74A 4OI8A 4Y1AD 4OZFB 2IPKA 2PYFB 4ZOBA 2OXHA 3KPNB 2HFGH 3CZFA 4M43L 1DBKH 4QXTA 3MNWA 5T1DL 2X1XR 2E7MA 4Q0XH 1NEUA 4WHTA 1F45A 5IWLA 1GC1L 2L7JA 2Q8AL 2WLZA 2Z8VC 2QV2A 4F7TB 5IMKA 4JO2L 4YDJB 5GGQH 3CSPA 2AXGB 2WV3A 4PV8A 4XP4H 3FFCE 4G9FA 3ZDXF 5E2TH 1FZMB 1OSPH 4M6AA 4X98B 1P4IL 2NR6C 3EDEA 2BXYA 1G7IA 4U31A 1JP5A 3VA2C 4PRHA 4JN2A 4PB0L 3JV6B 2HT2C 4LLMA 3U7WL 5JXED 2Z91B 5DYOB 5EU5B 3LMJH 1MFAH 1RVFL 1BFSA 3OR6B 1AGDA 3MUHL 5D6CA 1MHCA 1NLBH 5F9JB 1CGTA 1G9MC 3I6GB 5JNYA 1NLDL 2VZ3A 1CK0L 1OGTB 3NMEA 4H88L 4E41A 1GOHA 4QOKA 4MB3A 5KS9A 2EYTB 4F33B 3O6FA 4HWZA 2P8MA 4HWEH 4NQTA 5CS7A 2YHGA 1RIHH 3BSZH 2JB6B 1UWGL 5FDWA 4MAYA 4X9GA 3TN0D 2LVCA 3VFGH 2A83A 4L8SA 4OTXH 3TLRA 2YZ1A 1ZGLM 4G5ZH 3D3VE 2F5BL 2DWEB 1P5UA 2XQBH 4U1IB 5DJ2A 5IF0A 5TDNB 4PRIA 1RZJL 2WINA 4L1DA 2O5XL 2DQFA 3L5HA 3WDHA 4GO6B 2P5WD 2I5YL 4JQXA 1R5WB 2YPVH 4HFUH 3EO1A 4HIXH 2ZUXA 1N8ZA 4I0PC 3HTLX 1HKLL 4DKFL 1MI5B 3L6FA 2DLFH 3OR7B 2PW1A 4O4YL 5L2JA 2NY0D 2FSEB 1HCFX 3EYQD 4JAMA 4JR9L 4NRYA 4PR5A 3VXNB 4HBQA 1SEBA 5F7FA 2I25N 1AFVH 3S4SA 2J2ZA 1T03L 4KJPD 4XP6L 4JLRA 1UKSA 6FABL 3EHBC 5CLWA 2YUVA 1MAJA 2I26N 4P2OA 3CFCH 4MNGE 5IIEA 5K9JL 5A43C 4GBXC 4AM0B 3BPLC 1OP3H 5E8OA 3EYFA 1JPTH 1KB5B 4K94H 1ZT1A 1GZQA 4HGWB 1BF8A 4HZLB 3RWFB 3ZKMC 3MYJA 3HAEB 1X7QA 1HYRC 2XOTA 4Y1AE 2O26U 3WNNA 4LSTH 4AEFA 3ES6B 4JFZH 5J13C 1NEZA 1KIQA 4IRSB 4UT6H 1BLNA 2ORBL 4MA7H 2XRAH 4WGWB 4JQVA 5AUMB 1DL7H 5TPWH 4YHPA 4Z7UA 4L3EA 1WK0A 4PLJD 5FAAA 1LK2B 3KPQB 4KJWD 3EYUH 2DIJA 4I8DA 4P2RD 3TC9A 5K93A 4L3CB 4HXBH 2VXQH 3FB6B 4W6WB 1ITBB 4U1LA 4JKMA 3C9NB 3P30H 5JDJA 3T0EC 1NBYB 3MOBH 4MZ2A 1B6DA 4XMPH 5D1XD 3L5XH 3WN5B 1JZ2A 2QQNL 1N5AA 5HGHA 4KKCC 1JZ4A 4NRXA 3WLBB 4Q9QH 3WNPA 3DX7B 1HE7A 4IM8A 4QRUB 1FPTL 4HFWA 5FEBA 5IVZB 1U3HD 1S7WB 4TPRL 1CS6A 2P46B 2WUBL 4UZGA 5HHXH 3CSYA 1IM3A 5IESL 3MRRA 1DLHA 3OBAA 3B83A 2I07A 1JPFA 5CIPA 5CUSL 1DBJH 4TTGA 1LK3L 4UTAL 3KYKH 2Q3ZA 5DMGC 3D3VB 3T4AB 1IFHL 3SGJC 1GGBL 3OKEA 4LSPH 4WU5A 1S5HB 4XXDB 5J4MA 1P5VA 2EXYC 2P5WE 4N68A 1RUPH 1CE6A 5AAWA 1B0GB 4BZ1L 3DTXA 3T3PF 3UCRA 3RVTC 1Q9OA 3HNVH 5FHBH 2AGJH 1SYVA 2M8XA 4LLDB 4NKOA 5CEXB 5CZXC 2AJSL 3QG7H 4O2FB 1BWWA 4Z95H 1YEKL 5D7IA 1I9IL 1UC6A 5LQBL 1RFDH 3QXAA 4NHCH 4ZQKA 5IBUG 4YBHA 1N6VA 3V52H 3F6LA 4UB0L 1QYGH 3H9SE 4A6YA 2LE9A 3C8KB 3WIIL 3C8HA 3OKDB 3MXVL 5C0IA 1IL1B 3PGFH 2KQMA 3J8F7 4XI5D 3QG6B 4ZXBC 1UXSA 3PWNB 4Y2DA 2EDXA 3D0VA 3MRJB 1JWMA 2D31B 1KIRA 3MJ6A 4PUBL 2KL6A 1KLFA 1DBAH 1FSKC 2XZAH 3C5JA 5L9DH 3IJHA 3RHWF 4R8WH 1T5WB 1UM5H 4Y1AB 2VLME 2X1QA 4R4FL 3NCBB 5IFHH 2VXSH 2ZKHL 1ONQB 2MCPH 4MJIA 5MEND 2DJ4A 1W8NA 3SO3B 4Z7NE 2ZUSA 1XF4A 4PJ9C 4RGNE 4LRNL 5DD6A 1VFAB 1DQMH 1HQ4A 5IEKA 4JFFE 5E8NA 5ACMA 4CL7A 2UVEA 1E4WL 4Y89A 1UWEH 4KVCL 3P9WB 4OZGA 1BD2D 4OV6F 1NC4B 4YDKL 1FVCB 4P2RE 4Z78A 1N2RB 1H9VA 1IMHC 5L6YL 4MNHB 3FQRB 2ZCKL 3LQAL 2E7HA 2EYRA 4EN3A 1QFHA 43C9A 2ZUYA 2CK0L 1CQYA 5EU3A 4P57A 1Z9SA 3LEYH 3MV7A 2QKIA 3VXRE 3DBXA 3C8DA 4JN1H 3KPRE 5JPNA 1E28B 4FQLL 3ZHLA 5B39A 5BVPH 1MHHA 4IRSC 1MHEA 12E8L 3RU8H 3O9WD 1J0IA 2VLKA 4POZC 3QFJA 1ZHKA 1CFQA 5I71C 5J0BA 2YKLH 4ZFOA 1VGKA 2RR3A 3L5WA 5I75B 3OTTA 1KLUA 3RWCA 4EI5D 3BEVB 3BZDA 3H3PH 4YHYB 5FYJL 3TN0B 4PJFE 2CDGB 5AWNH 1QKZL 1LEGB 1W0WB 1JNNL 1IAII 3RFZC 1DEEB 3T1WA 4HH9B 2W65A 2JCCE 3QWQB 4GG6F 4CW1A 3L3OB 32C2A 1I3UA 2VAAA 4JKKA 2V7NA 1A3LH 1RU9L 2P5WB 1BHGA 1XZ0B 2MWCA 4GXVL 4DGYL 5T3ZD 2NX5A 5MEQB 1KBGL 3I75B 3TESA 3KLAA 3RP1A 1A0QL 3SKUD 4CVXA 4IOIB 2VISA 1U8OB 3MROA 5L88H 5J12B 2XWJB 3HI1A 4M5YL 4UAOB 4MCYA 1S7VB 3OKLB 2Y36L 3NA9L 5HJ3A 3JTTA 3LV3A 2IQAB 3SE3A 3A0OA 5F72S 4ZO6A 3D87B 1J1PH 2GHWB 1T3FB 2X4QA 5DFWH 4PJXF 2R0LH 3SGKC 4DW2L 2J8UA 3FQWB 3D25B 4I3SH 3QEHB 2GAZA 5MENE 4RISL 3QFDA 1CXFA 1TCMA 3KR3H 3D0LA 2QSCH 3WO4C 1MF2L 1FNSL 1WFOA 1KACB 2A2QT 4OCXH 1YN6A 4PTTA 5SWSD